4H2QA

Structure of mhpco-5hn complex
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-Methyl-3-hydroxypyridiine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
total genus 133
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2qA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2qA01
1XHCA 1OJCA 1ZMCA 1PS9A 3AECA 3CNJA 1EL5A 5KRQA 4U8JA 1E1LA 3KU9A 3RNMA 2C3DA 3SFDA 2Q0KA 3DK9A 4OPCA 4BJYA 3UOYA 2VVLA 1PBFA 1VG0A 3AEDA 3UKPA 5BVAA 5IPYA 5JCIA 3CPJG 4IA6A 3DGHA 5FS7A 3UTFA 3S61A 3AEFA 3QSEA 1TDFA 5FS9A 3GD4A 3CGCA 1XDIA 1Y56A 1YQ4A 4OPLA 2J3NA 4U8NA 1NHRA 1M64A 2C75A 1D4DA 3L1RA 4K5RA 5LV9A 4H4RA 4A65A 2WPFA 1GRFA 4IVMB 5KVHA 4J31A 4B1BA 1B37A 2BC0A 2BYBA 2WOVA 3BNUA 2RGOA 3NYCA 2I0ZA 4CBQA 1UKVG 1COYA 2EQ6A 1D7LA 4REKA 1H7WA 1LPFA 3CTYA 2JB1A 2Y6QA 2BXSA 1H81A 4NZHA 1QO8A 2C70A 3DA1A 3P4SA 1ZMDA 1ZOVA 5L46A 3AE3A 3UOVA 4K5SA 5M10A 1BKWA 2GH5A 2R46A 3QVPA 4U2SA 1CJ3A 1FCDA 3NRNA 5JCKA 2R0PA 4NEVA 3GYJA 5BUKA 5EBKA 3AD9B 1S3BA 3GDNA 4YTPA 1IUTA 1D7YA 3BI5A 5HY5A 3F8DA 4BK1A 2C73A 1BF3A 3SFEA 2XVEA 3D1CA 2XVIA 3DK4A 1H84A 1PJ7A 3IC9A 4GDPA 4NTCA 2WDRA 1OJ9A 4A5LA 3M12A 4H2RA 3GWDA 1IUXA 4B67A 3DJDA 1W4XA 3O0HA 2WBAA 4OPUA 1LQUA 4NEWA 3B6DA 1JEHA 3CPHG 2A89A 4Y4NA 2X8GA 3ICTA 2XLSA 4TM0A 4ZCCA 4H2PA 2NPXA 3AD7B 2ACZA 3AEAA 1TRBA 4DSHA 3C4AA 4EM4A 4OPGA 3VR8A 4H4SA 2X3NA 3FMWA 1NEKA 1OJAA 4JQ9A 4K7ZA 2YG6A 3D8XA 4ADWA 1BZLA 2B76A 1D5TA 1DXLA 2OLOA 1PBBA 3EF6A 2JKCA 3AB1A 3P4QA 2BC1A 2B9WA 5ER0A 2R0CA 2E1MA 1ZDLA 1RYIA 4Z25A 4TM1A 3GYIA 3KKJA 4GF7A 1YY5A 3AE7A 1JRYA 2GAHB 1PBDA 3NYEA 4FK1A 3UKQA 1B5QA 3IHMA 4ZN0A 2ZZBA 1N4VA 3IWAA 5EOWA 5FMHA 3NTDA 4H4ZA 3ALMA 1ZP0A 2FBWA 3HZLA 3VRDB 2H88A 2YLWA 3NK0X 1TDOA 2GMHA 4H4PA 3ZYXA 2XDOA 3BNMA 4D04A 3GRTA 3GSIA 3NIXA 1F8SA 3LOVA 1IUVA 4O5UA 4EMWA 2BK3A 3AEBA 2XVJA 2A8XA 2GR1A 3ALLA 2V3BA 3NN6X 5JCMA 3NNEA 4EIQA 1GRAA 2QA2A 3AEGA 1GV4A 5C3JA 4TM3A 5J7XA 2AAQA 1GSNA 4C5OA 1K0LA 1DOCA 2GQWA 4UDQA 2BS4A 4H2NA 3NGCX 4I59A 4B68A 1KNPA 3ABVA 3DJEA 1VG9A 3EPTA 2EQ9A 2GR0A 3SM8A 3F8RA 2WQYA 2FJBA 2WOWA 3DMEA 2ARDA 2Z5YA 1ELIA 2YM2A 2OA1A 2VOUA 3COXA 2R4JA 1IJHA 1JOAA 1IUUA 3CGEA 3DGZA 4UP3A 4A99A 1H86A 4H4WA 3DH9A 2YG4A 2XFUA 1V59A 3UOXA 3BI2A 5FS8A 1M6IA 1X31B 4Z43A 1O5WA 2NVKX 1Q9IA 3JSKA 4U8IA 3UP4A 3VRBA 4JY2A 2V6OA 1ZX9A 4DNAA 2GVCA 3CNTA 1CC6A 2Y6RA 1L9DA 4RG3A 3V3OA 4RG4A 1BGJA 1DOBA 2XCGA 4K8DA 2VVMA 1YKJA 2JB3A 4FX9A 3NT6A 1MOKA 1O95A 4YXDA 4NTEA 4JY3A 1CHUA 4JDRA 4U8KA 1CL0A 4C74A 2CFYA 4U8OA 5IQ4A 5HXIA 2BCGG 2C3CA 2FJDA 2YVJA 1PHHA 4A6NB 2XVFA 4TLXA 4B69A 4A9WA 1D4EA 4FK1C 3Q9TA 5BRTA 2YVFA 2OALA 1NPXA 4X4JA 2VZ2A 3LB8A 1LQTA 4Z2UA 4GRTA 2WOIA 1TYPA 1N4WA 2JBVA 3C96A 2W0HA 3AYIA 3CGBA 3NHOX 2O9ZA 1OJDA 4H50A 4H4QA 1CJCA 4AT2A 2YLTA 3CNPA 5J60A 1D4CA 3C4NA 4HA6A 2C76A 1O94A 2X50A 4Y4LA 2IVEA 3PO7A 2XLRA 1NG4A 1ZKQA 2WP5A 2GQFA 4EIPA 1F8WA 4YSZA 2OAMA 4EMJA 4EQXA 3RP8A 1Q1WA 3NKSA 1LVLA 4MJWA 2WDVA 3LZXA 4PABA 3P4RA 2VRMA 4CRTA 2Q7VA 2RABA 4M52A 2QAEA 2X8HA 4XWRA 2GR3A 2GR2A 1BWCA 2BCPA 3CNDA 2YLRA 3G5RA 3DK8A 2XFQA 4DSGA 1P2HA 2OLNA 1HYUA 4X9NA 2Z5XA 2YG5A 2YM1A 3AYLA 1F8RA 4C3YA 2XVHA 5U25A 1YQZA 2EQ7A 1IUSA 3UTHA 4EQRA 3P1WA 3NH3X 1H7XA 1OJTA 2B9YA 2F5ZA 2RGJA 1GRBA 3BI4A 1NG3A 4PAAA 1Q1RA 2CULA 2BABA 4D03A 3KVEA 2V3AA 1NDAA 3H4KA 1VQWA 1JNRA 2VQBA 3G5SA 3AYJA 3ICSA 3NTAA 1GRHA 1GPEA 1XPQA 4P9SA 3KD9A 3CPIG 3DJGX 1GERA 2GEWA 2GAGB 4CY8A 3AWIA 5C2TA 1H83A 3Q6JA 4JNAA 1CF3A 4EQWA 4B66A 4I58A 1PBEA 2WETA 1FOHA 4BURA 5M0ZA 3ATRA 2XLPA 1PXAA 4A79A 2IIDA 1Z6LA 2V61A 2JK6A 3LXDA 1PXCA 4H4VA 5U1OA 4B64A 4EQSA 1KF6A 4J36A 3SQPA 3GDPA 4U2TA 3AE9A 4JNQA 3NN0X 1Y0PA 4H4TA 1E6EA 3WE0A 2XLUA 4EMIA 2H89A 4GR1A 3QVRA 1PBCA 3UOZA 3VQRA 3UKKA 3ZDNA 2YAUA 2IVDA 3IHGA 2GV8A 2RGHA 3ADAB 3CGDA 1E1MA 4Z26A 3K30A 4OVIA 4OPIA 1PJ6A 1EL9A 5GRTA 4TM4A 3ISHA 4O5QA 1NENA 4YSYA 3UKLA 4FDCB 4KX6A 2WU5A 1CJ2A 4UDPA 2EQ8A 4CNKA 5HYMA 2WP9A 4EM3A 2E4GA 1DOEA 1TDKA 4Z2TA 1QJDA 3QJ4A 1PXBA 3ALJA 4IVOB 2HQMA 3NG7X 4J33A 1KFYA 5EB4A 4A6NA 3AE1A 1LV0A 2FJAA 3NLCA 1F6MA 5KOXA 2R9ZA 3AE2A 1KSSA 3ICRA 2C72A 4HB9A 2ZZ0A 2YLZA 4K2XA 2BACA 4X9MA 1TDNA 1GALA 3AE5A 3RP7A 1VDCA 3URHA 2GRTA 4K22A 2C67A 4U8PA 1S3EA 1E7PA 3AE4A 4BV6A 2YLSA 2YWLA 4BJZA 4C77A 1AOGA 2GMJA 2GF3A 3S5WA 2TMDA 2QA1A 2V60A 2WS3A 1E39A 1FEAA 2WPCA 1MXTA 1JRXA 4ICYA 4OPDA 2X8CA 5KWFA 3CIRA 3LZWA 4CCQA 4B63A 1DJNA 4USQA 1ONFA 4XWZA 1GXFA 2YG3A 3ATQA 4GCMA 4OPTA 3RP6A 2WP6A 1GEUA 1NAAA 3AD8B 3CNSA 3EANA 4U8LA 4Y4MA 3UKAA 4LA1A 1NHQA 2BK4A 1ZOYA 5KXJA 3K7MX 3GWFA 4AT0A 3GMCA 2YR5A 1JRZA 2AQJA 1KSUA 2E5VA 5GSNA 4YTNA 2GB0A 1PDHA 5KVIA 1H82A 1VRQB 2YLXA 4JN9A 3P9UA 3R9UA 3CN8A 3FPZA 4AP3A 1ZK7A 4CNJA 1JNZA 3UKHA 2BS3A 2TPRA 4AP1A 3L8KA 1N1PA 3FG2P 4CCRA 5HHFA 1GRTA 2WHDA 1L9CA 4ZCDA 1REOA 2PHHA 1DNCA 1GT8A 1N4UA 1TYTA 5U63A 3BHKA 3DJJA 2WPEA 4B65A 1QLBA 1NHPA 4XXGA 3KPFA 4YKFA 1NHSA 4WX1A 4H2QA 3QFBA 4J56A 3UTEA 3VRAA 4WCTA 1IUWA 1Y56B 3ITJA 4J34A 2Q6UA 3T37A 1YQ3A 2VRLA 5IQ1A 4Z44A 3UCLA 2YVGA 1EBDA 5CKUA 3AE6A 2YQUA 4DGKA 1L0VA 1GRGA 2JAEA 1B8SA 1KNRA 2R4EA 4U2LA 3I3LA 1EL8A 3BHFA 2X99A 1K0JA 1CBOA 1GNDA 1TDEA 4H4YA 3V76A 1ZY8A 2WESA 3H8IA 2XYOA 4YKGA 4USRA 1RSGA 2AR8A 3NYFA 2YR4A 2CDUA 2DKIA 2APGA 4RSLA 1CJ4A 4AOXA 1SEZA 1S2YA 1EL7A 2BK5A 3EAOA 4LU6A 3KA7A 4Z24A 3VR9A 2C7GA 3SGLA 4GDEA 3II4A 3REDA 5EB5A 1GESA 1K0IA 3QSSA 2C65A 1LTXR 3GD3A 1CC2A 3QFAA 5TR3A 3LADA 1FEBA 1DODA 2JB2A 4A7AA 2PYXA 2XLTA 3GRSA 4YT0A 4AOSA 3RHAA 1BGNA 3AE8A 4U8MA 1F3PA 1PN0A 2WDQA 2ZZCA 3H8LA 5KOWA 4NTDA 1KDGA 1GREA 4H7UA 3UP5A 2XFNA 1RP0A 1XANA 3I6DA 3B3RA 2BA9A 2XFPA 2V5ZA 4APNA 4KPRA 3K7TA 4IA5A 5JCLA 2A87A 3E1TA 2C64A 3IF9A 3K7QX 3UKFA 2VQ7A 5JCNA 4YSXA 2DKHA 4IV9A 4E0VA 1FL2A 1B4VA 2ZBWA 4LIIA 1PJ5A 3GMBA 1DJQA 2QCUA 2WEUA 4CY6A 4C3XA 3KLJA 1LJ1A 3FBSA 1E1KA 2B9XA 3M0OA 2C66A 4H4UA 2VVLG 4J57A 1GTEA 2B7SA 4Z2RA 1H6VA 1K4QA 2FJEA 2YR6A 1GTHA 4GUVA 1S2QA 2R45A 4BK3A 2YG7A 4OCGA 4ECHA 3PVCA 4BK2A 3P4PA 3PS9A 2CVJA 2B7RA 3AEEA 3QSMA 4YWOA 3F8PA 2WU2A 4YSHA 1E1NA 1GOSA 4TLZA 1JU2A 4H4XA 2XFOA 5CQFA 1L9EA 2R0GA 1CC4A 3FIMB 5DBJA 3AXBA 3UTGA 2Q0LA 3M13A 2UZZA 3G5QA 4N9XA 4UDRA 3V3NA 4J2WA 1MO9A 5BULA 3NK2X 1P2EA 4YTMA 3LJPA 1FECA 3OC4A 2BS2A 3NK1X 3OZ2A 5FS6A 1GETA 2BXRA
