4H2QA

Structure of mhpco-5hn complex
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-Methyl-3-hydroxypyridiine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 133
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2qA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2qA01
2JB3A 2YLZA 1JU2A 3LZXA 4B63A 4EMWA 1NDAA 2C3CA 1KF6A 1DNCA 3DK9A 3ALJA 2WOVA 3ISHA 3LJPA 4AP1A 3AEDA 3SQPA 2YG5A 2JB1A 3KPFA 3GMCA 1H82A 2WESA 3R9UA 3GDPA 3CNJA 4LA1A 4YSHA 1Z6LA 1O94A 2XVFA 4EMIA 3NYFA 1LQUA 3ITJA 1L0VA 3GDNA 3UCLA 2RGJA 3NKSA 2B7SA 1BZLA 4YTPA 1Y56A 4H4XA 1F8RA 2VQBA 3D1CA 1L9DA 1S3BA 1CC4A 3SFEA 4UDRA 3URHA 4H4QA 2EQ9A 2OA1A 3BI2A 2ZBWA 4I59A 4J34A 2VRLA 3UKFA 4B65A 1DOCA 2XFQA 2W0HA 1GXFA 2XFOA 1IUVA 4EQSA 2V5ZA 1GRAA 3ZYXA 4LU6A 2C3DA 1P2HA 4BK1A 2BK5A 3ADAB 4MJWA 3AE5A 2OAMA 2WU5A 1CJ4A 1D7YA 2BK4A 2XCGA 4IVMB 4X9MA 1H7XA 1S2YA 2YAUA 3K30A 2Q0KA 3GMBA 1Q9IA 2B9XA 4P9SA 2WETA 2V3BA 4A6NB 4B66A 2E5VA 3LOVA 5IPYA 2XVJA 2CDUA 1TDNA 3NIXA 2V60A 3FMWA 1KFYA 1X31B 2C76A 1SEZA 3M0OA 1DODA 3S61A 3RNMA 5JCIA 3UKKA 2TMDA 3GWFA 3NHOX 1COYA 3CPHG 2YQUA 3ATQA 4JNQA 1N4UA 1ZMDA 5FS7A 2V61A 1CF3A 4PABA 1TDOA 1GEUA 4XXGA 3UKPA 4CNKA 1PJ6A 3KKJA 4H2QA 4C3YA 2C65A 1N1PA 4D03A 2A89A 2NVKX 3AEEA 3AE7A 2Y6RA 4H4SA 3SGLA 4YSYA 2YLXA 2YLWA 3QVPA 2YM1A 1GRBA 1EL7A 1CC6A 1GRFA 3AB1A 3EF6A 5GRTA 4J31A 1H7WA 1E1KA 4RG3A 5FMHA 2V6OA 4Z25A 1GRTA 1VRQB 3EPTA 4U8OA 1PXAA 3RHAA 1FCDA 4YXDA 2V3AA 2YG4A 4REKA 2XLTA 3P1WA 4C74A 3AEBA 1GPEA 3PO7A 3UP4A 4Z24A 1RSGA 2E1MA 5U1OA 1ZDLA 4BK2A 4DSGA 1H86A 1Y56B 2CFYA 4CY8A 4YTNA 1PBFA 1TDKA 4KX6A 1E6EA 4H4PA 3AD8B 3ATRA 3UKQA 5HY5A 5BRTA 3CNSA 4H50A 3S5WA 1GT8A 4IA5A 1ZK7A 4JQ9A 4GR1A 2GVCA 2PHHA 2WPFA 3PS9A 3IF9A 2GR0A 1H81A 3NK2X 2JKCA 4ICYA 1GOSA 1FEBA 1D4EA 2DKIA 3UTFA 2X8GA 2A8XA 3V76A 2XVHA 2EQ7A 1CJCA 3E1TA 2X99A 1NAAA 5U63A 2YG7A 2QCUA 1ZMCA 4NTDA 4WX1A 1H84A 5BUKA 5EOWA 4U2LA 3AE2A 4YT0A 4OPIA 3K7TA 1GALA 4NZHA 3VRAA 1LQTA 3RP6A 3AD7B 4FDCB 3UOVA 2H89A 2JK6A 3AEAA 3CNDA 1NG4A 3F8RA 1PBEA 4IVOB 2R0PA 1JEHA 1YQ3A 4J56A 1RYIA 2Z5XA 1DJNA 1Q1RA 4ZCDA 3V3NA 3K7QX 3KD9A 4AP3A 2WP5A 3KLJA 1GSNA 1XPQA 2WDRA 2BS4A 3VRBA 4YSXA 1CJ2A 1KDGA 2HQMA 3VRDB 5JCLA 1REOA 3AEFA 3L1RA 2R0GA 3P4RA 3DJJA 2R4EA 4TM4A 1GETA 2ARDA 4H4RA 3ALMA 2IVEA 5JCNA 5C3JA 1F6MA 4UDPA 2XLPA 2WPEA 3GD4A 4N9XA 2YR5A 1HYUA 2C72A 1NEKA 2YVFA 2H88A 4K22A 4AT2A 4BJYA 4U8LA 4BJZA 2XLRA 1ZY8A 1GTHA 1FECA 2Q6UA 1IJHA 1W4XA 3BNUA 3Q9TA 1JRZA 1H83A 5IQ1A 4OPCA 1MOKA 3CPIG 3AYLA 1TRBA 1MXTA 4UP3A 2VVMA 3NLCA 3O0HA 1CC2A 4H2NA 1ZX9A 4RG4A 2YM2A 3EANA 1VG0A 4C77A 4YSZA 3M12A 4H2RA 1OJCA 3NTAA 4U8JA 5FS8A 2WDQA 4JN9A 4OPTA 4EM4A 3CGBA 2GQFA 1BKWA 1ONFA 2IIDA 4ADWA 2B76A 3RP8A 2WEUA 1E39A 3UKHA 4DSHA 2WDVA 3SFDA 1E1NA 3M13A 4KPRA 2WBAA 4K7ZA 2XYOA 3UKAA 3LXDA 2C70A 3UOZA 4H4TA 3QVRA 3CNPA 2X8CA 5JCKA 5LV9A 1KSUA 2BCPA 4U8PA 1GRHA 3BI4A 5BVAA 1XANA 4HB9A 1M64A 3DJEA 3I6DA 3GYIA 1LVLA 2WOWA 1GESA 4OPLA 4A6NA 1DOEA 1K0IA 3G5SA 3AWIA 1LJ1A 2BC1A 4A5LA 2R4JA 3IC9A 3DH9A 3DK8A 3PVCA 3NTDA 3NGCX 2GAHB 3H8IA 2X3NA 4H4YA 5KVIA 2FJEA 1BF3A 3T37A 3KU9A 2C7GA 1ZKQA 2GMHA 2OLOA 3BHFA 1E7PA 5KVHA 4Z2TA 1MO9A 5GSNA 1NG3A 4USQA 2E4GA 1F8WA 3DJDA 2WOIA 4A65A 2TPRA 5JCMA 3AEGA 1JOAA 3IHMA 2ZZ0A 4EQRA 4DGKA 2GH5A 4NEWA 4Y4LA 5CQFA 2WHDA 1Q1WA 3CGEA 1JNZA 2VRMA 3WE0A 4RSLA 3GWDA 1BGNA 4B64A 1D7LA 3DJGX 3UTEA 1KNPA 1PBCA 1GV4A 3P4PA 4JNAA 3NN0X 5HHFA 3CIRA 4GDEA 4CY6A 1N4VA 3C4NA 4K5SA 4Y4MA 2WP6A 5TR3A 1UKVG 4H7UA 1E1MA 3P4QA 4BURA 3NH3X 3FIMB 5FS9A 4U2SA 1IUXA 2FJBA 2GR2A 4Y4NA 4DNAA 4ECHA 1NHRA 3QSEA 4USRA 1E1LA 4TM1A 1O5WA 4CNJA 4JY3A 2CULA 5BULA 4YKFA 2UZZA 2YLSA 2Y6QA 2XFNA 3GRTA 4XWRA 2XFUA 3BNMA 3NNEA 4OPGA 4TLXA 1TYTA 4A99A 3NRNA 3BHKA 1LV0A 1LPFA 2YR4A 4C3XA 4E0VA 3AD9B 4IA6A 1GREA 2C64A 3G5QA 1OJDA 4H4ZA 2GRTA 2BCGG 3ICTA 3GRSA 2YG3A 3CTYA 3FG2P 1FL2A 2CVJA 3NYEA 3VR9A 3P9UA 2BS3A 2AQJA 5M10A 2C66A 2F5ZA 3CPJG 3FBSA 2AAQA 2VOUA 2Q7VA 2ACZA 1FEAA 2OALA 3UKLA 1DJQA 2R9ZA 3K7MX 3F8DA 2BABA 5IQ4A 2X8HA 2BACA 3GYJA 2WQYA 3QJ4A 3H8LA 1DXLA 4BK3A 3AE1A 3OZ2A 4H2PA 3IHGA 1LTXR 1PJ7A 5CKUA 1YY5A 2Q0LA 1RP0A 1F8SA 2AR8A 4Z43A 4FK1A 1B37A 1TDEA 2R45A 4EQXA 3UP5A 2R0CA 2XVIA 1S3EA 3LB8A 4TM3A 2YWLA 3AYJA 3C4AA 1EL5A 4GRTA 1F3PA 1GTEA 4PAAA 1AOGA 5FS6A 3BI5A 4I58A 1OJTA 4J2WA 2GEWA 4Z44A 1GERA 1JRXA 2GB0A 3QSMA 3QFAA 4GCMA 4WCTA 3CNTA 3SM8A 2YR6A 4TLZA 3H4KA 1K0JA 3AE9A 4M52A 1NHSA 1VQWA 1ZOYA 2BC0A 3HZLA 2OLNA 3AE8A 1CHUA 2WP9A 1TDFA 3AE6A 4CBQA 4JY2A 3AECA 3AXBA 2PYXA 2YVJA 3UTHA 4A7AA 1OJAA 2QAEA 4EQWA 4GF7A 1ZOVA 1EBDA 1KSSA 4J57A 1PBDA 1VDCA 2J3NA 3NN6X 5EB4A 4GDPA 2XLSA 3V3OA 1YKJA 1TYPA 1L9CA 1NENA 4FX9A 5DBJA 5ER0A 4O5QA 4APNA 3L8KA 1ZP0A 2B9WA 2BXSA 3RP7A 4CCRA 4AT0A 1PXBA 4OVIA 4AOXA 5EBKA 1CJ3A 2WU2A 4O5UA 4IV9A 4FK1C 2C73A 2GQWA 3GSIA 4CRTA 4J33A 3II4A 3IWAA 2EQ6A 4YKGA 3CGDA 2JAEA 2R46A 2ZZBA 3KA7A 1M6IA 3AE3A 4OPDA 2GR1A 1PJ5A 1B5QA 3DMEA 1BWCA 1PN0A 2RGOA 4H4UA 1B8SA 3DGHA 1Y0PA 3VR8A 1KNRA 3FPZA 4U8NA 5L46A 4J36A 4B1BA 4B69A 3ABVA 4TM0A 2QA2A 3AE4A 5HXIA 4K5RA 1YQZA 4GUVA 5KOXA 3DGZA 3UOXA 1EL9A 3NK0X 4U8MA 2GV8A 2FJDA 2ZZCA 2XVEA 4NTCA 5KOWA 4OPUA 1JNRA 1QLBA 4AOSA 3B6DA 3P4SA 1V59A 2VVLG 5EB5A 1K0LA 3JSKA 4LIIA 1VG9A 4B68A 4X4JA 1XDIA 2GAGB 2VVLA 1IUWA 1PS9A 1JRYA 2BK3A 2O9ZA 2YG6A 1QJDA 3KVEA 4H4WA 2GR3A 4U8KA 4XWZA 1K4QA 1YQ4A 2APGA 3NT6A 3ALLA 2RGHA 2YVGA 4CCQA 4D04A 3OC4A 1BGJA 3CN8A 3GD3A 5HYMA 1EL8A 1D4CA 2XDOA 3G5RA 3LADA 4YTMA 3LZWA 3ICRA 1D4DA 3F8PA 2FBWA 3QFBA 3C96A 2X50A 3EAOA 1B4VA 1IUUA 2BXRA 3Q6JA 4U8IA 4BV6A 2XLUA 1NHQA 1CL0A 1D5TA 1GRGA 1IUSA 4UDQA 5KRQA 4Z2UA 5KXJA 2BS2A 3VQRA 2VQ7A 4U2TA 1S2QA 1IUTA 2EQ8A 1NPXA 5C2TA 4NTEA 3NG7X 2BA9A 2I0ZA 3UTGA 4K2XA 2C75A 3UOYA 2FJAA 2B9YA 4ZCCA 2DKHA 1NHPA 3D8XA 4NEVA 1PBBA 5M0ZA 3CGCA 1O95A 2GF3A 3NYCA 2JBVA 4Z2RA 1XHCA 5U25A 4JDRA 1QO8A 4A79A 1ELIA 4EMJA 3REDA 4B67A 4EM3A 2GMJA 4EIPA 4Z26A 3NK1X 2YLRA 1N4WA 3AYIA 1CBOA 3ICSA 1FOHA 3ZDNA 1PXCA 3B3RA 2XFPA 5KWFA 4OCGA 1PHHA 2NPXA 1GNDA 1P2EA 3QSSA 2BYBA 4ZN0A 4H4VA 2IVDA 3DA1A 4A9WA 2QA1A 2WPCA 2RABA 3DK4A 2JB2A 1OJ9A 2B7RA 2Z5YA 5J7XA 1DOBA 1PDHA 1H6VA 3I3LA 4X9NA 2A87A 2C67A 2WS3A 2YLTA 5J60A 1L9EA 4K8DA 2VZ2A 4HA6A 4YWOA 4EIQA 3COXA 4C5OA
