4H37A

Crystal structure of a voltage-gated k+ channel pore domain in a closed state in lipid membranes
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
NGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Voltage-gated K+ Channel Pore Module in a Closed State in Lipid Membranes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Membrane protein
molecule keywords Lmo2059 protein
total genus 24
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4h37A00
4PA9A 2HJFC 4R8CA 4F4LA 3E8FA 3SYOA 3TETA 2EINC 2BOBC 2AHZA 1M56C 4X88A 4MW3A 4MTGA 4J9YB 4XDKA 1S5HC 3IGAC 2W0FC 3SPHA 4BW5A 4MVRA 3ABKC 3K08A 4H33A 4WFFA 1KKDA 3SPIA 3LNMB 2A0LA 3E83A 3RBZA 4P2ZA 3ZJZA 5BZBA 5CBGA 4OXSA 5EBLC 1K4DC 4PA7A 2Q69A 3EFFK 2EIMC 2EIKC 5CBHA 3RW0A 4EKWA 1P7BA 4XDLA 2WLMA 5EBMC 5EC1C 4QE7A 4MVSA 4GX2A 4MS2A 3SYCA 1QLEC 2IH1C 2A79B 2ZXWC 2DWEC 2WLIB 5EBWC 3STZC 4MVZA 5KUMA 2WLHA 3SPJA 3FB6C 4R6ZA 3K06A 3LDDA 4J9ZB 3WG7C 3FB7C 5IY5C 3ASNC 4MTFA 2EILC 5E1AC 4RUFA 4PDMA 3AG3C 3PJSK 3ABMC 3K04A 1R3IC 2X6AA 4RUEA 1R3LC 3HPLC 4MVOA 3GB7C 4WFEA 4JTDB 3UM7A 3FB5C 2ITCC 3ABLC 4MSWC 1V55C 1ORQC 2OCCC 4PA6A 5EC2C 2YEVA 3UKMA 2QKSA 4HZ3A 4JTCB 4X89A 4KFMA 5J9PC 3RVZA 1R3KC 4TWKA 4LCUC 4UUJC 5B3SC 2AHYA 4MTOA 2H8PC 2IH3C 2Y69C 3K03A 4P30A 1ZWIC 3E89A 2R9RB 4MVMA 3E8GA 4G27B 4RAIA 3T1CA 3SYQA 2WLLA 3E8BA 2WLLB 1OCZC 3JYCA 3T4DA 3OUFA 4H37A 4MW8A 4ZBMA 2ITDC 3F5WC 4X8AA 2JK5C 2DYSC 3E8HA 5B1BC 2NLJC 4GX5A 3ASOC 3OUSA 4CBCA 4XDJA 3RVYA 3SYPA 2A9HA 2QTOA 5EK0A 1OCRC 2HVJC 3KG2A 3OGCC 3TCUA 3K0GA 4PDRA 3AG2C 4RO2A 3STLC 1OCOC 1R3JC 2EIJC 4LP8A 3LDCA 1K4CC 1JVMA 1V54C 4P9PA 2HVKC 3X2QC 2Q68A 4G28B 2P7TC 3LDEA 3AG1C 4R50A 2X6CA 1J95A 1XL6A 4MVQA 2BOCC 3BEHA 4WFHA 2DYRC 3T4ZA 3FB8C 4GX0A 3K0DA 3LUTB 5B1AC 3SYAA 3IFXA 4I9WA 4HYOA 4QNHB 1OCCC 3F7VC 3VOUA 2DWDC 2WLNA 2WLIA 3F7YC 4R7CA 5CBFA 4PA3A 5KUKA 4QE9A 2K1EA 4PDLA 3T2MA 2X6BA 2Q6AA 4WFGA 2HFEC 2HG5C 3R65A 1M57C 3SJQC 3ZRSA 1BL8A 3E86A 4P9OA 3AG4C 2WLJA 1LNQA 3SPGA 4PDVA 2WLKA 3SPCA 4MVUA 1G4YB 3OR6C 1XL4A 3OR7C 4JTAB 2ATKC 2ZD9A 4DXWA 2Q67A 4GX1A 4LBEC 2KB1A 4PA4A
chains in the Genus database with same CATH superfamily
4Z1MG 3TETA 3SYOA 1SQPH 3JD0A 1MSDA 4XDKA 3T1YO 2QM4A 5IYZB 4KXRA 2KKWA 3LNMB 1RP3B 3E83A 1E1QG 4DV0B 1IZ3A 2B5UA 3H01A 4K8ZA 4DV5B 2MK3A 3J7AU 5FLXN 2A79B 5CA1A 2QJ1A 3FB6C 3ABMB 4DV4B 4PDMA 4PHZA 4NXMB 1R3LC 1NTZH 1VARA 5JH7A 3CMAV 1HW7A 4CS4A 1E79G 3RWRD 4LF7B 4LNUA 1H8EG 2IH3C 3HB3B 4WFBV 1WPXA 2R9RB 5JVDB 4GUNA 2HEPA 4ZBMA 1S76D 3WB0A 2X0LA 1PPJH 3LSSA 3CCJV 2UUBO 5BMVA 5IJ0A 4I50A 4ZHQB 3QVNA 1YTFB 2GUZB 1R3JC 1JVMA 1VQPV 3CCSV 2RCVA 3AEIA 5H6QA 2LP7A 2Q68A 4G28B 4BW9A 2X6CA 5A2QN 1WA8A 2BOCC 2ADQB 4N21A 1FFXA 1W2BU 3LUTB 5CA3A 3RYCA 3RYFB 4CC5A 3DC6A 1WJZA 3RYIB 4JI8B 2PUSA 1VMGA 2YXYA 2OIEA 3T2MA 2HFEC 1I0HA 2ZE6A 2D3OW 1K34A 1W59A 4O2AB 4LF6B 2F43G 1PL4A 2ILMA 5FNVB 3HKEB 4NTXA 5BMVB 1PM9A 5ITZA 3WU2Z 4FM1A 3AK3A 1YCIA 4CZZA 2CE4A 3B8MA 5IYDO 4UB8Z 3ABKC 2ZIOA 2JJ1G 3UO3A 3SPIA 2L6LA 2WA3A 4WFAV 3AK1A 3EFFK 1XNRB 3RW0A 2QWQB 3L73H 1K5SA 3N2KA 2XASA 2IJJA 3G4SV 1XMOB 1VIBA 2BSKB 4FK5C 4HNAB 3WB2A 2QKAA 1HDJA 1JOYA 5KAIZ 3JD3A 3ABLB 2EILC 2QKCA 5KHJA 2UUAB 3CRMA 3A0RA 1UFIA 1AP5A 2RQ6A 4YHHO 2KG7A 4X89A 5JWPA 1K97A 1BSMA 3RYIA 1S5JA 1LUVA 2CH7A 2ZCEA 1FJGB 1FFXB 4NVPA 3T4DA 1WA8B 2ZIMA 5CMUA 5FPOA 2YUAA 1URFA 3CX5F 3CEIA 2RN9A 4F6EA 3SJAC 1L0NH 3HKCA 2VQEB 1Y76A 2RDCA 4LF7O 5CA0A 1F7YA 1TAEA 1JJ2U 4DUYO 1J95A 1OZ0A 4MVQA 3H9VA 2UXNA 5EIBD 3C3SA 3O9OA 1GM7A 1ROPA 1OCCC 1KQSU 4F6RA 3A8TA 2Q8VA 5CBFA 4O4LB 2F66C 4PA3A 2X6BA 3CCVV 4KUMA 3K57A 4O2BB 3JAWB 2QEXV 5IYCO 3ZX6A 4FLTA 1OJHA 4IGGA 2ATKC 3QTCA 1PL0A 2Q67A 1Y6XA 1JX9A 4PA4A 1IXMA 4R8CA 4F4LA 5IWAB 3BCCH 2FB5A 2JGDA 4GCZA 2Q4PA 3SPHA 4JI7O 4X64B 5K1XA 4DR3O 4ZOLA 4J7ZA 1Q6UA 3OE7G 5FPRA 5CB4B 5A9GA 2OWOA 3CP1A 4FFBB 1GAXA 2A06H 4FLZA 4OGQB 5KA6A 3F5TA 2PZSA 3S3XA 2GDSA 3OMIB 4X1IB 4K35A 2PGGA 5EBWC 3TK1A 1KB9F 4DO2A 2HHHO 5J2TB 5B1AB 1VQKV 5KX5B 4I0XB 3CD6V 2FKXA 1SQGA 3THOA 4TV9A 3S3WA 4FFBA 4X1KA 1YSCA 2YI9A 2EX3A 2W6IG 2Y69C 3GVMA 4LF9B 1N34B 3QF7A 4X8AA 5DECA 3OEEG 1GKFA 3K9AA 2ZNIA 4FMTA 2UU9O 1N8RW 3FAVB 2Y0IA 5GONB 4JI2O 2DN9A 4DUYB 5BXZA 4U7OA 2CTQA 1V54C 2N04A 5IYBO 3D36A 4DR1B 5B1BB 5LMNB 1JR9A 1Y74A 1NBMG 5H5NA 2CGOA 4PI2A 3D36C 5BR8B 1ZX3A 3ETDA 2Q6AA 1P4RA 1JCHA 2IBZH 4WCEV 3ZS8C 1KMIZ 4JF3A 1K8AW 1GM9A 4JTAB 3K79A 1M9NA 3AG1B 3R66A 4K0KO 3BPZA 2YIBD 2Y0PA 2W0XA 4CH6A 2F95B 4K8XA 2BCCH 5LA6A 4OXSA 3QO5A 3AG7A 3JD2A 3HKDB 2F4VO 4X1YB 3ZMUA 2Q0OC 4I7ZB 3DC5A 1SESA 2DWEC 1OCCB 2ZR3A 3CMEV 1CXZB 1L0LH 3FB7C 4UVCA 4DV6B 2LW1A 2VRZA 1H2GA 