chains in the Genus database with same CATH superfamily
1XHCA 3T0KA 1OJCA 1ZMCA 1PS9A 1C0PA 3AECA 3CNJA 1EL5A 5KRQA 4U8JA 1E1LA 3KU9A 3RNMA 2C3DA 3SFDA 2Q0KA 4BJYA 3DK9A 4YJHB 4OPCA 2VVLA 1PBFA 1VG0A 3AEDA 3UKPA 3UOYA 5BVAA 5IPYA 3CPJG 4IA6A 3DGHA 5FS7A 3UTFA 3S61A 3AEFA 3QSEA 1TDFA 5FS9A 3GD4A 3CGCA 1XDIA 1Y56A 1YQ4A 4OPLA 2J3NA 4U8NA 1NHRA 1M64A 2C75A 1D4DA 3L1RA 4K5RA 5LV9A 4H4RA 4A65A 2WPFA 1GRFA 4IVMB 5KVHA 4J31A 4B1BA 1B37A 2BC0A 2BYBA 2WOVA 3BNUA 2RGOA 3NYCA 2I0ZA 4CBQA 1UKVG 1COYA 2EQ6A 1D7LA 4REKA 1H7WA 1LPFA 3CTYA 2JB1A 2Y6QA 2BXSA 1H81A 4NZHA 1QO8A 2C70A 3DA1A 3P4SA 1ZMDA 1ZOVA 5L46A 3AE3A 3UOVA 3SY4A 4K5SA 5M10A 1BKWA 4YJFA 2R46A 2GH5A 3QVPA 4U2SA 1CJ3A 1FCDA 3NRNA 5JCKA 2R0PA 4NEVA 3GYJA 5BUKA 5EBKA 3AD9B 1S3BA 5KMRA 4GAPA 3GDNA 4YTPA 1IUTA 1C0LA 1D7YA 3BI5A 5HY5A 3F8DA 4BK1A 2C73A 4G73A 1BF3A 3SFEA 2XVEA 3D1CA 2XVIA 3DK4A 3CMMA 1KIFA 1H84A 1PJ7A 3IC9A 4GDPA 4NTCA 2WDRA 1OJ9A 3SZFA 3M12A 4A5LA 4H2RA 3GWDA 1IUXA 4B67A 3DJDA 3SZCA 1W4XA 3O0HA 2WBAA 4OPUA 1LQUA 4NEWA 3B6DA 1JEHA 3CPHG 2A89A 4Y4NA 2X8GA 3ICTA 2XLSA 4TM0A 4ZCCA 4H2PA 2NPXA 4YJGA 3AD7B 2ACZA 3AEAA 1TRBA 4DSHA 3G3EA 3C4AA 4EM4A 4OPGA 3VR8A 4H4SA 1DAOA 2X3NA 3FMWA 1NEKA 1OJAA 2E4AA 4JQ9A 3CUKA 4K7ZA 2YG6A 3D8XA 4ADWA 4QFDA 1BZLA 2B76A 1D5TA 1DXLA 2OLOA 3W4KA 1PBBA 3EF6A 2JKCA 3AB1A 3P4QA 2BC1A 2B9WA 5ER0A 2R0CA 2E1MA 1ZDLA 1RYIA 3GYXA 4Z25A 4TM1A 3GYIA 3KKJA 4GF7A 1YY5A 3AE7A 1JRYA 2GAHB 1PBDA 3NYEA 4FK1A 3UKQA 3IHMA 1B5QA 4ZN0A 2ZZBA 1N4VA 3IWAA 5EOWA 5FMHA 3NTDA 4H4ZA 3ALMA 3HZLA 1ZP0A 2FBWA 3VRDB 2H88A 2YLWA 3NK0X 1TDOA 2GMHA 4H4PA 3ZYXA 2XDOA 3BNMA 4D04A 3GRTA 3GSIA 3NIXA 1F8SA 3LOVA 1IUVA 4O5UA 4EMWA 2BK3A 3AEBA 2XVJA 2A8XA 2GR1A 3ALLA 3ZNOA 2V3BA 3NN6X 5JCMA 3NNEA 4EIQA 1GRAA 2QA2A 3AEGA 1GV4A 5C3JA 4TM3A 5J7XA 2AAQA 1GSNA 4C5OA 5KNLA 1K0LA 1DOCA 2GQWA 4UDQA 2BS4A 4H2NA 3NGCX 4I59A 4B68A 3DJEA 1KNPA 3ABVA 1VG9A 3EPTA 2EQ9A 2GR0A 3SM8A 3F8RA 2WQYA 2FJBA 3DMEA 2WOWA 2ARDA 2Z5YA 1ELIA 2YM2A 2VOUA 2OA1A 3COXA 3SX6A 2R4JA 1IJHA 1JOAA 1DDOA 1IUUA 3CGEA 3DGZA 4UP3A 4A99A 1H86A 4H4WA 3SZWA 3DH9A 1VE9A 2YG4A 2XFUA 3W4JA 1V59A 3UOXA 3BI2A 5FS8A 1M6IA 1X31B 4II3A 4Z43A 1O5WA 4NWZA 2NVKX 1Q9IA 3JSKA 4U8IA 3UP4A 3VRBA 4JY2A 2V6OA 1ZX9A 4DNAA 2GVCA 4G9KA 3CNTA 1CC6A 2Y6RA 1L9DA 3T14A 4RG3A 3V3OA 4RG4A 1BGJA 1DOBA 2XCGA 4K8DA 2VVMA 1YKJA 2JB3A 4FX9A 3NT6A 3WGTA 1MOKA 1O95A 4YXDA 4NTEA 4JY3A 1CHUA 4JDRA 4U8KA 1CL0A 4C74A 2CFYA 4U8OA 5IQ4A 5HXIA 2BCGG 2C3CA 2FJDA 2YVJA 1PHHA 4A6NB 2XVFA 4TLXA 4B69A 4A9WA 1D4EA 4FK1C 3Q9TA 5BRTA 2YVFA 2OALA 1NPXA 4X4JA 2VZ2A 3LB8A 1LQTA 4Z2UA 4GRTA 2WOIA 1TYPA 3C96A 1N4WA 2JBVA 2W0HA 3AYIA 3CGBA 3NHOX 2O9ZA 1OJDA 4H50A 4H4QA 1CJCA 4AT2A 2YLTA 3CNPA 5J60A 3C4NA 1D4CA 4HA6A 2C76A 1O94A 2X50A 4Y4LA 2IVEA 3PO7A 2XLRA 3KPKA 1NG4A 1ZKQA 2WP5A 2GQFA 4EIPA 1F8WA 4YSZA 2OAMA 4EMJA 4EQXA 3RP8A 1Q1WA 3NKSA 1LVLA 4MJWA 2WDVA 4QFCA 3LZXA 4PABA 3P4RA 2VRMA 4CRTA 2Q7VA 2RABA 4M52A 2QAEA 2X8HA 4XWRA 2GR3A 2GR2A 3SZ0A 1BWCA 2BCPA 3CNDA 5KMPA 2YLRA 3G5RA 3DK8A 2XFQA 4DSGA 1P2HA 2OLNA 4X9NA 1HYUA 2Z5XA 2YG5A 2YM1A 3AYLA 1F8RA 4C3YA 2XVHA 5U25A 1YQZA 2EQ7A 1IUSA 3UTHA 4EQRA 3P1WA 3NH3X 1H7XA 1OJTA 2B9YA 2F5ZA 2RGJA 1GRBA 3BI4A 5KMSA 1NG3A 4PAAA 4G6HA 1Q1RA 2CULA 2BABA 4D03A 3KVEA 2V3AA 1NDAA 5JCIA 3H4KA 1VQWA 1JNRA 2VQBA 3G5SA 3AYJA 3ICSA 3NTAA 1GRHA 1GPEA 1XPQA 4P9SA 3KD9A 3CPIG 3DJGX 1GERA 2GEWA 2GAGB 4CY8A 3AWIA 3SXIA 5C2TA 1H83A 3Q6JA 4JNAA 1CF3A 4EQWA 4B66A 4I58A 1PBEA 2WETA 1FOHA 4BURA 5M0ZA 3ATRA 2XLPA 1PXAA 4A79A 2IIDA 1Z6LA 2V61A 2JK6A 3LXDA 1PXCA 4H4VA 2E48A 5U1OA 4B64A 1KF6A 4YJDA 4J36A 3ZNNA 3SQPA 3GDPA 4U2TA 3AE9A 4JNQA 3NN0X 1Y0PA 4H4TA 1E6EA 3WE0A 2XLUA 4EMIA 2H89A 4GR1A 4YJHA 1PBCA 3QVRA 3UOZA 3VQRA 3UKKA 1EVIA 4NNJA 3ZDNA 2YAUA 2IVDA 3IHGA 2GV8A 2RGHA 3ADAB 3CGDA 1E1MA 4Z26A 3K30A 4YJGB 4OVIA 1PJ6A 1EL9A 4OPIA 4TM4A 5GRTA 3ISHA 4O5QA 1NENA 4YSYA 3UKLA 4FDCB 4KX6A 2WU5A 1CJ2A 4UDPA 2EQ8A 4CNKA 5HYMA 2WP9A 4EM3A 2E4GA 3ZNPA 1DOEA 1TDKA 4Z2TA 1QJDA 3QJ4A 1PXBA 3ALJA 4IVOB 2HQMA 3NG7X 4J33A 1KFYA 5EB4A 4A6NA 3AE1A 1LV0A 2FJAA 3NLCA 1F6MA 5KOXA 3HYVA 2R9ZA 3AE2A 1KSSA 3ICRA 3T2KA 2C72A 4HB9A 2ZZ0A 2YLZA 4X9MA 2BACA 4K2XA 3RP7A 1GALA 1TDNA 3AE5A 1VDCA 3URHA 2GRTA 3W4IA 4K22A 2C67A 1C0IA 4U8PA 1S3EA 5KMQA 1E7PA 3AE4A 3SYIA 4BV6A 2YLSA 2YWLA 4BJZA 4C77A 1AOGA 2GMJA 2GF3A 3S5WA 2TMDA 1C0KA 2QA1A 2V60A 2WS3A 1E39A 1FEAA 2WPCA 1MXTA 1JRXA 4ICYA 4OPDA 2X8CA 5KWFA 3CIRA 3LZWA 4CCQA 4B63A 1DJNA 4USQA 4XWZA 1ONFA 1GXFA 2YG3A 3ATQA 4GCMA 2BRYA 4OPTA 3RP6A 2WP6A 3HYWA 1GEUA 1NAAA 3AD8B 3CNSA 3EANA 4G74A 4U8LA 4Y4MA 3UKAA 4LA1A 1NHQA 2BK4A 1ZOYA 5KXJA 3K7MX 3GWFA 4AT0A 3GMCA 2YR5A 1JRZA 2AQJA 1KSUA 2E5VA 5GSNA 4YTNA 2GB0A 3T2ZA 1PDHA 5KVIA 1VRQB 1H82A 2YLXA 4JN9A 3P9UA 3R9UA 3CN8A 3FPZA 4AP3A 1ZK7A 2E82A 4CNJA 1JNZA 3UKHA 2BS3A 2TPRA 4AP1A 3L8KA 1N1PA 3FG2P 4CCRA 5HHFA 1GRTA 2WHDA 1L9CA 4ZCDA 1REOA 2PHHA 1DNCA 1GT8A 1N4UA 1TYTA 5U63A 3BHKA 3DJJA 2WPEA 4B65A 1QLBA 1NHPA 4XXGA 3KPFA 4YKFA 1NHSA 4WX1A 4H2QA 3QFBA 4J56A 3T2YA 3UTEA 3VRAA 4WCTA 1IUWA 1Y56B 3ITJA 4J34A 2Q6UA 3T37A 1YQ3A 2VRLA 5IQ1A 4Z44A 3UCLA 2YVGA 1EBDA 5CKUA 3AE6A 2YQUA 4DGKA 1L0VA 1GRGA 2JAEA 1B8SA 1KNRA 2R4EA 4U2LA 3I3LA 1EL8A 3BHFA 2X99A 1K0JA 1CBOA 1GNDA 1TDEA 4H4YA 3V76A 1ZY8A 2WESA 3H8IA 2XYOA 4YKGA 4USRA 1RSGA 4G6GA 2AR8A 3NYFA 2YR4A 2CDUA 2DKIA 2APGA 4RSLA 1CJ4A 4AOXA 1SEZA 1S2YA 1EL7A 2BK5A 3EAOA 4II2A 4LU6A 3KA7A 3HYXA 4Z24A 3VR9A 2C7GA 3SGLA 4YJFB 3II4A 4GDEA 