chains in the Genus database with same CATH superfamily
2JB3A 2YLZA 1JU2A 3LZXA 4G74A 4B63A 4EMWA 1NDAA 2C3CA 1KF6A 1DNCA 3DK9A 3ALJA 2WOVA 3ISHA 3LJPA 4AP1A 3AEDA 3SQPA 2YG5A 2JB1A 4YSHA 3GMCA 1H82A 2WESA 3KPFA 3GDPA 3CNJA 4II3A 4LA1A 3R9UA 1Z6LA 1O94A 2XVFA 4EMIA 3NYFA 1LQUA 3ITJA 1L0VA 3GDNA 3UCLA 2RGJA 3NKSA 2B7SA 1BZLA 3SY4A 4YTPA 1Y56A 3CMMA 1F8RA 4H4XA 2VQBA 3D1CA 1L9DA 1S3BA 1CC4A 3SFEA 2BRAA 4UDRA 3URHA 4H4QA 2EQ9A 2OA1A 3BI2A 2ZBWA 4I59A 4J34A 4G73A 2VRLA 3UKFA 4B65A 1DOCA 2XFQA 2W0HA 1GXFA 2XFOA 1IUVA 4EQSA 2V5ZA 1GRAA 3ZYXA 4LU6A 2C3DA 3T31A 4BK1A 3G3EA 1P2HA 3ADAB 2BK5A 4MJWA 3AE5A 2OAMA 2WU5A 1CJ4A 1D7YA 3SZCA 2BK4A 3HYXA 2XCGA 4IVMB 4X9MA 1H7XA 1S2YA 2YAUA 3K30A 2Q0KA 3GMBA 1Q9IA 2B9XA 4P9SA 2WETA 2V3BA 4A6NB 4B66A 3ZNQA 2E5VA 3LOVA 5IPYA 2XVJA 2CDUA 3SX6A 1TDNA 3NIXA 2V60A 3FMWA 1KFYA 1X31B 2C76A 1SEZA 3M0OA 1DODA 3S61A 3RNMA 5JCIA 3GYXA 3UKKA 2TMDA 3GWFA 3NHOX 1COYA 3CPHG 2YQUA 3ATQA 4JNQA 1N4UA 1ZMDA 3HYWA 5FS7A 2V61A 4PABA 1CF3A 1TDOA 1GEUA 4XXGA 3UKPA 4CNKA 1PJ6A 3KKJA 4H2QA 4C3YA 2C65A 1N1PA 4D03A 2A89A 2NVKX 3AEEA 3AE7A 2Y6RA 4H4SA 3SGLA 4YSYA 2YLXA 2YLWA 3QVPA 2YM1A 1GRBA 1EL7A 1CC6A 1GRFA 3AB1A 3EF6A 5KMRA 5GRTA 4YJHB 4J31A 1H7WA 1E1KA 4RG3A 5FMHA 2V6OA 4Z25A 1EVIA 1GRTA 1VRQB 3EPTA 4U8OA 1PXAA 3CUKA 1FCDA 3RHAA 2V3AA 2YG4A 4REKA 4YXDA 2XLTA 3P1WA 4C74A 3AEBA 1GPEA 3PO7A 3UP4A 4Z24A 1RSGA 2E1MA 4BK2A 1ZDLA 5U1OA 4DSGA 1Y56B 1H86A 2CFYA 4CY8A 4YTNA 1PBFA 1TDKA 4KX6A 1E6EA 4H4PA 3AD8B 3ATRA 3UKQA 5HY5A 5BRTA 3CNSA 4H50A 3S5WA 4IA5A 1GT8A 1ZK7A 4JQ9A 4GR1A 2PHHA 2GVCA 2WPFA 3PS9A 3IF9A 2GR0A 1H81A 3NK2X 2JKCA 4ICYA 1GOSA 1FEBA 1D4EA 2DKIA 3UTFA 2X8GA 2A8XA 3V76A 2XVHA 2EQ7A 1CJCA 3E1TA 2X99A 3ZNNA 1NAAA 5U63A 2YG7A 2QCUA 1ZMCA 4NTDA 4WX1A 1H84A 3SXIA 3T2YA 5BUKA 5EOWA 1VE9A 4U2LA 3T2KA 3AE2A 4YT0A 4OPIA 3K7TA 1GALA 4NZHA 3VRAA 3RP6A 1LQTA 3AD7B 4FDCB 3UOVA 2H89A 2JK6A 3AEAA 3CNDA 1NG4A 3F8RA 1PBEA 4IVOB 2R0PA 1JEHA 1YQ3A 4J56A 1RYIA 2Z5XA 1DJNA 1Q1RA 4ZCDA 3V3NA 3K7QX 3KD9A 4AP3A 2WP5A 3KLJA 1GSNA 1XPQA 2WDRA 2BS4A 3VRBA 4YSXA 1CJ2A 1KDGA 2HQMA 3VRDB 5JCLA 1REOA 3AEFA 3L1RA 2R0GA 3P4RA 3DJJA 2R4EA 4TM4A 1GETA 2ARDA 4H4RA 3ALMA 2IVEA 5JCNA 5C3JA 1F6MA 4UDPA 2XLPA 2WPEA 3GD4A 4N9XA 2YR5A 2E48A 1HYUA 4GAPA 2C72A 1NEKA 2YVFA 4BJYA 4K22A 2H88A 4AT2A 4BJZA 4U8LA 2XLRA 1ZY8A 1GTHA 1FECA 2Q6UA 3T2ZA 1IJHA 1W4XA 3BNUA 3Q9TA 1JRZA 1H83A 5IQ1A 4OPCA 1MOKA 3CPIG 3AYLA 1TRBA 1MXTA 4UP3A 2VVMA 3NLCA 3O0HA 1CC2A 4H2NA 1ZX9A 4RG4A 2YM2A 4G6GA 3EANA 1VG0A 3SZWA 3ZNPA 4C77A 4YSZA 3M12A 4H2RA 1OJCA 3NTAA 4U8JA 5FS8A 3W4KA 2WDQA 4JN9A 4OPTA 4EM4A 3CGBA 2GQFA 1BKWA 4G6HA 1ONFA 2IIDA 4ADWA 2B76A 3RP8A 2WEUA 1C0KA 1E39A 3UKHA 4DSHA 2WDVA 3SFDA 3M13A 1E1NA 4KPRA 2WBAA 4K7ZA 2XYOA 3UKAA 3LXDA 2C70A 3UOZA 4H4TA 3QVRA 3CNPA 2X8CA 5JCKA 5LV9A 1KSUA 2BCPA 4U8PA 1GRHA 3BI4A 5BVAA 1XANA 4HB9A 1M64A 1C0LA 1C0IA 3DJEA 3I6DA 3GYIA 1LVLA 2WOWA 1GESA 4OPLA 4A6NA 1DOEA 1K0IA 3G5SA 3AWIA 1LJ1A 2BC1A 4A5LA 2R4JA 3IC9A 3PVCA 3DH9A 3DK8A 3NTDA 3NGCX 2GAHB 3H8IA 2X3NA 4H4YA 5KVIA 2C4CA 1BF3A 2FJEA 3T37A 3KU9A 2C7GA 2OLOA 2GMHA 3BHFA 1ZKQA 1E7PA 5KVHA 2DU8A 4Z2TA 1MO9A 5GSNA 1NG3A 4USQA 2E4GA 3DJDA 1F8WA 2WOIA 4A65A 2TPRA 5JCMA 3AEGA 4YJDA 1JOAA 3IHMA 2ZZ0A 4EQRA 3WGTA 4DGKA 2GH5A 4NEWA 4Y4LA 5CQFA 2WHDA 1Q1WA 3CGEA 1JNZA 3SYIA 2BRYA 2VRMA 3WE0A 4RSLA 3GWDA 1BGNA 4B64A 4NWZA 1D7LA 4YJHA 3DJGX 3UTEA 1PBCA 1KNPA 1GV4A 3P4PA 4JNAA 3NN0X 5HHFA 3CIRA 4GDEA 4CY6A 1N4VA 3C4NA 4K5SA 4Y4MA 2WP6A 5TR3A 1UKVG 4H7UA 1E1MA 3P4QA 4BURA 3NH3X 3FIMB 5FS9A 4U2SA 1IUXA 2FJBA 2GR2A 4Y4NA 4DNAA 4ECHA 1NHRA 3QSEA 4USRA 1E1LA 4TM1A 1O5WA 4CNJA 4JY3A 2CULA 5BULA 4YKFA 2UZZA 2YLSA 2Y6QA 2XFNA 3GRTA 4XWRA 2XFUA 3BNMA 3NNEA 4OPGA 4TLXA 1TYTA 4A99A 3NRNA 3BHKA 1LV0A 1LPFA 2YR4A 4C3XA 4E0VA 4QFCA 3AD9B 4IA6A 1GREA 2C64A 3SZFA 3G5QA 1OJDA 4H4ZA 2GRTA 2BCGG 3ICTA 3GRSA 2YG3A 3CTYA 3FG2P 3NYEA 1FL2A 2CVJA 3VR9A 3P9UA 2BS3A 2AQJA 5M10A 2C66A 2F5ZA 3CPJG 3FBSA 2AAQA 2VOUA 2Q7VA 2ACZA 3T0KA 1FEAA 2OALA 3UKLA 1DJQA 2R9ZA 3K7MX 3F8DA 2BABA 5IQ4A 2X8HA 2BACA 3GYJA 2WQYA 3QJ4A 3H8LA 1DXLA 4BK3A 4II2A 3AE1A 3OZ2A 3IHGA 1PJ7A 4H2PA 1LTXR 5CKUA 1YY5A 2Q0LA 1RP0A 1F8SA 2AR8A 4Z43A 4FK1A 2E4AA 2R45A 1B37A 1TDEA 4EQXA 3UP5A 2R0CA 2XVIA 1S3EA 3LB8A 4TM3A 2YWLA 3C4AA 3AYJA 1EL5A 4GRTA 1F3PA 4PAAA 1GTEA 1AOGA 5FS6A 3BI5A 4I58A 1OJTA 4J2WA 2GEWA 4Z44A 2GB0A 1GERA 1JRXA 3QSMA 3QFAA 4GCMA 4WCTA 3CNTA 3SM8A 2YR6A 4TLZA 3ZNOA 3H4KA 1K0JA 3AE9A 4M52A 1NHSA 1VQWA 1ZOYA 2BC0A 3HZLA 2OLNA 3AE8A 1CHUA 2WP9A 1TDFA 3AE6A 4CBQA 1DDOA 3AXBA 4JY2A 3AECA 2PYXA 2YVJA 3UTHA 4A7AA 1OJAA 2QAEA 4EQWA 4GF7A 1ZOVA 1EBDA 4NNJA 1KSSA 4J57A 1PBDA 1VDCA 2J3NA 3NN6X 5EB4A 4YJGA 4GDPA 2XLSA 3V3OA 1YKJA 1TYPA 1L9CA 1NENA 4FX9A 5DBJA 5ER0A 4O5QA 4APNA 3L8KA 1ZP0A 2B9WA 2BXSA 3RP7A 4CCRA 4AT0A 1PXBA 4OVIA 4AOXA 5EBKA 1CJ3A 2WU2A 4O5UA 4IV9A 4FK1C 5KMSA 2C73A 2GQWA 3GSIA 4CRTA 4J33A 3II4A 3IWAA 2EQ6A 4YKGA 3CGDA 2JAEA 2R46A 2ZZBA 3KA7A 4YJGB 1M6IA 3AE3A 4OPDA 2GR1A 1PJ5A 3DMEA 1B5QA 3W4IA 1BWCA 4GAVA 1KIFA 1PN0A 2RGOA 4H4UA 1B8SA 3DGHA 1Y0PA 3VR8A 1KNRA 3FPZA 4U8NA 5L46A 4J36A 4B1BA 4B69A 3ABVA 4TM0A 2QA2A 3AE4A 5HXIA 4K5RA 1YQZA 4GUVA 5KOXA 3DGZA 4YJFA 3UOXA 1EL9A 3NK0X 4U8MA 2GV8A 3T14A 2FJDA 2ZZCA 2XVEA 4NTCA 5KOWA 4OPUA 1JNRA 1QLBA 4G9KA 4AOSA 3B6DA 3P4SA 1V59A 2VVLG 5EB5A 1K0LA 3JSKA 4LIIA 1VG9A 4B68A 4X4JA 1XDIA 2GAGB 2VVLA 1IUWA 1PS9A 1JRYA 2BK3A 2O9ZA 2YG6A 4XWZA 1QJDA 3KVEA 2GR3A 4H4WA 4U8KA 1K4QA 1YQ4A 