4H33A

Crystal structure of a voltage-gated k+ channel pore module in a closed state in lipid membranes, tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
RSNGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRCKKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Voltage-gated K+ Channel Pore Module in a Closed State in Lipid Membranes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Membrane protein
molecule keywords Lmo2059 protein
total genus 30
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4h33A00
2JK5C 2AHZA 2EINC 2BOCC 3LDDA 4PDRA 4G28B 3T4DA 5E1AC 2Q6AA 3K03A 3SPHA 4X8AA 2WLLA 4X88A 4WFHA 2Y69C 3ZJZA 2IH3C 3K0GA 2HVKC 4PA9A 2NLJC 4P2ZA 3SYQA 3LDEA 4MTFA 4ZBMA 3ZRSA 4WFFA 2BOBC 3E8FA 4R6ZA 3LNMB 3E83A 1ORQC 2EIMC 3IFXA 4UUJC 3K06A 4TWKA 5B1AC 4GX2A 1JVMA 2KB1A 4MVMA 2ITCC 3X2QC 3HPLC 5EC1C 4JTCB 5CBHA 4RUEA 3ASNC 4MS2A 4F4LA 4QNHB 5B3SC 2IH1C 3FB7C 3ASOC 3LDCA 3TETA 4PA7A 3IGAC 4HYOA 4MVRA 3T2MA 4PDLA 4EKWA 3OUFA 3E8GA 4J9YB 4MSWC 3SYAA 5EBWC 4PDMA 3TCUA 3SPGA 1S5HC 2WLLB 1BL8A 4XDLA 2OCCC 1OCOC 4R7CA 4LCUC 5EC2C 4QE7A 1J95A 3ABKC 1ZWIC 3OR6C 2P7TC 4P30A 4MVUA 4X89A 1R3KC 2HFEC 2QTOA 4CBCA 3K04A 3GB7C 3SYOA 2WLJA 3AG3C 4GX0A 1OCCC 4OXSA 3VOUA 2HVJC 2ZXWC 1XL4A 1V54C 2HJFC 4JTDB 4XDJA 5EK0A 3RVZA 2W0FC 3AG2C 2DYRC 2HG5C 3SPCA 2Q69A 3AG1C 1QLEC 3FB8C 1V55C 2WLKA 2WLNA 3FB5C 3OUSA 1R3JC 4H37A 4I9WA 4PA4A 2WLIB 1R3LC 4PDVA 4R8CA 4MW8A 5EBLC 3E8HA 5CBFA 2ATKC 1K4CC 2A0LA 5CBGA 2Q67A 2QKSA 4MVZA 4JTAB 4RAIA 4R50A 3FB6C 3E86A 3ABMC 3WG7C 3T4ZA 4PA3A 3SPJA 5EBMC 3RVYA 2WLIA 3UM7A 1P7BA 4H33A 2WLHA 3T1CA 3E89A 4MVSA 2ITDC 2DYSC 4MTOA 4MW3A 3SYCA 3OR7C 4PA6A 2H8PC 4G27B 4LBEC 4WFEA 3EFFK 4RUFA 2EILC 3STZC 1M56C 4J9ZB 3RBZA 3SPIA 1OCRC 4MVQA 4XDKA 2EIJC 3F7YC 1M57C 3STLC 3SJQC 2A9HA 2X6BA 3AG4C 4RO2A 4BW5A 3R65A 1LNQA 3JYCA 1G4YB 3KG2A 3K08A 5BZBA 3SYPA 1XL6A 2A79B 3F5WC 2DWDC 4P9OA 2EIKC 3LUTB 3RW0A 2WLMA 4LP8A 1R3IC 2DWEC 4MVOA 4HZ3A 4KFMA 2X6AA 3E8BA 3BEHA 4DXWA 2X6CA 3UKMA 2K1EA 2YEVA 3F7VC 4GX1A 1OCZC 5IY5C 4MTGA 1K4DC 3K0DA 2ZD9A 4WFGA 2AHYA 4QE9A 3OGCC 5KUKA 3ABLC 2Q68A 5B1BC 1KKDA 5KUMA 2R9RB 4P9PA 4GX5A 3PJSK 5J9PC
chains in the Genus database with same CATH superfamily
4DR3B 2AHZA 5LBQA 2BTQA 3CRAA 4EB6B 2L35A 4WFHA 4U3JB 2L6LA 4U3JA 4AHCA 4DV0O 1ORQC 4I9QA 3FD9A 3X2QC 2Q0OC 4K35A 1F7YA 5CBHA 4X64O 2ZQMA 5KHGA 2YICA 4FFBA 1ZUQA 2DE0X 1R1BA 1EFRG 1O9HA 5TISZ 3OD4A 3T2MA 3E8GA 4MSWC 3ZBHA 1YI2V 4X64B 4XDLA 1YDXA 3G67A 3BY6A 1NI8A 3ZN0A 3THOA 4TV8B 2Z5UA 5BR8B 1X59A 2OTJV 1ENVA 1S5JA 1GKFA 3RT3C 1Y6XA 2DN9A 3FYIB 5K1PA 3BA8A 4NKGB 1AR5A 2BCCH 4PDVA 5CBFA 1FXVA 3E8HA 4HBNA 3SGIA 2CTQA 2YXYA 2UUBO 1FPOA 3RYFB 5LL6Y 3AG1B 1OZ0A 4I0XA 3BHPA 5B3SB 1SETA 4DV5O 4J80A 2B9ZA 3KZIZ 1FXKA 3ZHRA 1HNWO 3FAVA 4J41A 3W7XA 3ZHSA 2F4VB 4JAAA 3CYOA 2X0LA 2MK3A 3C3TA 2UUAB 3VQWA 2M6YA 2A9HA 5IJ9B 1HDJA 4U7OA 1PD3A 4CC6A 4DW1A 1FXKC 2A79B 2JDIG 4E4EA 3KCYA 2IM9A 1AI7A 2LJ2A 2HKOA 1M57B 1YJWV 3BEHA 4KHPO 3JARB 1YHQV 1JX9A 3Q4HB 4LF6B 4CH3A 4GYCB 1YTFD 3SJCC 1XNRB 1AVMA 1M93A 3U10A 1XMOB 1AILA 1Q86W 4LF6O 4IHJB 4FM1A 1GN2A 1NQTA 1Y76B 4GLXA 4N23A 1Y74A 4B7KA 4WF9V 4YHHB 2OCCB 4X66O 1VQKV 1TUBA 1US6A 3UT5A 4K3AA 4FFKA 2JS5A 4J9YB 2G38A 4JV5O 4FLUA 3RGBA 1PL0A 1QR9A 3WB2A 4NB5A 3GB7C 3K5NA 1AR1B 3JD3A 2W6IG 1HNWB 3VQVA 4JI0B 4UVCA 4BIUA 1JJOA 2LFRA 2Q7GA 3AG2C 1EN4A 2DYRC 1BZKA 3CCUV 1HWYA 1VQ7V 4FMTA 4LF9B 4NXNB 4UCTA 1IZ3A 5A2QN 5EYPA 2CK3G 1GTOA 1VQ8V 1V55B 1D5AA 4H0LB 2QEXV 1KP2A 3AK3A 3CRQA 5LP6B 2NNUA 1BT8A 3OR7C 4WFEA 2A7WA 3EFFK 2FMLA 3RWRD 2IBZH 1N0NA 3DXRA 2JJ2G 5IJ0B 2JGDA 1KU9A 2ZT9B 3SYPA 4O4IA 4H44B 1BGYH 2R9AA 5J2UA 1JCHA 1MABG 4WBNA 2PY5A 2LFSA 4FM0A 2YEVA 4JI0O 5JWPA 1Y67A 3OGCC 1MSWD 1FS0G 4DR6B 1JFFA 4GX5A 4DV1B 2IW5A 2VRZA 1NVPD 2DOSA 4PA9A 5B1AC 1PL4A 3B4SA 4IHJA 3ASNC 3A0HZ 1FFTB 4GZRB 1SS3A 5KHHA 3ZMZA 4LNUA 4PDLA 2QJ1A 4UV8A 5EZYA 2ZM6O 3CJHA 4LCUC 5KMGA 1X4TA 2P7TC 4MVUA 2CTPA 3H9VA 1FD9A 4JI1O 4FM2A 5IY5B 5IYDO 2DJVA 4LFBO 3CE2A 4XDJA 1I7FA 2F43G 2RNBA 4X20A 4OPAA 1EN5A 2YI8A 4DV2B 3SR2C 1KB9F 2WLKA 3K3WA 5ITZA 4R8CA 4DV3O 1NR1A 2A0LA 3FB6C 4HAMA 5LA6B 3GWKC 4PA3A 3LSSA 4DV6O 1IBKO 5C8YA 2B1GA 1SZXA 1VQLV 1DLBA 1OCCB 4K0KO 5B1OA 1TGOA 4E2LA 2ZCEA 5L3BA 4I5SA 5GTIZ 1Y76A 2FL4A 2OTLV 4FIPC 1CXZB 4L8JA 4ZIBA 1K97A 2Q4PA 2YIAA 2QE7G 2WA4A 2P67A 3QO8A 5DEDA 4UB8Z 1SQQH 1VF5B 3N2GB 5EYPB 3CB2A 3P3NA 4YY3B 5B1BC 2EJ7A 1XNQB 5J9PC 3DC6A 1CP9A 1G6UA 4NTXA 3LDDA 3QTCA 3I56V 2GSMB 2RMKB 4TQFA 3ZMVA 1E79G 4LH7A 5C8YB 3A0BZ 3HPLC 3JASB 5EC1C 3JASA 1JPXA 3A8TA 2ZIOA 1VIBA 1H2GA 2YUAA 5D5QA 1YXBA 4X9QA 4F6RB 3FB7C 1VEWA 2EX3A 2YXLA 1AP6A 2YS8A 3W7TA 3TCUA 1KD1W 2A06H 4N21A 1Q82W 3CC2V 3JD1A 4QPJA 5B1AB 5LHGA 1WP7A 2ZXWC 3ETEA 1S72V 1LUVA 3AG1C 1I94O 1HW7A 3H1KH 1KP3A 5BXZA 3JARA 1VQ6V 3IJ4A 4X1YB 2Y0PA 1Q5OA 3G71V 2XNDG 1N36B 5DN6G 5KLVH 3SYCA 2VQFO 4B08A 4ZHQB 3ZMSA 4LF4O 1XUQA 5GTHZ 1ZLZA 2H94A 2X6BA 4J42A 5LXTA 5JQGA 1YTFB 3FAVB 3F5WC 3S3XA 1W0KG 3L71H 1PV0A 1Z5VA 1F4MA 4FK5C 3HKBA 4D6TH 1H8HG 1IBLB 2WA3A 2ZR2A 4JI4B 3WFVA 2D3OW 2CAZC 5LYJB 2LW7A 4UFZA 1QVFU 3ZX6A 2R9RB 1L8DA 3PJSK 4JI6B 4G28B 4DV4O 1FXHA 4B3TB 5L3DA 5CMUA 3FYEB 4X88A 1FKAO 4DK0A 4EEQA 5LHIA 1U96A 5B1BB 1JR9A 2E75B 2CTWA 3ZCCA 1Y66A 3K5MA 4JI2O 3ZRVA 1G1XB 3HKDA 5FNVB 1EZVH 3OM3B 2ZDIC 1ZAUA 3OTOB 3CRRA 4CH6A 1SERA 2UUAO 4B3MO 1N36O 2BTOA 3CC4V 1OCCC 1W59A 3VOUA 3OTFA 4JYBA 1WPBA 4DO2A 4JTDB 5H6QA 4DYLA 1DF4A 3ABKB 2W0FC 4X62B 3FB8C 2QSAA 2Q7EA 3O65A 1OV9A 5JJNB 3UT5B 2E3CA 5IYCO 1K4CC 2Q67A 4R50A 4DV0B 3UO3A 4MT8A 2WWWA 4LF7O 2XT9A 4OGQB 1WB8A 1BCCH 1QCEA 4JZ2A 4MTOA 2Z3YA 4RUFA 3HKEB 5JH7A 5LMUO 1EM1A 1BSMA 2EINB 2IJJA 1WPXA 4NXNO 1M57C 4DRXA 