5EB5A 1K0IA 3QSSA 1GESA 2C65A 1LTXR 3REDA 3T31A 3GD3A 1CC2A 3QFAA 5TR3A 3LADA 1FEBA 1DODA 2JB2A 4A7AA 2PYXA 2XLTA 3GRSA 4YT0A 4AOSA 3RHAA 1BGNA 3AE8A 4U8MA 1F3PA 1PN0A 2WDQA 2E49A 2ZZCA 3H8LA 5KOWA 4NTDA 1KDGA 1GREA 4H7UA 3UP5A 2XFNA 1RP0A 1XANA 3I6DA 3B3RA 2BA9A 2XFPA 2V5ZA 4APNA 4KPRA 3K7TA 4IA5A 4GAVA 5JCLA 3IF9A 3E1TA 2A87A 2BRAA 2C64A 3K7QX 3UKFA 2VQ7A 5JCNA 4YSXA 2DKHA 4IV9A 4E0VA 1FL2A 1B4VA 2ZBWA 4LIIA 1PJ5A 3GMBA 1DJQA 2QCUA 2WEUA 4CY6A 4C3XA 3KLJA 1LJ1A 3FBSA 1E1KA 2B9XA 3M0OA 2C66A 4H4UA 2VVLG 4J57A 1GTEA 2B7SA 4Z2RA 1H6VA 1K4QA 2FJEA 2YR6A 1GTHA 4GUVA 1S2QA 2R45A 4BK3A 2YG7A 4OCGA 4ECHA 3PVCA 4BK2A 2DU8A 3PS9A 3P4PA 2CVJA 3QSMA 2B7RA 3AEEA 4YWOA 3F8PA 4YSHA 2WU2A 4EQSA 1E1NA 1GOSA 4TLZA 1JU2A 4H4XA 2XFOA 5CQFA 1AN9A 1L9EA 2R0GA 1CC4A 3FIMB 5DBJA 3AXBA 3UTGA 3M13A 2Q0LA 3ZNQA 2UZZA 3G5QA 4N9XA 4UDRA 3V3NA 4J2WA 1MO9A 5BULA 3NK2X 1P2EA 4YTMA 3LJPA 1FECA 2C4CA 3OC4A 2BS2A 3NK1X 3OZ2A 5FS6A 1GETA 2BXRA
chains in the Genus database with same CATH topology
1XHCA 3T0KA 1OJCA 1ZMCA 1PS9A 3AECA 3CNJA 1EL5A 5KRQA 4U8JA 1E1LA 3KU9A 3RNMA 2C3DA 3SFDA 2Q0KA 4BJYA 3DK9A 4OPCA 3UOYA 2VVLA 1PBFA 1VG0A 3AEDA 3UKPA 5BVAA 5IPYA 5JCIA 3CPJG 4IA6A 3DGHA 5FS7A 3UTFA 3S61A 3AEFA 3QSEA 1TDFA 5FS9A 3GD4A 3CGCA 1XDIA 1Y56A 1YQ4A 4OPLA 2J3NA 4U8NA 1NHRA 1M64A 2C75A 1D4DA 3L1RA 4K5RA 5LV9A 4H4RA 4A65A 2WPFA 1GRFA 4IVMB 5KVHA 4J31A 4B1BA 1B37A 2BC0A 2BYBA 2WOVA 3BNUA 2RGOA 3NYCA 2I0ZA 4CBQA 1UKVG 1COYA 2EQ6A 1D7LA 4REKA 1H7WA 1LPFA 3CTYA 2JB1A 2Y6QA 2BXSA 1H81A 4NZHA 1QO8A 2C70A 3DA1A 3P4SA 1ZMDA 1ZOVA 5L46A 3AE3A 3UOVA 3SY4A 4K5SA 5M10A 1BKWA 2GH5A 2R46A 3QVPA 4U2SA 1CJ3A 1FCDA 3NRNA 5JCKA 2R0PA 4NEVA 3GYJA 5BUKA 5EBKA 3AD9B 1S3BA 5KMRA 4GAPA 3GDNA 4YTPA 1IUTA 1D7YA 3BI5A 5HY5A 3F8DA 4BK1A 2C73A 4G73A 1BF3A 3SFEA 2XVEA 3D1CA 2XVIA 3DK4A 3CMMA 1H84A 1PJ7A 3IC9A 4GDPA 4NTCA 2WDRA 1OJ9A 3SZFA 3M12A 4A5LA 4H2RA 3GWDA 1IUXA 4B67A 3DJDA 3SZCA 1W4XA 3O0HA 2WBAA 4OPUA 1LQUA 4NEWA 3B6DA 1JEHA 3CPHG 2A89A 4Y4NA 2X8GA 3ICTA 2XLSA 4TM0A 4ZCCA 4H2PA 2NPXA 3AD7B 2ACZA 3AEAA 1TRBA 4DSHA 3C4AA 4EM4A 4OPGA 3VR8A 4H4SA 2X3NA 3FMWA 1NEKA 1OJAA 4JQ9A 4K7ZA 2YG6A 3D8XA 4ADWA 1BZLA 2B76A 1D5TA 1DXLA 2OLOA 1PBBA 3EF6A 2JKCA 3AB1A 3P4QA 2BC1A 2B9WA 5ER0A 2R0CA 2E1MA 1ZDLA 1RYIA 3GYXA 4Z25A 4TM1A 3GYIA 3KKJA 4GF7A 1YY5A 3AE7A 1JRYA 2GAHB 1PBDA 3NYEA 4FK1A 3UKQA 3IHMA 1B5QA 4ZN0A 2ZZBA 1N4VA 3IWAA 5EOWA 5FMHA 3NTDA 4H4ZA 3ALMA 1ZP0A 2FBWA 3HZLA 3VRDB 2H88A 2YLWA 3NK0X 1TDOA 2GMHA 4H4PA 3ZYXA 2XDOA 3BNMA 4D04A 3GRTA 3GSIA 3NIXA 1F8SA 3LOVA 1IUVA 4O5UA 4EMWA 2BK3A 3AEBA 2XVJA 2A8XA 2GR1A 3ALLA 2V3BA 3NN6X 5JCMA 3NNEA 4EIQA 1GRAA 2QA2A 3AEGA 1GV4A 5C3JA 4TM3A 5J7XA 2AAQA 1GSNA 4C5OA 5KNLA 1K0LA 1DOCA 2GQWA 4UDQA 2BS4A 4H2NA 3NGCX 4I59A 4B68A 1KNPA 3ABVA 3DJEA 1VG9A 3EPTA 2EQ9A 2GR0A 3SM8A 3F8RA 2WQYA 2FJBA 2WOWA 3DMEA 2ARDA 2Z5YA 1ELIA 2YM2A 2VOUA 2OA1A 3COXA 3SX6A 2R4JA 1IJHA 1JOAA 1IUUA 3CGEA 3DGZA 4UP3A 4A99A 1H86A 4H4WA 3SZWA 3DH9A 2YG4A 2XFUA 1V59A 3UOXA 3BI2A 5FS8A 1M6IA 1X31B 4II3A 4Z43A 1O5WA 4NWZA 2NVKX 1Q9IA 3JSKA 4U8IA 3UP4A 3VRBA 4JY2A 2V6OA 1ZX9A 4DNAA 2GVCA 4G9KA 3CNTA 1CC6A 2Y6RA 1L9DA 3T14A 4RG3A 3V3OA 4RG4A 1BGJA 1DOBA 2XCGA 4K8DA 2VVMA 1YKJA 2JB3A 4FX9A 3NT6A 1MOKA 1O95A 4YXDA 4NTEA 4JY3A 1CHUA 4JDRA 4U8KA 1CL0A 4C74A 2CFYA 4U8OA 5IQ4A 5HXIA 2BCGG 2C3CA 2FJDA 2YVJA 1PHHA 4A6NB 2XVFA 4TLXA 4B69A 4A9WA 1D4EA 4FK1C 3Q9TA 5BRTA 2YVFA 2OALA 1NPXA 4X4JA 2VZ2A 3LB8A 1LQTA 4Z2UA 4GRTA 2WOIA 1TYPA 3C96A 1N4WA 2JBVA 2W0HA 3AYIA 3CGBA 3NHOX 2O9ZA 1OJDA 4H50A 4H4QA 1CJCA 4AT2A 2YLTA 3CNPA 5J60A 1D4CA 3C4NA 4HA6A 2C76A 1O94A 2X50A 4Y4LA 2IVEA 3PO7A 2XLRA 3KPKA 1NG4A 1ZKQA 2WP5A 2GQFA 4EIPA 1F8WA 4YSZA 2OAMA 4EMJA 4EQXA 3RP8A 1Q1WA 3NKSA 1LVLA 4MJWA 2WDVA 3LZXA 4PABA 3P4RA 2VRMA 4CRTA 2Q7VA 2RABA 4M52A 2QAEA 2X8HA 4XWRA 2GR3A 2GR2A 3SZ0A 1BWCA 2BCPA 3CNDA 5KMPA 2YLRA 3G5RA 3DK8A 2XFQA 4DSGA 1P2HA 2OLNA 1HYUA 4X9NA 2Z5XA 2YG5A 2YM1A 3AYLA 1F8RA 4C3YA 2XVHA 5U25A 1YQZA 2EQ7A 1IUSA 3UTHA 4EQRA 3P1WA 3NH3X 1H7XA 1OJTA 2B9YA 2F5ZA 2RGJA 1GRBA 3BI4A 5KMSA 1NG3A 4G6HA 4PAAA 1Q1RA 2CULA 2BABA 4D03A 3KVEA 2V3AA 1NDAA 3H4KA 1VQWA 1JNRA 2VQBA 3G5SA 3AYJA 3ICSA 3NTAA 1GRHA 1GPEA 1XPQA 4P9SA 3KD9A 3CPIG 3DJGX 1GERA 2GEWA 2GAGB 4CY8A 3AWIA 3SXIA 5C2TA 1H83A 3Q6JA 4JNAA 1CF3A 4EQWA 4B66A 4I58A 1PBEA 2WETA 1FOHA 4BURA 5M0ZA 3ATRA 2XLPA 1PXAA 4A79A 2IIDA 1Z6LA 2V61A 2JK6A 3LXDA 1PXCA 4H4VA 5U1OA 4B64A 4EQSA 1KF6A 4J36A 3SQPA 3GDPA 4U2TA 3AE9A 4JNQA 3NN0X 1Y0PA 4H4TA 1E6EA 3WE0A 2XLUA 4EMIA 2H89A 4GR1A 3QVRA 1PBCA 3UOZA 3VQRA 3UKKA 4NNJA 3ZDNA 2YAUA 2IVDA 3IHGA 2GV8A 2RGHA 3ADAB 3CGDA 1E1MA 4Z26A 3K30A 4OVIA 4OPIA 1PJ6A 1EL9A 5GRTA 4TM4A 3ISHA 4O5QA 1NENA 4YSYA 3UKLA 4FDCB 4KX6A 2WU5A 1CJ2A 4UDPA 2EQ8A 4CNKA 5HYMA 2WP9A 4EM3A 2E4GA 1DOEA 1TDKA 4Z2TA 1QJDA 3QJ4A 1PXBA 3ALJA 4IVOB 2HQMA 3NG7X 4J33A 1KFYA 5EB4A 4A6NA 3AE1A 1LV0A 2FJAA 3NLCA 1F6MA 5KOXA 3HYVA 2R9ZA 3AE2A 1KSSA 3ICRA 3T2KA 2C72A 4HB9A 2ZZ0A 2YLZA 4K2XA 2BACA 4X9MA 3RP7A 1GALA 1TDNA 3AE5A 1VDCA 3URHA 2GRTA 4K22A 2C67A 5KMQA 4U8PA 1S3EA 1E7PA 3AE4A 3SYIA 4BV6A 2YLSA 2YWLA 4BJZA 4C77A 1AOGA 2GMJA 2GF3A 3S5WA 2TMDA 2QA1A 2V60A 2WS3A 1E39A 1FEAA 2WPCA 1MXTA 1JRXA 4ICYA 4OPDA 2X8CA 5KWFA 3CIRA 3LZWA 4CCQA 4B63A 1DJNA 4USQA 1ONFA 4XWZA 1GXFA 2YG3A 3ATQA 4GCMA 2BRYA 4OPTA 3RP6A 2WP6A 3HYWA 1GEUA 1NAAA 3AD8B 3CNSA 3EANA 4G74A 4U8LA 4Y4MA 3UKAA 4LA1A 1NHQA 2BK4A 1ZOYA 5KXJA 3K7MX 3GWFA 4AT0A 3GMCA 2YR5A 1JRZA 2AQJA 1KSUA 2E5VA 5GSNA 4YTNA 2GB0A 3T2ZA 1PDHA 5KVIA 1H82A 1VRQB 2YLXA 4JN9A 3P9UA 3R9UA 3CN8A 3FPZA 4AP3A 1ZK7A 4CNJA 1JNZA 3UKHA 2BS3A 2TPRA 4AP1A 3L8KA 1N1PA 3FG2P 4CCRA 5HHFA 1GRTA 2WHDA 1L9CA 4ZCDA 1REOA 2PHHA 1DNCA 1GT8A 1N4UA 1TYTA 5U63A 3BHKA 3DJJA 2WPEA 4B65A 1QLBA 1NHPA 4XXGA 3KPFA 4YKFA 1NHSA 4WX1A 4H2QA 3QFBA 4J56A 3T2YA 3UTEA 3VRAA 4WCTA 1IUWA 1Y56B 