2APGA 3NT6A 2RGHA 3ALLA 2YVGA 5KMQA 4CCQA 4D04A 3OC4A 1BGJA 3CN8A 1AN9A 5HYMA 1EL8A 3GD3A 1D4CA 2XDOA 3G5RA 3LADA 4YTMA 3SZ0A 3LZWA 3ICRA 1D4DA 3F8PA 2FBWA 3QFBA 3C96A 2X50A 3EAOA 1B4VA 1IUUA 2BXRA 3Q6JA 4U8IA 4BV6A 2XLUA 1NHQA 1CL0A 1D5TA 1GRGA 1IUSA 4UDQA 5KRQA 4Z2UA 5KXJA 3VQRA 2BS2A 2VQ7A 4U2TA 1S2QA 1IUTA 2EQ8A 1NPXA 5C2TA 4NTEA 1DAOA 4QFDA 3NG7X 2BA9A 2E82A 2I0ZA 3UTGA 4K2XA 2C75A 3HYVA 3KPKA 3UOYA 2FJAA 2B9YA 4ZCCA 2DKHA 1NHPA 3D8XA 4NEVA 1PBBA 5M0ZA 3CGCA 2GF3A 1O95A 3NYCA 2JBVA 4Z2RA 1XHCA 5U25A 4JDRA 1QO8A 4A79A 1ELIA 4EMJA 3REDA 4B67A 4EM3A 2GMJA 4EIPA 1C0PA 4Z26A 3NK1X 2YLRA 1N4WA 3AYIA 1CBOA 3ICSA 1FOHA 3ZDNA 1PXCA 3B3RA 2E49A 3W4JA 2XFPA 5KWFA 4OCGA 1PHHA 2NPXA 1GNDA 5KNLA 1P2EA 5KMPA 3QSSA 2BYBA 4ZN0A 4H4VA 2IVDA 3DA1A 4A9WA 2QA1A 4YJFB 2RABA 2WPCA 2JB2A 1OJ9A 2B7RA 2Z5YA 3DK4A 5J7XA 1DOBA 1PDHA 4X9NA 1H6VA 3I3LA 2A87A 2C67A 2WS3A 2YLTA 5J60A 1L9EA 4K8DA 2VZ2A 4HA6A 4YWOA 4EIQA 3COXA 4C5OA
chains in the Genus database with same CATH topology
2JB3A 2YLZA 1JU2A 3LZXA 4G74A 4B63A 4EMWA 1NDAA 2C3CA 1KF6A 1DNCA 3DK9A 3ALJA 2WOVA 3ISHA 3LJPA 4AP1A 3AEDA 3SQPA 2YG5A 2JB1A 3KPFA 3GMCA 1H82A 2WESA 3R9UA 3GDPA 3CNJA 4II3A 4LA1A 4YSHA 1Z6LA 1O94A 2XVFA 4EMIA 3NYFA 1LQUA 3ITJA 1L0VA 3GDNA 3UCLA 2RGJA 3NKSA 2B7SA 1BZLA 3SY4A 4YTPA 1Y56A 3CMMA 1F8RA 4H4XA 2VQBA 3D1CA 1L9DA 1S3BA 1CC4A 3SFEA 2BRAA 4UDRA 3URHA 4H4QA 2EQ9A 2OA1A 3BI2A 2ZBWA 4I59A 4J34A 4G73A 2VRLA 3UKFA 4B65A 1DOCA 2XFQA 2W0HA 1GXFA 2XFOA 1IUVA 4EQSA 2V5ZA 1GRAA 3ZYXA 4LU6A 2C3DA 3T31A 4BK1A 1P2HA 2BK5A 3ADAB 4MJWA 3AE5A 2OAMA 2WU5A 1CJ4A 1D7YA 3SZCA 2BK4A 3HYXA 2XCGA 4IVMB 4X9MA 1H7XA 1S2YA 2YAUA 3K30A 2Q0KA 3GMBA 1Q9IA 2B9XA 4P9SA 2WETA 2V3BA 4A6NB 4B66A 2E5VA 3LOVA 5IPYA 2XVJA 2CDUA 3SX6A 1TDNA 3NIXA 2V60A 3FMWA 1KFYA 1X31B 2C76A 1SEZA 3M0OA 1DODA 3S61A 3RNMA 5JCIA 3GYXA 3UKKA 2TMDA 3GWFA 3NHOX 1COYA 3CPHG 2YQUA 3ATQA 4JNQA 1N4UA 1ZMDA 3HYWA 5FS7A 2V61A 1CF3A 4PABA 1TDOA 1GEUA 4XXGA 3UKPA 4CNKA 1PJ6A 3KKJA 4H2QA 4C3YA 2C65A 1N1PA 4D03A 2A89A 2NVKX 3AEEA 3AE7A 2Y6RA 4H4SA 3SGLA 4YSYA 2YLXA 2YLWA 3QVPA 2YM1A 1GRBA 1EL7A 1CC6A 1GRFA 3AB1A 3EF6A 5KMRA 5GRTA 4J31A 1H7WA 1E1KA 4RG3A 5FMHA 2V6OA 4Z25A 1GRTA 1VRQB 3EPTA 4U8OA 1PXAA 3RHAA 1FCDA 4YXDA 2V3AA 2YG4A 4REKA 2XLTA 3P1WA 4C74A 3AEBA 1GPEA 3PO7A 3UP4A 4Z24A 1RSGA 2E1MA 4BK2A 1ZDLA 5U1OA 4DSGA 1H86A 1Y56B 2CFYA 4CY8A 4YTNA 1PBFA 1TDKA 4KX6A 1E6EA 4H4PA 3AD8B 3ATRA 3UKQA 5HY5A 5BRTA 3CNSA 4H50A 3S5WA 4IA5A 1GT8A 1ZK7A 4JQ9A 4GR1A 2GVCA 2PHHA 2WPFA 3PS9A 3IF9A 2GR0A 1H81A 3NK2X 2JKCA 4ICYA 1GOSA 1FEBA 1D4EA 2DKIA 3UTFA 2X8GA 2A8XA 3V76A 2XVHA 2EQ7A 1CJCA 3E1TA 2X99A 1NAAA 5U63A 2YG7A 2QCUA 1ZMCA 4NTDA 4WX1A 1H84A 3SXIA 3T2YA 5BUKA 5EOWA 4U2LA 3T2KA 3AE2A 4YT0A 4OPIA 3K7TA 1GALA 4NZHA 3VRAA 3RP6A 1LQTA 3AD7B 4FDCB 3UOVA 2H89A 2JK6A 3AEAA 3CNDA 1NG4A 3F8RA 1PBEA 4IVOB 2R0PA 1JEHA 1YQ3A 4J56A 1RYIA 2Z5XA 1DJNA 1Q1RA 4ZCDA 3V3NA 3K7QX 3KD9A 4AP3A 2WP5A 3KLJA 1GSNA 1XPQA 2WDRA 2BS4A 3VRBA 4YSXA 1CJ2A 1KDGA 2HQMA 3VRDB 5JCLA 1REOA 3AEFA 3L1RA 2R0GA 3P4RA 3DJJA 2R4EA 4TM4A 1GETA 2ARDA 4H4RA 3ALMA 2IVEA 5JCNA 5C3JA 1F6MA 4UDPA 2XLPA 2WPEA 3GD4A 4N9XA 2YR5A 1HYUA 4GAPA 2C72A 1NEKA 2YVFA 4BJYA 4K22A 2H88A 4AT2A 4BJZA 4U8LA 2XLRA 1ZY8A 1GTHA 1FECA 2Q6UA 3T2ZA 1IJHA 1W4XA 3BNUA 3Q9TA 1JRZA 1H83A 5IQ1A 4OPCA 1MOKA 3CPIG 3AYLA 1TRBA 1MXTA 4UP3A 2VVMA 3NLCA 3O0HA 1CC2A 4H2NA 1ZX9A 4RG4A 2YM2A 4G6GA 3EANA 1VG0A 3SZWA 4C77A 4YSZA 3M12A 4H2RA 1OJCA 3NTAA 4U8JA 5FS8A 2WDQA 4JN9A 4OPTA 4EM4A 3CGBA 2GQFA 1BKWA 4G6HA 1ONFA 2IIDA 4ADWA 2B76A 3RP8A 2WEUA 1E39A 3UKHA 4DSHA 2WDVA 3SFDA 1E1NA 3M13A 4KPRA 2WBAA 4K7ZA 2XYOA 3UKAA 3LXDA 2C70A 3UOZA 4H4TA 3QVRA 3CNPA 2X8CA 5JCKA 5LV9A 1KSUA 2BCPA 4U8PA 1GRHA 3BI4A 5BVAA 1XANA 4HB9A 1M64A 3DJEA 3I6DA 3GYIA 1LVLA 2WOWA 1GESA 4OPLA 4A6NA 1DOEA 1K0IA 3G5SA 3AWIA 1LJ1A 2BC1A 4A5LA 2R4JA 3IC9A 3DH9A 3DK8A 3PVCA 3NTDA 3NGCX 2GAHB 3H8IA 2X3NA 4H4YA 5KVIA 2C4CA 1BF3A 2FJEA 3T37A 3KU9A 2C7GA 1ZKQA 2GMHA 2OLOA 3BHFA 1E7PA 5KVHA 4Z2TA 1MO9A 5GSNA 1NG3A 4USQA 2E4GA 1F8WA 3DJDA 2WOIA 4A65A 2TPRA 5JCMA 3AEGA 1JOAA 3IHMA 2ZZ0A 4EQRA 4DGKA 2GH5A 4NEWA 4Y4LA 5CQFA 2WHDA 1Q1WA 3CGEA 1JNZA 3SYIA 2BRYA 2VRMA 3WE0A 4RSLA 3GWDA 1BGNA 4B64A 4NWZA 1D7LA 3DJGX 3UTEA 1KNPA 1PBCA 1GV4A 3P4PA 4JNAA 3NN0X 5HHFA 3CIRA 4GDEA 4CY6A 1N4VA 3C4NA 4K5SA 4Y4MA 2WP6A 5TR3A 1UKVG 4H7UA 1E1MA 3P4QA 4BURA 3NH3X 3FIMB 5FS9A 4U2SA 1IUXA 2FJBA 2GR2A 4Y4NA 4DNAA 4ECHA 1NHRA 3QSEA 4USRA 1E1LA 4TM1A 1O5WA 4CNJA 4JY3A 2CULA 5BULA 4YKFA 2UZZA 2YLSA 2Y6QA 2XFNA 3GRTA 4XWRA 2XFUA 3BNMA 3NNEA 4OPGA 4TLXA 1TYTA 4A99A 3NRNA 3BHKA 1LV0A 1LPFA 2YR4A 4C3XA 4E0VA 4IA6A 3AD9B 1GREA 2C64A 3SZFA 3G5QA 1OJDA 4H4ZA 2GRTA 2BCGG 3ICTA 3GRSA 2YG3A 3CTYA 3FG2P 1FL2A 2CVJA 3NYEA 3VR9A 3P9UA 2BS3A 2AQJA 5M10A 2C66A 2F5ZA 3CPJG 3FBSA 2AAQA 2VOUA 2Q7VA 2ACZA 3T0KA 1FEAA 2OALA 3UKLA 1DJQA 2R9ZA 3K7MX 3F8DA 2BABA 5IQ4A 2X8HA 2BACA 3GYJA 2WQYA 3QJ4A 3H8LA 1DXLA 4BK3A 4II2A 3AE1A 3OZ2A 3IHGA 4H2PA 1LTXR 1PJ7A 5CKUA 1YY5A 2Q0LA 1RP0A 1F8SA 2AR8A 4Z43A 4FK1A 1B37A 1TDEA 2R45A 4EQXA 3UP5A 2R0CA 2XVIA 1S3EA 3LB8A 4TM3A 2YWLA 3C4AA 3AYJA 1EL5A 4GRTA 1F3PA 1GTEA 4PAAA 1AOGA 5FS6A 3BI5A 4I58A 1OJTA 4J2WA 2GEWA 4Z44A 1GERA 1JRXA 2GB0A 3QSMA 3QFAA 4GCMA 4WCTA 3CNTA 3SM8A 2YR6A 4TLZA 3H4KA 1K0JA 3AE9A 4M52A 1NHSA 1VQWA 1ZOYA 2BC0A 3HZLA 2OLNA 3AE8A 1CHUA 2WP9A 1TDFA 3AE6A 4CBQA 4JY2A 3AECA 3AXBA 2PYXA 2YVJA 3UTHA 4A7AA 1OJAA 2QAEA 4EQWA 4GF7A 1ZOVA 1EBDA 4NNJA 1KSSA 4J57A 1PBDA 1VDCA 2J3NA 3NN6X 5EB4A 4GDPA 2XLSA 3V3OA 1YKJA 1TYPA 1L9CA 1NENA 4FX9A 5DBJA 5ER0A 4O5QA 4APNA 3L8KA 1ZP0A 2B9WA 2BXSA 3RP7A 4CCRA 4AT0A 1PXBA 4OVIA 4AOXA 5EBKA 1CJ3A 2WU2A 4O5UA 4IV9A 4FK1C 5KMSA 2C73A 2GQWA 3GSIA 4CRTA 4J33A 3II4A 3IWAA 2EQ6A 4YKGA 3CGDA 2JAEA 2R46A 2ZZBA 3KA7A 1M6IA 3AE3A 4OPDA 2GR1A 1PJ5A 1B5QA 3DMEA 1BWCA 4GAVA 1PN0A 