2HR3A 1KECA 4DR4O 3LSUA 4K8ZA 4LFAB 1P49A 4GUNA 4DR7O 1F23A 1AP5A 3QG5A 2PYLA 1E1RG 4QE9A 1IVSA 3CCVV 2JS3A 1G8MA 2JK5C 2VS0A 5IJ9A 3QO7A 1K7DA 3GWOA 4PV1B 4OX9O 5LA6A 4KP4A 4O4LA 5L3CA 4L87A 1M4UA 4DUYB 1MZEA 4OPHA 1H2LA 2DYSB 2QM7A 3K06A 1Y74B 3T1YB 3W7UA 5CB4B 1K34A 4MS2A 1PP9H 3ASOC 4AQYO 1SRYA 4CH5A 5IWAO 1QHTA 3OUFA 1PM9A 3M99B 2JIZG 4R7CA 4D7SA 2QDOA 1J95A 4JGSA 4P30A 3K5LA 2UUBB 4U3FH 3K04A 2ADQB 1GM9A 2A3QA 3AG3C 2F66C 4B3SO 4G2KA 2AXTZ 5JCOA 1V55C 1EN6A 1ZL8A 2YIDA 1SQFA 4DR1B 4B3RO 3CX5F 1FFXB 1XI1A 2X7RB 4CS3A 3E35A 3T4ZA 2GBOA 2OWOA 3RVYA 2PF4E 3JAWA 4PA6A 3W7WA 3G4SV 2EBOA 4UCOA 1S0VA 2E5LB 2RQ6A 3MHSC 2VQFB 3TJTA 1AB3A 2GTAA 1DK1A 3L72H 3UCSC 4X1YA 4O4IB 2XUMA 1I94B 5LMUB 1OCRB 4HZ3A 4IIJB 3E8BA 4JI5O 5EZYB 2YDEA 3HR0A 3SJBC 1NZ6A 4DR2O 2AGAA 4LWSA 4Q20A 4X1IB 3T4DA 2F95B 1O9GA 1VQ5V 4FLZA 4JV5B 1S76D 2ODMA 2HLDG 1ROPA 3LNMB 4F6RA 1I5XA 2UU9O 3P30A 2KB1A 5C93A 4O2BA 2CE4A 1VQOV 4JI2B 2QR4A 1IURA 4QPKA 1M5IA 3M8AA 4LF9O 2Q5ZA 4C7UA 2WPDG 1UJWB 1MSDA 2EIKB 4PELA 4GKKO 3AG2B 3ZHUA 3ABKC 1JJ2U 2HFEC 1Q6UA 4B3TO 1N33O 3JALB 2GUZA 4BIOA 1BS3A 2BSKB 4I50B 1XL4A 2HJFC 4FLYA 1JOYA 3VBBA 2CUGA 4J11A 5KMGB 1YITV 2WLNA 1R6KA 5EBLC 1VF6C 4LFCO 2UXDB 1K9MW 1Q8IA 1B6QA 3K57A 4YJ3B 5EBMC 4PD4F 5KHIA 2WLHA 2PI5A 1ZX3A 5CA1B 3IAYA 2V7QG 5KX5A 2F4VO 2XAGA 1K3EA 4XDKA 3F7YC 4CH4A 3SJQC 2YXHA 3AG4C 4BW5A 1SQBH 4RO2A 2DWDC 1SC5B 1NBMG 2VQEO 1QVGU 2GTSA 5FPOA 4AILC 3K0DA 5L3EA 2CDYA 1M1KW 1M90W 4ZHQA 2K9PA 4LF4B 2OIEA 1SKVA 3ETDA 2ZM6B 3G6EV 3E22A 4GKKB 2IH3C 3LSQA 3ABMB 1VARA 4RQEA 1RFYA 3P32A 4X65O 2E76B 1CEZA 1R6NA 4MVMA 2N04A 2UXXA 4MTXA 2C2AA 2DYRB 1R6TA 3I5DA 1TUEB 4F4LA 5CN0A 3CCLV 5KAFZ 1YJNV 4MVRA 3B77A 4I50A 1KQSU 2RN9A 4PDMA 4ZOLB 5BMVB 1BL8A 1GH6A 4KL1A 5AG2A 3N2KA 3H1LH 1K92A 4JI8O 1W2BU 3QF7A 3ABUA 2Y4TA 2PI4A 3RVZA 1XREA 2Y48A 4I9WA 1R3JC 2PTMA 4TQDA 5KA6A 4MVZA 2QM4A 3C90A 3E86A 4BR6A 4YJ2A 4JF3A 3G80A 1HR0B 5IDJA 3UM7A 4O2AB 3B40A 3CMAV 1B06A 3VQXA 3J80N 2NR5A 3H01A 3CCMV 3E2EA 3CCSV 3D36A 1NU1H 2QA4V 4FLVA 1SF9A 3ASOB 2Q0AA 3R65A 3P3PA 3J7AU 3K08A 4IYHA 4IGGA 2PGGA 4PI0A 3CCJV 2V1DA 4LR3A 4JI6O 4NVPA 2X6CA 4I7ZB 1WN7A 3BVOA 4YXWG 5LGNA 2ARHA 4HNAB 2Q68A 2UXBB 1NVPB 4FFBB 4JI4O 4PDRA 2EIMB 1MG1A 5E1AC 2ZE8A 5FLXN 1MMMA 4UCRA 2Y69C 3CRMA 5DM6V 4MTFA 2CTRA 1NTKH 3JATA 4R6ZA 1Z2GA 3JAKB 4TWKA 3N27A 4GCZA 1UFIA 4FVMA 1RP3B 3N2KB 5K1XA 2ADPA 3CPWU 3SJAC 1SZTA 5H6RA 2IJHA 1P4RA 3QVNA 3AG4B 4O4HB 2LP7A 5IYBO 3L75H 1NTMH 3W7SA 3HKDB 3OR6C 4IL6Z 2E74B 3CC7V 3DXRB 5IJ0A 1WAZA 3A0RA 3VQYA 2WLJA 5J2TB 4KHPB 2UXCB 1NS1A 2V4DA 2CH7A 3J81N 4MW8A 2OCHA 2QGNA 3BA9A 5A9GA 1U97A 5CBGA 1HNZB 3GVMA 2QKSA 3RYIA 3SDLA 3CCEV 2XTAA 2GUZB 2LGQA 4MW3A 2ZKOA 2JGUA 4LF5O 1MOFA 4DV5B 3T1HO 1M9NA 1H2NA 3D3QA 2HEPA 1PNMA 1SA0B 4DK1A 2Y0IA 1J5EO 4LP8A 2JEUA 5D5PA 3MAQA 4KXRA 4JYCA 3ZMUA 4IT5A 3F7VC 4YY3O 4X62O 4I4TB 5JVDB 4Z1MG 5J2TA 2WAMA 3B09A 1BHAA 3N2GA 2R9IA 2EULA 3CCRV 3ZJZA 3WG7B 1SESA 3RYCA 2JJ1G 3CXCU 3ZHVA 4DR5O 4WFFA 1BQZA 4WFBV 2N74A 3IFXA 4IIJA 4XBFA 3CD6V 1WA8A 3EVKA 1S5LZ 4JTCB 2R70A 4LC1A 3KCXA 2UXNA 3JD4A 3HKBB 4O2AA 2AZ0A 5FL7G 3AK1A 4GKJB 4CZZA 4HYOA 4EKWA 2ZXWB 5EBWC 3SPGA 4X66B 4EB6A 2VWKA 3RFRA 1J5EB 4DUZB 2ZE6A 3APOA 3JCZA 2PUSA 4ZKIA 3OFNG 2QTSA 5KA5A 3OMIB 4PA4A 2XAHA 4DV6B 4H37A 1Q7YW 4DV7B 1N34B 1P7GA 1ZTEA 4QGPA 5LP6C 4JTAB 1NH2B 2UXCO 2EILB 2WSSG 4FLXA 1WLEA 2AW9A 1FAFA 5H5NA 5IYZA 3E89A 1XOUA 4LF8B 4UXNA 1V54B 3NXSA 3STZC 1VMGA 3BFRA 1QR8A 2CGOA 3EXAA 5B1NA 3JALA 2P5OA 3K9AA 4UVBA 3CWBH 1L0LH 4JAUA 4OX9B 3BCCH 2Q9LA 4P9OA 4F6EA 4O4JA 1JA8A 1N33B 1Q6IA 3RYHB 4DXWA 4DUYO 1HNXB 4UCVA 4MTGA 4TUYB 4TUYA 4WFGA 2AHYA 3ABLC 1AJNA 4KUMA 5LGTA 2JVDA 1TUBB 4TV9A 3RYHA 2Q6AA 3ZRWA 3JCUZ 4GKJO 2HVKC 4DR6O 2VQEB 3LDEA 4X1IA 2R72A 3CHXA 3K59A 3OT7A 3D3IA 2Y69B 2ZNJA 5BY1A 2F23A 5LOVA 4TT3G 4JYAO 4ASUG 2IH1C 3OE7G 4LNUB 3T1YO 4B3MB 3BPZA 3MD0A 1V9PA 3ETGA 3CSXA 5KAIZ 1QLNA 4PHZA 1NJIW 1FJGO 1XEQA 4W4KA 1KKCA 4O4LB 2EIJB 5KHKA 1XNQO 1K73W 1PNLA 3DC5A 2E5LO 4GT1A 4DR7B 2FYUH 1WB7A 2RCVA 1P7BA 4PJ0Z 1RM1C 4DR1O 1IBMB 4B3RB 4X65B 4MVSA 5CA3A 1XHZA 2YEVB 2DYSC 5LXTB 4J7ZA 2NN4A 1DGSA 2ZIMA 3QNEA 5KX5B 1F51A 5JJEB 3ZHTA 2EIJC 3STLC 2MW2B 4YIOA 3RYIB 1IDSA 4I55B 3LUTB 3RW0A 4KFMA 2X6AA 4LWSB 3LNNA 5LP6A 3OMNB 3CXHF 1E1QG 4H13B 3O9OA 4I4TA 1OCOB 1DF5A 1KKDA 4PI2A 5KUMA 3Q4HA 2ZR3A 5GW7A 1W0JG 2BE3A 5JJJB 2QWNB 4DUZO 2Y4UA 1H2MA 1VQ4V 3ZHQA 1SQPH 3HKCB 5LYJA 4JI3O 2F1MA 3K0GA 1GN4A 2FKXA 1GMGA 1RPRA 2P4KA 3ZRSA 3ASNB 1JFFB 3AEIA 5LMNB 3HB3B 1XQ8A 2IU0A 1JVMA 2M7WA 3ZRWB 4JI1B 1EZJA 2QWQB 5ITZB 5B3SC 4QNHB 1I08A 4LFCB 1D5NA 3AG3B 1NH2D 3QO5A 3SYAA 2YSUB 4Z2WA 5IWAB 3HKCA 1GM8A 2WLLB 3OW2U 1URFA 1Q90D 5EC2C 3K79A 1L1FA 3F5TA 3BRCA 4QJFB 1R3KC 2KQXA 1P84F 3FKSG 3TGUH 4OXSA 1AI4A 1XILA 4JI7O 3L9DA 3JSNA 4WFAV 2Q69A 5DECA 2LQTA 2EZOA 2ATKC 4UB6Z 1IXBA 4JZGA 3AG7A 4BIZA 3SPJA 5BR8O 2IJIA 2W0XA 1JQ0A 3ZS8C 5H9CA 3WB0A 1I5YA 5CB4A 1H8EG 3OEEG 2YC0A 4YIPA 1S3JA 4UV9A 3JATB 1MZFA 2ILMA 4JI8B 3NR7A 2P06A 1XL6A 3DSQA 2EIKC 2KKWA 1A32A 2UUCB 3OTOO 2DWEC 4MVOA 5IE9A 3JSLA 3L73H 1FFXA 4FLTA 3T1HB 2ETNA 4JI5B 4HNAA 1H2KA 2PYJA 4QIWF 4I0XB 1LR1A 1COWG 4W4LA 2LGWA 4Z1VA 4BWAA 1GAXA 1N8RW 1N0JA 1GO3F 3G6BA 2NLJC 4P2ZA 1BMFG 3ZN1A 1DTOA 3UO2A 1VP7A 1HNZO 2Q7HA 2ZE5A 1RPOA 1GM7A 4DV3B 1VQNV 3L70H 1OHHG 2ITCC 1B04A 3U11A 3BAAA 3ETQA 2Z0AA 1N32B 2QKCA 4JYAB 5JVDA 2XAJA 4ZI7A 5LMNO 2QWPB 4UCUA 1JMKC 2LW1A 4NXMO 1R73A 5EIBC 2YIBD 1Q43A 4YJ2B 4CS4A 4K0KB 2HP8A 1ZWIC 4UCSA 4A5UB 4TV9B 1BE3H 2IJKA 5GONA 5GONB 4FPPA 2HVJC 1SQXH 4DV2O 1VF7A 3ML0A 1KC8W 3OUSA 2LO1A 2WLIB 4DV4B 4AQYB 2PZSA 1RM1B 3ZEDA 1TAEA 2AZ2A 4FZ0A 3ZIAG 4ZOLA 3MHHC 3RYFA 3WG7C 5BMVA 5E79Z 1IX9A 1YEWA 