3W7WA 2MW2B 3ABMC 2X6AA 2XAFA 2NN4A 2UUCO 2QWRB 2YEVA 1ZAUA 4HZ3A 4FIPC 2XAJA 5LP6B 3FKSG 5FL7G 2QE7G 3TJTA 1HNZO 1D5NA 2E5LB 4QIWF 5LOVB 1M93A 2DYSC 1QR8A 3JAKA 1AR1B 2UXDO 1IVSA 3ETGA 3D8CA 2DQ0A 3RGBA 1YJ9V 4UV8A 4B3SO 4OX9O 3NR7A 3ETQA 4JI6O 5LL6Y 3LDCA 2WWWA 2ZNJA 3WB1A 4YJ2B 4I0XA 2V7QG 1I5XA 4G2KA 1FXVA 4GX0A 1QU7A 3K0DA 3T1HO 5LXTB 5L3BA 4TT3G 5KAFZ 1K73W 3OFNG 3AG2B 5K1PA 1SQXH 2QWOB 3O65A 4IHJB 4X1IA 1V55B 2HLDG 1CPYA 1SA0A 2P6JA 1RPOA 1FYJA 3CRCA 4PDVA 2C2AA 4BR6A 4X66O 2R9AA 4HBNA 2JGDB 1BCCH 3FD9A 2VQFO 2P06A 4B7KA 1WB8A 4H33A 5JVDA 3CSXA 2A0LA 3RBZA 4D6TH 4DR5O 1WLEA 1RFYA 1OCZB 2Z0AA 1VQ4V 2AZ0A 5JH7B 3CJHB 3FFQA 4FLYA 2AZ2A 1M4UA 4NTWA 4B3TO 2XT9A 2IW5A 5B5EZ 3ABKB 3CXCU 1V55C 4PA6A 3SR2C 3TXQA 3I56V 2K9PA 2HJDA 2YC0A 1NR1A 4MVMA 2CTPA 2FMLA 3SYQA 2OCHA 1NT2B 4DRXB 4H37A 4MW8A 2A7WA 3ABUA 5DN6G 3CPWU 5B1BC 1IBLO 1NQTA 3KG2A 5B1OA 2YICA 4JGSA 1FXKB 1GH6A 4PDRA 4KHPB 5LHHA 2NNUA 1RSOA 3STLC 4O4LA 3OTFA 3CRRA 2DYSB 5GTHZ 3ZRWB 2DYRC 2QSAA 3CC2V 4LF4O 2LFSA 3D3QA 4O4IB 5KUKA 1M57C 4DV1B 3OM3B 3ZRVA 3A0HZ 1X59A 1SETA 2Z5UA 5D5PA 5H9CA 3ZHTA 4LH6A 1NZ6A 1SQVH 1GO3F 3M7MX 1WPBA 2M6YA 2JVDA 3VQXA 1FXKC 3ZRXA 1Q6IA 3VQWA 4UVBA 4PA7A 3UO2A 4OX9B 1M57B 1KU9A 3SYCA 1QLEC 1FPOA 1GM8A 4J80A 1K5QA 4RWUA 4R6ZA 3LDDA 4J9ZB 4W4KA 4JAUA 3JAMN 1XBLA 1PNKA 3MDSA 1HP8A 1WP7A 1R73A 4JI3B 3JATB 4ZIBA 1QNMA 2ZDIA 1KD1W 1B3QA 4JTCB 1H38A 2P22C 2P4KA 2PYJA 2Y69B 4UUJC 1NTKH 2H8PC 5CN0A 3K9SA 3QG5A 1FKAO 4TUYB 4H44B 3E8BA 4MTXA 4ABMA 4BIOA 4O4HA 2ITDC 4DW0A 3HKEA 4IIJA 4JI5O 4H13B 2XNDG 1ZL8A 2ZKOA 3JALB 3IAYA 3KKYA 4J7KA 5KMGB 3M8AA 5L3FA 4DR4O 1AI4A 1O9HA 4FLXA 2IJKA 4TV8A 3L74H 1YIJV 1BS3A 1Q43A 3ZHQA 2LGQA 4DK1A 1F51A 4WFGA 4B3MO 4U3JB 4NXMO 3SJQC 1PKXA 1MZFA 1G6UA 4P9OA 3AG4C 1VQNV 4I9QA 3SPCA 2Q7EA 2H3OA 1L1FA 4IYIA 1RM1C 3N27A 1PNMA 4FVMA 5JQGB 4KL1A 2EINC 4DV0O 2ODMA 4LNUB 4MTGA 2QA4V 3WFVA 3HR0A 3E22B 3CJHA 4O2BA 3I5DA 1G1XB 2FYUH 1TVKA 1BQZA 2EZOA 4F6RB 1XDCA 1MSWD 1H2SB 5H6RA 3N2GB 2Z3YA 1SS3A 1ZL8B 4FZ1A 4K3AA 1MNGA 2YXLA 2R70A 2CGNA 5IY5C 3ASNC 1I5YA 2DQ3A 1F4MA 4CH3A 2XOKG 3L75H 1N36B 5LA6B 1K33A 4TQDA 1BGYH 4GLXA 1JPXA 1ZSPA 2G38A 2YIBA 2WA4A 3E89A 4JI0O 1PV0A 3JYCA 3OUFA 4UFZA 4X20B 3RVYA 2BTQA 4TSFG 4TOIA 5BY1A 4DR4B 3K0GA 1E1RG 1KC8W 1SERA 4JYAO 5LMUB 1F4NA 1S3JA 2CTWA 3AG1C 4Q20A 4U7NA 3CYOA 3T4ZA 1K9MW 1QQCA 5B1AC 2AGAA 5JJEB 5KHGA 4NXNO 3F7YC 2QWNB 2OT5A 2YXHA 4J10A 5LHIA 4UV9A 3B4SA 1VP7A 3C90A 4MVUA 4DR7O 2GBOA 4UB6Z 3CC7V 5LHGA 1H2KA 3H1JH 3SDLA 4DXWA 2B1IA 1NTMH 4QPJA 1QBZA 1AJQA 3P3NA 4QJFB 3DTUB 4MVRA 5IJ9A 1SA0B 4WFFA 2GHYA 1XREA 1Z5WA 4X1YA 1HNWO 1VQ9V 5CBHA 4J42A 2GTSA 1W0JG 1I94O 3RYFA 3B09A 4L8JA 1FXKA 1I7FA 2YI8A 2Q0AA 2DOSA 3PN1A 3H1KH 2RNBA 3WG7C 4K0KB 2XAGA 4LF6O 4DRXA 3PJSK 4LF5O 3H1IH 1DLBA 1CP9A 4JTDB 3UM7A 4MSWC 1Z5VA 3UKMA 5C93A 4TWKA 1EN5A 5B3SC 4MTOA 3UT5A 2VS0A 4P30A 4U3JA 3OTOB 3E8GA 1Q5OA 2QGNA 2HHHB 2UU9B 3K5OA 3ASOC 4JYBA 3CWBH 3CXHF 4CS2A 2XUMA 3OGCC 4JI7B 1FD9A 5H2FZ 2X7RB 1AJNA 2DE0X 1XMOO 3M99B 3OGIB 3QO7A 2UXXA 4X62B 4JZ2A 1S0VA 2PI4A 4JI0B 5LYJA 3CHXA 4NYKA 2EILB 1XHXA 4IIJB 4YY3O 1BZKA 1KP2A 3E35A 3L72H 2DWDC 3HKDA 1KYOF 2N05A 2WLIA 5GW7A 2ZXWB 4JPRA 1XQ8A 4B3RO 1S77D 4JASA 3VBBA 4Q6GA 2VWKA 2YSUB 5IYZA 1X4TA 4DR6O 1D2DA 3IC7A 4PD4F 4GX1A 2QTSA 4I55B 2CUGA 4J11A 3E8FA 2BOBC 1OV9A 3L71H 5C8YA 1S5HC 4FJCC 3OTOO 2XAHA 3P30A 5TISZ 1V9PA 3RYHA 1GK9A 4DR7B 3ZCCA 4FM2A 1SQFA 3ZMVA 1S5LZ 3ZHRA 3JARA 3BABA 2IH1C 4DR3B 2B9ZA 3K59A 3L70H 1O9GA 3JSNA 4WFEA 3GB7C 1AROP 1DTOA 4NR1A 2HR3A 3CRAA 2HP8A 2F4VB 5IWAO 1Z2GA 1ZWIC 1YF2A 3T1CA 1AI6A 1NR7A 4UCSA 1HNXO 1TUBA 2WLLB 3KZIZ 1MMMA 1FAFA 2Y48A 4D7SA 2F1MA 5KLVH 1VEWA 4YIPA 3WG7B 5B66Z 4PELA 1NVPB 2HVJC 4X62O 2AXTZ 4LP8A 4DK0A 2O57A 1RSOB 5J2TA 1Q86W 1KUQA 1XL6A 4EB6B 1G8MA 1U97A 1SZTA 1GTOA 1QCEA 4LFAO 3IFXA 3H1LH 4U3FH 2KQXA 4ZHQA 1BL8A 3K5LA 1GN4A 3ZN0A 4JYYA 1XUQA 3K5NA 1BE3H 2KG7B 2IU0A 1P84F 5LYJB 2HJFC 1ENVA 3TXSA 1AI7A 4J7JA 4JAAA 1Q6HA 3OEHG 4YJ3B 3JAWA 4WBNA 4H0LB 4C7UA 5L3DA 3J81N 5BZBA 5CBGA 2UXDB 4DR1O 2Q69A 5DEDA 4DR6B 2EIKC 1WN7A 4DV7B 4JZGA 5GONA 3JASB 4ASUG 5CA1B 4EFBA 4FZ0A 2VWJA 1QLNA 5L3GA 2M7WA 1IBMB 1YXBA 4BAYA 5EYPB 4UCUA 3AG3C 3K04A 5IY5B 3CCLV 5KHHA 3A2FA 3FYEB 2ZT9B 3RVZA 5LBQA 3W7UA 2AHYA 1EZJA 1EM1A 2YIAA 3JATA 4IHJA 5IDJA 1M90W 1H2MA 2R72A 2EJRA 3E8HA 4TV8B 2NLJC 2UXCO 1WAZA 2A9HA 4HAMA 1N33O 1RPRA 4UXNA 2QDOA 3Q4HA 4FLVA 3CCEV 2EIMB 2Y4UA 2Q5ZA 1H2LA 2IJHA 3N2KB 4JI6B 1TA8A 1MOFA 3VOUA 1M56B 4DV3O 3R65A 4KHPO 4FPPA 2YDEA 1IBMO 5J2UB 2LQTA 2AW9A 4GKKO 1NH2D 2Y4TA 3ML0A 1XEQA 4AILC 5ITZB 2KB1A 2WSSG 4NTYA 1U96A 2F23A 4LR3A 4B08A 