2RGOA 4H4UA 1B8SA 3DGHA 1Y0PA 3VR8A 1KNRA 3FPZA 4U8NA 5L46A 4J36A 4B1BA 4B69A 3ABVA 4TM0A 2QA2A 3AE4A 5HXIA 4K5RA 1YQZA 4GUVA 5KOXA 3DGZA 3UOXA 1EL9A 3NK0X 4U8MA 2GV8A 3T14A 2FJDA 2ZZCA 2XVEA 4NTCA 5KOWA 4OPUA 1JNRA 1QLBA 4G9KA 4AOSA 3B6DA 3P4SA 1V59A 2VVLG 5EB5A 1K0LA 3JSKA 4LIIA 1VG9A 4B68A 4X4JA 1XDIA 2GAGB 2VVLA 1IUWA 1PS9A 1JRYA 2BK3A 2O9ZA 2YG6A 1QJDA 3KVEA 4H4WA 2GR3A 4U8KA 4XWZA 1K4QA 1YQ4A 2APGA 3NT6A 3ALLA 2RGHA 2YVGA 5KMQA 4CCQA 4D04A 3OC4A 1BGJA 3CN8A 5HYMA 3GD3A 1EL8A 1D4CA 2XDOA 3G5RA 3LADA 4YTMA 3SZ0A 3LZWA 3ICRA 1D4DA 3F8PA 2FBWA 3QFBA 3C96A 2X50A 3EAOA 1B4VA 1IUUA 2BXRA 3Q6JA 4U8IA 4BV6A 2XLUA 1NHQA 1CL0A 1D5TA 1GRGA 1IUSA 4UDQA 5KRQA 4Z2UA 5KXJA 2BS2A 3VQRA 2VQ7A 4U2TA 1S2QA 1IUTA 2EQ8A 1NPXA 5C2TA 4NTEA 3NG7X 2BA9A 2I0ZA 3UTGA 4K2XA 2C75A 3HYVA 3KPKA 3UOYA 2FJAA 2B9YA 4ZCCA 2DKHA 1NHPA 3D8XA 4NEVA 1PBBA 5M0ZA 3CGCA 1O95A 2GF3A 3NYCA 2JBVA 4Z2RA 1XHCA 5U25A 4JDRA 1QO8A 4A79A 1ELIA 4EMJA 3REDA 4B67A 4EM3A 2GMJA 4EIPA 4Z26A 3NK1X 2YLRA 1N4WA 3AYIA 1CBOA 3ICSA 1FOHA 3ZDNA 1PXCA 3B3RA 2XFPA 5KWFA 4OCGA 1PHHA 2NPXA 1GNDA 5KNLA 1P2EA 5KMPA 3QSSA 2BYBA 4ZN0A 4H4VA 2IVDA 3DA1A 4A9WA 2QA1A 2WPCA 2RABA 3DK4A 2JB2A 1OJ9A 2B7RA 2Z5YA 5J7XA 1DOBA 1PDHA 1H6VA 3I3LA 4X9NA 2A87A 2C67A 2WS3A 2YLTA 5J60A 1L9EA 4K8DA 2VZ2A 4HA6A 4YWOA 4EIQA 3COXA 4C5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JB3 A;  2YLZ A;  1JU2 A;  3LZX A;  4B63 A;  4EMW A;  1NDA A;  2C3C A;  1KF6 A;  1DNC A;  3DK9 A;  3ALJ A;  2WOV A;  3ISH A;  3LJP A;  4AP1 A;  3AED A;  3SQP A;  2YG5 A;  2JB1 A;  3KPF A;  3GMC A;  1H82 A;  2WES A;  3R9U A;  3GDP A;  3CNJ A;  4LA1 A;  4YSH A;  1Z6L A;  1O94 A;  2XVF A;  4EMI A;  3NYF A;  1LQU A;  3ITJ A;  1L0V A;  3GDN A;  3UCL A;  2RGJ A;  3NKS A;  2B7S A;  1BZL A;  4YTP A;  1Y56 A;  4H4X A;  1F8R A;  2VQB A;  3D1C A;  1L9D A;  1S3B A;  1CC4 A;  3SFE A;  4UDR A;  3URH A;  4H4Q A;  2EQ9 A;  2OA1 A;  3BI2 A;  2ZBW A;  4I59 A;  4J34 A;  2VRL A;  3UKF A;  4B65 A;  1DOC A;  2XFQ A;  2W0H A;  1GXF A;  2XFO A;  1IUV A;  4EQS A;  2V5Z A;  1GRA A;  3ZYX A;  4LU6 A;  2C3D A;  1P2H A;  4BK1 A;  2BK5 A;  3ADA B;  4MJW A;  3AE5 A;  2OAM A;  2WU5 A;  1CJ4 A;  1D7Y A;  2BK4 A;  2XCG A;  4IVM B;  4X9M A;  1H7X A;  1S2Y A;  2YAU A;  3K30 A;  2Q0K A;  3GMB A;  1Q9I A;  2B9X A;  4P9S A;  2WET A;  2V3B A;  4A6N B;  4B66 A;  2E5V A;  3LOV A;  5IPY A;  2XVJ A;  2CDU A;  1TDN A;  3NIX A;  2V60 A;  3FMW A;  1KFY A;  1X31 B;  2C76 A;  1SEZ A;  3M0O A;  1DOD A;  3S61 A;  3RNM A;  5JCI A;  3UKK A;  2TMD A;  3GWF A;  3NHO X;  1COY A;  3CPH G;  2YQU A;  3ATQ A;  4JNQ A;  1N4U A;  1ZMD A;  5FS7 A;  2V61 A;  1CF3 A;  4PAB A;  1TDO A;  1GEU A;  4XXG A;  3UKP A;  4CNK A;  1PJ6 A;  3KKJ A;  4H2Q A;  4C3Y A;  2C65 A;  1N1P A;  4D03 A;  2A89 A;  2NVK X;  3AEE A;  3AE7 A;  2Y6R A;  4H4S A;  3SGL A;  4YSY A;  2YLX A;  2YLW A;  3QVP A;  2YM1 A;  1GRB A;  1EL7 A;  1CC6 A;  1GRF A;  3AB1 A;  3EF6 A;  5GRT A;  4J31 A;  1H7W A;  1E1K A;  4RG3 A;  5FMH A;  2V6O A;  4Z25 A;  1GRT A;  1VRQ B;  3EPT A;  4U8O A;  1PXA A;  3RHA A;  1FCD A;  4YXD A;  2V3A A;  2YG4 A;  4REK A;  2XLT A;  3P1W A;  4C74 A;  3AEB A;  1GPE A;  3PO7 A;  3UP4 A;  4Z24 A;  1RSG A;  2E1M A;  5U1O A;  1ZDL A;  4BK2 A;  4DSG A;  1H86 A;  1Y56 B;  2CFY A;  4CY8 A;  4YTN A;  1PBF A;  1TDK A;  4KX6 A;  1E6E A;  4H4P A;  3AD8 B;  3ATR A;  3UKQ A;  5HY5 A;  5BRT A;  3CNS A;  4H50 A;  3S5W A;  1GT8 A;  4IA5 A;  1ZK7 A;  4JQ9 A;  4GR1 A;  2GVC A;  2PHH A;  2WPF A;  3PS9 A;  3IF9 A;  2GR0 A;  1H81 A;  3NK2 X;  2JKC A;  4ICY A;  1GOS A;  1FEB A;  1D4E A;  2DKI A;  3UTF A;  2X8G A;  2A8X A;  3V76 A;  2XVH A;  2EQ7 A;  1CJC A;  3E1T A;  2X99 A;  1NAA A;  5U63 A;  2YG7 A;  2QCU A;  1ZMC A;  4NTD A;  4WX1 A;  1H84 A;  5BUK A;  5EOW A;  4U2L A;  3AE2 A;  4YT0 A;  4OPI A;  3K7T A;  1GAL A;  4NZH A;  3VRA A;  1LQT A;  3RP6 A;  3AD7 B;  4FDC B;  3UOV A;  2H89 A;  2JK6 A;  3AEA A;  3CND A;  1NG4 A;  3F8R A;  1PBE A;  4IVO B;  2R0P A;  1JEH A;  1YQ3 A;  4J56 A;  1RYI A;  2Z5X A;  1DJN A;  1Q1R A;  4ZCD A;  3V3N A;  3K7Q X;  3KD9 A;  4AP3 A;  2WP5 A;  3KLJ A;  1GSN A;  1XPQ A;  2WDR A;  2BS4 A;  3VRB A;  4YSX A;  1CJ2 A;  1KDG A;  2HQM A;  3VRD B;  5JCL A;  1REO A;  3AEF A;  3L1R A;  2R0G A;  3P4R A;  3DJJ A;  2R4E A;  4TM4 A;  1GET A;  2ARD A;  4H4R A;  3ALM A;  2IVE A;  5JCN A;  5C3J A;  1F6M A;  4UDP A;  2XLP A;  2WPE A;  3GD4 A;  4N9X A;  2YR5 A;  1HYU A;  2C72 A;  1NEK A;  2YVF A;  2H88 A;  4K22 A;  4AT2 A;  4BJY A;  4U8L A;  4BJZ A;  2XLR A;  1ZY8 A;  1GTH A;  1FEC A;  2Q6U A;  1IJH A;  1W4X A;  3BNU A;  3Q9T A;  1JRZ A;  1H83 A;  5IQ1 A;  4OPC A;  1MOK A;  3CPI G;  3AYL A;  1TRB A;  1MXT A;  4UP3 A;  2VVM A;  3NLC A;  3O0H A;  1CC2 A;  4H2N A;  1ZX9 A;  4RG4 A;  2YM2 A;  3EAN A;  1VG0 A;  4C77 A;  4YSZ A;  3M12 A;  4H2R A;  1OJC A;  3NTA A;  4U8J A;  5FS8 A;  2WDQ A;  4JN9 A;  4OPT A;  4EM4 A;  3CGB A;  2GQF A;  1BKW A;  1ONF A;  2IID A;  4ADW A;  2B76 A;  3RP8 A;  2WEU A;  1E39 A;  3UKH A;  4DSH A;  2WDV A;  3SFD A;  1E1N A;  3M13 A;  4KPR A;  2WBA A;  4K7Z A;  2XYO A;  3UKA A;  3LXD A;  2C70 A;  3UOZ A;  4H4T A;  3QVR A;  3CNP A;  2X8C A;  5JCK A;  5LV9 A;  1KSU A;  2BCP A;  4U8P A;  1GRH A;  3BI4 A;  5BVA A;  1XAN A;  4HB9 A;  1M64 A;  3DJE A;  3I6D A;  3GYI A;  1LVL A;  2WOW A;  1GES A;  4OPL A;  4A6N A;  1DOE A;  1K0I A;  3G5S A;  3AWI A;  1LJ1 A;  2BC1 A;  4A5L A;  2R4J A;  3IC9 A;  3DH9 A;  3DK8 A;  3PVC A;  3NTD A;  3NGC X;  2GAH B;  3H8I A;  2X3N A;  4H4Y A;  5KVI A;  2FJE A;  1BF3 A;  3T37 A;  3KU9 A;  2C7G A;  1ZKQ A;  2GMH A;  2OLO A;  3BHF A;  1E7P A;  5KVH A;  4Z2T A;  1MO9 A;  5GSN A;  1NG3 A;  4USQ A;  2E4G A;  1F8W A;  3DJD A;  2WOI A;  4A65 A;  2TPR A;  5JCM A;  3AEG A;  1JOA A;  3IHM A;  2ZZ0 A;  4EQR A;  4DGK A;  2GH5 A;  