1GRJA 1WA8B 2JGDB 1L0NH 4DW0A 2XAQA 4DRXB 2O57A 2P4VA 2RDCA 3HKEA 2P6JA 3RBZA 3SPIA 5L3FA 1VQ9V 3K9SA 4YHHO 3KG2A 3JYCA 1G4YB 5BZBA 1OJHA 3E22B 2H3OA 1YIJV 3CMEV 4Q6GA 3D8CA 3IC7A 3B8MA 3AK2A 4DR4B 4RWUA 1YJ9V 4LFAO 2QWOB 4NTWA 2KSDA 5EIBD 1XMQB 2ZE7A 3K5OA 3SPHA 4X8AA 3K58A 1HP8A 1MA1A 3E8FA 2HHHO 4WBNB 4UUJC 1AROP 4GX2A 3H1HH 3H1IH 1K8AW 5CA1A 3RN4A 1AI6A 3PN1A 4DR5B 3LDCA 2W6JG 1ZSPA 2D2CB 2EJRA 2OCCC 1NKDA 4CBCA 4I55A 4EFEA 5B5EZ 3SYOA 4LF7B 2QWRB 1OCZB 1I0HA 5LGUA 2Q8VA 1H2SB 3TK1A 5LHHA 2HG5C 1BHBA 3FB5C 1NR7A 1H38A 2BSKA 4K8XA 3FX7A 1HR0O 5JCOC 2ZDIA 2WLIA 1EBOA 1KYOF 3JAKA 3S3WA 3CRCA 5JQGB 2QKAA 3WU2Z 3JAWB 3OMAB 1NT2B 2EZPA 3BABA 3KKYA 2IU3A 4FJCC 4LBEC 4O2BB 1SQGA 1XHXA 4X20B 2P90A 1QNMA 3CP1A 4BAYA 3CS5A 2JRIA 4NTYA 4J10A 3ABLB 2KG7A 4RQFA 4YJ3A 5CA0A 3U0ZA 4CC5A 1R3IC 2HJDA 4B3SB 5FPRA 5H2FZ 4GX1A 2GDSA 5IY5C 4JI3B 1Q81W 1THZA 2F93B 3WB1A 1M56B 3JD0A 5IYZB 1HNXO 4TV8A 3K03A 4WCEV 4O4HA 2CGNA 1UPGA 2WLLA 1YSCA 4FZ1A 3R66A 3SYQA 5L3GA 1QQCA 2BOBC 3E83A 1RSOA 4B7EA 1B3QA 3ICXA 2B1IA 2XASA 4JPRA 4TSFG 1GK9A 4RUEA 4J7KA 2VWJA 5HFMA 4PA7A 3IGAC 3DGEA 3I55V 2DQ0A 4JI7B 2OIGA 1S5HC 4NXMB 3D36C 1OCOC 1YCIA 3C3SA 2DMXA 3TXQA 4X1KB 1PNKA 2ZNIA 4DR2B 1V54C 4TOIA 2B5UA 2JEXA 5HFLA 1Y4MA 3SPCA 1KUQA 1T5EA 2YIBA 4LFBB 4RAIA 1PKXA 1N32O 5B66Z 3ABMC 2OYQA 3MDSA 2DW4A 3ABTA 5JH7B 2RJZA 1K5QA 2UU9B 1GN6A 3A2FA 3T1CA 1XMQO 2XHBA 2N05A 4LF5B 1YVWA 3L74H 1BQ0A 3B2EE 1AR4A 1M56C 3OAAG 1QLEB 1S77D 1OCRC 1YZBA 1AI5A 4X1KA 4J7JA 4IYIA 2HHHB 1LNQA 1SA0A 4D7TA 3UQ8A 1VQPV 1FJGB 2DQ3A 4EFBA 1K33A 4U7NA 1FXKB 2K1EA 1AJPA 3B8NA 1K4DC 4ICGA 1GN3A 1ZL8B 4GX0A 4P9PA 1WJZA 4ZI7B 2EINC 2BOCC 1RSOB 3OGIB 5F2VO 1IBKB 2FB5A 5KHJA 2XAFA 1IBMO 2XOKG 4UVAA 2QM8A 3DTUB 1IXMA 3RYCB 2UUCO 5FNVA 4ZBMA 2OT5A 2EIMC 1CPYA 1LUWA 1PPJH 4DR3O 1VQMV 2GV9A 1K5SA 4CS2A 5CA0B 3TETA 1Q3EA 4NYKA 3ZRXA 4NR1A 3JAMN 1XBLA 3TXSA 2YI9A 4QE7A 4X89A 1QBZA 2QTOA 1IBLO 1TVKB 3CEIA 1YF2A 1XMOO 5EK0A 4JAVA 1FYJA 1QLEC 1Z5WA 3H1JH 1R3LC 4O4JB 4JASA 1NTZH 4DV7O 1N34O 2BTQB 2ZINA 3X2QB 4ABMA 1AJQA 1D2DA 1TVKA 1QU7A 2FTKA 5J2UB 2GHYA 4H33A 3ZMTA 2UXDO 2ITDC 4DV1O 3M7MX 5IT9N 2H8PC 4LF8O 4G27B 3CJHB 2P22C 2EILC 3EHBB 4J9ZB 4JYYA 1Q6HA 2CH7B 4MVQA 1KBHA 4BW9A 1WNSA 1SQVH 1WP8A 1N4CA 1TA8A 2Q73A 4LH6A 2KG7B 2WLMA 3APQA 1KMIZ 1VF6A 2UXBO 5LOVB 3CCQV 3FFQA 4FLWA 3UKMA 1F4NA 1XNRO 1OCZC 3OEHG 2ZD9A 4AI8A 5KUKA 3IC9A 1MNGA 3JD2A 1XDCA
chains in the Genus database with same CATH topology
2AHZA 5LBQA 4PDRA 2EIMB 1MG1A 4G28B 1FXHA 5E1AC 5L3DA 5CMUA 3FYEB 4X88A 1N8RW 4WFHA 2Y69C 5LHIA 1GO3F 5B1BB 5DM6V 2NLJC 4P2ZA 1BMFG 3ZN1A 1DTOA 4MTFA 1RPOA 4R6ZA 1ORQC 3ZCCA 1GM7A 1Y66A 4TWKA 1VQNV 4GCZA 1OHHG 2ITCC 3X2QC 5CBHA 3ZRVA 2ZQMA 3CPWU 3OM3B 2ZDIC 1SZTA 2XAJA 5H6RA 2IJHA 1EFRG 1P4RA 3T2MA 3AG4B 3E8GA 2LP7A 4MSWC 1YI2V 1R73A 5IYBO 3W7SA 4XDLA 1SERA 3BY6A 1ZWIC 3OR6C 3CC7V 3CC4V 3A0RA 3ZN0A 2WLJA 2IJKA 1OCCC 4FPPA 2Z5UA 4JYBA 2HVJC 3VOUA 4DO2A 4JTDB 5H6QA 1DF4A 2OTJV 1ENVA 3ML0A 1GKFA 2W0FC 3ABKB 3FYIB 1KC8W 3FB8C 3OUSA 2WLIB 4PDVA 4MW8A 5CBFA 1FXVA 3E8HA 1RM1B 5IYCO 1K4CC 5CBGA 2Q67A 2QKSA 4R50A 3ZIAG 3MHHC 2WWWA 4MT8A 3WG7C 3CCEV 3AG1B 1OZ0A 5B3SB 1SETA 1QCEA 4MTOA 1FXKA 4MW3A 2XAQA 2Z3YA 3W7XA 4RUFA 1MOFA 3CYOA 2P6JA 2X0LA 2EINB 3RBZA 2IJJA 1WPXA 3SPIA 2MK3A 5L3FA 1VQ9V 1M57C 2A9HA 4U7OA 1PD3A 3KG2A 3JYCA 1G4YB 1M9NA 5BZBA 1FXKC 2A79B 2HR3A 2JDIG 1PNMA 1KECA 1YIJV 3CMEV 1AI7A 4LP8A 2JEUA 2HKOA 1M57B 3IC7A 1YJWV 3BEHA 4JYCA 3ZMUA 1F23A 3B8MA 3F7VC 1YHQV 1E1RG 4QE9A 1YJ9V 1JX9A 3CCVV 1G8MA 2JK5C 4Z1MG 1YTFD 2WAMA 3QO7A 1BHAA 1K7DA 4X8AA 2R9IA 3SPHA 3GWOA 3CCRV 3ZJZA 3WG7B 1SESA 4KP4A 1Q86W 5L3CA 4L87A 2JJ1G 3CXCU 4WFFA 3E8FA 1NQTA 4WFBV 3IFXA 2DYSB 2QM7A 4N23A 4UUJC 4XBFA 1AROP 3K06A 3CD6V 4GX2A 1K8AW 4WF9V 3W7UA 2OCCB 4JTCB 4LC1A 1AI6A 1VQKV 2UXNA 3JD4A 1K34A 4MS2A 3ASOC 3LDCA 2W6JG 5FL7G 1SRYA 4CZZA 4HYOA 4EKWA 2ZXWB 3OUFA 4J9YB 2EJRA 5EBWC 3SPGA 3M99B 2JIZG 2OCCC 4R7CA 1J95A 1NKDA 4JGSA 4P30A 4CBCA 1PL0A 1QR9A 3K04A 3GB7C 3SYOA 1GM9A 1AR1B 3AG3C 3JD3A 2W6IG 3JCZA 1OCZB 4UVCA 4BIUA 2LFRA 4G2KA 5LGUA 3TK1A 3AG2C 2DYRC 2HG5C 4ZKIA 5LHHA 3OFNG 5KA5A 1BHBA 1V55C 3OMIB 4PA4A 3FB5C 2XAHA 3CCUV 4H37A 1Q7YW 1HWYA 1NR7A 1VQ7V 4FMTA 1H38A 2CK3G 4JTAB 1NH2B 2X7RB 3E35A 1GTOA 3T4ZA 2EILB 1V55B 2WSSG 1VQ8V 1WLEA 2ZDIA 2QEXV 3RVYA 2WLIA 1EBOA 1KP2A 3E89A 2NNUA 4UXNA 3OMAB 2EZPA 3OR7C 4PA6A 3W7WA 2IU3A 1V54B 3NXSA 4FJCC 4LBEC 4WFEA 3EFFK 3G4SV 2P90A 2EBOA 3STZC 1S0VA 3MHSC 1QR8A 2JJ2G 5B1NA 3CP1A 4BAYA 3K9AA 4UVBA 3SYPA 4JAUA 3ABLB 4P9OA 4RQFA 1JCHA 1OCRB 1R3IC 4HZ3A 1MABG 3E8BA 2LFSA 4DXWA 2YEVA 4GX1A 5IY5C 4MTGA 1Q81W 4WFGA 2AHYA 3OGCC 3ABLC 1THZA 1AJNA 4KUMA 5LGTA 1FS0G 1MSWD 1M56B 3JD0A 4GX5A 4Q20A 2IW5A 3T4DA 2Q6AA 3K03A 1VQ5V 3ZRWA 4WCEV 1NVPD 2WLLA 1YSCA 1S76D 2HVKC 4PA9A 3SYQA 3LDEA 5L3GA 2BOBC 2HLDG 1ROPA 3LNMB 3E83A 1I5XA 5B1AC 2B1IA 3P30A 2KB1A 2XASA 3D3IA 4JPRA 2Y69B 4TSFG 1GK9A 5C93A 4RUEA 1VQOV 3ASNC 4QPKA 4TT3G 1FFTB 4ASUG 2IH1C 5HFMA 3OE7G 4PA7A 3IGAC 3DGEA 3ZMZA 4PDLA 3I55V 2DQ0A 4UV8A 1S5HC 2WPDG 1UJWB 2EIKB 4PELA 1OCOC 3MD0A 4LCUC 3AG2B 1JJ2U 3ABKC 2P7TC 4MVUA 2HFEC 3ETGA 1QLNA 1PNKA 5IY5B 1NJIW 5IYDO 1XL4A 1V54C 2HJFC 2B5UA 4XDJA 1JOYA 3VBBA 2JEXA 2F43G 5HFLA 1Y4MA 1YITV 3SPCA 2WLKA 3K3WA 2WLNA 1R6KA 2EIJB 5EBLC 4R8CA 1K73W 1NR1A 1PNLA 1K9MW 1B6QA 2A0LA 4GT1A 4RAIA 1PKXA 3FB6C 4HAMA 3ABMC 2DW4A 4PA3A 3ABTA 3LSSA 3PJSK 5EBMC 1K5QA 1P7BA 1RM1C 2WLHA 3T1CA 2PI5A 2B1GA 4MVSA 5CA3A 2YEVB 2DYSC 1VQLV 1DLBA 1OCCB 5B1OA 3QNEA 4E2LA 2V7QG 1M56C 3OAAG 1F51A 1QLEB 5L3BA 1S77D 2XAGA 4I5SA 1OCRC 1K3EA 4XDKA 3F7YC 2EIJC 1AI5A 3STLC 3SJQC 3AG4C 4BW5A 4RO2A 2OTLV 1LNQA 4FIPC 2DWDC 1NBMG 1K97A 1VQPV 2QE7G 