3ITJA 4J34A 2Q6UA 3T37A 1YQ3A 2VRLA 5IQ1A 4Z44A 3UCLA 2YVGA 1EBDA 5CKUA 3AE6A 2YQUA 4DGKA 1L0VA 1GRGA 2JAEA 1B8SA 1KNRA 2R4EA 4U2LA 3I3LA 1EL8A 3BHFA 2X99A 1K0JA 1CBOA 1GNDA 1TDEA 4H4YA 3V76A 1ZY8A 2WESA 3H8IA 2XYOA 4YKGA 4USRA 1RSGA 4G6GA 2AR8A 3NYFA 2YR4A 2CDUA 2DKIA 2APGA 4RSLA 1CJ4A 4AOXA 1SEZA 1S2YA 1EL7A 2BK5A 3EAOA 4II2A 4LU6A 3KA7A 3HYXA 4Z24A 3VR9A 2C7GA 3SGLA 4GDEA 3II4A 3REDA 5EB5A 1GESA 1K0IA 3QSSA 2C65A 1LTXR 3T31A 3GD3A 1CC2A 3QFAA 5TR3A 3LADA 1FEBA 1DODA 2JB2A 4A7AA 2PYXA 2XLTA 3GRSA 4YT0A 4AOSA 3RHAA 1BGNA 3AE8A 4U8MA 1F3PA 1PN0A 2WDQA 2ZZCA 3H8LA 5KOWA 4NTDA 1KDGA 1GREA 4H7UA 3UP5A 2XFNA 1RP0A 1XANA 3I6DA 3B3RA 2BA9A 2XFPA 2V5ZA 4APNA 4KPRA 3K7TA 4IA5A 4GAVA 5JCLA 2A87A 3E1TA 2BRAA 2C64A 3IF9A 3K7QX 3UKFA 2VQ7A 5JCNA 4YSXA 2DKHA 4IV9A 4E0VA 1FL2A 1B4VA 2ZBWA 4LIIA 1PJ5A 3GMBA 1DJQA 2QCUA 2WEUA 4CY6A 4C3XA 3KLJA 1LJ1A 3FBSA 1E1KA 2B9XA 3M0OA 2C66A 4H4UA 2VVLG 4J57A 1GTEA 2B7SA 4Z2RA 1H6VA 1K4QA 2FJEA 2YR6A 1GTHA 4GUVA 1S2QA 4BK3A 2R45A 2YG7A 4OCGA 4ECHA 3PVCA 4BK2A 3P4PA 3PS9A 2CVJA 2B7RA 3AEEA 3QSMA 4YWOA 3F8PA 2WU2A 4YSHA 1E1NA 1GOSA 4TLZA 1JU2A 4H4XA 2XFOA 5CQFA 1L9EA 2R0GA 1CC4A 3FIMB 5DBJA 3AXBA 3UTGA 2Q0LA 3M13A 2UZZA 3G5QA 4N9XA 4UDRA 3V3NA 4J2WA 1MO9A 5BULA 3NK2X 1P2EA 4YTMA 3LJPA 1FECA 2C4CA 3OC4A 2BS2A 3NK1X 3OZ2A 5FS6A 1GETA 2BXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHC A;  1OJC A;  1ZMC A;  1PS9 A;  3AEC A;  3CNJ A;  1EL5 A;  5KRQ A;  4U8J A;  1E1L A;  3KU9 A;  3RNM A;  2C3D A;  3SFD A;  2Q0K A;  3DK9 A;  4OPC A;  4BJY A;  3UOY A;  2VVL A;  1PBF A;  1VG0 A;  3AED A;  3UKP A;  5BVA A;  5IPY A;  5JCI A;  3CPJ G;  4IA6 A;  3DGH A;  5FS7 A;  3UTF A;  3S61 A;  3AEF A;  3QSE A;  1TDF A;  5FS9 A;  3GD4 A;  3CGC A;  1XDI A;  1Y56 A;  1YQ4 A;  4OPL A;  2J3N A;  4U8N A;  1NHR A;  1M64 A;  2C75 A;  1D4D A;  3L1R A;  4K5R A;  5LV9 A;  4H4R A;  4A65 A;  2WPF A;  1GRF A;  4IVM B;  5KVH A;  4J31 A;  4B1B A;  1B37 A;  2BC0 A;  2BYB A;  2WOV A;  3BNU A;  2RGO A;  3NYC A;  2I0Z A;  4CBQ A;  1UKV G;  1COY A;  2EQ6 A;  1D7L A;  4REK A;  1H7W A;  1LPF A;  3CTY A;  2JB1 A;  2Y6Q A;  2BXS A;  1H81 A;  4NZH A;  1QO8 A;  2C70 A;  3DA1 A;  3P4S A;  1ZMD A;  1ZOV A;  5L46 A;  3AE3 A;  3UOV A;  4K5S A;  5M10 A;  1BKW A;  2GH5 A;  2R46 A;  3QVP A;  4U2S A;  1CJ3 A;  1FCD A;  3NRN A;  5JCK A;  2R0P A;  4NEV A;  3GYJ A;  5BUK A;  5EBK A;  3AD9 B;  1S3B A;  3GDN A;  4YTP A;  1IUT A;  1D7Y A;  3BI5 A;  5HY5 A;  3F8D A;  4BK1 A;  2C73 A;  1BF3 A;  3SFE A;  2XVE A;  3D1C A;  2XVI A;  3DK4 A;  1H84 A;  1PJ7 A;  3IC9 A;  4GDP A;  4NTC A;  2WDR A;  1OJ9 A;  4A5L A;  3M12 A;  4H2R A;  3GWD A;  1IUX A;  4B67 A;  3DJD A;  1W4X A;  3O0H A;  2WBA A;  4OPU A;  1LQU A;  4NEW A;  3B6D A;  1JEH A;  3CPH G;  2A89 A;  4Y4N A;  2X8G A;  3ICT A;  2XLS A;  4TM0 A;  4ZCC A;  4H2P A;  2NPX A;  3AD7 B;  2ACZ A;  3AEA A;  1TRB A;  4DSH A;  3C4A A;  4EM4 A;  4OPG A;  3VR8 A;  4H4S A;  2X3N A;  3FMW A;  1NEK A;  1OJA A;  4JQ9 A;  4K7Z A;  2YG6 A;  3D8X A;  4ADW A;  1BZL A;  2B76 A;  1D5T A;  1DXL A;  2OLO A;  1PBB A;  3EF6 A;  2JKC A;  3AB1 A;  3P4Q A;  2BC1 A;  2B9W A;  5ER0 A;  2R0C A;  2E1M A;  1ZDL A;  1RYI A;  4Z25 A;  4TM1 A;  3GYI A;  3KKJ A;  4GF7 A;  1YY5 A;  3AE7 A;  1JRY A;  2GAH B;  1PBD A;  3NYE A;  4FK1 A;  3UKQ A;  1B5Q A;  3IHM A;  4ZN0 A;  2ZZB A;  1N4V A;  3IWA A;  5EOW A;  5FMH A;  3NTD A;  4H4Z A;  3ALM A;  1ZP0 A;  2FBW A;  3HZL A;  3VRD B;  2H88 A;  2YLW A;  3NK0 X;  1TDO A;  2GMH A;  4H4P A;  3ZYX A;  2XDO A;  3BNM A;  4D04 A;  3GRT A;  3GSI A;  3NIX A;  1F8S A;  3LOV A;  1IUV A;  4O5U A;  4EMW A;  2BK3 A;  3AEB A;  2XVJ A;  2A8X A;  2GR1 A;  3ALL A;  2V3B A;  3NN6 X;  5JCM A;  3NNE A;  4EIQ A;  1GRA A;  2QA2 A;  3AEG A;  1GV4 A;  5C3J A;  4TM3 A;  5J7X A;  2AAQ A;  1GSN A;  4C5O A;  1K0L A;  1DOC A;  2GQW A;  4UDQ A;  2BS4 A;  4H2N A;  3NGC X;  4I59 A;  4B68 A;  1KNP A;  3ABV A;  3DJE A;  1VG9 A;  3EPT A;  2EQ9 A;  2GR0 A;  3SM8 A;  3F8R A;  2WQY A;  2FJB A;  2WOW A;  3DME A;  2ARD A;  2Z5Y A;  1ELI A;  2YM2 A;  2OA1 A;  2VOU A;  3COX A;  2R4J A;  1IJH A;  1JOA A;  1IUU A;  3CGE A;  3DGZ A;  4UP3 A;  4A99 A;  1H86 A;  4H4W A;  3DH9 A;  2YG4 A;  2XFU A;  1V59 A;  3UOX A;  3BI2 A;  5FS8 A;  1M6I A;  1X31 B;  4Z43 A;  1O5W A;  2NVK X;  1Q9I A;  3JSK A;  4U8I A;  3UP4 A;  3VRB A;  4JY2 A;  2V6O A;  1ZX9 A;  4DNA A;  2GVC A;  3CNT A;  1CC6 A;  2Y6R A;  1L9D A;  4RG3 A;  3V3O A;  4RG4 A;  1BGJ A;  1DOB A;  2XCG A;  4K8D A;  2VVM A;  1YKJ A;  2JB3 A;  4FX9 A;  3NT6 A;  1MOK A;  1O95 A;  4YXD A;  4NTE A;  4JY3 A;  1CHU A;  4JDR A;  4U8K A;  1CL0 A;  4C74 A;  2CFY A;  4U8O A;  5IQ4 A;  5HXI A;  2BCG G;  2C3C A;  2FJD A;  2YVJ A;  1PHH A;  4A6N B;  2XVF A;  4TLX A;  4B69 A;  4A9W A;  1D4E A;  4FK1 C;  3Q9T A;  5BRT A;  2YVF A;  2OAL A;  1NPX A;  4X4J A;  2VZ2 A;  3LB8 A;  1LQT A;  4Z2U A;  4GRT A;  2WOI A;  1TYP A;  1N4W A;  2JBV A;  3C96 A;  2W0H A;  3AYI A;  3CGB A;  3NHO X;  2O9Z A;  1OJD A;  4H50 A;  4H4Q A;  1CJC A;  4AT2 A;  2YLT A;  3CNP A;  5J60 A;  1D4C A;  3C4N A;  4HA6 A;  2C76 A;  1O94 A;  2X50 A;  4Y4L A;  2IVE A;  3PO7 A;  2XLR A;  1NG4 A;  1ZKQ A;  2WP5 A;  2GQF A;  4EIP A;  1F8W A;  4YSZ A;  2OAM A;  4EMJ A;  4EQX A;  3RP8 A;  1Q1W A;  3NKS A;  1LVL A;  4MJW A;  2WDV A;  3LZX A;  4PAB A;  3P4R A;  2VRM A;  4CRT A;  2Q7V A;  2RAB A;  4M52 A;  2QAE A;  2X8H A;  4XWR A;  2GR3 A;  2GR2 A;  1BWC A;  2BCP A;  3CND A;  2YLR A;  3G5R A;  3DK8 A;  2XFQ A;  4DSG A;  1P2H A;  2OLN A;  1HYU A;  4X9N A;  2Z5X A;  2YG5 A;  2YM1 A;  3AYL A;  1F8R A;  4C3Y A;  2XVH A;  5U25 A;  1YQZ A;  2EQ7 A;  1IUS A;  3UTH A;  4EQR A;  3P1W A;  3NH3 X;  1H7X A;  1OJT A;  2B9Y A;  2F5Z A;  2RGJ A;  1GRB A;  3BI4 A;  1NG3 A;  4PAA A;  1Q1R A;  2CUL A;  2BAB A;  4D03 A;  3KVE A;  2V3A