4NEW A;  4Y4L A;  5CQF A;  2WHD A;  1Q1W A;  3CGE A;  1JNZ A;  2VRM A;  3WE0 A;  4RSL A;  3GWD A;  1BGN A;  4B64 A;  1D7L A;  3DJG X;  3UTE A;  1KNP A;  1PBC A;  1GV4 A;  3P4P A;  4JNA A;  3NN0 X;  5HHF A;  3CIR A;  4GDE A;  4CY6 A;  1N4V A;  3C4N A;  4K5S A;  4Y4M A;  2WP6 A;  5TR3 A;  1UKV G;  4H7U A;  1E1M A;  3P4Q A;  4BUR A;  3NH3 X;  3FIM B;  5FS9 A;  4U2S A;  1IUX A;  2FJB A;  2GR2 A;  4Y4N A;  4DNA A;  4ECH A;  1NHR A;  3QSE A;  4USR A;  1E1L A;  4TM1 A;  1O5W A;  4CNJ A;  4JY3 A;  2CUL A;  5BUL A;  4YKF A;  2UZZ A;  2YLS A;  2Y6Q A;  2XFN A;  3GRT A;  4XWR A;  2XFU A;  3BNM A;  3NNE A;  4OPG A;  4TLX A;  1TYT A;  4A99 A;  3NRN A;  3BHK A;  1LV0 A;  1LPF A;  2YR4 A;  4C3X A;  4E0V A;  3AD9 B;  4IA6 A;  1GRE A;  2C64 A;  3G5Q A;  1OJD A;  4H4Z A;  2GRT A;  2BCG G;  3ICT A;  3GRS A;  2YG3 A;  3CTY A;  3FG2 P;  1FL2 A;  2CVJ A;  3NYE A;  3VR9 A;  3P9U A;  2BS3 A;  2AQJ A;  5M10 A;  2C66 A;  2F5Z A;  3CPJ G;  3FBS A;  2AAQ A;  2VOU A;  2Q7V A;  2ACZ A;  1FEA A;  2OAL A;  3UKL A;  1DJQ A;  2R9Z A;  3K7M X;  3F8D A;  2BAB A;  5IQ4 A;  2X8H A;  2BAC A;  3GYJ A;  2WQY A;  3QJ4 A;  3H8L A;  1DXL A;  4BK3 A;  3AE1 A;  3OZ2 A;  4H2P A;  3IHG A;  1LTX R;  1PJ7 A;  5CKU A;  1YY5 A;  2Q0L A;  1RP0 A;  1F8S A;  2AR8 A;  4Z43 A;  4FK1 A;  1B37 A;  1TDE A;  2R45 A;  4EQX A;  3UP5 A;  2R0C A;  2XVI A;  1S3E A;  3LB8 A;  4TM3 A;  2YWL A;  3AYJ A;  3C4A A;  1EL5 A;  4GRT A;  1F3P A;  1GTE A;  4PAA A;  1AOG A;  5FS6 A;  3BI5 A;  4I58 A;  1OJT A;  4J2W A;  2GEW A;  4Z44 A;  1GER A;  1JRX A;  2GB0 A;  3QSM A;  3QFA A;  4GCM A;  4WCT A;  3CNT A;  3SM8 A;  2YR6 A;  4TLZ A;  3H4K A;  1K0J A;  3AE9 A;  4M52 A;  1NHS A;  1VQW A;  1ZOY A;  2BC0 A;  3HZL A;  2OLN A;  3AE8 A;  1CHU A;  2WP9 A;  1TDF A;  3AE6 A;  4CBQ A;  4JY2 A;  3AEC A;  3AXB A;  2PYX A;  2YVJ A;  3UTH A;  4A7A A;  1OJA A;  2QAE A;  4EQW A;  4GF7 A;  1ZOV A;  1EBD A;  1KSS A;  4J57 A;  1PBD A;  1VDC A;  2J3N A;  3NN6 X;  5EB4 A;  4GDP A;  2XLS A;  3V3O A;  1YKJ A;  1TYP A;  1L9C A;  1NEN A;  4FX9 A;  5DBJ A;  5ER0 A;  4O5Q A;  4APN A;  3L8K A;  1ZP0 A;  2B9W A;  2BXS A;  3RP7 A;  4CCR A;  4AT0 A;  1PXB A;  4OVI A;  4AOX A;  5EBK A;  1CJ3 A;  2WU2 A;  4O5U A;  4IV9 A;  4FK1 C;  2C73 A;  2GQW A;  3GSI A;  4CRT A;  4J33 A;  3II4 A;  3IWA A;  2EQ6 A;  4YKG A;  3CGD A;  2JAE A;  2R46 A;  2ZZB A;  3KA7 A;  1M6I A;  3AE3 A;  4OPD A;  2GR1 A;  1PJ5 A;  1B5Q A;  3DME A;  1BWC A;  1PN0 A;  2RGO A;  4H4U A;  1B8S A;  3DGH A;  1Y0P A;  3VR8 A;  1KNR A;  3FPZ A;  4U8N A;  5L46 A;  4J36 A;  4B1B A;  4B69 A;  3ABV A;  4TM0 A;  2QA2 A;  3AE4 A;  5HXI A;  4K5R A;  1YQZ A;  4GUV A;  5KOX A;  3DGZ A;  3UOX A;  1EL9 A;  3NK0 X;  4U8M A;  2GV8 A;  2FJD A;  2ZZC A;  2XVE A;  4NTC A;  5KOW A;  4OPU A;  1JNR A;  1QLB A;  4AOS A;  3B6D A;  3P4S A;  1V59 A;  2VVL G;  5EB5 A;  1K0L A;  3JSK A;  4LII A;  1VG9 A;  4B68 A;  4X4J A;  1XDI A;  2GAG B;  2VVL A;  1IUW A;  1PS9 A;  1JRY A;  2BK3 A;  2O9Z A;  2YG6 A;  1QJD A;  3KVE A;  4H4W A;  2GR3 A;  4U8K A;  4XWZ A;  1K4Q A;  1YQ4 A;  2APG A;  3NT6 A;  3ALL A;  2RGH A;  2YVG A;  4CCQ A;  4D04 A;  3OC4 A;  1BGJ A;  3CN8 A;  3GD3 A;  5HYM A;  1EL8 A;  1D4C A;  2XDO A;  3G5R A;  3LAD A;  4YTM A;  3LZW A;  3ICR A;  1D4D A;  3F8P A;  2FBW A;  3QFB A;  3C96 A;  2X50 A;  3EAO A;  1B4V A;  1IUU A;  2BXR A;  3Q6J A;  4U8I A;  4BV6 A;  2XLU A;  1NHQ A;  1CL0 A;  1D5T A;  1GRG A;  1IUS A;  4UDQ A;  5KRQ A;  4Z2U A;  5KXJ A;  2BS2 A;  3VQR A;  2VQ7 A;  4U2T A;  1S2Q A;  1IUT A;  2EQ8 A;  1NPX A;  5C2T A;  4NTE A;  3NG7 X;  2BA9 A;  2I0Z A;  3UTG A;  4K2X A;  2C75 A;  3UOY A;  2FJA A;  2B9Y A;  4ZCC A;  2DKH A;  1NHP A;  3D8X A;  4NEV A;  1PBB A;  5M0Z A;  3CGC A;  1O95 A;  2GF3 A;  3NYC A;  2JBV A;  4Z2R A;  1XHC A;  5U25 A;  4JDR A;  1QO8 A;  4A79 A;  1ELI A;  4EMJ A;  3RED A;  4B67 A;  4EM3 A;  2GMJ A;  4EIP A;  4Z26 A;  3NK1 X;  2YLR A;  1N4W A;  3AYI A;  1CBO A;  3ICS A;  1FOH A;  3ZDN A;  1PXC A;  3B3R A;  2XFP A;  5KWF A;  4OCG A;  1PHH A;  2NPX A;  1GND A;  1P2E A;  3QSS A;  2BYB A;  4ZN0 A;  4H4V A;  2IVD A;  3DA1 A;  4A9W A;  2QA1 A;  2WPC A;  2RAB A;  3DK4 A;  2JB2 A;  1OJ9 A;  2B7R A;  2Z5Y A;  5J7X A;  1DOB A;  1PDH A;  1H6V A;  3I3L A;  4X9N A;  2A87 A;  2C67 A;  2WS3 A;  2YLT A;  5J60 A;  1L9E A;  4K8D A;  2VZ2 A;  4HA6 A;  4YWO A;  4EIQ A;  3COX A;  4C5O A; 
#chains in the Genus database with same CATH topology
 2JB3 A;  2YLZ A;  1JU2 A;  3LZX A;  4G74 A;  4B63 A;  4EMW A;  1NDA A;  2C3C A;  1KF6 A;  1DNC A;  3DK9 A;  3ALJ A;  2WOV A;  3ISH A;  3LJP A;  4AP1 A;  3AED A;  3SQP A;  2YG5 A;  2JB1 A;  4YSH A;  3GMC A;  1H82 A;  2WES A;  3KPF A;  3GDP A;  3CNJ A;  4II3 A;  4LA1 A;  3R9U A;  1Z6L A;  1O94 A;  2XVF A;  4EMI A;  3NYF A;  1LQU A;  3ITJ A;  1L0V A;  3GDN A;  3UCL A;  2RGJ A;  3NKS A;  2B7S A;  1BZL A;  3SY4 A;  4YTP A;  1Y56 A;  3CMM A;  1F8R A;  4H4X A;  2VQB A;  3D1C A;  1L9D A;  1S3B A;  1CC4 A;  3SFE A;  2BRA A;  4UDR A;  3URH A;  4H4Q A;  2EQ9 A;  2OA1 A;  3BI2 A;  2ZBW A;  4I59 A;  4J34 A;  4G73 A;  2VRL A;  3UKF A;  4B65 A;  1DOC A;  2XFQ A;  2W0H A;  1GXF A;  2XFO A;  1IUV A;  4EQS A;  2V5Z A;  1GRA A;  3ZYX A;  4LU6 A;  2C3D A;  3T31 A;  4BK1 A;  3G3E A;  1P2H A;  3ADA B;  2BK5 A;  4MJW A;  3AE5 A;  2OAM A;  2WU5 A;  1CJ4 A;  1D7Y A;  3SZC A;  2BK4 A;  3HYX A;  2XCG A;  4IVM B;  4X9M A;  1H7X A;  1S2Y A;  2YAU A;  3K30 A;  2Q0K A;  3GMB A;  1Q9I A;  2B9X A;  4P9S A;  2WET A;  2V3B A;  4A6N B;  4B66 A;  3ZNQ A;  2E5V A;  3LOV A;  5IPY A;  2XVJ A;  2CDU A;  3SX6 A;  1TDN A;  3NIX A;  2V60 A;  3FMW A;  1KFY A;  1X31 B;  2C76 A;  1SEZ A;  3M0O A;  1DOD A;  3S61 A;  3RNM A;  5JCI A;  3GYX A;  3UKK A;  2TMD A;  3GWF A;  3NHO X;  1COY A;  3CPH G;  2YQU A;  3ATQ A;  4JNQ A;  1N4U A;  1ZMD