3LUTB 2P67A 3RW0A 3QO8A 2DQ3A 1QVGU 1K33A 4KFMA 2X6AA 4U7NA 1FXKB 2K1EA 3OMNB 1AJPA 3B8NA 1K4DC 3K0DA 5L3EA 1E1QG 1OCOB 5B1BC 1DF5A 1M1KW 1M90W 1KKDA 5KUMA 4GX0A 2ZR3A 4P9PA 5GW7A 1W0JG 5J9PC 1CP9A 2EINC 2BOCC 3LDDA 3I56V 3ETDA 1VQ4V 2GSMB 2XAFA 3G6EV 2XOKG 4UVAA 2IH3C 3K0GA 3ABMB 3LSQA 2QM8A 4RQEA 1GMGA 3DTUB 1IXMA 1RPRA 3ZRSA 3ASNB 4ZBMA 3P32A 3AEIA 2OT5A 3ZMVA 2EIMC 1E79G 1CEZA 1CPYA 3HB3B 2IU0A 1JVMA 2M7WA 1R6NA 4MVMA 3ZRWB 4MTXA 2UXXA 3HPLC 2C2AA 5EC1C 1JPXA 2DYRB 1EZJA 1VQMV 1TUEB 1H2GA 1K5SA 4F4LA 5CN0A 4QNHB 5B3SC 3CCLV 3FB7C 1NH2D 3AG3B 3TETA 3QO5A 1YJNV 4MVRA 3B77A 3ZRXA 3SYAA 1KQSU 2YSUB 4PDMA 3TCUA 3W7TA 1GM8A 1BL8A 2WLLB 3OW2U 1KD1W 4N21A 5EC2C 3K79A 4QE7A 1L1FA 1Q82W 3CC2V 4QJFB 4X89A 1R3KC 1K92A 1QBZA 2QTOA 3JD1A 3FKSG 4OXSA 4QPJA 1W2BU 1AI4A 5B1AB 5LHGA 2ZXWC 3ABUA 3ETEA 1S72V 2PI4A 5EK0A 4JAVA 3RVZA 4WFAV 2Q69A 2Y48A 1QLEC 3AG1C 4I9WA 1R3JC 1R3LC 2EZOA 4JASA 2ATKC 1KP3A 3X2QB 1AJQA 5KA6A 1VQ6V 4MVZA 2FTKA 3E86A 4BIZA 4JF3A 3SPJA 3G71V 2GHYA 2XNDG 5IDJA 3UM7A 5DN6G 2IJIA 4H33A 3CMAV 3ZMTA 1JQ0A 2ITDC 5H9CA 3H01A 3CCMV 3E2EA 3SYCA 3CCSV 3D36A 2H8PC 1I5YA 4G27B 2QA4V 1H8EG 2EILC 3EHBB 3OEEG 4J9ZB 3ZMSA 4MVQA 1S3JA 4UV9A 3ASOB 2H94A 2X6BA 3R65A 1YTFB 3K08A 1XL6A 3F5WC 1W0KG 2EIKC 1F4MA 4FK5C 2WLMA 3CCJV 2DWEC 4MVOA 1H8HG 2V1DA 2ZR2A 3CCQV 2X6CA 3UKMA 1F4NA 1OCZC 3WFVA 2D3OW 4YXWG 5LGNA 3OEHG 2ZD9A 5KUKA 4QIWF 2Q68A 1QVFU 3JD2A 2R9RB 1NVPB 1COWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK5 C;  2AHZ A;  2EIN C;  2BOC C;  3LDD A;  4PDR A;  4G28 B;  3T4D A;  5E1A C;  2Q6A A;  3K03 A;  3SPH A;  4X8A A;  2WLL A;  4X88 A;  4WFH A;  2Y69 C;  3ZJZ A;  2IH3 C;  3K0G A;  2HVK C;  4PA9 A;  2NLJ C;  4P2Z A;  3SYQ A;  3LDE A;  4MTF A;  4ZBM A;  3ZRS A;  4WFF A;  2BOB C;  3E8F A;  4R6Z A;  3LNM B;  3E83 A;  1ORQ C;  2EIM C;  3IFX A;  4UUJ C;  3K06 A;  4TWK A;  5B1A C;  4GX2 A;  1JVM A;  2KB1 A;  4MVM A;  2ITC C;  3X2Q C;  3HPL C;  5EC1 C;  4JTC B;  5CBH A;  4RUE A;  3ASN C;  4MS2 A;  4F4L A;  4QNH B;  5B3S C;  2IH1 C;  3FB7 C;  3ASO C;  3LDC A;  3TET A;  4PA7 A;  3IGA C;  4HYO A;  4MVR A;  3T2M A;  4PDL A;  4EKW A;  3OUF A;  3E8G A;  4J9Y B;  4MSW C;  3SYA A;  5EBW C;  4PDM A;  3TCU A;  3SPG A;  1S5H C;  2WLL B;  1BL8 A;  4XDL A;  2OCC C;  1OCO C;  4R7C A;  4LCU C;  5EC2 C;  4QE7 A;  1J95 A;  3ABK C;  1ZWI C;  3OR6 C;  2P7T C;  4P30 A;  4MVU A;  4X89 A;  1R3K C;  2HFE C;  2QTO A;  4CBC A;  3K04 A;  3GB7 C;  3SYO A;  2WLJ A;  3AG3 C;  4GX0 A;  1OCC C;  4OXS A;  3VOU A;  2HVJ C;  2ZXW C;  1XL4 A;  1V54 C;  2HJF C;  4JTD B;  4XDJ A;  5EK0 A;  3RVZ A;  2W0F C;  3AG2 C;  2DYR C;  2HG5 C;  3SPC A;  2Q69 A;  3AG1 C;  1QLE C;  3FB8 C;  1V55 C;  2WLK A;  2WLN A;  3FB5 C;  3OUS A;  1R3J C;  4H37 A;  4I9W A;  4PA4 A;  2WLI B;  1R3L C;  4PDV A;  4R8C A;  4MW8 A;  5EBL C;  3E8H A;  5CBF A;  2ATK C;  1K4C C;  2A0L A;  5CBG A;  2Q67 A;  2QKS A;  4MVZ A;  4JTA B;  4RAI A;  4R50 A;  3FB6 C;  3E86 A;  3ABM C;  3WG7 C;  3T4Z A;  4PA3 A;  3SPJ A;  5EBM C;  3RVY A;  2WLI A;  3UM7 A;  1P7B A;  4H33 A;  2WLH A;  3T1C A;  3E89 A;  4MVS A;  2ITD C;  2DYS C;  4MTO A;  4MW3 A;  3SYC A;  3OR7 C;  4PA6 A;  2H8P C;  4G27 B;  4LBE C;  4WFE A;  3EFF K;  4RUF A;  2EIL C;  3STZ C;  1M56 C;  4J9Z B;  3RBZ A;  3SPI A;  1OCR C;  4MVQ A;  4XDK A;  2EIJ C;  3F7Y C;  1M57 C;  3STL C;  3SJQ C;  2A9H A;  2X6B A;  3AG4 C;  4RO2 A;  4BW5 A;  3R65 A;  1LNQ A;  3JYC A;  1G4Y B;  3KG2 A;  3K08 A;  5BZB A;  3SYP A;  1XL6 A;  2A79 B;  3F5W C;  2DWD C;  4P9O A;  2EIK C;  3LUT B;  3RW0 A;  2WLM A;  4LP8 A;  1R3I C;  2DWE C;  4MVO A;  4HZ3 A;  4KFM A;  2X6A A;  3E8B A;  3BEH A;  4DXW A;  2X6C A;  3UKM A;  2K1E A;  2YEV A;  3F7V C;  4GX1 A;  1OCZ C;  5IY5 C;  4MTG A;  1K4D C;  3K0D A;  2ZD9 A;  4WFG A;  2AHY A;  4QE9 A;  3OGC C;  5KUK A;  3ABL C;  2Q68 A;  5B1B C;  1KKD A;  5KUM A;  2R9R B;  4P9P A;  4GX5 A;  3PJS K;  5J9P C; 
#chains in the Genus database with same CATH topology
 4DR3 B;  2AHZ A;  5LBQ A;  2BTQ A;  3CRA A;  4EB6 B;  2L35 A;  4WFH A;  4U3J B;  2L6L A;  4U3J A;  4AHC A;  4DV0 O;  1ORQ C;  4I9Q A;  3FD9 A;  3X2Q C;  2Q0O C;  4K35 A;  1F7Y A;  5CBH A;  4X64 O;  2ZQM A;  5KHG A;  2YIC A;  4FFB A;  1ZUQ A;  2DE0 X;  1R1B A;  1EFR G;  1O9H A;  5TIS Z;  3OD4 A;  3T2M A;  3E8G A;  4MSW C;  3ZBH A;  1YI2 V;  4X64 B;  4XDL A;  1YDX A;  3G67 A;  3BY6 A;  1NI8 A;  3ZN0 A;  3THO A;  4TV8 B;  2Z5U A;  5BR8 B;  1X59 A;  2OTJ V;  1ENV A;  1S5J A;  1GKF A;  3RT3 C;  1Y6X A;  2DN9 A;  3FYI B;  5K1P A;  3BA8 A;  4NKG B;  1AR5 A;  2BCC H;  4PDV A;  5CBF A;  1FXV A;  3E8H A;  4HBN A;  3SGI A;  2CTQ A;  2YXY A;  2UUB O;  1FPO A;  3RYF B;  5LL6 Y;  3AG1 B;  1OZ0 A;  4I0X A;  3BHP A;  5B3S B;  1SET A;  4DV5 O;  4J80 A;  2B9Z A;  3KZI Z;  1FXK A;  3ZHR A;  1HNW O;  3FAV A;  4J41 A;  3W7X A;  3ZHS A;  2F4V B;  4JAA A;  3CYO A;  2X0L A;  2MK3 A;  3C3T A;  2UUA B;  3VQW A;  2M6Y A;  2A9H A;  5IJ9 B;  1HDJ A;  4U7O A;  1PD3 A;  4CC6 A;  4DW1 A;  1FXK C;  2A79 B;  2JDI G;  4E4E A;  3KCY A;  2IM9 A;  1AI7 A;  2LJ2 A;  2HKO A;  1M57 B;  1YJW V;  3BEH A;  4KHP O;  3JAR B;  1YHQ V;  1JX9 A;  3Q4H B;  4LF6 B;  4CH3 A;  4GYC B;  1YTF D;  3SJC C;  1XNR B;  1AVM A;  1M93 A;  3U10 A;  1XMO B;  1AIL A;  1Q86 W;  4LF6 O;  4IHJ B;  4FM1 A;  1GN2 A;  1NQT A;  1Y76 B;  4GLX A;  4N23 A;  1Y74 A;  4B7K A;  4WF9 V;  4YHH B;  2OCC B;  4X66 O;  1VQK V;  1TUB A;  1US6 A;  3UT5 A;  4K3A A;  4FFK A;  2JS5 A;  4J9Y B;  2G38 A;  4JV5 O;  4FLU A;  3RGB A;  1PL0 A;  1QR9 A;  3WB2 A;  4NB5 A;  3GB7 C;  3K5N A;  1AR1 B;  3JD3 A;  2W6I G;  1HNW B;  3VQV A;  4JI0 B;  4UVC A;  4BIU A;  1JJO A;  2LFR A;  2Q7G