A;  1NDA A;  3H4K A;  1VQW A;  1JNR A;  2VQB A;  3G5S A;  3AYJ A;  3ICS A;  3NTA A;  1GRH A;  1GPE A;  1XPQ A;  4P9S A;  3KD9 A;  3CPI G;  3DJG X;  1GER A;  2GEW A;  2GAG B;  4CY8 A;  3AWI A;  5C2T A;  1H83 A;  3Q6J A;  4JNA A;  1CF3 A;  4EQW A;  4B66 A;  4I58 A;  1PBE A;  2WET A;  1FOH A;  4BUR A;  5M0Z A;  3ATR A;  2XLP A;  1PXA A;  4A79 A;  2IID A;  1Z6L A;  2V61 A;  2JK6 A;  3LXD A;  1PXC A;  4H4V A;  5U1O A;  4B64 A;  4EQS A;  1KF6 A;  4J36 A;  3SQP A;  3GDP A;  4U2T A;  3AE9 A;  4JNQ A;  3NN0 X;  1Y0P A;  4H4T A;  1E6E A;  3WE0 A;  2XLU A;  4EMI A;  2H89 A;  4GR1 A;  3QVR A;  1PBC A;  3UOZ A;  3VQR A;  3UKK A;  3ZDN A;  2YAU A;  2IVD A;  3IHG A;  2GV8 A;  2RGH A;  3ADA B;  3CGD A;  1E1M A;  4Z26 A;  3K30 A;  4OVI A;  4OPI A;  1PJ6 A;  1EL9 A;  5GRT A;  4TM4 A;  3ISH A;  4O5Q A;  1NEN A;  4YSY A;  3UKL A;  4FDC B;  4KX6 A;  2WU5 A;  1CJ2 A;  4UDP A;  2EQ8 A;  4CNK A;  5HYM A;  2WP9 A;  4EM3 A;  2E4G A;  1DOE A;  1TDK A;  4Z2T A;  1QJD A;  3QJ4 A;  1PXB A;  3ALJ A;  4IVO B;  2HQM A;  3NG7 X;  4J33 A;  1KFY A;  5EB4 A;  4A6N A;  3AE1 A;  1LV0 A;  2FJA A;  3NLC A;  1F6M A;  5KOX A;  2R9Z A;  3AE2 A;  1KSS A;  3ICR A;  2C72 A;  4HB9 A;  2ZZ0 A;  2YLZ A;  4K2X A;  2BAC A;  4X9M A;  1TDN A;  1GAL A;  3AE5 A;  3RP7 A;  1VDC A;  3URH A;  2GRT A;  4K22 A;  2C67 A;  4U8P A;  1S3E A;  1E7P A;  3AE4 A;  4BV6 A;  2YLS A;  2YWL A;  4BJZ A;  4C77 A;  1AOG A;  2GMJ A;  2GF3 A;  3S5W A;  2TMD A;  2QA1 A;  2V60 A;  2WS3 A;  1E39 A;  1FEA A;  2WPC A;  1MXT A;  1JRX A;  4ICY A;  4OPD A;  2X8C A;  5KWF A;  3CIR A;  3LZW A;  4CCQ A;  4B63 A;  1DJN A;  4USQ A;  1ONF A;  4XWZ A;  1GXF A;  2YG3 A;  3ATQ A;  4GCM A;  4OPT A;  3RP6 A;  2WP6 A;  1GEU A;  1NAA A;  3AD8 B;  3CNS A;  3EAN A;  4U8L A;  4Y4M A;  3UKA A;  4LA1 A;  1NHQ A;  2BK4 A;  1ZOY A;  5KXJ A;  3K7M X;  3GWF A;  4AT0 A;  3GMC A;  2YR5 A;  1JRZ A;  2AQJ A;  1KSU A;  2E5V A;  5GSN A;  4YTN A;  2GB0 A;  1PDH A;  5KVI A;  1H82 A;  1VRQ B;  2YLX A;  4JN9 A;  3P9U A;  3R9U A;  3CN8 A;  3FPZ A;  4AP3 A;  1ZK7 A;  4CNJ A;  1JNZ A;  3UKH A;  2BS3 A;  2TPR A;  4AP1 A;  3L8K A;  1N1P A;  3FG2 P;  4CCR A;  5HHF A;  1GRT A;  2WHD A;  1L9C A;  4ZCD A;  1REO A;  2PHH A;  1DNC A;  1GT8 A;  1N4U A;  1TYT A;  5U63 A;  3BHK A;  3DJJ A;  2WPE A;  4B65 A;  1QLB A;  1NHP A;  4XXG A;  3KPF A;  4YKF A;  1NHS A;  4WX1 A;  4H2Q A;  3QFB A;  4J56 A;  3UTE A;  3VRA A;  4WCT A;  1IUW A;  1Y56 B;  3ITJ A;  4J34 A;  2Q6U A;  3T37 A;  1YQ3 A;  2VRL A;  5IQ1 A;  4Z44 A;  3UCL A;  2YVG A;  1EBD A;  5CKU A;  3AE6 A;  2YQU A;  4DGK A;  1L0V A;  1GRG A;  2JAE A;  1B8S A;  1KNR A;  2R4E A;  4U2L A;  3I3L A;  1EL8 A;  3BHF A;  2X99 A;  1K0J A;  1CBO A;  1GND A;  1TDE A;  4H4Y A;  3V76 A;  1ZY8 A;  2WES A;  3H8I A;  2XYO A;  4YKG A;  4USR A;  1RSG A;  2AR8 A;  3NYF A;  2YR4 A;  2CDU A;  2DKI A;  2APG A;  4RSL A;  1CJ4 A;  4AOX A;  1SEZ A;  1S2Y A;  1EL7 A;  2BK5 A;  3EAO A;  4LU6 A;  3KA7 A;  4Z24 A;  3VR9 A;  2C7G A;  3SGL A;  4GDE A;  3II4 A;  3RED A;  5EB5 A;  1GES A;  1K0I A;  3QSS A;  2C65 A;  1LTX R;  3GD3 A;  1CC2 A;  3QFA A;  5TR3 A;  3LAD A;  1FEB A;  1DOD A;  2JB2 A;  4A7A A;  2PYX A;  2XLT A;  3GRS A;  4YT0 A;  4AOS A;  3RHA A;  1BGN A;  3AE8 A;  4U8M A;  1F3P A;  1PN0 A;  2WDQ A;  2ZZC A;  3H8L A;  5KOW A;  4NTD A;  1KDG A;  1GRE A;  4H7U A;  3UP5 A;  2XFN A;  1RP0 A;  1XAN A;  3I6D A;  3B3R A;  2BA9 A;  2XFP A;  2V5Z A;  4APN A;  4KPR A;  3K7T A;  4IA5 A;  5JCL A;  2A87 A;  3E1T A;  2C64 A;  3IF9 A;  3K7Q X;  3UKF A;  2VQ7 A;  5JCN A;  4YSX A;  2DKH A;  4IV9 A;  4E0V A;  1FL2 A;  1B4V A;  2ZBW A;  4LII A;  1PJ5 A;  3GMB A;  1DJQ A;  2QCU A;  2WEU A;  4CY6 A;  4C3X A;  3KLJ A;  1LJ1 A;  3FBS A;  1E1K A;  2B9X A;  3M0O A;  2C66 A;  4H4U A;  2VVL G;  4J57 A;  1GTE A;  2B7S A;  4Z2R A;  1H6V A;  1K4Q A;  2FJE A;  2YR6 A;  1GTH A;  4GUV A;  1S2Q A;  2R45 A;  4BK3 A;  2YG7 A;  4OCG A;  4ECH A;  3PVC A;  4BK2 A;  3P4P A;  3PS9 A;  2CVJ A;  2B7R A;  3AEE A;  3QSM A;  4YWO A;  3F8P A;  2WU2 A;  4YSH A;  1E1N A;  1GOS A;  4TLZ A;  1JU2 A;  4H4X A;  2XFO A;  5CQF A;  1L9E A;  2R0G A;  1CC4 A;  3FIM B;  5DBJ A;  3AXB A;  3UTG A;  2Q0L A;  3M13 A;  2UZZ A;  3G5Q A;  4N9X A;  4UDR A;  3V3N A;  4J2W A;  1MO9 A;  5BUL A;  3NK2 X;  1P2E A;  4YTM A;  3LJP A;  1FEC A;  3OC4 A;  2BS2 A;  3NK1 X;  3OZ2 A;  5FS6 A;  1GET A;  2BXR A; 
#chains in the Genus database with same CATH topology
 1XHC A;  3T0K A;  1OJC A;  1ZMC A;  1PS9 A;  1C0P A;  3AEC A;  3CNJ A;  1EL5 A;  5KRQ A;  4U8J A;  1E1L A;  3KU9 A;  3RNM A;  2C3D A;  3SFD A;  2Q0K A;  4BJY A;  3DK9 A;  4YJH B;  4OPC A;  2VVL A;  1PBF A;  1VG0 A;  3AED A;  3UKP A;  3UOY A;  5BVA A;  5IPY A;  3CPJ G;  4IA6 A;  3DGH A;  5FS7 A;  3UTF A;  3S61 A;  3AEF A;  3QSE A;  1TDF A;  5FS9 A;  3GD4 A;  3CGC A;  1XDI A;  1Y56 A;  1YQ4 A;  4OPL A;  2J3N A;  4U8N A;  1NHR A;  1M64 A;  2C75 A;  1D4D A;  3L1R A;  4K5R A;  5LV9 A;  4H4R A;  4A65 A;  2WPF A;  1GRF A;  4IVM B;  5KVH A;  4J31 A;  4B1B A;  1B37 A;  2BC0 A;  2BYB A;  2WOV A;  3BNU A;  2RGO A;  3NYC A;  2I0Z A;  4CBQ A;  1UKV G;  1COY A;  2EQ6 A;  1D7L A;  4REK A;  1H7W A;  1LPF A;  3CTY A;  2JB1 A;  2Y6Q A;  2BXS A;  1H81 A;  4NZH A;  1QO8 A;  2C70 A;  3DA1 A;  3P4S A;  1ZMD A;  1ZOV A;  5L46 A;  3AE3 A;  3UOV A;  3SY4 A;  4K5S A;  5M10 A;  1BKW A;  4YJF A;  2R46 A;  2GH5 A;  3QVP A;  4U2S A;  1CJ3 A;  1FCD A;  3NRN A;  5JCK A;  2R0P A;  4NEV A;  3GYJ A;  5BUK A;  5EBK A;  3AD9 B;  1S3B A;  5KMR A;  4GAP A;  3GDN A;  4YTP A;  1IUT A;  1C0L A;  1D7Y A;  3BI5 A;  5HY5 A;  3F8D A;  4BK1 A;  2C73 A;  4G73 A;  1BF3 A;  3SFE A;  2XVE A;  3D1C A;  2XVI A;  3DK4 A;  3CMM A;  1KIF A;  1H84 A;  1PJ7 A;  3IC9 A;  4GDP A;  4NTC A;  2WDR A;  1OJ9 A;  3SZF A;  3M12 A;  4A5L A;  4H2R A;  