A;  3HYW A;  5FS7 A;  2V61 A;  4PAB A;  1CF3 A;  1TDO A;  1GEU A;  4XXG A;  3UKP A;  4CNK A;  1PJ6 A;  3KKJ A;  4H2Q A;  4C3Y A;  2C65 A;  1N1P A;  4D03 A;  2A89 A;  2NVK X;  3AEE A;  3AE7 A;  2Y6R A;  4H4S A;  3SGL A;  4YSY A;  2YLX A;  2YLW A;  3QVP A;  2YM1 A;  1GRB A;  1EL7 A;  1CC6 A;  1GRF A;  3AB1 A;  3EF6 A;  5KMR A;  5GRT A;  4YJH B;  4J31 A;  1H7W A;  1E1K A;  4RG3 A;  5FMH A;  2V6O A;  4Z25 A;  1EVI A;  1GRT A;  1VRQ B;  3EPT A;  4U8O A;  1PXA A;  3CUK A;  1FCD A;  3RHA A;  2V3A A;  2YG4 A;  4REK A;  4YXD A;  2XLT A;  3P1W A;  4C74 A;  3AEB A;  1GPE A;  3PO7 A;  3UP4 A;  4Z24 A;  1RSG A;  2E1M A;  4BK2 A;  1ZDL A;  5U1O A;  4DSG A;  1Y56 B;  1H86 A;  2CFY A;  4CY8 A;  4YTN A;  1PBF A;  1TDK A;  4KX6 A;  1E6E A;  4H4P A;  3AD8 B;  3ATR A;  3UKQ A;  5HY5 A;  5BRT A;  3CNS A;  4H50 A;  3S5W A;  4IA5 A;  1GT8 A;  1ZK7 A;  4JQ9 A;  4GR1 A;  2PHH A;  2GVC A;  2WPF A;  3PS9 A;  3IF9 A;  2GR0 A;  1H81 A;  3NK2 X;  2JKC A;  4ICY A;  1GOS A;  1FEB A;  1D4E A;  2DKI A;  3UTF A;  2X8G A;  2A8X A;  3V76 A;  2XVH A;  2EQ7 A;  1CJC A;  3E1T A;  2X99 A;  3ZNN A;  1NAA A;  5U63 A;  2YG7 A;  2QCU A;  1ZMC A;  4NTD A;  4WX1 A;  1H84 A;  3SXI A;  3T2Y A;  5BUK A;  5EOW A;  1VE9 A;  4U2L A;  3T2K A;  3AE2 A;  4YT0 A;  4OPI A;  3K7T A;  1GAL A;  4NZH A;  3VRA A;  3RP6 A;  1LQT A;  3AD7 B;  4FDC B;  3UOV A;  2H89 A;  2JK6 A;  3AEA A;  3CND A;  1NG4 A;  3F8R A;  1PBE A;  4IVO B;  2R0P A;  1JEH A;  1YQ3 A;  4J56 A;  1RYI A;  2Z5X A;  1DJN A;  1Q1R A;  4ZCD A;  3V3N A;  3K7Q X;  3KD9 A;  4AP3 A;  2WP5 A;  3KLJ A;  1GSN A;  1XPQ A;  2WDR A;  2BS4 A;  3VRB A;  4YSX A;  1CJ2 A;  1KDG A;  2HQM A;  3VRD B;  5JCL A;  1REO A;  3AEF A;  3L1R A;  2R0G A;  3P4R A;  3DJJ A;  2R4E A;  4TM4 A;  1GET A;  2ARD A;  4H4R A;  3ALM A;  2IVE A;  5JCN A;  5C3J A;  1F6M A;  4UDP A;  2XLP A;  2WPE A;  3GD4 A;  4N9X A;  2YR5 A;  2E48 A;  1HYU A;  4GAP A;  2C72 A;  1NEK A;  2YVF A;  4BJY A;  4K22 A;  2H88 A;  4AT2 A;  4BJZ A;  4U8L A;  2XLR A;  1ZY8 A;  1GTH A;  1FEC A;  2Q6U A;  3T2Z A;  1IJH A;  1W4X A;  3BNU A;  3Q9T A;  1JRZ A;  1H83 A;  5IQ1 A;  4OPC A;  1MOK A;  3CPI G;  3AYL A;  1TRB A;  1MXT A;  4UP3 A;  2VVM A;  3NLC A;  3O0H A;  1CC2 A;  4H2N A;  1ZX9 A;  4RG4 A;  2YM2 A;  4G6G A;  3EAN A;  1VG0 A;  3SZW A;  3ZNP A;  4C77 A;  4YSZ A;  3M12 A;  4H2R A;  1OJC A;  3NTA A;  4U8J A;  5FS8 A;  3W4K A;  2WDQ A;  4JN9 A;  4OPT A;  4EM4 A;  3CGB A;  2GQF A;  1BKW A;  4G6H A;  1ONF A;  2IID A;  4ADW A;  2B76 A;  3RP8 A;  2WEU A;  1C0K A;  1E39 A;  3UKH A;  4DSH A;  2WDV A;  3SFD A;  3M13 A;  1E1N A;  4KPR A;  2WBA A;  4K7Z A;  2XYO A;  3UKA A;  3LXD A;  2C70 A;  3UOZ A;  4H4T A;  3QVR A;  3CNP A;  2X8C A;  5JCK A;  5LV9 A;  1KSU A;  2BCP A;  4U8P A;  1GRH A;  3BI4 A;  5BVA A;  1XAN A;  4HB9 A;  1M64 A;  1C0L A;  1C0I A;  3DJE A;  3I6D A;  3GYI A;  1LVL A;  2WOW A;  1GES A;  4OPL A;  4A6N A;  1DOE A;  1K0I A;  3G5S A;  3AWI A;  1LJ1 A;  2BC1 A;  4A5L A;  2R4J A;  3IC9 A;  3PVC A;  3DH9 A;  3DK8 A;  3NTD A;  3NGC X;  2GAH B;  3H8I A;  2X3N A;  4H4Y A;  5KVI A;  2C4C A;  1BF3 A;  2FJE A;  3T37 A;  3KU9 A;  2C7G A;  2OLO A;  2GMH A;  3BHF A;  1ZKQ A;  1E7P A;  5KVH A;  2DU8 A;  4Z2T A;  1MO9 A;  5GSN A;  1NG3 A;  4USQ A;  2E4G A;  3DJD A;  1F8W A;  2WOI A;  4A65 A;  2TPR A;  5JCM A;  3AEG A;  4YJD A;  1JOA A;  3IHM A;  2ZZ0 A;  4EQR A;  3WGT A;  4DGK A;  2GH5 A;  4NEW A;  4Y4L A;  5CQF A;  2WHD A;  1Q1W A;  3CGE A;  1JNZ A;  3SYI A;  2BRY A;  2VRM A;  3WE0 A;  4RSL A;  3GWD A;  1BGN A;  4B64 A;  4NWZ A;  1D7L A;  4YJH A;  3DJG X;  3UTE A;  1PBC A;  1KNP A;  1GV4 A;  3P4P A;  4JNA A;  3NN0 X;  5HHF A;  3CIR A;  4GDE A;  4CY6 A;  1N4V A;  3C4N A;  4K5S A;  4Y4M A;  2WP6 A;  5TR3 A;  1UKV G;  4H7U A;  1E1M A;  3P4Q A;  4BUR A;  3NH3 X;  3FIM B;  5FS9 A;  4U2S A;  1IUX A;  2FJB A;  2GR2 A;  4Y4N A;  4DNA A;  4ECH A;  1NHR A;  3QSE A;  4USR A;  1E1L A;  4TM1 A;  1O5W A;  4CNJ A;  4JY3 A;  2CUL A;  5BUL A;  4YKF A;  2UZZ A;  2YLS A;  2Y6Q A;  2XFN A;  3GRT A;  4XWR A;  2XFU A;  3BNM A;  3NNE A;  4OPG A;  4TLX A;  1TYT A;  4A99 A;  3NRN A;  3BHK A;  1LV0 A;  1LPF A;  2YR4 A;  4C3X A;  4E0V A;  4QFC A;  3AD9 B;  4IA6 A;  1GRE A;  2C64 A;  3SZF A;  3G5Q A;  1OJD A;  4H4Z A;  2GRT A;  2BCG G;  3ICT A;  3GRS A;  2YG3 A;  3CTY A;  3FG2 P;  3NYE A;  1FL2 A;  2CVJ A;  3VR9 A;  3P9U A;  2BS3 A;  2AQJ A;  5M10 A;  2C66 A;  2F5Z A;  3CPJ G;  3FBS A;  2AAQ A;  2VOU A;  2Q7V A;  2ACZ A;  3T0K A;  1FEA A;  2OAL A;  3UKL A;  1DJQ A;  2R9Z A;  3K7M X;  3F8D A;  2BAB A;  5IQ4 A;  2X8H A;  2BAC A;  3GYJ A;  2WQY A;  3QJ4 A;  3H8L A;  1DXL A;  4BK3 A;  4II2 A;  3AE1 A;  3OZ2 A;  3IHG A;  1PJ7 A;  4H2P A;  1LTX R;  5CKU A;  1YY5 A;  2Q0L A;  1RP0 A;  1F8S A;  2AR8 A;  4Z43 A;  4FK1 A;  2E4A A;  2R45 A;  1B37 A;  1TDE A;  4EQX A;  3UP5 A;  2R0C A;  2XVI A;  1S3E A;  3LB8 A;  4TM3 A;  2YWL A;  3C4A A;  3AYJ A;  1EL5 A;  4GRT A;  1F3P A;  4PAA A;  1GTE A;  1AOG A;  5FS6 A;  3BI5 A;  4I58 A;  1OJT A;  4J2W A;  2GEW A;  4Z44 A;  2GB0 A;  1GER A;  1JRX A;  3QSM A;  3QFA A;  4GCM A;  4WCT A;  3CNT A;  3SM8 A;  2YR6 A;  4TLZ A;  3ZNO A;  3H4K A;  1K0J A;  3AE9 A;  4M52 A;  1NHS A;  1VQW A;  1ZOY A;  2BC0 A;  3HZL A;  2OLN A;  3AE8 A;  1CHU A;  2WP9 A;  1TDF A;  3AE6 A;  4CBQ A;  1DDO A;  3AXB A;  4JY2 A;  3AEC A;  2PYX A;  2YVJ A;  3UTH A;  4A7A A;  1OJA A;  2QAE A;  4EQW A;  4GF7 A;  1ZOV A;  1EBD A;  4NNJ A;  1KSS A;  4J57 A;  1PBD A;  1VDC A;  2J3N A;  3NN6 X;  5EB4 A;  4YJG A;  4GDP A;  2XLS A;  3V3O A;  1YKJ A;  1TYP A;  1L9C A;  1NEN A;  4FX9 A;  5DBJ A;  5ER0 A;  4O5Q A;  4APN A;  3L8K A;  1ZP0 A;  2B9W A;  2BXS A;  3RP7 A;  4CCR A;  4AT0 A;  1PXB A;  4OVI A;  4AOX A;  5EBK A;  1CJ3 A;  2WU2 A;  4O5U A;  4IV9 A;  4FK1 C;  5KMS A;  2C73 