A;  3AG2 C;  1EN4 A;  2DYR C;  1BZK A;  3CCU V;  1HWY A;  1VQ7 V;  4FMT A;  4LF9 B;  4NXN B;  4UCT A;  1IZ3 A;  5A2Q N;  5EYP A;  2CK3 G;  1GTO A;  1VQ8 V;  1V55 B;  1D5A A;  4H0L B;  2QEX V;  1KP2 A;  3AK3 A;  3CRQ A;  5LP6 B;  2NNU A;  1BT8 A;  3OR7 C;  4WFE A;  2A7W A;  3EFF K;  2FML A;  3RWR D;  2IBZ H;  1N0N A;  3DXR A;  2JJ2 G;  5IJ0 B;  2JGD A;  1KU9 A;  2ZT9 B;  3SYP A;  4O4I A;  4H44 B;  1BGY H;  2R9A A;  5J2U A;  1JCH A;  1MAB G;  4WBN A;  2PY5 A;  2LFS A;  4FM0 A;  2YEV A;  4JI0 O;  5JWP A;  1Y67 A;  3OGC C;  1MSW D;  1FS0 G;  4DR6 B;  1JFF A;  4GX5 A;  4DV1 B;  2IW5 A;  2VRZ A;  1NVP D;  2DOS A;  4PA9 A;  5B1A C;  1PL4 A;  3B4S A;  4IHJ A;  3ASN C;  3A0H Z;  1FFT B;  4GZR B;  1SS3 A;  5KHH A;  3ZMZ A;  4LNU A;  4PDL A;  2QJ1 A;  4UV8 A;  5EZY A;  2ZM6 O;  3CJH A;  4LCU C;  5KMG A;  1X4T A;  2P7T C;  4MVU A;  2CTP A;  3H9V A;  1FD9 A;  4JI1 O;  4FM2 A;  5IY5 B;  5IYD O;  2DJV A;  4LFB O;  3CE2 A;  4XDJ A;  1I7F A;  2F43 G;  2RNB A;  4X20 A;  4OPA A;  1EN5 A;  2YI8 A;  4DV2 B;  3SR2 C;  1KB9 F;  2WLK A;  3K3W A;  5ITZ A;  4R8C A;  4DV3 O;  1NR1 A;  2A0L A;  3FB6 C;  4HAM A;  5LA6 B;  3GWK C;  4PA3 A;  3LSS A;  4DV6 O;  1IBK O;  5C8Y A;  2B1G A;  1SZX A;  1VQL V;  1DLB A;  1OCC B;  4K0K O;  5B1O A;  1TGO A;  4E2L A;  2ZCE A;  5L3B A;  4I5S A;  5GTI Z;  1Y76 A;  2FL4 A;  2OTL V;  4FIP C;  1CXZ B;  4L8J A;  4ZIB A;  1K97 A;  2Q4P A;  2YIA A;  2QE7 G;  2WA4 A;  2P67 A;  3QO8 A;  5DED A;  4UB8 Z;  1SQQ H;  1VF5 B;  3N2G B;  5EYP B;  3CB2 A;  3P3N A;  4YY3 B;  5B1B C;  2EJ7 A;  1XNQ B;  5J9P C;  3DC6 A;  1CP9 A;  1G6U A;  4NTX A;  3LDD A;  3QTC A;  3I56 V;  2GSM B;  2RMK B;  4TQF A;  3ZMV A;  1E79 G;  4LH7 A;  5C8Y B;  3A0B Z;  3HPL C;  3JAS B;  5EC1 C;  3JAS A;  1JPX A;  3A8T A;  2ZIO A;  1VIB A;  1H2G A;  2YUA A;  5D5Q A;  1YXB A;  4X9Q A;  4F6R B;  3FB7 C;  1VEW A;  2EX3 A;  2YXL A;  1AP6 A;  2YS8 A;  3W7T A;  3TCU A;  1KD1 W;  2A06 H;  4N21 A;  1Q82 W;  3CC2 V;  3JD1 A;  4QPJ A;  5B1A B;  5LHG A;  1WP7 A;  2ZXW C;  3ETE A;  1S72 V;  1LUV A;  3AG1 C;  1I94 O;  1HW7 A;  3H1K H;  1KP3 A;  5BXZ A;  3JAR A;  1VQ6 V;  3IJ4 A;  4X1Y B;  2Y0P A;  1Q5O A;  3G71 V;  2XND G;  1N36 B;  5DN6 G;  5KLV H;  3SYC A;  2VQF O;  4B08 A;  4ZHQ B;  3ZMS A;  4LF4 O;  1XUQ A;  5GTH Z;  1ZLZ A;  2H94 A;  2X6B A;  4J42 A;  5LXT A;  5JQG A;  1YTF B;  3FAV B;  3F5W C;  3S3X A;  1W0K G;  3L71 H;  1PV0 A;  1Z5V A;  1F4M A;  4FK5 C;  3HKB A;  4D6T H;  1H8H G;  1IBL B;  2WA3 A;  2ZR2 A;  4JI4 B;  3WFV A;  2D3O W;  2CAZ C;  5LYJ B;  2LW7 A;  4UFZ A;  1QVF U;  3ZX6 A;  2R9R B;  1L8D A;  3PJS K;  4JI6 B;  4G28 B;  4DV4 O;  1FXH A;  4B3T B;  5L3D A;  5CMU A;  3FYE B;  4X88 A;  1FKA O;  4DK0 A;  4EEQ A;  5LHI A;  1U96 A;  5B1B B;  1JR9 A;  2E75 B;  2CTW A;  3ZCC A;  1Y66 A;  3K5M A;  4JI2 O;  3ZRV A;  1G1X B;  3HKD A;  5FNV B;  1EZV H;  3OM3 B;  2ZDI C;  1ZAU A;  3OTO B;  3CRR A;  4CH6 A;  1SER A;  2UUA O;  4B3M O;  1N36 O;  2BTO A;  3CC4 V;  1OCC C;  1W59 A;  3VOU A;  3OTF A;  4JYB A;  1WPB A;  4DO2 A;  4JTD B;  5H6Q A;  4DYL A;  1DF4 A;  3ABK B;  2W0F C;  4X62 B;  3FB8 C;  2QSA A;  2Q7E A;  3O65 A;  1OV9 A;  5JJN B;  3UT5 B;  2E3C A;  5IYC O;  1K4C C;  2Q67 A;  4R50 A;  4DV0 B;  3UO3 A;  4MT8 A;  2WWW A;  4LF7 O;  2XT9 A;  4OGQ B;  1WB8 A;  1BCC H;  1QCE A;  4JZ2 A;  4MTO A;  2Z3Y A;  4RUF A;  3HKE B;  5JH7 A;  5LMU O;  1EM1 A;  1BSM A;  2EIN B;  2IJJ A;  1WPX A;  4NXN O;  1M57 C;  4DRX A;  2HR3 A;  1KEC A;  4DR4 O;  3LSU A;  4K8Z A;  4LFA B;  1P49 A;  4GUN A;  4DR7 O;  1F23 A;  1AP5 A;  3QG5 A;  2PYL A;  1E1R G;  4QE9 A;  1IVS A;  3CCV V;  2JS3 A;  1G8M A;  2JK5 C;  2VS0 A;  5IJ9 A;  3QO7 A;  1K7D A;  3GWO A;  4PV1 B;  4OX9 O;  5LA6 A;  4KP4 A;  4O4L A;  5L3C A;  4L87 A;  1M4U A;  4DUY B;  1MZE A;  4OPH A;  1H2L A;  2DYS B;  2QM7 A;  3K06 A;  1Y74 B;  3T1Y B;  3W7U A;  5CB4 B;  1K34 A;  4MS2 A;  1PP9 H;  3ASO C;  4AQY O;  1SRY A;  4CH5 A;  5IWA O;  1QHT A;  3OUF A;  1PM9 A;  3M99 B;  2JIZ G;  4R7C A;  4D7S A;  2QDO A;  1J95 A;  4JGS A;  4P30 A;  3K5L A;  2UUB B;  4U3F H;  3K04 A;  2ADQ B;  1GM9 A;  2A3Q A;  3AG3 C;  2F66 C;  4B3S O;  4G2K A;  2AXT Z;  5JCO A;  1V55 C;  1EN6 A;  1ZL8 A;  2YID A;  1SQF A;  4DR1 B;  4B3R O;  3CX5 F;  1FFX B;  1XI1 A;  2X7R B;  4CS3 A;  3E35 A;  3T4Z A;  2GBO A;  2OWO A;  3RVY A;  2PF4 E;  3JAW A;  4PA6 A;  3W7W A;  3G4S V;  2EBO A;  4UCO A;  1S0V A;  2E5L B;  2RQ6 A;  3MHS C;  2VQF B;  3TJT A;  1AB3 A;  2GTA A;  1DK1 A;  3L72 H;  3UCS C;  4X1Y A;  4O4I B;  2XUM A;  1I94 B;  5LMU B;  1OCR B;  4HZ3 A;  4IIJ B;  3E8B A;  4JI5 O;  5EZY B;  2YDE A;  3HR0 A;  3SJB C;  1NZ6 A;  4DR2 O;  2AGA A;  4LWS A;  4Q20 A;  4X1I B;  3T4D A;  2F95 B;  1O9G A;  1VQ5 V;  4FLZ A;  4JV5 B;  1S76 D;  2ODM A;  2HLD G;  1ROP A;  3LNM B;  4F6R A;  1I5X A;  2UU9 O;  3P30 A;  2KB1 A;  5C93 A;  4O2B A;  2CE4 A;  1VQO V;  4JI2 B;  2QR4 A;  1IUR A;  4QPK A;  1M5I A;  3M8A A;  4LF9 O;  2Q5Z A;  4C7U A;  2WPD G;  1UJW B;  1MSD A;  2EIK B;  4PEL A;  4GKK O;  3AG2 B;  3ZHU A;  3ABK C;  1JJ2 U;  2HFE C;  1Q6U A;  4B3T O;  1N33 O;  3JAL B;  2GUZ A;  4BIO A;  1BS3 A;  2BSK B;  4I50 B;  1XL4 A;  2HJF C;  4FLY A;  1JOY A;  3VBB A;  2CUG A;  4J11 A;  5KMG B;  1YIT V;  2WLN A;  1R6K A;  5EBL C;  1VF6 C;  4LFC O;  2UXD B;  1K9M W;  1Q8I A;  1B6Q A;  3K57 A;  4YJ3 B;  5EBM C;  4PD4 F;  5KHI A;  2WLH A;  2PI5 A;  1ZX3 A;  5CA1 B;  3IAY A;  2V7Q G;  5KX5 A;  2F4V O;  2XAG A;  1K3E A;  4XDK A;  3F7Y C;  4CH4 A;  3SJQ C;  2YXH A;  3AG4 C;  4BW5 A;  1SQB H;  4RO2 A;  2DWD C;  1SC5 B;  1NBM G;  2VQE O;  1QVG U;  2GTS A;  5FPO A;  4AIL C;  3K0D A;  5L3E A;  2CDY A;  