4MW3A 4JYAB 4IL6Z 3IGAC 5LGNA 1R6NA 5KHIA 1F23A 1IBLB 4B7EA 1JJOA 1MG1A 2UUBB 1SKVA 2EIMC 5JCOC 4EKWA 2JIZG 4MS2A 1PNLA 1N33B 2ADPA 4I55A 5LP6C 1JFFB 2F93B 4OPHA 2B1GA 2ZE8A 3ZMSA 1VQLV 5L3CA 1R6KA 3UCSC 4GKJB 3HPLC 1XOUA 4X64O 3C3TA 2V4DA 3B2EE 4O4IA 4AI8A 1T5EA 3VQVA 1N0JA 2DJVA 3ABTA 5HFMA 3TGUH 3U11A 2ZQMA 4X65O 3T1YB 3G80A 2DYRB 1FFTB 4AHCA 1P7GA 4CBCA 5JJNB 4HNAA 1NJIW 1OCRC 2RJZA 4EFEA 1H2NA 1QVFU 4UVAA 4WBNB 1COWG 5J2UA 4EEQA 3LDEA 4ZKIA 1IURA 2JEUA 1BT8A 2IM9A 2OTLV 1VF5B 4QNHB 2JS3A 3DSQA 3W7TA 2BE3A 1VQOV 1NI8A 4ICGA 2K1EA 1JQ0A 2R9IA 3D3IA 3ZRSA 5FNVA 5HFLA 1B6QA 1S72V 2LO1A 3APQA 2WLKA 3EXAA 3E2EA 3DXRA 2JDIG 3G6BA 1QLEB 1XHZA 4X88A 3HKBB 4J9YB 4QGPA 1MA1A 1P49A 2W0FC 3L9DA 1QHTA 3K08A 1B06A 5KA5A 4B3MB 4AQYB 1KKDA 4P2ZA 5EBLC 1NVPD 3ASNB 1K4DC 4J41A 1XNQO 5IT9N 4I50B 5F2VO 1SC5B 4LFBB 1TUBB 1AILA 4TUYA 2WLIB 5EYPA 3NXSA 1Q8IA 4NB5A 4DR2O 1XNRO 4UCRA 2UXBO 4RUEA 2JGUA 4NKGB 5JCOA 4MVOA 1YEWA 3JASA 4UCTA 2Q7HA 1GN3A 4KFMA 4DUZO 3HKBA 1R3KC 1M5IA 3OW2U 2YS8A 3K03A 3T1HB 1QVGU 4GYCB 4LC1A 1Q3EA 4CC6A 3W7SA 4GX5A 1YVWA 4X9QA 5JQGA 3FYIB 5EK0A 3UT5B 5LMUO 3OMAB 2D2CB 2LJ2A 1SQQH 1W0KG 1Y76B 4LH7A 2HVKC 4X20A 2W6JG 4R50A 2ZE5A 4CS3A 3ZMZA 2GV9A 3BEHA 1D5AA 5AG2A 4NXNB 4JYCA 2UUAO 4I9WA 1WP8A 4HYOA 1GN2A 1M1KW 4R7CA 1JFFA 2JS5A 4YHHB 4QE9A 2RMKB 2HG5C 2CH7B 4GKJO 4E4EA 1PP9H 2PYLA 4DYLA 2ARHA 2WLJA 1YDXA 1LNQA 2QR4A 1KECA 3OR6C 4OPAA 3JCUZ 4TQFA 1VQ6V 3GWOA 3B77A 4CH4A 1GRJA 3APOA 3AK2A 3N2GA 4UCOA 1Y66A 4DUZB 2P67A 4YY3B 1B04A 1XNQB 3G67A 3AG3B 5EZYA 1I94B 3KCXA 1EN4A 2H94A 3X2QB 1AJPA 4QE7A 4MVSA 3LNNA 4JV5B 4ZI7B 1US6A 1CEZA 2IU3A 2FL4A 5KUMA 2PTMA 3SPJA 3K06A 1YI2V 3W7XA 3BA9A 4LF9O 2GTAA 4I4TA 1UJWB 3FX7A 3ABLC 5EC2C 3SJBC 4X1KB 3RYHB 1IDSA 1VF7A 2EBOA 1PD3A 4BIUA 4IT5A 2EJ7A 3Q4HB 4O2AA 3OAAG 3LSUA 3BRCA 4O4JB 1HWYA 1LUWA 3RN4A 1VQ7V 3F5WC 2JK5C 1VQ5V 4XDJA 3SYPA 1IBKO 3QO8A 4XBFA 5KMGA 3BHPA 4RO2A 3MHSC 2EIJC 2LGWA 1K4CC 1HNWB 2PF4E 3BY6A 1EN6A 4O4HB 4ZOLB 1Y67A 2XTAA 4L87A 1JA8A 2WPDG 2ZINA 1OHHG 2WLNA 1YTFD 4A5UB 1Y4MA 3CE2A 2WAMA 4PDLA 2CAZC 3G71V 5DM6V 2ZDIC 1DF5A 3CCUV 2EIKB 5KX5A 3P3PA 2Q9LA 5E79Z 2ZE7A 4GZRB 5LGUA 1G4YB 2UXCB 1XL4A 2E76B 2UUCB 2ZD9A 1N34O 1V54B 3DGEA 2LFRA 5LXTA 1AP6A 3ZN1A 4LBEC 4PA9A 3A0BZ 1SQBH 3ZEDA 2DMXA 4W4LA 1MABG 3CB2A 4BW5A 1Q90D 3ZHSA 3G6EV 5CB4A 4RQFA 5LMNO 1YHQV 3BFRA 3U0ZA 3JAKB 1BHAA 5GTIZ 4GX2A 2P5OA 1IBKB 3H1HH 3HKCB 3BVOA 2ZXWC 3ZHVA 2EULA 3P32A 4MVZA 4MTFA 2YIDA 1R3IC 2E5LO 2YEVB 4DV2B 4EB6A 3FB5C 1ORQC 2QKSA 3B8NA 4B3RB 5B1NA 4MT8A 1FXHA 4LCUC 1ZUQA 1R6TA 1BQ0A 3OMNB 1VF6A 2ETNA 5IJ9B 3CCMV 1OCZC 1TUEB 3CCRV 4D7TA 5CA0B 3ZHUA 4X66B 1DF4A 1TVKB 2QTOA 4YXWG 2BSKA 2EINB 1GN6A 3TCUA 2PI5A 4GKKB 3AG2C 5B3SB 1OCRB 3CS5A 4PV1B 1N32B 1L8DA 1BMFG 4JI2B 3RT3C 2QM7A 3AG4B 2HKOA 4I5SA 4JV5O 4DV6O 3SYAA 1NH2B 4JAVA 1K92A 2ZR2A 4B3TB 4X65B 2OCCB 1KBHA 1J5EB 3MD0A 4YJ2A 1AVMA 3ASOB 3E86A 1HR0O 2OYQA 1HNZB 2E3CA 3MAQA 3SPGA 2VQFB 3IJ4A 4BIZA 2VQEO 1GMGA 3RFRA 1NKDA 4I4TB 3GWKC 4GT1A 2BTQB 5C8YB 2CTRA 3KCYA 1AI5A 1M56C 1THZA 2BTOA 5LOVA 1YJNV 4LWSA 5JJJB 1N36O 3EHBB 3B40A 4ZI7A 1FJGO 1TGOA 2XAQA 3ZJZA 4FLWA 1NS1A 4UCVA 4PI0A 2ZM6B 4XDLA 2Q7GA 2QWPB 2KSDA 5EC1C 1K3EA 5IJ0B 2LW7A 3BAAA 3MHHC 2CK3G 3OD4A 3STZC 3JARB 4RQEA 4JI4O 3U10A 3K5MA 1RM1B 1UPGA 4LF4B 4RUFA 5L3EA 2OIGA 5D5QA 3ZRWA 4Z2WA 3I55V 1FS0G 2OCCC 2GSMB 4LF8O 1SRYA 1I08A 5J9PC 3JSLA 3K58A 4AQYO 2QM8A 4RAIA 2E74B 4G27B 3E22A 3JD4A 4O4JA 3IC9A 4QPKA 1BHBA 1AB3A 2FTKA 1MZEA 3OUSA 4LFCB 2GUZA 3ZMTA 4DV2O 2EIJB 2V1DA 3CRQA 2P4VA 1HNXB 1SF9A 4FLUA 1N4CA 2E75B 4P9PA 1EBOA 2P7TC 4JI1O 2P90A 1VF6C 4FM0A 5LP6A 3QNEA 3JCZA 3F7VC 5KHKA 3OT7A 1Y74B 4WF9V 1YZBA 4LFBO 4JI3O 1N32O 3BA8A 4YJ3A 3OR7C 4DR2B 1AR4A 3JALA 1Q7YW 1XILA 2UXBB 1KP3A 1XMQB 4CH5A 2AHZA 1KKCA 3J80N 4DV4O 2EZPA 1A32A 3UQ8A 4KP4A 1DGSA 2CDYA 1J5EO 1ZTEA 4JI5B 2Q73A 3ETEA 1YITV 1IX9A 4FFKA 1P7BA 5EBMC 2WLMA 4DR5B 4E2LA 4TV9B 1XI1A 3CCQV 4LFAB 4PJ0Z 3SGIA 4LWSB 2WLHA 4JI8O 1R1BA 2PY5A 2L35A 5E1AC 2XHBA 4LF8B 3DXRB 1XMQO 4B3SB 2ITCC 1Q82W 1AR5A 3JD1A 1YJWV 1HR0B 5BR8O 4N23A 4YIOA 2A3QA 2OTJV 1WNSA 2DW4A 1EFRG 3VQYA 1Q81W 2WLLA 2JJ2G 4LFCO 1DK1A 3LSQA 2JRIA 3SJCC 4Z1VA 1QR9A 1IXBA 3EVKA 1SZXA 3K3WA 2NR5A 3ZBHA 1OCOB 4LF5B 3FAVA 4DV1O 4DV7O 1OCOC 1K7DA 4DW1A 1VQMV 3X2QC 2ZM6O 5EZYB 1VQ8V 1LR1A 2IJIA 4WFHA 5IE9A 3FB8C 1WB7A 5EIBC 3ZIAG 1H8HG 4JI4B 1NU1H 5LGTA 4IYHA 2JEXA 1N0NA 3ICXA 4DV5O 2N74A 1JMKC 4BWAA 1ZLZA 1EZVH 3RYCB 3CC4V 4JI1B 4DV3B
chains in the Genus database with same CATH topology