A;  2GQW A;  3GSI A;  4CRT A;  4J33 A;  3II4 A;  3IWA A;  2EQ6 A;  4YKG A;  3CGD A;  2JAE A;  2R46 A;  2ZZB A;  3KA7 A;  4YJG B;  1M6I A;  3AE3 A;  4OPD A;  2GR1 A;  1PJ5 A;  3DME A;  1B5Q A;  3W4I A;  1BWC A;  4GAV A;  1KIF A;  1PN0 A;  2RGO A;  4H4U A;  1B8S A;  3DGH A;  1Y0P A;  3VR8 A;  1KNR A;  3FPZ A;  4U8N A;  5L46 A;  4J36 A;  4B1B A;  4B69 A;  3ABV A;  4TM0 A;  2QA2 A;  3AE4 A;  5HXI A;  4K5R A;  1YQZ A;  4GUV A;  5KOX A;  3DGZ A;  4YJF A;  3UOX A;  1EL9 A;  3NK0 X;  4U8M A;  2GV8 A;  3T14 A;  2FJD A;  2ZZC A;  2XVE A;  4NTC A;  5KOW A;  4OPU A;  1JNR A;  1QLB A;  4G9K A;  4AOS A;  3B6D A;  3P4S A;  1V59 A;  2VVL G;  5EB5 A;  1K0L A;  3JSK A;  4LII A;  1VG9 A;  4B68 A;  4X4J A;  1XDI A;  2GAG B;  2VVL A;  1IUW A;  1PS9 A;  1JRY A;  2BK3 A;  2O9Z A;  2YG6 A;  4XWZ A;  1QJD A;  3KVE A;  2GR3 A;  4H4W A;  4U8K A;  1K4Q A;  1YQ4 A;  2APG A;  3NT6 A;  2RGH A;  3ALL A;  2YVG A;  5KMQ A;  4CCQ A;  4D04 A;  3OC4 A;  1BGJ A;  3CN8 A;  1AN9 A;  5HYM A;  1EL8 A;  3GD3 A;  1D4C A;  2XDO A;  3G5R A;  3LAD A;  4YTM A;  3SZ0 A;  3LZW A;  3ICR A;  1D4D A;  3F8P A;  2FBW A;  3QFB A;  3C96 A;  2X50 A;  3EAO A;  1B4V A;  1IUU A;  2BXR A;  3Q6J A;  4U8I A;  4BV6 A;  2XLU A;  1NHQ A;  1CL0 A;  1D5T A;  1GRG A;  1IUS A;  4UDQ A;  5KRQ A;  4Z2U A;  5KXJ A;  3VQR A;  2BS2 A;  2VQ7 A;  4U2T A;  1S2Q A;  1IUT A;  2EQ8 A;  1NPX A;  5C2T A;  4NTE A;  1DAO A;  4QFD A;  3NG7 X;  2BA9 A;  2E82 A;  2I0Z A;  3UTG A;  4K2X A;  2C75 A;  3HYV A;  3KPK A;  3UOY A;  2FJA A;  2B9Y A;  4ZCC A;  2DKH A;  1NHP A;  3D8X A;  4NEV A;  1PBB A;  5M0Z A;  3CGC A;  2GF3 A;  1O95 A;  3NYC A;  2JBV A;  4Z2R A;  1XHC A;  5U25 A;  4JDR A;  1QO8 A;  4A79 A;  1ELI A;  4EMJ A;  3RED A;  4B67 A;  4EM3 A;  2GMJ A;  4EIP A;  1C0P A;  4Z26 A;  3NK1 X;  2YLR A;  1N4W A;  3AYI A;  1CBO A;  3ICS A;  1FOH A;  3ZDN A;  1PXC A;  3B3R A;  2E49 A;  3W4J A;  2XFP A;  5KWF A;  4OCG A;  1PHH A;  2NPX A;  1GND A;  5KNL A;  1P2E A;  5KMP A;  3QSS A;  2BYB A;  4ZN0 A;  4H4V A;  2IVD A;  3DA1 A;  4A9W A;  2QA1 A;  4YJF B;  2RAB A;  2WPC A;  2JB2 A;  1OJ9 A;  2B7R A;  2Z5Y A;  3DK4 A;  5J7X A;  1DOB A;  1PDH A;  4X9N A;  1H6V A;  3I3L A;  2A87 A;  2C67 A;  2WS3 A;  2YLT A;  5J60 A;  1L9E A;  4K8D A;  2VZ2 A;  4HA6 A;  4YWO A;  4EIQ A;  3COX A;  4C5O A; 
#chains in the Genus database with same CATH homology
 2JB3 A;  2YLZ A;  1JU2 A;  3LZX A;  4G74 A;  4B63 A;  4EMW A;  1NDA A;  2C3C A;  1KF6 A;  1DNC A;  3DK9 A;  3ALJ A;  2WOV A;  3ISH A;  3LJP A;  4AP1 A;  3AED A;  3SQP A;  2YG5 A;  2JB1 A;  3KPF A;  3GMC A;  1H82 A;  2WES A;  3R9U A;  3GDP A;  3CNJ A;  4II3 A;  4LA1 A;  4YSH A;  1Z6L A;  1O94 A;  2XVF A;  4EMI A;  3NYF A;  1LQU A;  3ITJ A;  1L0V A;  3GDN A;  3UCL A;  2RGJ A;  3NKS A;  2B7S A;  1BZL A;  3SY4 A;  4YTP A;  1Y56 A;  3CMM A;  1F8R A;  4H4X A;  2VQB A;  3D1C A;  1L9D A;  1S3B A;  1CC4 A;  3SFE A;  2BRA A;  4UDR A;  3URH A;  4H4Q A;  2EQ9 A;  2OA1 A;  3BI2 A;  2ZBW A;  4I59 A;  4J34 A;  4G73 A;  2VRL A;  3UKF A;  4B65 A;  1DOC A;  2XFQ A;  2W0H A;  1GXF A;  2XFO A;  1IUV A;  4EQS A;  2V5Z A;  1GRA A;  3ZYX A;  4LU6 A;  2C3D A;  3T31 A;  4BK1 A;  1P2H A;  2BK5 A;  3ADA B;  4MJW A;  3AE5 A;  2OAM A;  2WU5 A;  1CJ4 A;  1D7Y A;  3SZC A;  2BK4 A;  3HYX A;  2XCG A;  4IVM B;  4X9M A;  1H7X A;  1S2Y A;  2YAU A;  3K30 A;  2Q0K A;  3GMB A;  1Q9I A;  2B9X A;  4P9S A;  2WET A;  2V3B A;  4A6N B;  4B66 A;  2E5V A;  3LOV A;  5IPY A;  2XVJ A;  2CDU A;  3SX6 A;  1TDN A;  3NIX A;  2V60 A;  3FMW A;  1KFY A;  1X31 B;  2C76 A;  1SEZ A;  3M0O A;  1DOD A;  3S61 A;  3RNM A;  5JCI A;  3GYX A;  3UKK A;  2TMD A;  3GWF A;  3NHO X;  1COY A;  3CPH G;  2YQU A;  3ATQ A;  4JNQ A;  1N4U A;  1ZMD A;  3HYW A;  5FS7 A;  2V61 A;  1CF3 A;  4PAB A;  1TDO A;  1GEU A;  4XXG A;  3UKP A;  4CNK A;  1PJ6 A;  3KKJ A;  4H2Q A;  4C3Y A;  2C65 A;  1N1P A;  4D03 A;  2A89 A;  2NVK X;  3AEE A;  3AE7 A;  2Y6R A;  4H4S A;  3SGL A;  4YSY A;  2YLX A;  2YLW A;  3QVP A;  2YM1 A;  1GRB A;  1EL7 A;  1CC6 A;  1GRF A;  3AB1 A;  3EF6 A;  5KMR A;  5GRT A;  4J31 A;  1H7W A;  1E1K A;  4RG3 A;  5FMH A;  2V6O A;  4Z25 A;  1GRT A;  1VRQ B;  3EPT A;  4U8O A;  1PXA A;  3RHA A;  1FCD A;  4YXD A;  2V3A A;  2YG4 A;  4REK A;  2XLT A;  3P1W A;  4C74 A;  3AEB A;  1GPE A;  3PO7 A;  3UP4 A;  4Z24 A;  1RSG A;  2E1M A;  4BK2 A;  1ZDL A;  5U1O A;  4DSG A;  1H86 A;  1Y56 B;  2CFY A;  4CY8 A;  4YTN A;  1PBF A;  1TDK A;  4KX6 A;  1E6E A;  4H4P A;  3AD8 B;  3ATR A;  3UKQ A;  5HY5 A;  5BRT A;  3CNS A;  4H50 A;  3S5W A;  4IA5 A;  1GT8 A;  1ZK7 A;  4JQ9 A;  4GR1 A;  2GVC A;  2PHH A;  2WPF A;  3PS9 A;  3IF9 A;  2GR0 A;  1H81 A;  3NK2 X;  2JKC A;  4ICY A;  1GOS A;  1FEB A;  1D4E A;  2DKI A;  3UTF A;  2X8G A;  2A8X A;  3V76 A;  2XVH A;  2EQ7 A;  1CJC A;  3E1T A;  2X99 A;  1NAA A;  5U63 A;  2YG7 A;  2QCU A;  1ZMC A;  4NTD A;  4WX1 A;  1H84 A;  3SXI A;  3T2Y A;  5BUK A;  5EOW A;  4U2L A;  3T2K A;  3AE2 A;  4YT0 A;  4OPI A;  3K7T A;  1GAL A;  4NZH A;  3VRA A;  3RP6 A;  1LQT A;  3AD7 B;  4FDC B;  3UOV A;  2H89 A;  2JK6 A;  3AEA A;  3CND A;  1NG4 A;  3F8R A;  1PBE A;  4IVO B;  2R0P A;  1JEH A;  1YQ3 A;  4J56 A;  1RYI A;  2Z5X A;  1DJN A;  1Q1R A;  4ZCD A;  3V3N A;  3K7Q X;  3KD9 A;  4AP3 A;  2WP5 A;  3KLJ A;  1GSN A;  1XPQ A;  2WDR A;  2BS4 A;  3VRB A;  4YSX A;  1CJ2 A;  1KDG A;  2HQM A;  3VRD B;  5JCL A;  1REO A;  3AEF A;  3L1R A;  2R0G A;  3P4R A;  3DJJ A;  2R4E A;  4TM4 A;  1GET A;  2ARD A;  4H4R A;  3ALM A;  2IVE A;  5JCN A;  5C3J A;  1F6M A;  4UDP A;  2XLP A;  2WPE A;  3GD4 A;  4N9X A;  2YR5 A;  1HYU A;  4GAP A;  2C72 A;  1NEK A;  2YVF A;  4BJY A;  4K22 A;  2H88 A;  4AT2 A;  4BJZ A;  4U8L A;  2XLR A;  1ZY8 A;  1GTH A;  1FEC A;  2Q6U A;  3T2Z A;  1IJH A;  1W4X A;  3BNU A;  3Q9T A;  1JRZ A;  1H83 A;  5IQ1 A;  