3GWD A;  1IUX A;  4B67 A;  3DJD A;  3SZC A;  1W4X A;  3O0H A;  2WBA A;  4OPU A;  1LQU A;  4NEW A;  3B6D A;  1JEH A;  3CPH G;  2A89 A;  4Y4N A;  2X8G A;  3ICT A;  2XLS A;  4TM0 A;  4ZCC A;  4H2P A;  2NPX A;  4YJG A;  3AD7 B;  2ACZ A;  3AEA A;  1TRB A;  4DSH A;  3G3E A;  3C4A A;  4EM4 A;  4OPG A;  3VR8 A;  4H4S A;  1DAO A;  2X3N A;  3FMW A;  1NEK A;  1OJA A;  2E4A A;  4JQ9 A;  3CUK A;  4K7Z A;  2YG6 A;  3D8X A;  4ADW A;  4QFD A;  1BZL A;  2B76 A;  1D5T A;  1DXL A;  2OLO A;  3W4K A;  1PBB A;  3EF6 A;  2JKC A;  3AB1 A;  3P4Q A;  2BC1 A;  2B9W A;  5ER0 A;  2R0C A;  2E1M A;  1ZDL A;  1RYI A;  3GYX A;  4Z25 A;  4TM1 A;  3GYI A;  3KKJ A;  4GF7 A;  1YY5 A;  3AE7 A;  1JRY A;  2GAH B;  1PBD A;  3NYE A;  4FK1 A;  3UKQ A;  3IHM A;  1B5Q A;  4ZN0 A;  2ZZB A;  1N4V A;  3IWA A;  5EOW A;  5FMH A;  3NTD A;  4H4Z A;  3ALM A;  3HZL A;  1ZP0 A;  2FBW A;  3VRD B;  2H88 A;  2YLW A;  3NK0 X;  1TDO A;  2GMH A;  4H4P A;  3ZYX A;  2XDO A;  3BNM A;  4D04 A;  3GRT A;  3GSI A;  3NIX A;  1F8S A;  3LOV A;  1IUV A;  4O5U A;  4EMW A;  2BK3 A;  3AEB A;  2XVJ A;  2A8X A;  2GR1 A;  3ALL A;  3ZNO A;  2V3B A;  3NN6 X;  5JCM A;  3NNE A;  4EIQ A;  1GRA A;  2QA2 A;  3AEG A;  1GV4 A;  5C3J A;  4TM3 A;  5J7X A;  2AAQ A;  1GSN A;  4C5O A;  5KNL A;  1K0L A;  1DOC A;  2GQW A;  4UDQ A;  2BS4 A;  4H2N A;  3NGC X;  4I59 A;  4B68 A;  3DJE A;  1KNP A;  3ABV A;  1VG9 A;  3EPT A;  2EQ9 A;  2GR0 A;  3SM8 A;  3F8R A;  2WQY A;  2FJB A;  3DME A;  2WOW A;  2ARD A;  2Z5Y A;  1ELI A;  2YM2 A;  2VOU A;  2OA1 A;  3COX A;  3SX6 A;  2R4J A;  1IJH A;  1JOA A;  1DDO A;  1IUU A;  3CGE A;  3DGZ A;  4UP3 A;  4A99 A;  1H86 A;  4H4W A;  3SZW A;  3DH9 A;  1VE9 A;  2YG4 A;  2XFU A;  3W4J A;  1V59 A;  3UOX A;  3BI2 A;  5FS8 A;  1M6I A;  1X31 B;  4II3 A;  4Z43 A;  1O5W A;  4NWZ A;  2NVK X;  1Q9I A;  3JSK A;  4U8I A;  3UP4 A;  3VRB A;  4JY2 A;  2V6O A;  1ZX9 A;  4DNA A;  2GVC A;  4G9K A;  3CNT A;  1CC6 A;  2Y6R A;  1L9D A;  3T14 A;  4RG3 A;  3V3O A;  4RG4 A;  1BGJ A;  1DOB A;  2XCG A;  4K8D A;  2VVM A;  1YKJ A;  2JB3 A;  4FX9 A;  3NT6 A;  3WGT A;  1MOK A;  1O95 A;  4YXD A;  4NTE A;  4JY3 A;  1CHU A;  4JDR A;  4U8K A;  1CL0 A;  4C74 A;  2CFY A;  4U8O A;  5IQ4 A;  5HXI A;  2BCG G;  2C3C A;  2FJD A;  2YVJ A;  1PHH A;  4A6N B;  2XVF A;  4TLX A;  4B69 A;  4A9W A;  1D4E A;  4FK1 C;  3Q9T A;  5BRT A;  2YVF A;  2OAL A;  1NPX A;  4X4J A;  2VZ2 A;  3LB8 A;  1LQT A;  4Z2U A;  4GRT A;  2WOI A;  1TYP A;  3C96 A;  1N4W A;  2JBV A;  2W0H A;  3AYI A;  3CGB A;  3NHO X;  2O9Z A;  1OJD A;  4H50 A;  4H4Q A;  1CJC A;  4AT2 A;  2YLT A;  3CNP A;  5J60 A;  3C4N A;  1D4C A;  4HA6 A;  2C76 A;  1O94 A;  2X50 A;  4Y4L A;  2IVE A;  3PO7 A;  2XLR A;  3KPK A;  1NG4 A;  1ZKQ A;  2WP5 A;  2GQF A;  4EIP A;  1F8W A;  4YSZ A;  2OAM A;  4EMJ A;  4EQX A;  3RP8 A;  1Q1W A;  3NKS A;  1LVL A;  4MJW A;  2WDV A;  4QFC A;  3LZX A;  4PAB A;  3P4R A;  2VRM A;  4CRT A;  2Q7V A;  2RAB A;  4M52 A;  2QAE A;  2X8H A;  4XWR A;  2GR3 A;  2GR2 A;  3SZ0 A;  1BWC A;  2BCP A;  3CND A;  5KMP A;  2YLR A;  3G5R A;  3DK8 A;  2XFQ A;  4DSG A;  1P2H A;  2OLN A;  4X9N A;  1HYU A;  2Z5X A;  2YG5 A;  2YM1 A;  3AYL A;  1F8R A;  4C3Y A;  2XVH A;  5U25 A;  1YQZ A;  2EQ7 A;  1IUS A;  3UTH A;  4EQR A;  3P1W A;  3NH3 X;  1H7X A;  1OJT A;  2B9Y A;  2F5Z A;  2RGJ A;  1GRB A;  3BI4 A;  5KMS A;  1NG3 A;  4PAA A;  4G6H A;  1Q1R A;  2CUL A;  2BAB A;  4D03 A;  3KVE A;  2V3A A;  1NDA A;  5JCI A;  3H4K A;  1VQW A;  1JNR A;  2VQB A;  3G5S A;  3AYJ A;  3ICS A;  3NTA A;  1GRH A;  1GPE A;  1XPQ A;  4P9S A;  3KD9 A;  3CPI G;  3DJG X;  1GER A;  2GEW A;  2GAG B;  4CY8 A;  3AWI A;  3SXI A;  5C2T A;  1H83 A;  3Q6J A;  4JNA A;  1CF3 A;  4EQW A;  4B66 A;  4I58 A;  1PBE A;  2WET A;  1FOH A;  4BUR A;  5M0Z A;  3ATR A;  2XLP A;  1PXA A;  4A79 A;  2IID A;  1Z6L A;  2V61 A;  2JK6 A;  3LXD A;  1PXC A;  4H4V A;  2E48 A;  5U1O A;  4B64 A;  1KF6 A;  4YJD A;  4J36 A;  3ZNN A;  3SQP A;  3GDP A;  4U2T A;  3AE9 A;  4JNQ A;  3NN0 X;  1Y0P A;  4H4T A;  1E6E A;  3WE0 A;  2XLU A;  4EMI A;  2H89 A;  4GR1 A;  4YJH A;  1PBC A;  3QVR A;  3UOZ A;  3VQR A;  3UKK A;  1EVI A;  4NNJ A;  3ZDN A;  2YAU A;  2IVD A;  3IHG A;  2GV8 A;  2RGH A;  3ADA B;  3CGD A;  1E1M A;  4Z26 A;  3K30 A;  4YJG B;  4OVI A;  1PJ6 A;  1EL9 A;  4OPI A;  4TM4 A;  5GRT A;  3ISH A;  4O5Q A;  1NEN A;  4YSY A;  3UKL A;  4FDC B;  4KX6 A;  2WU5 A;  1CJ2 A;  4UDP A;  2EQ8 A;  4CNK A;  5HYM A;  2WP9 A;  4EM3 A;  2E4G A;  3ZNP A;  1DOE A;  1TDK A;  4Z2T A;  1QJD A;  3QJ4 A;  1PXB A;  3ALJ A;  4IVO B;  2HQM A;  3NG7 X;  4J33 A;  1KFY A;  5EB4 A;  4A6N A;  3AE1 A;  1LV0 A;  2FJA A;  3NLC A;  1F6M A;  5KOX A;  3HYV A;  2R9Z A;  3AE2 A;  1KSS A;  3ICR A;  3T2K A;  2C72 A;  4HB9 A;  2ZZ0 A;  2YLZ A;  4X9M A;  2BAC A;  4K2X A;  3RP7 A;  1GAL A;  1TDN A;  3AE5 A;  1VDC A;  3URH A;  2GRT A;  3W4I A;  4K22 A;  2C67 A;  1C0I A;  4U8P A;  1S3E A;  5KMQ A;  1E7P A;  3AE4 A;  3SYI A;  4BV6 A;  2YLS A;  2YWL A;  4BJZ A;  4C77 A;  1AOG A;  2GMJ A;  2GF3 A;  3S5W A;  2TMD A;  1C0K A;  2QA1 A;  2V60 A;  2WS3 A;  1E39 A;  1FEA A;  2WPC A;  1MXT A;  1JRX A;  4ICY A;  4OPD A;  2X8C A;  5KWF A;  3CIR A;  3LZW A;  4CCQ A;  4B63 A;  1DJN A;  4USQ A;  4XWZ A;  1ONF A;  1GXF A;  2YG3 A;  3ATQ A;  4GCM A;  2BRY A;  4OPT A;  3RP6 A;  2WP6 A;  3HYW A;  1GEU A;  1NAA A;  3AD8 B;  3CNS A;  3EAN A;  4G74 A;  4U8L A;  4Y4M A;  3UKA A;  4LA1 A;  1NHQ A;  2BK4 A;  1ZOY A;  5KXJ A;  3K7M X;  3GWF A;  4AT0 A;  3GMC A;  2YR5 A;  1JRZ A;  2AQJ A;  1KSU A;  2E5V A;  5GSN A;  4YTN A;  2GB0 A;  3T2Z A;  1PDH A;  5KVI A;  1VRQ B;  1H82 A;  2YLX A;  4JN9 A;  3P9U A;  3R9U A;  3CN8 A;  3FPZ A;  4AP3 A;  1ZK7 A;  2E82 A;  4CNJ A;  1JNZ A;  3UKH A;  2BS3 A;  2TPR A;  4AP1 A;  3L8K A;  1N1P A;  3FG2 P;  4CCR A;  5HHF A;  1GRT A;  2WHD A;  