4Z1MG 3E8FA 3SYOA 3TETA 2BOBC 1Y66A 2P67A 3JD0A 4XDKA 1S5HC 4FJCC 4H33A 2XAHA 3P30A 3AG3B 3LNMB 2A0LA 3E83A 3RBZA 1WLEA 2H94A 1E1QG 1GK9A 1OCZB 3X2QB 1AJPA 2B5UA 1VQ4V 3ZCCA 3H01A 4QE7A 4MVSA 3ZMVA 2MK3A 2IH1C 2A79B 1CEZA 2IU3A 5KUMA 3SPJA 3FB6C 3K06A 1YI2V 3ABMB 3W7XA 2IW5A 4PDMA 1R3LC 3ABKB 3GB7C 4WFEA 1UJWB 1AROP 1DTOA 3ABLC 3CXCU 1V55C 4PA6A 5EC2C 2HR3A 3CMAV 2EBOA 1E79G 3I56V 1PD3A 1H8EG 2IH3C 3HB3B 4BIUA 4WFBV 3OAAG 1WPXA 1NR1A 1ZWIC 4MVMA 2R9RB 3T1CA 1AI6A 3SYQA 1NR7A 1HWYA 2WLLB 4H37A 4MW8A 4ZBMA 1VQ7V 3F5WC 2Y48A 1S76D 3ABUA 2JK5C 2X0LA 5DN6G 3CPWU 5B1BC 3LSSA 1VQ5V 4XDJA 3CCJV 3SYPA 3WG7B 4PELA 1NVPB 1NQTA 3QO8A 4XBFA 2HVJC 3KG2A 5B1OA 4JGSA 1FXKB 4PDRA 5LHHA 2NNUA 4RO2A 1YTFB 3STLC 3MHSC 1R3JC 2EIJC 4LP8A 1JVMA 1K4CC 1VQPV 3CCSV 3AEIA 3BY6A 5H6QA 2LP7A 2Q68A 4G28B 2DYSB 1Q86W 2X6CA 1XL6A 2BOCC 3ZRWB 1G8MA 2DYRC 4N21A 1W2BU 3CC2V 1SZTA 1GTOA 3LUTB 1QCEA 4L87A 5CA3A 3IFXA 2LFSA 2WPDG 1OHHG 2WLNA 1YTFD 1Y4MA 5KUKA 2WAMA 4PDLA 3T2MA 3G71V 2HFEC 1M57C 5DM6V 2D3OW 3OM3B 1K34A 3ZRVA 1BL8A 2ZDIC 1DF5A 2F43G 3CCUV 2EIKB 3ZN0A 1SETA 2Z5UA 5LGUA 1G4YB 1XL4A 2ZD9A 1V54B 5H9CA 3DGEA 2LFRA 2IU0A 3ZN1A 4LBEC 4PA9A 2HJFC 1ENVA 1AI7A 1GO3F 4CZZA 1MABG 3B8MA 3OEHG 1FXKC 5IYDO 4BW5A 3ABKC 2JJ1G 5L3DA 3ZRXA 3SPIA 5BZBA 5CBGA 3G6EV 4WFAV 4RQFA 4UVBA 4PA7A 2Q69A 3EFFK 1YHQV 2EIKC 3RW0A 1M57B 1K5SA 1BHAA 2XASA 4ASUG 4GX2A 2IJJA 3SYCA 3G4SV 4FK5C 1QLEC 1GM8A 2ZXWC 1K5QA 3P32A 4MVZA 1JOYA 1QLNA 4R6ZA 5L3GA 2M7WA 3LDDA 4J9ZB 4JAUA 3JD3A 3ABLB 2EILC 4MTFA 4BAYA 1PNKA 3AG3C 3K04A 1R73A 1R3IC 5IY5B 2YEVB 3CCLV 3A0RA 3FB5C 3FYEB 1ORQC 2ZDIA 1KD1W 2QKSA 3B8NA 4JTCB 4X89A 1H38A 2Y69B 3RVZA 5LBQA 5B1NA 3W7UA 4MT8A 1K97A 1FXHA 4LCUC 4UUJC 2AHYA 2H8PC 3OMNB 1EZJA 5CN0A 5IDJA 4MTXA 3E8BA 3CCMV 1OCZC 1TUEB 3T4DA 1M90W 2ITDC 3CCRV 5CMUA 2EJRA 3E8HA 2NLJC 1DF4A 2A9HA 2QTOA 2XNDG 4HAMA 4YXWG 1RPRA 4UXNA 2EINB 3TCUA 2PI5A 3AG2C 5B3SB 1OCRB 5L3FA 1AI4A 2IJKA 1BMFG 3CCEV 1JJ2U 2QM7A 2EIMB 1J95A 1OZ0A 4MVQA 3AG4B 2UXNA 1YIJV 2HKOA 4I5SA 3SYAA 1GM7A 2IJHA 1NH2B 1ROPA 4JAVA 1K92A 1OCCC 1KQSU 1MOFA 3VOUA 2ZR2A 5CBFA 1M56B 4PA3A 1F51A 2X6BA 4WFGA 3R65A 3CCVV 4KUMA 2OCCB 3SJQC 1PKXA 4FPPA 3MD0A 3ASOB 3E86A 4P9OA 3AG4C 1VQNV 2QEXV 5IYCO 3SPGA 3SPCA 4BIZA 1L1FA 2ATKC 1GMGA 1PL0A 2Q67A 1NH2D 1RM1C 3ML0A 1JX9A 1NKDA 2KB1A 2WSSG 4PA4A 1IXMA 4GT1A 4R8CA 4F4LA 1PNMA 2EINC 1AI5A 1M56C 4GCZA 4MW3A 1THZA 4MTGA 2QA4V 3IGAC 5LGNA 1YJNV 3SPHA 3WFVA 3EHBB 1R6NA 1F23A 3OE7G 2XAQA 3ZJZA 3CP1A 1MG1A 2EIMC 4EKWA 2EZOA 4XDLA 1MSWD 5KA6A 5EC1C 2JIZG 5H6RA 4MS2A 1K3EA 2Z3YA 1PNLA 3OMIB 3MHHC 2CK3G 5EBWC 3STZC 4RQEA 2B1GA 3TK1A 1RM1B 4DO2A 3ZMSA 5IY5C 5B1AB 1VQLV 3ASNC 1I5YA 1R6KA 5L3CA 2DQ3A 4RUFA 1F4MA 1VQKV 5L3EA 3HPLC 2XOKG 3ZRWA 3CD6V 3I55V 1FS0G 1K33A 2OCCC 2GSMB 1JPXA 1SRYA 5J9PC 1YSCA 2W6IG 2Y69C 3ABTA 5HFMA 3E89A 2ZQMA 2QM8A 4RAIA 4G27B 3JD4A 3JYCA 3OUFA 4QPKA 2DYRB 4X8AA 1BHBA 1FFTB 2FTKA 4CBCA 3OEEG 3OUSA 1GKFA 3RVYA 4TSFG 3K9AA 4FMTA 3ZMTA 1NJIW 2EIJB 2V1DA 1OCRC 1N8RW 3K0GA 1E1RG 1QVFU 4UVAA 1COWG 1KC8W 4U7OA 1V54C 1SERA 5IYBO 1F4NA 3D36A 4P9PA 1S3JA 1EBOA 2P7TC 3LDEA 3AG1C 5B1BB 4Q20A 4ZKIA 2JEUA 4U7NA 1NBMG 3CYOA 3T4ZA 1K9MW 5B1AC 2OTLV 2P90A 4QNHB 3QNEA 3JCZA 3F7VC 3W7TA 3F7YC 1VQOV 2K1EA 1JQ0A 3ETDA 2R9IA 2Q6AA 2OT5A 1P4RA 3D3IA 4WF9V 3ZRSA 5HFLA 1JCHA 1B6QA 1S72V 5LHIA 4UV9A 4WCEV 2WLKA 4MVUA 4JF3A 3OR7C 1K8AW 1GM9A 3CC7V 5LHGA 4JTAB 4DXWA 2B1IA 3E2EA 3K79A 1M9NA 3AG1B 1Q7YW 4QPJA 2JDIG 1QBZA 1KP3A 1QLEB 1AJQA 2AHZA 4QJFB 4X88A 4J9YB 2EZPA 2W0FC 3DTUB 4KP4A 3K08A 4MVRA 5KA5A 4WFFA 1KKDA 2GHYA 4P2ZA 4OXSA 5EBLC 3QO5A 3ASNB 1K4DC 1NVPD 3JD2A 3ETEA 1YITV 1VQ9V 5CBHA 1P7BA 5EBMC 2WLMA 1W0JG 4E2LA 3ZMUA 1FXKA 3CCQV 1SESA 2DWEC 2WLIB 3NXSA 1OCCB 2WLHA 2ZR3A 3CMEV 3WG7C 3FB7C 4UVCA 2XAGA 5E1AC 1H2GA 3W7WA 3PJSK 4RUEA 3ABMC 2X6AA 1DLBA 4MVOA 1CP9A 4JTDB 2XAFA 3UM7A 2ITCC 4MSWC 1Q82W 2YEVA 3UKMA 3JD1A 4HZ3A 1YJWV 4KFMA 4FIPC 2XAJA 1R3KC 4TWKA 5C93A 5B3SC 3FKSG 4MTOA 2QE7G 4N23A 5FL7G 3OW2U 3K03A 4P30A 2OTJV 2DW4A 1EFRG 3E8GA 1Q81W 2WLLA 2JJ2G 1QVGU 4QIWF 4LC1A 3LSQA 2DYSC 3W7SA 1QR8A 4GX5A 3ASOC 1AR1B 1QR9A 4JYBA 3FYIB 3ETGA 3K3WA 5EK0A 2DQ0A 1OCOB 3OGCC 1YJ9V 4UV8A 2X7RB 1AJNA 3OMAB 1OCOC 3M99B 1K7DA 1VQMV 3LDCA 1W0KG 3QO7A 2UXXA 2WWWA 2HVKC 3X2QC 2W6JG 4R50A 1S0VA 1VQ8V 2PI4A 2V7QG 3ZMZA 1I5XA 3BEHA 2IJIA 4G2KA 4WFHA 3FB8C 1FXVA 4GX0A 2EILB 3K0DA 3ZIAG 4JYCA 5L3BA 1H8HG 4TT3G 4I9WA 1KP2A 4HYOA 1K73W 3E35A 2DWDC 3OFNG 1M1KW 3AG2B 2WLIA 4R7CA 2ZXWB 5GW7A 5LGTA 4QE9A 4JPRA 1S77D 2JEXA 2HG5C 1V55B 4JASA 3VBBA 2HLDG 1CPYA 2P6JA 2YSUB 1RPOA 2WLJA 1LNQA 4PDVA 1KECA 3OR6C 3IC7A 2C2AA 3CC4V 4GX1A 1VQ6V 3GWOA 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA9 A;  2HJF C;  4R8C