4OPC A;  1MOK A;  3CPI G;  3AYL A;  1TRB A;  1MXT A;  4UP3 A;  2VVM A;  3NLC A;  3O0H A;  1CC2 A;  4H2N A;  1ZX9 A;  4RG4 A;  2YM2 A;  4G6G A;  3EAN A;  1VG0 A;  3SZW A;  4C77 A;  4YSZ A;  3M12 A;  4H2R A;  1OJC A;  3NTA A;  4U8J A;  5FS8 A;  2WDQ A;  4JN9 A;  4OPT A;  4EM4 A;  3CGB A;  2GQF A;  1BKW A;  4G6H A;  1ONF A;  2IID A;  4ADW A;  2B76 A;  3RP8 A;  2WEU A;  1E39 A;  3UKH A;  4DSH A;  2WDV A;  3SFD A;  1E1N A;  3M13 A;  4KPR A;  2WBA A;  4K7Z A;  2XYO A;  3UKA A;  3LXD A;  2C70 A;  3UOZ A;  4H4T A;  3QVR A;  3CNP A;  2X8C A;  5JCK A;  5LV9 A;  1KSU A;  2BCP A;  4U8P A;  1GRH A;  3BI4 A;  5BVA A;  1XAN A;  4HB9 A;  1M64 A;  3DJE A;  3I6D A;  3GYI A;  1LVL A;  2WOW A;  1GES A;  4OPL A;  4A6N A;  1DOE A;  1K0I A;  3G5S A;  3AWI A;  1LJ1 A;  2BC1 A;  4A5L A;  2R4J A;  3IC9 A;  3DH9 A;  3DK8 A;  3PVC A;  3NTD A;  3NGC X;  2GAH B;  3H8I A;  2X3N A;  4H4Y A;  5KVI A;  2C4C A;  1BF3 A;  2FJE A;  3T37 A;  3KU9 A;  2C7G A;  1ZKQ A;  2GMH A;  2OLO A;  3BHF A;  1E7P A;  5KVH A;  4Z2T A;  1MO9 A;  5GSN A;  1NG3 A;  4USQ A;  2E4G A;  1F8W A;  3DJD A;  2WOI A;  4A65 A;  2TPR A;  5JCM A;  3AEG A;  1JOA A;  3IHM A;  2ZZ0 A;  4EQR A;  4DGK A;  2GH5 A;  4NEW A;  4Y4L A;  5CQF A;  2WHD A;  1Q1W A;  3CGE A;  1JNZ A;  3SYI A;  2BRY A;  2VRM A;  3WE0 A;  4RSL A;  3GWD A;  1BGN A;  4B64 A;  4NWZ A;  1D7L A;  3DJG X;  3UTE A;  1KNP A;  1PBC A;  1GV4 A;  3P4P A;  4JNA A;  3NN0 X;  5HHF A;  3CIR A;  4GDE A;  4CY6 A;  1N4V A;  3C4N A;  4K5S A;  4Y4M A;  2WP6 A;  5TR3 A;  1UKV G;  4H7U A;  1E1M A;  3P4Q A;  4BUR A;  3NH3 X;  3FIM B;  5FS9 A;  4U2S A;  1IUX A;  2FJB A;  2GR2 A;  4Y4N A;  4DNA A;  4ECH A;  1NHR A;  3QSE A;  4USR A;  1E1L A;  4TM1 A;  1O5W A;  4CNJ A;  4JY3 A;  2CUL A;  5BUL A;  4YKF A;  2UZZ A;  2YLS A;  2Y6Q A;  2XFN A;  3GRT A;  4XWR A;  2XFU A;  3BNM A;  3NNE A;  4OPG A;  4TLX A;  1TYT A;  4A99 A;  3NRN A;  3BHK A;  1LV0 A;  1LPF A;  2YR4 A;  4C3X A;  4E0V A;  4IA6 A;  3AD9 B;  1GRE A;  2C64 A;  3SZF A;  3G5Q A;  1OJD A;  4H4Z A;  2GRT A;  2BCG G;  3ICT A;  3GRS A;  2YG3 A;  3CTY A;  3FG2 P;  1FL2 A;  2CVJ A;  3NYE A;  3VR9 A;  3P9U A;  2BS3 A;  2AQJ A;  5M10 A;  2C66 A;  2F5Z A;  3CPJ G;  3FBS A;  2AAQ A;  2VOU A;  2Q7V A;  2ACZ A;  3T0K A;  1FEA A;  2OAL A;  3UKL A;  1DJQ A;  2R9Z A;  3K7M X;  3F8D A;  2BAB A;  5IQ4 A;  2X8H A;  2BAC A;  3GYJ A;  2WQY A;  3QJ4 A;  3H8L A;  1DXL A;  4BK3 A;  4II2 A;  3AE1 A;  3OZ2 A;  3IHG A;  4H2P A;  1LTX R;  1PJ7 A;  5CKU A;  1YY5 A;  2Q0L A;  1RP0 A;  1F8S A;  2AR8 A;  4Z43 A;  4FK1 A;  1B37 A;  1TDE A;  2R45 A;  4EQX A;  3UP5 A;  2R0C A;  2XVI A;  1S3E A;  3LB8 A;  4TM3 A;  2YWL A;  3C4A A;  3AYJ A;  1EL5 A;  4GRT A;  1F3P A;  1GTE A;  4PAA A;  1AOG A;  5FS6 A;  3BI5 A;  4I58 A;  1OJT A;  4J2W A;  2GEW A;  4Z44 A;  1GER A;  1JRX A;  2GB0 A;  3QSM A;  3QFA A;  4GCM A;  4WCT A;  3CNT A;  3SM8 A;  2YR6 A;  4TLZ A;  3H4K A;  1K0J A;  3AE9 A;  4M52 A;  1NHS A;  1VQW A;  1ZOY A;  2BC0 A;  3HZL A;  2OLN A;  3AE8 A;  1CHU A;  2WP9 A;  1TDF A;  3AE6 A;  4CBQ A;  4JY2 A;  3AEC A;  3AXB A;  2PYX A;  2YVJ A;  3UTH A;  4A7A A;  1OJA A;  2QAE A;  4EQW A;  4GF7 A;  1ZOV A;  1EBD A;  4NNJ A;  1KSS A;  4J57 A;  1PBD A;  1VDC A;  2J3N A;  3NN6 X;  5EB4 A;  4GDP A;  2XLS A;  3V3O A;  1YKJ A;  1TYP A;  1L9C A;  1NEN A;  4FX9 A;  5DBJ A;  5ER0 A;  4O5Q A;  4APN A;  3L8K A;  1ZP0 A;  2B9W A;  2BXS A;  3RP7 A;  4CCR A;  4AT0 A;  1PXB A;  4OVI A;  4AOX A;  5EBK A;  1CJ3 A;  2WU2 A;  4O5U A;  4IV9 A;  4FK1 C;  5KMS A;  2C73 A;  2GQW A;  3GSI A;  4CRT A;  4J33 A;  3II4 A;  3IWA A;  2EQ6 A;  4YKG A;  3CGD A;  2JAE A;  2R46 A;  2ZZB A;  3KA7 A;  1M6I A;  3AE3 A;  4OPD A;  2GR1 A;  1PJ5 A;  1B5Q A;  3DME A;  1BWC A;  4GAV A;  1PN0 A;  2RGO A;  4H4U A;  1B8S A;  3DGH A;  1Y0P A;  3VR8 A;  1KNR A;  3FPZ A;  4U8N A;  5L46 A;  4J36 A;  4B1B A;  4B69 A;  3ABV A;  4TM0 A;  2QA2 A;  3AE4 A;  5HXI A;  4K5R A;  1YQZ A;  4GUV A;  5KOX A;  3DGZ A;  3UOX A;  1EL9 A;  3NK0 X;  4U8M A;  2GV8 A;  3T14 A;  2FJD A;  2ZZC A;  2XVE A;  4NTC A;  5KOW A;  4OPU A;  1JNR A;  1QLB A;  4G9K A;  4AOS A;  3B6D A;  3P4S A;  1V59 A;  2VVL G;  5EB5 A;  1K0L A;  3JSK A;  4LII A;  1VG9 A;  4B68 A;  4X4J A;  1XDI A;  2GAG B;  2VVL A;  1IUW A;  1PS9 A;  1JRY A;  2BK3 A;  2O9Z A;  2YG6 A;  1QJD A;  3KVE A;  4H4W A;  2GR3 A;  4U8K A;  4XWZ A;  1K4Q A;  1YQ4 A;  2APG A;  3NT6 A;  3ALL A;  2RGH A;  2YVG A;  5KMQ A;  4CCQ A;  4D04 A;  3OC4 A;  1BGJ A;  3CN8 A;  5HYM A;  3GD3 A;  1EL8 A;  1D4C A;  2XDO A;  3G5R A;  3LAD A;  4YTM A;  3SZ0 A;  3LZW A;  3ICR A;  1D4D A;  3F8P A;  2FBW A;  3QFB A;  3C96 A;  2X50 A;  3EAO A;  1B4V A;  1IUU A;  2BXR A;  3Q6J A;  4U8I A;  4BV6 A;  2XLU A;  1NHQ A;  1CL0 A;  1D5T A;  1GRG A;  1IUS A;  4UDQ A;  5KRQ A;  4Z2U A;  5KXJ A;  2BS2 A;  3VQR A;  2VQ7 A;  4U2T A;  1S2Q A;  1IUT A;  2EQ8 A;  1NPX A;  5C2T A;  4NTE A;  3NG7 X;  2BA9 A;  2I0Z A;  3UTG A;  4K2X A;  2C75 A;  3HYV A;  3KPK A;  3UOY A;  2FJA A;  2B9Y A;  4ZCC A;  2DKH A;  1NHP A;  3D8X A;  4NEV A;  1PBB A;  5M0Z A;  3CGC A;  1O95 A;  2GF3 A;  3NYC A;  2JBV A;  4Z2R A;  1XHC A;  5U25 A;  4JDR A;  1QO8 A;  4A79 A;  1ELI A;  4EMJ A;  3RED A;  4B67 A;  4EM3 A;  2GMJ A;  4EIP A;  4Z26 A;  3NK1 X;  2YLR A;  1N4W A;  3AYI A;  1CBO A;  3ICS A;  1FOH A;  3ZDN A;  1PXC A;  3B3R A;  2XFP A;  5KWF A;  4OCG A;  1PHH A;  2NPX A;  1GND A;  5KNL A;  1P2E A;  5KMP A;  3QSS A;  2BYB A;  4ZN0 A;  4H4V A;  2IVD A;  3DA1 A;  4A9W A;  2QA1 A;  2WPC A;  2RAB A;  3DK4 A;  2JB2 A;  1OJ9 A;  2B7R A;  2Z5Y A;  5J7X A;  1DOB A;  1PDH A;  1H6V A;  3I3L A;  4X9N A;  2A87 A;  2C67 A;  2WS3 A;  2YLT A;  5J60 A;  1L9E A;  4K8D A;  2VZ2 A;  4HA6 A;  4YWO A;  4EIQ A;  3COX A;  4C5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...