1M1K W;  1M90 W;  4ZHQ A;  2K9P A;  4LF4 B;  2OIE A;  1SKV A;  3ETD A;  2ZM6 B;  3G6E V;  3E22 A;  4GKK B;  2IH3 C;  3LSQ A;  3ABM B;  1VAR A;  4RQE A;  1RFY A;  3P32 A;  4X65 O;  2E76 B;  1CEZ A;  1R6N A;  4MVM A;  2N04 A;  2UXX A;  4MTX A;  2C2A A;  2DYR B;  1R6T A;  3I5D A;  1TUE B;  4F4L A;  5CN0 A;  3CCL V;  5KAF Z;  1YJN V;  4MVR A;  3B77 A;  4I50 A;  1KQS U;  2RN9 A;  4PDM A;  4ZOL B;  5BMV B;  1BL8 A;  1GH6 A;  4KL1 A;  5AG2 A;  3N2K A;  3H1L H;  1K92 A;  4JI8 O;  1W2B U;  3QF7 A;  3ABU A;  2Y4T A;  2PI4 A;  3RVZ A;  1XRE A;  2Y48 A;  4I9W A;  1R3J C;  2PTM A;  4TQD A;  5KA6 A;  4MVZ A;  2QM4 A;  3C90 A;  3E86 A;  4BR6 A;  4YJ2 A;  4JF3 A;  3G80 A;  1HR0 B;  5IDJ A;  3UM7 A;  4O2A B;  3B40 A;  3CMA V;  1B06 A;  3VQX A;  3J80 N;  2NR5 A;  3H01 A;  3CCM V;  3E2E A;  3CCS V;  3D36 A;  1NU1 H;  2QA4 V;  4FLV A;  1SF9 A;  3ASO B;  2Q0A A;  3R65 A;  3P3P A;  3J7A U;  3K08 A;  4IYH A;  4IGG A;  2PGG A;  4PI0 A;  3CCJ V;  2V1D A;  4LR3 A;  4JI6 O;  4NVP A;  2X6C A;  4I7Z B;  1WN7 A;  3BVO A;  4YXW G;  5LGN A;  2ARH A;  4HNA B;  2Q68 A;  2UXB B;  1NVP B;  4FFB B;  4JI4 O;  4PDR A;  2EIM B;  1MG1 A;  5E1A C;  2ZE8 A;  5FLX N;  1MMM A;  4UCR A;  2Y69 C;  3CRM A;  5DM6 V;  4MTF A;  2CTR A;  1NTK H;  3JAT A;  4R6Z A;  1Z2G A;  3JAK B;  4TWK A;  3N27 A;  4GCZ A;  1UFI A;  4FVM A;  1RP3 B;  3N2K B;  5K1X A;  2ADP A;  3CPW U;  3SJA C;  1SZT A;  5H6R A;  2IJH A;  1P4R A;  3QVN A;  3AG4 B;  4O4H B;  2LP7 A;  5IYB O;  3L75 H;  1NTM H;  3W7S A;  3HKD B;  3OR6 C;  4IL6 Z;  2E74 B;  3CC7 V;  3DXR B;  5IJ0 A;  1WAZ A;  3A0R A;  3VQY A;  2WLJ A;  5J2T B;  4KHP B;  2UXC B;  1NS1 A;  2V4D A;  2CH7 A;  3J81 N;  4MW8 A;  2OCH A;  2QGN A;  3BA9 A;  5A9G A;  1U97 A;  5CBG A;  1HNZ B;  3GVM A;  2QKS A;  3RYI A;  3SDL A;  3CCE V;  2XTA A;  2GUZ B;  2LGQ A;  4MW3 A;  2ZKO A;  2JGU A;  4LF5 O;  1MOF A;  4DV5 B;  3T1H O;  1M9N A;  1H2N A;  3D3Q A;  2HEP A;  1PNM A;  1SA0 B;  4DK1 A;  2Y0I A;  1J5E O;  4LP8 A;  2JEU A;  5D5P A;  3MAQ A;  4KXR A;  4JYC A;  3ZMU A;  4IT5 A;  3F7V C;  4YY3 O;  4X62 O;  4I4T B;  5JVD B;  4Z1M G;  5J2T A;  2WAM A;  3B09 A;  1BHA A;  3N2G A;  2R9I A;  2EUL A;  3CCR V;  3ZJZ A;  3WG7 B;  1SES A;  3RYC A;  2JJ1 G;  3CXC U;  3ZHV A;  4DR5 O;  4WFF A;  1BQZ A;  4WFB V;  2N74 A;  3IFX A;  4IIJ A;  4XBF A;  3CD6 V;  1WA8 A;  3EVK A;  1S5L Z;  4JTC B;  2R70 A;  4LC1 A;  3KCX A;  2UXN A;  3JD4 A;  3HKB B;  4O2A A;  2AZ0 A;  5FL7 G;  3AK1 A;  4GKJ B;  4CZZ A;  4HYO A;  4EKW A;  2ZXW B;  5EBW C;  3SPG A;  4X66 B;  4EB6 A;  2VWK A;  3RFR A;  1J5E B;  4DUZ B;  2ZE6 A;  3APO A;  3JCZ A;  2PUS A;  4ZKI A;  3OFN G;  2QTS A;  5KA5 A;  3OMI B;  4PA4 A;  2XAH A;  4DV6 B;  4H37 A;  1Q7Y W;  4DV7 B;  1N34 B;  1P7G A;  1ZTE A;  4QGP A;  5LP6 C;  4JTA B;  1NH2 B;  2UXC O;  2EIL B;  2WSS G;  4FLX A;  1WLE A;  2AW9 A;  1FAF A;  5H5N A;  5IYZ A;  3E89 A;  1XOU A;  4LF8 B;  4UXN A;  1V54 B;  3NXS A;  3STZ C;  1VMG A;  3BFR A;  1QR8 A;  2CGO A;  3EXA A;  5B1N A;  3JAL A;  2P5O A;  3K9A A;  4UVB A;  3CWB H;  1L0L H;  4JAU A;  4OX9 B;  3BCC H;  2Q9L A;  4P9O A;  4F6E A;  4O4J A;  1JA8 A;  1N33 B;  1Q6I A;  3RYH B;  4DXW A;  4DUY O;  1HNX B;  4UCV A;  4MTG A;  4TUY B;  4TUY A;  4WFG A;  2AHY A;  3ABL C;  1AJN A;  4KUM A;  5LGT A;  2JVD A;  1TUB B;  4TV9 A;  3RYH A;  2Q6A A;  3ZRW A;  3JCU Z;  4GKJ O;  2HVK C;  4DR6 O;  2VQE B;  3LDE A;  4X1I A;  2R72 A;  3CHX A;  3K59 A;  3OT7 A;  3D3I A;  2Y69 B;  2ZNJ A;  5BY1 A;  2F23 A;  5LOV A;  4TT3 G;  4JYA O;  4ASU G;  2IH1 C;  3OE7 G;  4LNU B;  3T1Y O;  4B3M B;  3BPZ A;  3MD0 A;  1V9P A;  3ETG A;  3CSX A;  5KAI Z;  1QLN A;  4PHZ A;  1NJI W;  1FJG O;  1XEQ A;  4W4K A;  1KKC A;  4O4L B;  2EIJ B;  5KHK A;  1XNQ O;  1K73 W;  1PNL A;  3DC5 A;  2E5L O;  4GT1 A;  4DR7 B;  2FYU H;  1WB7 A;  2RCV A;  1P7B A;  4PJ0 Z;  1RM1 C;  4DR1 O;  1IBM B;  4B3R B;  4X65 B;  4MVS A;  5CA3 A;  1XHZ A;  2YEV B;  2DYS C;  5LXT B;  4J7Z A;  2NN4 A;  1DGS A;  2ZIM A;  3QNE A;  5KX5 B;  1F51 A;  5JJE B;  3ZHT A;  2EIJ C;  3STL C;  2MW2 B;  4YIO A;  3RYI B;  1IDS A;  4I55 B;  3LUT B;  3RW0 A;  4KFM A;  2X6A A;  4LWS B;  3LNN A;  5LP6 A;  3OMN B;  3CXH F;  1E1Q G;  4H13 B;  3O9O A;  4I4T A;  1OCO B;  1DF5 A;  1KKD A;  4PI2 A;  5KUM A;  3Q4H A;  2ZR3 A;  5GW7 A;  1W0J G;  2BE3 A;  5JJJ B;  2QWN B;  4DUZ O;  2Y4U A;  1H2M A;  1VQ4 V;  3ZHQ A;  1SQP H;  3HKC B;  5LYJ A;  4JI3 O;  2F1M A;  3K0G A;  1GN4 A;  2FKX A;  1GMG A;  1RPR A;  2P4K A;  3ZRS A;  3ASN B;  1JFF B;  3AEI A;  5LMN B;  3HB3 B;  1XQ8 A;  2IU0 A;  1JVM A;  2M7W A;  3ZRW B;  4JI1 B;  1EZJ A;  2QWQ B;  5ITZ B;  5B3S C;  4QNH B;  1I08 A;  4LFC B;  1D5N A;  3AG3 B;  1NH2 D;  3QO5 A;  3SYA A;  2YSU B;  4Z2W A;  5IWA B;  3HKC A;  1GM8 A;  2WLL B;  3OW2 U;  1URF A;  1Q90 D;  5EC2 C;  3K79 A;  1L1F A;  3F5T A;  3BRC A;  4QJF B;  1R3K C;  2KQX A;  1P84 F;  3FKS G;  3TGU H;  4OXS A;  1AI4 A;  1XIL A;  4JI7 O;  3L9D A;  3JSN A;  4WFA V;  2Q69 A;  5DEC A;  2LQT A;  2EZO A;  2ATK C;  4UB6 Z;  1IXB A;  4JZG A;  3AG7 A;  4BIZ A;  3SPJ A;  5BR8 O;  2IJI A;  2W0X A;  1JQ0 A;  3ZS8 C;  5H9C A;  3WB0 A;  1I5Y A;  5CB4 A;  1H8E G;  3OEE G;  2YC0 A;  4YIP A;  1S3J A;  4UV9 A;  3JAT B;  1MZF A;  2ILM A;  4JI8 B;  3NR7 A;  2P06 A;  1XL6 A;  3DSQ A;  2EIK C;  2KKW A;  1A32 A;  2UUC B;  3OTO O;  2DWE C;  4MVO A;  5IE9 A;  3JSL A;  3L73 H;  1FFX A;  4FLT A;  3T1H B;  2ETN A;  4JI5 B;  4HNA A;  1H2K A;  2PYJ A;  4QIW F;  4I0X B;  1LR1 A;  1COW G;  4W4L A;  2LGW A;  4Z1V A;  4BWA A;  1GAX A;  1N8R W;  1N0J A;  1GO3 F;  3G6B A;  2NLJ C;  4P2Z A;  1BMF G;  3ZN1 A;  1DTO A;  3UO2 A;  1VP7 A;  1HNZ O;  2Q7H