1L9C A;  4ZCD A;  1REO A;  2PHH A;  1DNC A;  1GT8 A;  1N4U A;  1TYT A;  5U63 A;  3BHK A;  3DJJ A;  2WPE A;  4B65 A;  1QLB A;  1NHP A;  4XXG A;  3KPF A;  4YKF A;  1NHS A;  4WX1 A;  4H2Q A;  3QFB A;  4J56 A;  3T2Y A;  3UTE A;  3VRA A;  4WCT A;  1IUW A;  1Y56 B;  3ITJ A;  4J34 A;  2Q6U A;  3T37 A;  1YQ3 A;  2VRL A;  5IQ1 A;  4Z44 A;  3UCL A;  2YVG A;  1EBD A;  5CKU A;  3AE6 A;  2YQU A;  4DGK A;  1L0V A;  1GRG A;  2JAE A;  1B8S A;  1KNR A;  2R4E A;  4U2L A;  3I3L A;  1EL8 A;  3BHF A;  2X99 A;  1K0J A;  1CBO A;  1GND A;  1TDE A;  4H4Y A;  3V76 A;  1ZY8 A;  2WES A;  3H8I A;  2XYO A;  4YKG A;  4USR A;  1RSG A;  4G6G A;  2AR8 A;  3NYF A;  2YR4 A;  2CDU A;  2DKI A;  2APG A;  4RSL A;  1CJ4 A;  4AOX A;  1SEZ A;  1S2Y A;  1EL7 A;  2BK5 A;  3EAO A;  4II2 A;  4LU6 A;  3KA7 A;  3HYX A;  4Z24 A;  3VR9 A;  2C7G A;  3SGL A;  4YJF B;  3II4 A;  4GDE A;  5EB5 A;  1K0I A;  3QSS A;  1GES A;  2C65 A;  1LTX R;  3RED A;  3T31 A;  3GD3 A;  1CC2 A;  3QFA A;  5TR3 A;  3LAD A;  1FEB A;  1DOD A;  2JB2 A;  4A7A A;  2PYX A;  2XLT A;  3GRS A;  4YT0 A;  4AOS A;  3RHA A;  1BGN A;  3AE8 A;  4U8M A;  1F3P A;  1PN0 A;  2WDQ A;  2E49 A;  2ZZC A;  3H8L A;  5KOW A;  4NTD A;  1KDG A;  1GRE A;  4H7U A;  3UP5 A;  2XFN A;  1RP0 A;  1XAN A;  3I6D A;  3B3R A;  2BA9 A;  2XFP A;  2V5Z A;  4APN A;  4KPR A;  3K7T A;  4IA5 A;  4GAV A;  5JCL A;  3IF9 A;  3E1T A;  2A87 A;  2BRA A;  2C64 A;  3K7Q X;  3UKF A;  2VQ7 A;  5JCN A;  4YSX A;  2DKH A;  4IV9 A;  4E0V A;  1FL2 A;  1B4V A;  2ZBW A;  4LII A;  1PJ5 A;  3GMB A;  1DJQ A;  2QCU A;  2WEU A;  4CY6 A;  4C3X A;  3KLJ A;  1LJ1 A;  3FBS A;  1E1K A;  2B9X A;  3M0O A;  2C66 A;  4H4U A;  2VVL G;  4J57 A;  1GTE A;  2B7S A;  4Z2R A;  1H6V A;  1K4Q A;  2FJE A;  2YR6 A;  1GTH A;  4GUV A;  1S2Q A;  2R45 A;  4BK3 A;  2YG7 A;  4OCG A;  4ECH A;  3PVC A;  4BK2 A;  2DU8 A;  3PS9 A;  3P4P A;  2CVJ A;  3QSM A;  2B7R A;  3AEE A;  4YWO A;  3F8P A;  4YSH A;  2WU2 A;  4EQS A;  1E1N A;  1GOS A;  4TLZ A;  1JU2 A;  4H4X A;  2XFO A;  5CQF A;  1AN9 A;  1L9E A;  2R0G A;  1CC4 A;  3FIM B;  5DBJ A;  3AXB A;  3UTG A;  3M13 A;  2Q0L A;  3ZNQ A;  2UZZ A;  3G5Q A;  4N9X A;  4UDR A;  3V3N A;  4J2W A;  1MO9 A;  5BUL A;  3NK2 X;  1P2E A;  4YTM A;  3LJP A;  1FEC A;  2C4C A;  3OC4 A;  2BS2 A;  3NK1 X;  3OZ2 A;  5FS6 A;  1GET A;  2BXR A; 
#chains in the Genus database with same CATH homology
 1XHC A;  3T0K A;  1OJC A;  1ZMC A;  1PS9 A;  3AEC A;  3CNJ A;  1EL5 A;  5KRQ A;  4U8J A;  1E1L A;  3KU9 A;  3RNM A;  2C3D A;  3SFD A;  2Q0K A;  4BJY A;  3DK9 A;  4OPC A;  3UOY A;  2VVL A;  1PBF A;  1VG0 A;  3AED A;  3UKP A;  5BVA A;  5IPY A;  5JCI A;  3CPJ G;  4IA6 A;  3DGH A;  5FS7 A;  3UTF A;  3S61 A;  3AEF A;  3QSE A;  1TDF A;  5FS9 A;  3GD4 A;  3CGC A;  1XDI A;  1Y56 A;  1YQ4 A;  4OPL A;  2J3N A;  4U8N A;  1NHR A;  1M64 A;  2C75 A;  1D4D A;  3L1R A;  4K5R A;  5LV9 A;  4H4R A;  4A65 A;  2WPF A;  1GRF A;  4IVM B;  5KVH A;  4J31 A;  4B1B A;  1B37 A;  2BC0 A;  2BYB A;  2WOV A;  3BNU A;  2RGO A;  3NYC A;  2I0Z A;  4CBQ A;  1UKV G;  1COY A;  2EQ6 A;  1D7L A;  4REK A;  1H7W A;  1LPF A;  3CTY A;  2JB1 A;  2Y6Q A;  2BXS A;  1H81 A;  4NZH A;  1QO8 A;  2C70 A;  3DA1 A;  3P4S A;  1ZMD A;  1ZOV A;  5L46 A;  3AE3 A;  3UOV A;  3SY4 A;  4K5S A;  5M10 A;  1BKW A;  2GH5 A;  2R46 A;  3QVP A;  4U2S A;  1CJ3 A;  1FCD A;  3NRN A;  5JCK A;  2R0P A;  4NEV A;  3GYJ A;  5BUK A;  5EBK A;  3AD9 B;  1S3B A;  5KMR A;  4GAP A;  3GDN A;  4YTP A;  1IUT A;  1D7Y A;  3BI5 A;  5HY5 A;  3F8D A;  4BK1 A;  2C73 A;  4G73 A;  1BF3 A;  3SFE A;  2XVE A;  3D1C A;  2XVI A;  3DK4 A;  3CMM A;  1H84 A;  1PJ7 A;  3IC9 A;  4GDP A;  4NTC A;  2WDR A;  1OJ9 A;  3SZF A;  3M12 A;  4A5L A;  4H2R A;  3GWD A;  1IUX A;  4B67 A;  3DJD A;  3SZC A;  1W4X A;  3O0H A;  2WBA A;  4OPU A;  1LQU A;  4NEW A;  3B6D A;  1JEH A;  3CPH G;  2A89 A;  4Y4N A;  2X8G A;  3ICT A;  2XLS A;  4TM0 A;  4ZCC A;  4H2P A;  2NPX A;  3AD7 B;  2ACZ A;  3AEA A;  1TRB A;  4DSH A;  3C4A A;  4EM4 A;  4OPG A;  3VR8 A;  4H4S A;  2X3N A;  3FMW A;  1NEK A;  1OJA A;  4JQ9 A;  4K7Z A;  2YG6 A;  3D8X A;  4ADW A;  1BZL A;  2B76 A;  1D5T A;  1DXL A;  2OLO A;  1PBB A;  3EF6 A;  2JKC A;  3AB1 A;  3P4Q A;  2BC1 A;  2B9W A;  5ER0 A;  2R0C A;  2E1M A;  1ZDL A;  1RYI A;  3GYX A;  4Z25 A;  4TM1 A;  3GYI A;  3KKJ A;  4GF7 A;  1YY5 A;  3AE7 A;  1JRY A;  2GAH B;  1PBD A;  3NYE A;  4FK1 A;  3UKQ A;  3IHM A;  1B5Q A;  4ZN0 A;  2ZZB A;  1N4V A;  3IWA A;  5EOW A;  5FMH A;  3NTD A;  4H4Z A;  3ALM A;  1ZP0 A;  2FBW A;  3HZL A;  3VRD B;  2H88 A;  2YLW A;  3NK0 X;  1TDO A;  2GMH A;  4H4P A;  3ZYX A;  2XDO A;  3BNM A;  4D04 A;  3GRT A;  3GSI A;  3NIX A;  1F8S A;  3LOV A;  1IUV A;  4O5U A;  4EMW A;  2BK3 A;  3AEB A;  2XVJ A;  2A8X A;  2GR1 A;  3ALL A;  2V3B A;  3NN6 X;  5JCM A;  3NNE A;  4EIQ A;  1GRA A;  2QA2 A;  3AEG A;  1GV4 A;  5C3J A;  4TM3 A;  5J7X A;  2AAQ A;  1GSN A;  4C5O A;  5KNL A;  1K0L A;  1DOC A;  2GQW A;  4UDQ A;  2BS4 A;  4H2N A;  3NGC X;  4I59 A;  4B68 A;  1KNP A;  3ABV A;  3DJE A;  1VG9 A;  3EPT A;  2EQ9 A;  2GR0 A;  3SM8 A;  3F8R A;  2WQY A;  2FJB A;  2WOW A;  3DME A;  2ARD A;  2Z5Y A;  1ELI A;  2YM2 A;  2VOU A;  2OA1 A;  3COX A;  3SX6 A;  2R4J A;  1IJH A;  1JOA A;  1IUU A;  3CGE A;  3DGZ A;  4UP3 A;  4A99 A;  1H86 A;  4H4W A;  3SZW A;  3DH9 A;  2YG4 A;  2XFU A;  1V59 A;  3UOX A;  3BI2 A;  5FS8 A;  1M6I A;  1X31 B;  4II3 A;  4Z43 A;  1O5W A;  4NWZ A;  2NVK X;  1Q9I A;  3JSK A;  4U8I A;  3UP4 A;  3VRB A;  4JY2 A;  2V6O A;  1ZX9 A;  4DNA A;  2GVC A;  4G9K A;  3CNT A;  1CC6 A;  2Y6R A;  1L9D A;  3T14 A;  4RG3 A;  3V3O A;  4RG4 A;  1BGJ A;  1DOB A;  2XCG A;  4K8D A;  2VVM A;  1YKJ A;  2JB3 A;  4FX9 A;  3NT6 A;  1MOK A;  1O95 A;  4YXD A;  4NTE A;  4JY3 A;  1CHU A;  4JDR A;  4U8K A;  1CL0 A;  4C74 A;  2CFY A;  4U8O A;  5IQ4 