A;  4F4L A;  3E8F A;  3SYO A;  3TET A;  2EIN C;  2BOB C;  2AHZ A;  1M56 C;  4X88 A;  4MW3 A;  4MTG A;  4J9Y B;  4XDK A;  1S5H C;  3IGA C;  2W0F C;  3SPH A;  4BW5 A;  4MVR A;  3ABK C;  3K08 A;  4H33 A;  4WFF A;  1KKD A;  3SPI A;  3LNM B;  2A0L A;  3E83 A;  3RBZ A;  4P2Z A;  3ZJZ A;  5BZB A;  5CBG A;  4OXS A;  5EBL C;  1K4D C;  4PA7 A;  2Q69 A;  3EFF K;  2EIM C;  2EIK C;  5CBH A;  3RW0 A;  4EKW A;  1P7B A;  4XDL A;  2WLM A;  5EBM C;  5EC1 C;  4QE7 A;  4MVS A;  4GX2 A;  4MS2 A;  3SYC A;  1QLE C;  2IH1 C;  2A79 B;  2ZXW C;  2DWE C;  2WLI B;  5EBW C;  3STZ C;  4MVZ A;  5KUM A;  2WLH A;  3SPJ A;  3FB6 C;  4R6Z A;  3K06 A;  3LDD A;  4J9Z B;  3WG7 C;  3FB7 C;  5IY5 C;  3ASN C;  4MTF A;  2EIL C;  5E1A C;  4RUF A;  4PDM A;  3AG3 C;  3PJS K;  3ABM C;  3K04 A;  1R3I C;  2X6A A;  4RUE A;  1R3L C;  3HPL C;  4MVO A;  3GB7 C;  4WFE A;  4JTD B;  3UM7 A;  3FB5 C;  2ITC C;  3ABL C;  4MSW C;  1V55 C;  1ORQ C;  2OCC C;  4PA6 A;  5EC2 C;  2YEV A;  3UKM A;  2QKS A;  4HZ3 A;  4JTC B;  4X89 A;  4KFM A;  5J9P C;  3RVZ A;  1R3K C;  4TWK A;  4LCU C;  4UUJ C;  5B3S C;  2AHY A;  4MTO A;  2H8P C;  2IH3 C;  2Y69 C;  3K03 A;  4P30 A;  1ZWI C;  3E89 A;  2R9R B;  4MVM A;  3E8G A;  4G27 B;  4RAI A;  3T1C A;  3SYQ A;  2WLL A;  3E8B A;  2WLL B;  1OCZ C;  3JYC A;  3T4D A;  3OUF A;  4H37 A;  4MW8 A;  4ZBM A;  2ITD C;  3F5W C;  4X8A A;  2JK5 C;  2DYS C;  3E8H A;  5B1B C;  2NLJ C;  4GX5 A;  3ASO C;  3OUS A;  4CBC A;  4XDJ A;  3RVY A;  3SYP A;  2A9H A;  2QTO A;  5EK0 A;  1OCR C;  2HVJ C;  3KG2 A;  3OGC C;  3TCU A;  3K0G A;  4PDR A;  3AG2 C;  4RO2 A;  3STL C;  1OCO C;  1R3J C;  2EIJ C;  4LP8 A;  3LDC A;  1K4C C;  1JVM A;  1V54 C;  4P9P A;  2HVK C;  3X2Q C;  2Q68 A;  4G28 B;  2P7T C;  3LDE A;  3AG1 C;  4R50 A;  2X6C A;  1J95 A;  1XL6 A;  4MVQ A;  2BOC C;  3BEH A;  4WFH A;  2DYR C;  3T4Z A;  3FB8 C;  4GX0 A;  3K0D A;  3LUT B;  5B1A C;  3SYA A;  3IFX A;  4I9W A;  4HYO A;  4QNH B;  1OCC C;  3F7V C;  3VOU A;  2DWD C;  2WLN A;  2WLI A;  3F7Y C;  4R7C A;  5CBF A;  4PA3 A;  5KUK A;  4QE9 A;  2K1E A;  4PDL A;  3T2M A;  2X6B A;  2Q6A A;  4WFG A;  2HFE C;  2HG5 C;  3R65 A;  1M57 C;  3SJQ C;  3ZRS A;  1BL8 A;  3E86 A;  4P9O A;  3AG4 C;  2WLJ A;  1LNQ A;  3SPG A;  4PDV A;  2WLK A;  3SPC A;  4MVU A;  1G4Y B;  3OR6 C;  1XL4 A;  3OR7 C;  4JTA B;  2ATK C;  2ZD9 A;  4DXW A;  2Q67 A;  4GX1 A;  4LBE C;  2KB1 A;  4PA4 A; 
#chains in the Genus database with same CATH topology
 4Z1M G;  3TET A;  3SYO A;  1SQP H;  3JD0 A;  1MSD A;  4XDK A;  3T1Y O;  2QM4 A;  5IYZ B;  4KXR A;  2KKW A;  3LNM B;  1RP3 B;  3E83 A;  1E1Q G;  4DV0 B;  1IZ3 A;  2B5U A;  3H01 A;  4K8Z A;  4DV5 B;  2MK3 A;  3J7A U;  5FLX N;  2A79 B;  5CA1 A;  2QJ1 A;  3FB6 C;  3ABM B;  4DV4 B;  4PDM A;  4PHZ A;  4NXM B;  1R3L C;  1NTZ H;  1VAR A;  5JH7 A;  3CMA V;  1HW7 A;  4CS4 A;  1E79 G;  3RWR D;  4LF7 B;  4LNU A;  1H8E G;  2IH3 C;  3HB3 B;  4WFB V;  1WPX A;  2R9R B;  5JVD B;  4GUN A;  2HEP A;  4ZBM A;  1S76 D;  3WB0 A;  2X0L A;  1PPJ H;  3LSS A;  3CCJ V;  2UUB O;  5BMV A;  5IJ0 A;  4I50 A;  4ZHQ B;  3QVN A;  1YTF B;  2GUZ B;  1R3J C;  1JVM A;  1VQP V;  3CCS V;  2RCV A;  3AEI A;  5H6Q A;  2LP7 A;  2Q68 A;  4G28 B;  4BW9 A;  2X6C A;  5A2Q N;  1WA8 A;  2BOC C;  2ADQ B;  4N21 A;  1FFX A;  1W2B U;  3LUT B;  5CA3 A;  3RYC A;  3RYF B;  4CC5 A;  3DC6 A;  1WJZ A;  3RYI B;  4JI8 B;  2PUS A;  1VMG A;  2YXY A;  2OIE A;  3T2M A;  2HFE C;  1I0H A;  2ZE6 A;  2D3O W;  1K34 A;  1W59 A;  4O2A B;  4LF6 B;  2F43 G;  1PL4 A;  2ILM A;  5FNV B;  3HKE B;  4NTX A;  5BMV B;  1PM9 A;  5ITZ A;  3WU2 Z;  4FM1 A;  3AK3 A;  1YCI A;  4CZZ A;  2CE4 A;  3B8M A;  5IYD O;  4UB8 Z;  3ABK C;  2ZIO A;  2JJ1 G;  3UO3 A;  3SPI A;  2L6L A;  2WA3 A;  4WFA V;  3AK1 A;  3EFF K;  1XNR B;  3RW0 A;  2QWQ B;  3L73 H;  1K5S A;  3N2K A;  2XAS A;  2IJJ A;  3G4S V;  1XMO B;  1VIB A;  2BSK B;  4FK5 C;  4HNA B;  3WB2 A;  2QKA A;  1HDJ A;  1JOY A;  5KAI Z;  3JD3 A;  3ABL B;  2EIL C;  2QKC A;  5KHJ A;  2UUA B;  3CRM A;  3A0R A;  1UFI A;  1AP5 A;  2RQ6 A;  4YHH O;  2KG7 A;  4X89 A;  5JWP A;  1K97 A;  1BSM A;  3RYI A;  1S5J A;  1LUV A;  2CH7 A;  2ZCE A;  1FJG B;  1FFX B;  4NVP A;  3T4D A;  1WA8 B;  2ZIM A;  5CMU A;  5FPO A;  2YUA A;  1URF A;  3CX5 F;  3CEI A;  2RN9 A;  4F6E A;  3SJA C;  1L0N H;  3HKC A;  2VQE B;  1Y76 A;  2RDC A;  4LF7 O;  5CA0 A;  1F7Y A;  1TAE A;  1JJ2 U;  4DUY O;  1J95 A;  1OZ0 A;  4MVQ A;  3H9V A;  2UXN A;  5EIB D;  3C3S A;  3O9O A;  1GM7 A;  1ROP A;  1OCC C;  1KQS U;  4F6R A;  3A8T A;  2Q8V A;  5CBF A;  4O4L B;  2F66 C;  4PA3 A;  2X6B A;  3CCV V;  4KUM A;  3K57 A;  4O2B B;  