A;  2ZE5 A;  1RPO A;  1GM7 A;  4DV3 B;  1VQN V;  3L70 H;  1OHH G;  2ITC C;  1B04 A;  3U11 A;  3BAA A;  3ETQ A;  2Z0A A;  1N32 B;  2QKC A;  4JYA B;  5JVD A;  2XAJ A;  4ZI7 A;  5LMN O;  2QWP B;  4UCU A;  1JMK C;  2LW1 A;  4NXM O;  1R73 A;  5EIB C;  2YIB D;  1Q43 A;  4YJ2 B;  4CS4 A;  4K0K B;  2HP8 A;  1ZWI C;  4UCS A;  4A5U B;  4TV9 B;  1BE3 H;  2IJK A;  5GON A;  5GON B;  4FPP A;  2HVJ C;  1SQX H;  4DV2 O;  1VF7 A;  3ML0 A;  1KC8 W;  3OUS A;  2LO1 A;  2WLI B;  4DV4 B;  4AQY B;  2PZS A;  1RM1 B;  3ZED A;  1TAE A;  2AZ2 A;  4FZ0 A;  3ZIA G;  4ZOL A;  3MHH C;  3RYF A;  3WG7 C;  5BMV A;  5E79 Z;  1IX9 A;  1YEW A;  1GRJ A;  1WA8 B;  2JGD B;  1L0N H;  4DW0 A;  2XAQ A;  4DRX B;  2O57 A;  2P4V A;  2RDC A;  3HKE A;  2P6J A;  3RBZ A;  3SPI A;  5L3F A;  1VQ9 V;  3K9S A;  4YHH O;  3KG2 A;  3JYC A;  1G4Y B;  5BZB A;  1OJH A;  3E22 B;  2H3O A;  1YIJ V;  3CME V;  4Q6G A;  3D8C A;  3IC7 A;  3B8M A;  3AK2 A;  4DR4 B;  4RWU A;  1YJ9 V;  4LFA O;  2QWO B;  4NTW A;  2KSD A;  5EIB D;  1XMQ B;  2ZE7 A;  3K5O A;  3SPH A;  4X8A A;  3K58 A;  1HP8 A;  1MA1 A;  3E8F A;  2HHH O;  4WBN B;  4UUJ C;  1ARO P;  4GX2 A;  3H1H H;  3H1I H;  1K8A W;  5CA1 A;  3RN4 A;  1AI6 A;  3PN1 A;  4DR5 B;  3LDC A;  2W6J G;  1ZSP A;  2D2C B;  2EJR A;  2OCC C;  1NKD A;  4CBC A;  4I55 A;  4EFE A;  5B5E Z;  3SYO A;  4LF7 B;  2QWR B;  1OCZ B;  1I0H A;  5LGU A;  2Q8V A;  1H2S B;  3TK1 A;  5LHH A;  2HG5 C;  1BHB A;  3FB5 C;  1NR7 A;  1H38 A;  2BSK A;  4K8X A;  3FX7 A;  1HR0 O;  5JCO C;  2ZDI A;  2WLI A;  1EBO A;  1KYO F;  3JAK A;  3S3W A;  3CRC A;  5JQG B;  2QKA A;  3WU2 Z;  3JAW B;  3OMA B;  1NT2 B;  2EZP A;  3BAB A;  3KKY A;  2IU3 A;  4FJC C;  4LBE C;  4O2B B;  1SQG A;  1XHX A;  4X20 B;  2P90 A;  1QNM A;  3CP1 A;  4BAY A;  3CS5 A;  2JRI A;  4NTY A;  4J10 A;  3ABL B;  2KG7 A;  4RQF A;  4YJ3 A;  5CA0 A;  3U0Z A;  4CC5 A;  1R3I C;  2HJD A;  4B3S B;  5FPR A;  5H2F Z;  4GX1 A;  2GDS A;  5IY5 C;  4JI3 B;  1Q81 W;  1THZ A;  2F93 B;  3WB1 A;  1M56 B;  3JD0 A;  5IYZ B;  1HNX O;  4TV8 A;  3K03 A;  4WCE V;  4O4H A;  2CGN A;  1UPG A;  2WLL A;  1YSC A;  4FZ1 A;  3R66 A;  3SYQ A;  5L3G A;  1QQC A;  2BOB C;  3E83 A;  1RSO A;  4B7E A;  1B3Q A;  3ICX A;  2B1I A;  2XAS A;  4JPR A;  4TSF G;  1GK9 A;  4RUE A;  4J7K A;  2VWJ A;  5HFM A;  4PA7 A;  3IGA C;  3DGE A;  3I55 V;  2DQ0 A;  4JI7 B;  2OIG A;  1S5H C;  4NXM B;  3D36 C;  1OCO C;  1YCI A;  3C3S A;  2DMX A;  3TXQ A;  4X1K B;  1PNK A;  2ZNI A;  4DR2 B;  1V54 C;  4TOI A;  2B5U A;  2JEX A;  5HFL A;  1Y4M A;  3SPC A;  1KUQ A;  1T5E A;  2YIB A;  4LFB B;  4RAI A;  1PKX A;  1N32 O;  5B66 Z;  3ABM C;  2OYQ A;  3MDS A;  2DW4 A;  3ABT A;  5JH7 B;  2RJZ A;  1K5Q A;  2UU9 B;  1GN6 A;  3A2F A;  3T1C A;  1XMQ O;  2XHB A;  2N05 A;  4LF5 B;  1YVW A;  3L74 H;  1BQ0 A;  3B2E E;  1AR4 A;  1M56 C;  3OAA G;  1QLE B;  1S77 D;  1OCR C;  1YZB A;  1AI5 A;  4X1K A;  4J7J A;  4IYI A;  2HHH B;  1LNQ A;  1SA0 A;  4D7T A;  3UQ8 A;  1VQP V;  1FJG B;  2DQ3 A;  4EFB A;  1K33 A;  4U7N A;  1FXK B;  2K1E A;  1AJP A;  3B8N A;  1K4D C;  4ICG A;  1GN3 A;  1ZL8 B;  4GX0 A;  4P9P A;  1WJZ A;  4ZI7 B;  2EIN C;  2BOC C;  1RSO B;  3OGI B;  5F2V O;  1IBK B;  2FB5 A;  5KHJ A;  2XAF A;  1IBM O;  2XOK G;  4UVA A;  2QM8 A;  3DTU B;  1IXM A;  3RYC B;  2UUC O;  5FNV A;  4ZBM A;  2OT5 A;  2EIM C;  1CPY A;  1LUW A;  1PPJ H;  4DR3 O;  1VQM V;  2GV9 A;  1K5S A;  4CS2 A;  5CA0 B;  3TET A;  1Q3E A;  4NYK A;  3ZRX A;  4NR1 A;  3JAM N;  1XBL A;  3TXS A;  2YI9 A;  4QE7 A;  4X89 A;  1QBZ A;  2QTO A;  1IBL O;  1TVK B;  3CEI A;  1YF2 A;  1XMO O;  5EK0 A;  4JAV A;  1FYJ A;  1QLE C;  1Z5W A;  3H1J H;  1R3L C;  4O4J B;  4JAS A;  1NTZ H;  4DV7 O;  1N34 O;  2BTQ B;  2ZIN A;  3X2Q B;  4ABM A;  1AJQ A;  1D2D A;  1TVK A;  1QU7 A;  2FTK A;  5J2U B;  2GHY A;  4H33 A;  3ZMT A;  2UXD O;  2ITD C;  4DV1 O;  3M7M X;  5IT9 N;  2H8P C;  4LF8 O;  4G27 B;  3CJH B;  2P22 C;  2EIL C;  3EHB B;  4J9Z B;  4JYY A;  1Q6H A;  2CH7 B;  4MVQ A;  1KBH A;  4BW9 A;  1WNS A;  1SQV H;  1WP8 A;  1N4C A;  1TA8 A;  2Q73 A;  4LH6 A;  2KG7 B;  2WLM A;  3APQ A;  1KMI Z;  1VF6 A;  2UXB O;  5LOV B;  3CCQ V;  3FFQ A;  4FLW A;  3UKM A;  1F4N A;  1XNR O;  1OCZ C;  3OEH G;  2ZD9 A;  4AI8 A;  5KUK A;  3IC9 A;  1MNG A;  3JD2 A;  1XDC A; 
#chains in the Genus database with same CATH homology
 2AHZ A;  5LBQ A;  4PDR A;  2EIM B;  1MG1 A;  4G28 B;  1FXH A;  5E1A C;  5L3D A;  5CMU A;  3FYE B;  4X88 A;  1N8R W;  4WFH A;  2Y69 C;  5LHI A;  1GO3 F;  5B1B B;  5DM6 V;  2NLJ C;  4P2Z A;  1BMF G;  3ZN1 A;  1DTO A;  4MTF A;  1RPO A;  4R6Z A;  1ORQ C;  3ZCC A;  1GM7 A;  1Y66 A;  4TWK A;  1VQN V;  4GCZ A;  1OHH G;  2ITC C;  3X2Q C;  5CBH A;  3ZRV A;  2ZQM A;  3CPW U;  3OM3 B;  2ZDI C;  1SZT A;  2XAJ A;  5H6R A;  2IJH A;  1EFR G;  1P4R A;  3T2M A;  3AG4 B;  3E8G A;  2LP7 A;  4MSW C;  1YI2 V;  1R73 A;  5IYB O;  3W7S A;  4XDL A;  1SER A;  3BY6 A;  1ZWI C;  3OR6 C;  3CC7 V;  3CC4 V;  3A0R A;  3ZN0 A;  2WLJ A;  2IJK A;  1OCC C;  4FPP A;  2Z5U A;  4JYB A;  2HVJ C;  3VOU A;  4DO2 A;  4JTD B;  5H6Q A;  1DF4 A;  2OTJ V;  1ENV A;  3ML0 A;  1GKF A;  2W0F C;  3ABK B;  3FYI B;  1KC8 W;  3FB8 C;  3OUS A;  2WLI B;  4PDV A;  4MW8 A;  5CBF A;  1FXV A;  3E8H A;  1RM1 B;  5IYC O;  1K4C C;  5CBG A;  2Q67 A;  2QKS A;  4R50 A;  3ZIA G;  3MHH C;  2WWW A;  4MT8 A;  3WG7 C;  3CCE V;  3AG1 B;  1OZ0 A;  5B3S B;  1SET A;  1QCE A;  4MTO A;  1FXK A;  4MW3 A;  2XAQ A;  2Z3Y A;  3W7X A;  4RUF A;  1MOF A;  3CYO A;  2P6J A;  2X0L A;  2EIN B;  3RBZ A;  2IJJ A;  1WPX A;  3SPI A;  2MK3 A;  5L3F A;  1VQ9 V;  1M57 C;  2A9H A;  4U7O A;  1PD3 A;  3KG2 A;  3JYC A;  1G4Y B;  1M9N A;  5BZB A;  1FXK C;  2A79 B;  