A;  5HXI A;  2BCG G;  2C3C A;  2FJD A;  2YVJ A;  1PHH A;  4A6N B;  2XVF A;  4TLX A;  4B69 A;  4A9W A;  1D4E A;  4FK1 C;  3Q9T A;  5BRT A;  2YVF A;  2OAL A;  1NPX A;  4X4J A;  2VZ2 A;  3LB8 A;  1LQT A;  4Z2U A;  4GRT A;  2WOI A;  1TYP A;  3C96 A;  1N4W A;  2JBV A;  2W0H A;  3AYI A;  3CGB A;  3NHO X;  2O9Z A;  1OJD A;  4H50 A;  4H4Q A;  1CJC A;  4AT2 A;  2YLT A;  3CNP A;  5J60 A;  1D4C A;  3C4N A;  4HA6 A;  2C76 A;  1O94 A;  2X50 A;  4Y4L A;  2IVE A;  3PO7 A;  2XLR A;  3KPK A;  1NG4 A;  1ZKQ A;  2WP5 A;  2GQF A;  4EIP A;  1F8W A;  4YSZ A;  2OAM A;  4EMJ A;  4EQX A;  3RP8 A;  1Q1W A;  3NKS A;  1LVL A;  4MJW A;  2WDV A;  3LZX A;  4PAB A;  3P4R A;  2VRM A;  4CRT A;  2Q7V A;  2RAB A;  4M52 A;  2QAE A;  2X8H A;  4XWR A;  2GR3 A;  2GR2 A;  3SZ0 A;  1BWC A;  2BCP A;  3CND A;  5KMP A;  2YLR A;  3G5R A;  3DK8 A;  2XFQ A;  4DSG A;  1P2H A;  2OLN A;  1HYU A;  4X9N A;  2Z5X A;  2YG5 A;  2YM1 A;  3AYL A;  1F8R A;  4C3Y A;  2XVH A;  5U25 A;  1YQZ A;  2EQ7 A;  1IUS A;  3UTH A;  4EQR A;  3P1W A;  3NH3 X;  1H7X A;  1OJT A;  2B9Y A;  2F5Z A;  2RGJ A;  1GRB A;  3BI4 A;  5KMS A;  1NG3 A;  4G6H A;  4PAA A;  1Q1R A;  2CUL A;  2BAB A;  4D03 A;  3KVE A;  2V3A A;  1NDA A;  3H4K A;  1VQW A;  1JNR A;  2VQB A;  3G5S A;  3AYJ A;  3ICS A;  3NTA A;  1GRH A;  1GPE A;  1XPQ A;  4P9S A;  3KD9 A;  3CPI G;  3DJG X;  1GER A;  2GEW A;  2GAG B;  4CY8 A;  3AWI A;  3SXI A;  5C2T A;  1H83 A;  3Q6J A;  4JNA A;  1CF3 A;  4EQW A;  4B66 A;  4I58 A;  1PBE A;  2WET A;  1FOH A;  4BUR A;  5M0Z A;  3ATR A;  2XLP A;  1PXA A;  4A79 A;  2IID A;  1Z6L A;  2V61 A;  2JK6 A;  3LXD A;  1PXC A;  4H4V A;  5U1O A;  4B64 A;  4EQS A;  1KF6 A;  4J36 A;  3SQP A;  3GDP A;  4U2T A;  3AE9 A;  4JNQ A;  3NN0 X;  1Y0P A;  4H4T A;  1E6E A;  3WE0 A;  2XLU A;  4EMI A;  2H89 A;  4GR1 A;  3QVR A;  1PBC A;  3UOZ A;  3VQR A;  3UKK A;  4NNJ A;  3ZDN A;  2YAU A;  2IVD A;  3IHG A;  2GV8 A;  2RGH A;  3ADA B;  3CGD A;  1E1M A;  4Z26 A;  3K30 A;  4OVI A;  4OPI A;  1PJ6 A;  1EL9 A;  5GRT A;  4TM4 A;  3ISH A;  4O5Q A;  1NEN A;  4YSY A;  3UKL A;  4FDC B;  4KX6 A;  2WU5 A;  1CJ2 A;  4UDP A;  2EQ8 A;  4CNK A;  5HYM A;  2WP9 A;  4EM3 A;  2E4G A;  1DOE A;  1TDK A;  4Z2T A;  1QJD A;  3QJ4 A;  1PXB A;  3ALJ A;  4IVO B;  2HQM A;  3NG7 X;  4J33 A;  1KFY A;  5EB4 A;  4A6N A;  3AE1 A;  1LV0 A;  2FJA A;  3NLC A;  1F6M A;  5KOX A;  3HYV A;  2R9Z A;  3AE2 A;  1KSS A;  3ICR A;  3T2K A;  2C72 A;  4HB9 A;  2ZZ0 A;  2YLZ A;  4K2X A;  2BAC A;  4X9M A;  3RP7 A;  1GAL A;  1TDN A;  3AE5 A;  1VDC A;  3URH A;  2GRT A;  4K22 A;  2C67 A;  5KMQ A;  4U8P A;  1S3E A;  1E7P A;  3AE4 A;  3SYI A;  4BV6 A;  2YLS A;  2YWL A;  4BJZ A;  4C77 A;  1AOG A;  2GMJ A;  2GF3 A;  3S5W A;  2TMD A;  2QA1 A;  2V60 A;  2WS3 A;  1E39 A;  1FEA A;  2WPC A;  1MXT A;  1JRX A;  4ICY A;  4OPD A;  2X8C A;  5KWF A;  3CIR A;  3LZW A;  4CCQ A;  4B63 A;  1DJN A;  4USQ A;  1ONF A;  4XWZ A;  1GXF A;  2YG3 A;  3ATQ A;  4GCM A;  2BRY A;  4OPT A;  3RP6 A;  2WP6 A;  3HYW A;  1GEU A;  1NAA A;  3AD8 B;  3CNS A;  3EAN A;  4G74 A;  4U8L A;  4Y4M A;  3UKA A;  4LA1 A;  1NHQ A;  2BK4 A;  1ZOY A;  5KXJ A;  3K7M X;  3GWF A;  4AT0 A;  3GMC A;  2YR5 A;  1JRZ A;  2AQJ A;  1KSU A;  2E5V A;  5GSN A;  4YTN A;  2GB0 A;  3T2Z A;  1PDH A;  5KVI A;  1H82 A;  1VRQ B;  2YLX A;  4JN9 A;  3P9U A;  3R9U A;  3CN8 A;  3FPZ A;  4AP3 A;  1ZK7 A;  4CNJ A;  1JNZ A;  3UKH A;  2BS3 A;  2TPR A;  4AP1 A;  3L8K A;  1N1P A;  3FG2 P;  4CCR A;  5HHF A;  1GRT A;  2WHD A;  1L9C A;  4ZCD A;  1REO A;  2PHH A;  1DNC A;  1GT8 A;  1N4U A;  1TYT A;  5U63 A;  3BHK A;  3DJJ A;  2WPE A;  4B65 A;  1QLB A;  1NHP A;  4XXG A;  3KPF A;  4YKF A;  1NHS A;  4WX1 A;  4H2Q A;  3QFB A;  4J56 A;  3T2Y A;  3UTE A;  3VRA A;  4WCT A;  1IUW A;  1Y56 B;  3ITJ A;  4J34 A;  2Q6U A;  3T37 A;  1YQ3 A;  2VRL A;  5IQ1 A;  4Z44 A;  3UCL A;  2YVG A;  1EBD A;  5CKU A;  3AE6 A;  2YQU A;  4DGK A;  1L0V A;  1GRG A;  2JAE A;  1B8S A;  1KNR A;  2R4E A;  4U2L A;  3I3L A;  1EL8 A;  3BHF A;  2X99 A;  1K0J A;  1CBO A;  1GND A;  1TDE A;  4H4Y A;  3V76 A;  1ZY8 A;  2WES A;  3H8I A;  2XYO A;  4YKG A;  4USR A;  1RSG A;  4G6G A;  2AR8 A;  3NYF A;  2YR4 A;  2CDU A;  2DKI A;  2APG A;  4RSL A;  1CJ4 A;  4AOX A;  1SEZ A;  1S2Y A;  1EL7 A;  2BK5 A;  3EAO A;  4II2 A;  4LU6 A;  3KA7 A;  3HYX A;  4Z24 A;  3VR9 A;  2C7G A;  3SGL A;  4GDE A;  3II4 A;  3RED A;  5EB5 A;  1GES A;  1K0I A;  3QSS A;  2C65 A;  1LTX R;  3T31 A;  3GD3 A;  1CC2 A;  3QFA A;  5TR3 A;  3LAD A;  1FEB A;  1DOD A;  2JB2 A;  4A7A A;  2PYX A;  2XLT A;  3GRS A;  4YT0 A;  4AOS A;  3RHA A;  1BGN A;  3AE8 A;  4U8M A;  1F3P A;  1PN0 A;  2WDQ A;  2ZZC A;  3H8L A;  5KOW A;  4NTD A;  1KDG A;  1GRE A;  4H7U A;  3UP5 A;  2XFN A;  1RP0 A;  1XAN A;  3I6D A;  3B3R A;  2BA9 A;  2XFP A;  2V5Z A;  4APN A;  4KPR A;  3K7T A;  4IA5 A;  4GAV A;  5JCL A;  2A87 A;  3E1T A;  2BRA A;  2C64 A;  3IF9 A;  3K7Q X;  3UKF A;  2VQ7 A;  5JCN A;  4YSX A;  2DKH A;  4IV9 A;  4E0V A;  1FL2 A;  1B4V A;  2ZBW A;  4LII A;  1PJ5 A;  3GMB A;  1DJQ A;  2QCU A;  2WEU A;  4CY6 A;  4C3X A;  3KLJ A;  1LJ1 A;  3FBS A;  1E1K A;  2B9X A;  3M0O A;  2C66 A;  4H4U A;  2VVL G;  4J57 A;  1GTE A;  2B7S A;  4Z2R A;  1H6V A;  1K4Q A;  2FJE A;  2YR6 A;  1GTH A;  4GUV A;  1S2Q A;  4BK3 A;  2R45 A;  2YG7 A;  4OCG A;  4ECH A;  3PVC A;  4BK2 A;  3P4P A;  3PS9 A;  2CVJ A;  2B7R A;  3AEE A;  3QSM A;  4YWO A;  3F8P A;  2WU2 A;  4YSH A;  1E1N A;  1GOS A;  4TLZ A;  1JU2 A;  4H4X A;  2XFO A;  5CQF A;  1L9E A;  2R0G A;  1CC4 A;  3FIM B;  5DBJ A;  3AXB A;  3UTG A;  2Q0L A;  3M13 A;  2UZZ A;  3G5Q A;  4N9X A;  4UDR A;  3V3N A;  4J2W A;  1MO9 A;  5BUL A;  3NK2 X;  1P2E A;  4YTM A;  3LJP A;  1FEC A;  2C4C A;  3OC4 A;  2BS2 A;  3NK1 X;  3OZ2 A;  5FS6 A;  1GET A;  2BXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...