3JAW B;  2QEX V;  5IYC O;  3ZX6 A;  4FLT A;  1OJH A;  4IGG A;  2ATK C;  3QTC A;  1PL0 A;  2Q67 A;  1Y6X A;  1JX9 A;  4PA4 A;  1IXM A;  4R8C A;  4F4L A;  5IWA B;  3BCC H;  2FB5 A;  2JGD A;  4GCZ A;  2Q4P A;  3SPH A;  4JI7 O;  4X64 B;  5K1X A;  4DR3 O;  4ZOL A;  4J7Z A;  1Q6U A;  3OE7 G;  5FPR A;  5CB4 B;  5A9G A;  2OWO A;  3CP1 A;  4FFB B;  1GAX A;  2A06 H;  4FLZ A;  4OGQ B;  5KA6 A;  3F5T A;  2PZS A;  3S3X A;  2GDS A;  3OMI B;  4X1I B;  4K35 A;  2PGG A;  5EBW C;  3TK1 A;  1KB9 F;  4DO2 A;  2HHH O;  5J2T B;  5B1A B;  1VQK V;  5KX5 B;  4I0X B;  3CD6 V;  2FKX A;  1SQG A;  3THO A;  4TV9 A;  3S3W A;  4FFB A;  4X1K A;  1YSC A;  2YI9 A;  2EX3 A;  2W6I G;  2Y69 C;  3GVM A;  4LF9 B;  1N34 B;  3QF7 A;  4X8A A;  5DEC A;  3OEE G;  1GKF A;  3K9A A;  2ZNI A;  4FMT A;  2UU9 O;  1N8R W;  3FAV B;  2Y0I A;  5GON B;  4JI2 O;  2DN9 A;  4DUY B;  5BXZ A;  4U7O A;  2CTQ A;  1V54 C;  2N04 A;  5IYB O;  3D36 A;  4DR1 B;  5B1B B;  5LMN B;  1JR9 A;  1Y74 A;  1NBM G;  5H5N A;  2CGO A;  4PI2 A;  3D36 C;  5BR8 B;  1ZX3 A;  3ETD A;  2Q6A A;  1P4R A;  1JCH A;  2IBZ H;  4WCE V;  3ZS8 C;  1KMI Z;  4JF3 A;  1K8A W;  1GM9 A;  4JTA B;  3K79 A;  1M9N A;  3AG1 B;  3R66 A;  4K0K O;  3BPZ A;  2YIB D;  2Y0P A;  2W0X A;  4CH6 A;  2F95 B;  4K8X A;  2BCC H;  5LA6 A;  4OXS A;  3QO5 A;  3AG7 A;  3JD2 A;  3HKD B;  2F4V O;  4X1Y B;  3ZMU A;  2Q0O C;  4I7Z B;  3DC5 A;  1SES A;  2DWE C;  1OCC B;  2ZR3 A;  3CME V;  1CXZ B;  1L0L H;  3FB7 C;  4UVC A;  4DV6 B;  2LW1 A;  2VRZ A;  1H2G A;  3W7W A;  2MW2 B;  3ABM C;  2X6A A;  2XAF A;  2NN4 A;  2UUC O;  2QWR B;  2YEV A;  1ZAU A;  4HZ3 A;  4FIP C;  2XAJ A;  5LP6 B;  3FKS G;  5FL7 G;  2QE7 G;  3TJT A;  1HNZ O;  1D5N A;  2E5L B;  4QIW F;  5LOV B;  1M93 A;  2DYS C;  1QR8 A;  3JAK A;  1AR1 B;  2UXD O;  1IVS A;  3ETG A;  3D8C A;  2DQ0 A;  3RGB A;  1YJ9 V;  4UV8 A;  4B3S O;  4OX9 O;  3NR7 A;  3ETQ A;  4JI6 O;  5LL6 Y;  3LDC A;  2WWW A;  2ZNJ A;  3WB1 A;  4YJ2 B;  4I0X A;  2V7Q G;  1I5X A;  4G2K A;  1FXV A;  4GX0 A;  1QU7 A;  3K0D A;  3T1H O;  5LXT B;  5L3B A;  4TT3 G;  5KAF Z;  1K73 W;  3OFN G;  3AG2 B;  5K1P A;  1SQX H;  2QWO B;  3O65 A;  4IHJ B;  4X1I A;  1V55 B;  2HLD G;  1CPY A;  1SA0 A;  2P6J A;  1RPO A;  1FYJ A;  3CRC A;  4PDV A;  2C2A A;  4BR6 A;  4X66 O;  2R9A A;  4HBN A;  2JGD B;  1BCC H;  3FD9 A;  2VQF O;  2P06 A;  4B7K A;  1WB8 A;  4H33 A;  5JVD A;  3CSX A;  2A0L A;  3RBZ A;  4D6T H;  4DR5 O;  1WLE A;  1RFY A;  1OCZ B;  2Z0A A;  1VQ4 V;  2AZ0 A;  5JH7 B;  3CJH B;  3FFQ A;  4FLY A;  2AZ2 A;  1M4U A;  4NTW A;  4B3T O;  2XT9 A;  2IW5 A;  5B5E Z;  3ABK B;  3CXC U;  1V55 C;  4PA6 A;  3SR2 C;  3TXQ A;  3I56 V;  2K9P A;  2HJD A;  2YC0 A;  1NR1 A;  4MVM A;  2CTP A;  2FML A;  3SYQ A;  2OCH A;  1NT2 B;  4DRX B;  4H37 A;  4MW8 A;  2A7W A;  3ABU A;  5DN6 G;  3CPW U;  5B1B C;  1IBL O;  1NQT A;  3KG2 A;  5B1O A;  2YIC A;  4JGS A;  1FXK B;  1GH6 A;  4PDR A;  4KHP B;  5LHH A;  2NNU A;  1RSO A;  3STL C;  4O4L A;  3OTF A;  3CRR A;  2DYS B;  5GTH Z;  3ZRW B;  2DYR C;  2QSA A;  3CC2 V;  4LF4 O;  2LFS A;  3D3Q A;  4O4I B;  5KUK A;  1M57 C;  4DV1 B;  3OM3 B;  3ZRV A;  3A0H Z;  1X59 A;  1SET A;  2Z5U A;  5D5P A;  5H9C A;  3ZHT A;  4LH6 A;  1NZ6 A;  1SQV H;  1GO3 F;  3M7M X;  1WPB A;  2M6Y A;  2JVD A;  3VQX A;  1FXK C;  3ZRX A;  1Q6I A;  3VQW A;  4UVB A;  4PA7 A;  3UO2 A;  4OX9 B;  1M57 B;  1KU9 A;  3SYC A;  1QLE C;  1FPO A;  1GM8 A;  4J80 A;  1K5Q A;  4RWU A;  4R6Z A;  3LDD A;  4J9Z B;  4W4K A;  4JAU A;  3JAM N;  1XBL A;  1PNK A;  3MDS A;  1HP8 A;  1WP7 A;  1R73 A;  4JI3 B;  3JAT B;  4ZIB A;  1QNM A;  2ZDI A;  1KD1 W;  1B3Q A;  4JTC B;  1H38 A;  2P22 C;  2P4K A;  2PYJ A;  2Y69 B;  4UUJ C;  1NTK H;  2H8P C;  5CN0 A;  3K9S A;  3QG5 A;  1FKA O;  4TUY B;  4H44 B;  3E8B A;  4MTX A;  4ABM A;  4BIO A;  4O4H A;  2ITD C;  4DW0 A;  3HKE A;  4IIJ A;  4JI5 O;  4H13 B;  2XND G;  1ZL8 A;  2ZKO A;  3JAL B;  3IAY A;  3KKY A;  4J7K A;  5KMG B;  3M8A A;  5L3F A;  4DR4 O;  1AI4 A;  1O9H A;  4FLX A;  2IJK A;  4TV8 A;  3L74 H;  1YIJ V;  1BS3 A;  1Q43 A;  3ZHQ A;  2LGQ A;  4DK1 A;  1F51 A;  4WFG A;  4B3M O;  4U3J B;  4NXM O;  3SJQ C;  1PKX A;  1MZF A;  1G6U A;  4P9O A;  3AG4 C;  1VQN V;  4I9Q A;  3SPC A;  2Q7E A;  2H3O A;  1L1F A;  4IYI A;  1RM1 C;  3N27 A;  1PNM A;  4FVM A;  5JQG B;  4KL1 A;  2EIN C;  4DV0 O;  2ODM A;  4LNU B;  4MTG A;  2QA4 V;  3WFV A;  3HR0 A;  3E22 B;  3CJH A;  4O2B A;  3I5D A;  1G1X B;  2FYU H;  1TVK A;  1BQZ A;  2EZO A;  4F6R B;  1XDC A;  1MSW D;  1H2S B;  5H6R A;  3N2G B;  2Z3Y A;  1SS3 A;  1ZL8 B;  4FZ1 A;  4K3A A;  1MNG A;  2YXL A;  2R70 A;  2CGN A;  5IY5 