2HR3 A;  2JDI G;  1PNM A;  1KEC A;  1YIJ V;  3CME V;  1AI7 A;  4LP8 A;  2JEU A;  2HKO A;  1M57 B;  3IC7 A;  1YJW V;  3BEH A;  4JYC A;  3ZMU A;  1F23 A;  3B8M A;  3F7V C;  1YHQ V;  1E1R G;  4QE9 A;  1YJ9 V;  1JX9 A;  3CCV V;  1G8M A;  2JK5 C;  4Z1M G;  1YTF D;  2WAM A;  3QO7 A;  1BHA A;  1K7D A;  4X8A A;  2R9I A;  3SPH A;  3GWO A;  3CCR V;  3ZJZ A;  3WG7 B;  1SES A;  4KP4 A;  1Q86 W;  5L3C A;  4L87 A;  2JJ1 G;  3CXC U;  4WFF A;  3E8F A;  1NQT A;  4WFB V;  3IFX A;  2DYS B;  2QM7 A;  4N23 A;  4UUJ C;  4XBF A;  1ARO P;  3K06 A;  3CD6 V;  4GX2 A;  1K8A W;  4WF9 V;  3W7U A;  2OCC B;  4JTC B;  4LC1 A;  1AI6 A;  1VQK V;  2UXN A;  3JD4 A;  1K34 A;  4MS2 A;  3ASO C;  3LDC A;  2W6J G;  5FL7 G;  1SRY A;  4CZZ A;  4HYO A;  4EKW A;  2ZXW B;  3OUF A;  4J9Y B;  2EJR A;  5EBW C;  3SPG A;  3M99 B;  2JIZ G;  2OCC C;  4R7C A;  1J95 A;  1NKD A;  4JGS A;  4P30 A;  4CBC A;  1PL0 A;  1QR9 A;  3K04 A;  3GB7 C;  3SYO A;  1GM9 A;  1AR1 B;  3AG3 C;  3JD3 A;  2W6I G;  3JCZ A;  1OCZ B;  4UVC A;  4BIU A;  2LFR A;  4G2K A;  5LGU A;  3TK1 A;  3AG2 C;  2DYR C;  2HG5 C;  4ZKI A;  5LHH A;  3OFN G;  5KA5 A;  1BHB A;  1V55 C;  3OMI B;  4PA4 A;  3FB5 C;  2XAH A;  3CCU V;  4H37 A;  1Q7Y W;  1HWY A;  1NR7 A;  1VQ7 V;  4FMT A;  1H38 A;  2CK3 G;  4JTA B;  1NH2 B;  2X7R B;  3E35 A;  1GTO A;  3T4Z A;  2EIL B;  1V55 B;  2WSS G;  1VQ8 V;  1WLE A;  2ZDI A;  2QEX V;  3RVY A;  2WLI A;  1EBO A;  1KP2 A;  3E89 A;  2NNU A;  4UXN A;  3OMA B;  2EZP A;  3OR7 C;  4PA6 A;  3W7W A;  2IU3 A;  1V54 B;  3NXS A;  4FJC C;  4LBE C;  4WFE A;  3EFF K;  3G4S V;  2P90 A;  2EBO A;  3STZ C;  1S0V A;  3MHS C;  1QR8 A;  2JJ2 G;  5B1N A;  3CP1 A;  4BAY A;  3K9A A;  4UVB A;  3SYP A;  4JAU A;  3ABL B;  4P9O A;  4RQF A;  1JCH A;  1OCR B;  1R3I C;  4HZ3 A;  1MAB G;  3E8B A;  2LFS A;  4DXW A;  2YEV A;  4GX1 A;  5IY5 C;  4MTG A;  1Q81 W;  4WFG A;  2AHY A;  3OGC C;  3ABL C;  1THZ A;  1AJN A;  4KUM A;  5LGT A;  1FS0 G;  1MSW D;  1M56 B;  3JD0 A;  4GX5 A;  4Q20 A;  2IW5 A;  3T4D A;  2Q6A A;  3K03 A;  1VQ5 V;  3ZRW A;  4WCE V;  1NVP D;  2WLL A;  1YSC A;  1S76 D;  2HVK C;  4PA9 A;  3SYQ A;  3LDE A;  5L3G A;  2BOB C;  2HLD G;  1ROP A;  3LNM B;  3E83 A;  1I5X A;  5B1A C;  2B1I A;  3P30 A;  2KB1 A;  2XAS A;  3D3I A;  4JPR A;  2Y69 B;  4TSF G;  1GK9 A;  5C93 A;  4RUE A;  1VQO V;  3ASN C;  4QPK A;  4TT3 G;  1FFT B;  4ASU G;  2IH1 C;  5HFM A;  3OE7 G;  4PA7 A;  3IGA C;  3DGE A;  3ZMZ A;  4PDL A;  3I55 V;  2DQ0 A;  4UV8 A;  1S5H C;  2WPD G;  1UJW B;  2EIK B;  4PEL A;  1OCO C;  3MD0 A;  4LCU C;  3AG2 B;  1JJ2 U;  3ABK C;  2P7T C;  4MVU A;  2HFE C;  3ETG A;  1QLN A;  1PNK A;  5IY5 B;  1NJI W;  5IYD O;  1XL4 A;  1V54 C;  2HJF C;  2B5U A;  4XDJ A;  1JOY A;  3VBB A;  2JEX A;  2F43 G;  5HFL A;  1Y4M A;  1YIT V;  3SPC A;  2WLK A;  3K3W A;  2WLN A;  1R6K A;  2EIJ B;  5EBL C;  4R8C A;  1K73 W;  1NR1 A;  1PNL A;  1K9M W;  1B6Q A;  2A0L A;  4GT1 A;  4RAI A;  1PKX A;  3FB6 C;  4HAM A;  3ABM C;  2DW4 A;  4PA3 A;  3ABT A;  3LSS A;  3PJS K;  5EBM C;  1K5Q A;  1P7B A;  1RM1 C;  2WLH A;  3T1C A;  2PI5 A;  2B1G A;  4MVS A;  5CA3 A;  2YEV B;  2DYS C;  1VQL V;  1DLB A;  1OCC B;  5B1O A;  3QNE A;  4E2L A;  2V7Q G;  1M56 C;  3OAA G;  1F51 A;  1QLE B;  5L3B A;  1S77 D;  2XAG A;  4I5S A;  1OCR C;  1K3E A;  4XDK A;  3F7Y C;  2EIJ C;  1AI5 A;  3STL C;  3SJQ C;  3AG4 C;  4BW5 A;  4RO2 A;  2OTL V;  1LNQ A;  4FIP C;  2DWD C;  1NBM G;  1K97 A;  1VQP V;  2QE7 G;  3LUT B;  2P67 A;  3RW0 A;  3QO8 A;  2DQ3 A;  1QVG U;  1K33 A;  4KFM A;  2X6A A;  4U7N A;  1FXK B;  2K1E A;  3OMN B;  1AJP A;  3B8N A;  1K4D C;  3K0D A;  5L3E A;  1E1Q G;  1OCO B;  5B1B C;  1DF5 A;  1M1K W;  1M90 W;  1KKD A;  5KUM A;  4GX0 A;  2ZR3 A;  4P9P A;  5GW7 A;  1W0J G;  5J9P C;  1CP9 A;  2EIN C;  2BOC C;  3LDD A;  3I56 V;  3ETD A;  1VQ4 V;  2GSM B;  2XAF A;  3G6E V;  2XOK G;  4UVA A;  2IH3 C;  3K0G A;  3ABM B;  3LSQ A;  2QM8 A;  4RQE A;  1GMG A;  3DTU B;  1IXM A;  1RPR A;  3ZRS A;  3ASN B;  4ZBM A;  3P32 A;  3AEI A;  2OT5 A;  3ZMV A;  2EIM C;  1E79 G;  1CEZ A;  1CPY A;  3HB3 B;  2IU0 A;  1JVM A;  2M7W A;  1R6N A;  4MVM A;  3ZRW B;  4MTX A;  2UXX A;  3HPL C;  2C2A A;  5EC1 C;  1JPX A;  2DYR B;  1EZJ A;  1VQM V;  1TUE B;  1H2G A;  1K5S A;  4F4L A;  5CN0 A;  4QNH B;  5B3S C;  3CCL V;  3FB7 C;  1NH2 D;  3AG3 B;  3TET A;  3QO5 A;  1YJN V;  4MVR A;  3B77 A;  3ZRX A;  3SYA A;  1KQS U;  2YSU B;  4PDM A;  3TCU A;  3W7T A;  1GM8 A;  1BL8 A;  2WLL B;  3OW2 U;  1KD1 W;  4N21 A;  5EC2 C;  3K79 A;  4QE7 A;  1L1F A;  1Q82 W;  3CC2 V;  4QJF B;  4X89 A;  1R3K C;  1K92 A;  1QBZ A;  2QTO A;  3JD1 A;  3FKS G;  4OXS A;  4QPJ A;  1W2B U;  1AI4 A;  5B1A B;  5LHG A;  2ZXW C;  3ABU A;  3ETE A;  1S72 V;  2PI4 A;  5EK0 A;  4JAV A;  3RVZ A;  4WFA V;  2Q69 A;  2Y48 A;  1QLE C;  3AG1 C;  4I9W A;  1R3J C;  1R3L C;  2EZO A;  4JAS A;  2ATK C;  1KP3 A;  3X2Q B;  1AJQ A;  5KA6 A;  1VQ6 V;  4MVZ A;  2FTK A;  3E86 A;  4BIZ A;  4JF3 A;  3SPJ A;  3G71 V;  2GHY A;  2XND G;  5IDJ A;  3UM7 A;  5DN6 G;  2IJI A;  4H33 A;  3CMA V;  3ZMT A;  1JQ0 A;  2ITD C;  5H9C A;  3H01 A;  3CCM V;  3E2E A;  3SYC A;  3CCS V;  3D36 A;  2H8P C;  1I5Y A;  4G27 B;  2QA4 V;  1H8E G;  2EIL C;  3EHB B;  3OEE G;  4J9Z B;  3ZMS A;  4MVQ A;  1S3J A;  4UV9 A;  3ASO B;  2H94 A;  2X6B A;  3R65 A;  1YTF B;  3K08 A;  1XL6 A;  3F5W C;  1W0K G;  2EIK C;  1F4M A;  4FK5 C;  2WLM A;  3CCJ V;  2DWE C;  4MVO A;  1H8H G;  2V1D A;  2ZR2 A;  3CCQ V;  2X6C A;  3UKM A;  1F4N A;  1OCZ C;  3WFV A;  2D3O W;  4YXW G;  5LGN A;  3OEH G;  2ZD9 A;  5KUK A;  4QIW F;  2Q68 A;  1QVF U;  3JD2 A;  2R9R B;  1NVP B;  1COW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...