C;  3ASN C;  1I5Y A;  2DQ3 A;  1F4M A;  4CH3 A;  2XOK G;  3L75 H;  1N36 B;  5LA6 B;  1K33 A;  4TQD A;  1BGY H;  4GLX A;  1JPX A;  1ZSP A;  2G38 A;  2YIB A;  2WA4 A;  3E89 A;  4JI0 O;  1PV0 A;  3JYC A;  3OUF A;  4UFZ A;  4X20 B;  3RVY A;  2BTQ A;  4TSF G;  4TOI A;  5BY1 A;  4DR4 B;  3K0G A;  1E1R G;  1KC8 W;  1SER A;  4JYA O;  5LMU B;  1F4N A;  1S3J A;  2CTW A;  3AG1 C;  4Q20 A;  4U7N A;  3CYO A;  3T4Z A;  1K9M W;  1QQC A;  5B1A C;  2AGA A;  5JJE B;  5KHG A;  4NXN O;  3F7Y C;  2QWN B;  2OT5 A;  2YXH A;  4J10 A;  5LHI A;  4UV9 A;  3B4S A;  1VP7 A;  3C90 A;  4MVU A;  4DR7 O;  2GBO A;  4UB6 Z;  3CC7 V;  5LHG A;  1H2K A;  3H1J H;  3SDL A;  4DXW A;  2B1I A;  1NTM H;  4QPJ A;  1QBZ A;  1AJQ A;  3P3N A;  4QJF B;  3DTU B;  4MVR A;  5IJ9 A;  1SA0 B;  4WFF A;  2GHY A;  1XRE A;  1Z5W A;  4X1Y A;  1HNW O;  1VQ9 V;  5CBH A;  4J42 A;  2GTS A;  1W0J G;  1I94 O;  3RYF A;  3B09 A;  4L8J A;  1FXK A;  1I7F A;  2YI8 A;  2Q0A A;  2DOS A;  3PN1 A;  3H1K H;  2RNB A;  3WG7 C;  4K0K B;  2XAG A;  4LF6 O;  4DRX A;  3PJS K;  4LF5 O;  3H1I H;  1DLB A;  1CP9 A;  4JTD B;  3UM7 A;  4MSW C;  1Z5V A;  3UKM A;  5C93 A;  4TWK A;  1EN5 A;  5B3S C;  4MTO A;  3UT5 A;  2VS0 A;  4P30 A;  4U3J A;  3OTO B;  3E8G A;  1Q5O A;  2QGN A;  2HHH B;  2UU9 B;  3K5O A;  3ASO C;  4JYB A;  3CWB H;  3CXH F;  4CS2 A;  2XUM A;  3OGC C;  4JI7 B;  1FD9 A;  5H2F Z;  2X7R B;  1AJN A;  2DE0 X;  1XMO O;  3M99 B;  3OGI B;  3QO7 A;  2UXX A;  4X62 B;  4JZ2 A;  1S0V A;  2PI4 A;  4JI0 B;  5LYJ A;  3CHX A;  4NYK A;  2EIL B;  1XHX A;  4IIJ B;  4YY3 O;  1BZK A;  1KP2 A;  3E35 A;  3L72 H;  2DWD C;  3HKD A;  1KYO F;  2N05 A;  2WLI A;  5GW7 A;  2ZXW B;  4JPR A;  1XQ8 A;  4B3R O;  1S77 D;  4JAS A;  3VBB A;  4Q6G A;  2VWK A;  2YSU B;  5IYZ A;  1X4T A;  4DR6 O;  1D2D A;  3IC7 A;  4PD4 F;  4GX1 A;  2QTS A;  4I55 B;  2CUG A;  4J11 A;  3E8F A;  2BOB C;  1OV9 A;  3L71 H;  5C8Y A;  1S5H C;  4FJC C;  3OTO O;  2XAH A;  3P30 A;  5TIS Z;  1V9P A;  3RYH A;  1GK9 A;  4DR7 B;  3ZCC A;  4FM2 A;  1SQF A;  3ZMV A;  1S5L Z;  3ZHR A;  3JAR A;  3BAB A;  2IH1 C;  4DR3 B;  2B9Z A;  3K59 A;  3L70 H;  1O9G A;  3JSN A;  4WFE A;  3GB7 C;  1ARO P;  1DTO A;  4NR1 A;  2HR3 A;  3CRA A;  2HP8 A;  2F4V B;  5IWA O;  1Z2G A;  1ZWI C;  1YF2 A;  3T1C A;  1AI6 A;  1NR7 A;  4UCS A;  1HNX O;  1TUB A;  2WLL B;  3KZI Z;  1MMM A;  1FAF A;  2Y48 A;  4D7S A;  2F1M A;  5KLV H;  1VEW A;  4YIP A;  3WG7 B;  5B66 Z;  4PEL A;  1NVP B;  2HVJ C;  4X62 O;  2AXT Z;  4LP8 A;  4DK0 A;  2O57 A;  1RSO B;  5J2T A;  1Q86 W;  1KUQ A;  1XL6 A;  4EB6 B;  1G8M A;  1U97 A;  1SZT A;  1GTO A;  1QCE A;  4LFA O;  3IFX A;  3H1L H;  4U3F H;  2KQX A;  4ZHQ A;  1BL8 A;  3K5L A;  1GN4 A;  3ZN0 A;  4JYY A;  1XUQ A;  3K5N A;  1BE3 H;  2KG7 B;  2IU0 A;  1P84 F;  5LYJ B;  2HJF C;  1ENV A;  3TXS A;  1AI7 A;  4J7J A;  4JAA A;  1Q6H A;  3OEH G;  4YJ3 B;  3JAW A;  4WBN A;  4H0L B;  4C7U A;  5L3D A;  3J81 N;  5BZB A;  5CBG A;  2UXD B;  4DR1 O;  2Q69 A;  5DED A;  4DR6 B;  2EIK C;  1WN7 A;  4DV7 B;  4JZG A;  5GON A;  3JAS B;  4ASU G;  5CA1 B;  4EFB A;  4FZ0 A;  2VWJ A;  1QLN A;  5L3G A;  2M7W A;  1IBM B;  1YXB A;  4BAY A;  5EYP B;  4UCU A;  3AG3 C;  3K04 A;  5IY5 B;  3CCL V;  5KHH A;  3A2F A;  3FYE B;  2ZT9 B;  3RVZ A;  5LBQ A;  3W7U A;  2AHY A;  1EZJ A;  1EM1 A;  2YIA A;  3JAT A;  4IHJ A;  5IDJ A;  1M90 W;  1H2M A;  2R72 A;  2EJR A;  3E8H A;  4TV8 B;  2NLJ C;  2UXC O;  1WAZ A;  2A9H A;  4HAM A;  1N33 O;  1RPR A;  4UXN A;  2QDO A;  3Q4H A;  4FLV A;  3CCE V;  2EIM B;  2Y4U A;  2Q5Z A;  1H2L A;  2IJH A;  3N2K B;  4JI6 B;  1TA8 A;  1MOF A;  3VOU A;  1M56 B;  4DV3 O;  3R65 A;  4KHP O;  4FPP A;  2YDE A;  1IBM O;  5J2U B;  2LQT A;  2AW9 A;  4GKK O;  1NH2 D;  2Y4T A;  3ML0 A;  1XEQ A;  4AIL C;  5ITZ B;  2KB1 A;  2WSS G;  4NTY A;  1U96 A;  2F23 A;  4LR3 A;  4B08 A;  4MW3 A;  4JYA B;  4IL6 Z;  3IGA C;  5LGN A;  1R6N A;  5KHI A;  1F23 A;  1IBL B;  4B7E A;  1JJO A;  1MG1 A;  2UUB B;  1SKV A;  2EIM C;  5JCO C;  4EKW A;  2JIZ G;  4MS2 A;  1PNL A;  1N33 B;  2ADP A;  4I55 A;  5LP6 C;  1JFF B;  2F93 B;  4OPH A;  2B1G A;  2ZE8 A;  3ZMS A;  1VQL V;  5L3C A;  1R6K A;  3UCS C;  4GKJ B;  3HPL C;  1XOU A;  4X64 O;  3C3T A;  2V4D A;  3B2E E;  4O4I A;  4AI8 A;  1T5E A;  3VQV A;  1N0J A;  2DJV A;  3ABT A;  5HFM A;  3TGU H;  3U11 A;  2ZQM A;  4X65 O;  3T1Y B;  3G80 A;  2DYR B;  1FFT B;  4AHC A;  1P7G A;  4CBC A;  5JJN B;  4HNA A;  1NJI W;  1OCR C;  2RJZ A;  4EFE A;  1H2N A;  1QVF U;  4UVA A;  4WBN B;  1COW G;  5J2U A;  4EEQ A;  3LDE A;  4ZKI A;  1IUR A;  2JEU A;  1BT8 A;  2IM9 A;  2OTL V;  1VF5 B;  4QNH B;  2JS3 A;  3DSQ A;  3W7T A;  2BE3 A;  1VQO V;  1NI8 A;  4ICG A;  2K1E A;  1JQ0 A;  2R9I A;  3D3I A;  3ZRS A;  5FNV A;  5HFL A;  1B6Q A;  1S72 V;  2LO1 A;  3APQ A;  2WLK A;  3EXA A;  3E2E A;  3DXR A;  2JDI G;  3G6B A;  1QLE B;  1XHZ A;  4X88 A;  3HKB B;  4J9Y B;  4QGP A;  1MA1 A;  1P49 A;  2W0F C;  3L9D A;  1QHT A;  3K08 A;  1B06 A;  5KA5 A;  4B3M B;  4AQY B;  1KKD A;  4P2Z A;  5EBL C;  1NVP D;  3ASN B;  1K4D C;  4J41 A;  1XNQ O;  5IT9 N;  4I50 B;  5F2V O;  1SC5 B;  4LFB B;  1TUB B;  1AIL A;  4TUY A;  2WLI B;  5EYP A;  3NXS A;  1Q8I A;  4NB5 A;  4DR2 O;  1XNR O;  4UCR A;  2UXB O;  4RUE A;  2JGU A;  4NKG B;  5JCO A;  4MVO A;  1YEW A;  3JAS A;  4UCT A;  2Q7H A;  1GN3 A;  4KFM A;  4DUZ O;  3HKB A;  1R3K C;  1M5I A;  3OW2 U;  2YS8 A;  3K03 A;  3T1H B;  1QVG U;  4GYC B;  4LC1 A;  1Q3E A;  4CC6 A;  3W7S A;  4GX5 A;  1YVW A;  4X9Q A;  5JQG A;  3FYI B;  5EK0 A;  3UT5 B;  5LMU O;  3OMA B;  2D2C B;  2LJ2 A;  1SQQ H;  1W0K G;  1Y76 B;  4LH7 A;  2HVK C;  4X20 A;  2W6J G;  4R50 A;  2ZE5 A;  4CS3 A;  3ZMZ A;  2GV9 A;  3BEH A;  1D5A A;  5AG2 A;  4NXN B;  4JYC A;  2UUA O;  4I9W A;  1WP8 A;  4HYO A;  1GN2 A;  1M1K W;  4R7C A;  1JFF A;  2JS5 A;  4YHH B;  4QE9 A;  2RMK B;  2HG5 C;  2CH7 B;  4GKJ O;  4E4E A;  1PP9 H;  2PYL A;  4DYL A;  2ARH A;  2WLJ A;  1YDX A;  1LNQ A;  2QR4 A;  1KEC A;  3OR6 C;  4OPA A;  3JCU Z;  4TQF A;  1VQ6 V;  3GWO A;  3B77 A;  4CH4 A;  1GRJ A;  3APO A;  3AK2 A;  3N2G A;  4UCO A;  1Y66 A;  4DUZ B;  2P67 A;  4YY3 B;  1B04 A;  1XNQ B;  3G67 A;  3AG3 B;  5EZY A;  1I94 B;  3KCX A;  1EN4 A;  2H94 A;  3X2Q B;  1AJP A;  4QE7 A;  4MVS A;  3LNN A;  4JV5 B;  4ZI7 B;  1US6 A;  1CEZ A;  2IU3 A;  2FL4 A;  5KUM A;  2PTM A;  3SPJ A;  3K06 A;  1YI2 V;  3W7X A;  3BA9 A;  4LF9 O;  2GTA A;  4I4T A;  1UJW B;  3FX7 A;  3ABL C;  5EC2 C;  3SJB C;  4X1K B;  3RYH B;  1IDS A;  1VF7 A;  2EBO A;  1PD3 A;  4BIU A;  4IT5 A;  2EJ7 A;  3Q4H B;  4O2A A;  3OAA G;  3LSU A;  3BRC A;  4O4J B;  1HWY A;  1LUW A;  3RN4 A;  1VQ7 V;  3F5W C;  2JK5 C;  1VQ5 V;  4XDJ A;  3SYP A;  1IBK O;  3QO8 A;  4XBF A;  5KMG A;  3BHP A;  4RO2 A;  3MHS C;  2EIJ C;  2LGW A;  1K4C C;  1HNW B;  2PF4 E;  3BY6 A;  1EN6 A;  4O4H B;  4ZOL B;  1Y67 A;  2XTA A;  4L87 A;  1JA8 A;  2WPD G;  2ZIN A;  1OHH G;  2WLN A;  1YTF D;  4A5U B;  1Y4M A;  3CE2 A;  2WAM A;  4PDL A;  2CAZ C;  3G71 V;  5DM6 V;  2ZDI C;  1DF5 A;  3CCU V;  2EIK B;  5KX5 A;  3P3P A;  2Q9L A;  5E79 Z;  2ZE7 A;  4GZR B;  5LGU A;  1G4Y B;  2UXC B;  1XL4 A;  2E76 B;  2UUC B;  2ZD9 A;  1N34 O;  1V54 B;  3DGE A;  2LFR A;  5LXT A;  1AP6 A;  3ZN1 A;  4LBE C;  4PA9 A;  3A0B Z;  1SQB H;  3ZED A;  2DMX A;  4W4L A;  1MAB G;  3CB2 A;  4BW5 A;  1Q90 D;  3ZHS A;  3G6E V;  5CB4 A;  4RQF A;  5LMN O;  1YHQ V;  3BFR A;  3U0Z A;  3JAK B;  1BHA A;  5GTI Z;  4GX2 A;  2P5O A;  1IBK B;  3H1H H;  3HKC B;  3BVO A;  2ZXW C;  3ZHV A;  2EUL A;  3P32 A;  4MVZ A;  4MTF A;  2YID A;  1R3I C;  2E5L O;  2YEV B;  4DV2 B;  4EB6 A;  3FB5 C;  1ORQ C;  2QKS A;  3B8N A;  4B3R B;  5B1N A;  4MT8 A;  1FXH A;  4LCU C;  1ZUQ A;  1R6T A;  1BQ0 A;  3OMN B;  1VF6 A;  2ETN A;  5IJ9 B;  3CCM V;  1OCZ C;  1TUE B;  3CCR V;  4D7T A;  5CA0 B;  3ZHU A;  4X66 B;  1DF4 A;  1TVK B;  2QTO A;  4YXW G;  2BSK A;  2EIN B;  1GN6 A;  3TCU A;  2PI5 A;  4GKK B;  3AG2 C;  5B3S B;  1OCR B;  3CS5 A;  4PV1 B;  1N32 B;  1L8D A;  1BMF G;  4JI2 B;  3RT3 C;  2QM7 A;  3AG4 B;  2HKO A;  4I5S A;  4JV5 O;  4DV6 O;  3SYA A;  1NH2 B;  4JAV A;  1K92 A;  2ZR2 A;  4B3T B;  4X65 B;  2OCC B;  1KBH A;  1J5E B;  3MD0 A;  4YJ2 A;  1AVM A;  3ASO B;  3E86 A;  1HR0 O;  2OYQ A;  1HNZ B;  2E3C A;  3MAQ A;  3SPG A;  2VQF B;  3IJ4 A;  4BIZ A;  2VQE O;  1GMG A;  3RFR A;  1NKD A;  4I4T B;  3GWK C;  4GT1 A;  2BTQ B;  5C8Y B;  2CTR A;  3KCY A;  1AI5 A;  1M56 C;  1THZ A;  2BTO A;  5LOV A;  1YJN V;  4LWS A;  5JJJ B;  1N36 O;  3EHB B;  3B40 A;  4ZI7 A;  1FJG O;  1TGO A;  2XAQ A;  3ZJZ A;  4FLW A;  1NS1 A;  4UCV A;  4PI0 A;  2ZM6 B;  4XDL A;  2Q7G A;  2QWP B;  2KSD A;  5EC1 C;  1K3E A;  5IJ0 B;  2LW7 A;  3BAA A;  3MHH C;  2CK3 G;  3OD4 A;  3STZ C;  3JAR B;  4RQE A;  4JI4 O;  3U10 A;  3K5M A;  1RM1 B;  1UPG A;  4LF4 B;  4RUF A;  5L3E A;  2OIG A;  5D5Q A;  3ZRW A;  4Z2W A;  3I55 V;  1FS0 G;  2OCC C;  2GSM B;  4LF8 O;  1SRY A;  1I08 A;  5J9P C;  3JSL A;  3K58 A;  4AQY O;  2QM8 A;  4RAI A;  2E74 B;  4G27 B;  3E22 A;  3JD4 A;  4O4J A;  3IC9 A;  4QPK A;  1BHB A;  1AB3 A;  2FTK A;  1MZE A;  3OUS A;  4LFC B;  2GUZ A;  3ZMT A;  4DV2 O;  2EIJ B;  2V1D A;  3CRQ A;  2P4V A;  1HNX B;  1SF9 A;  4FLU A;  1N4C A;  2E75 B;  4P9P A;  1EBO A;  2P7T C;  4JI1 O;  2P90 A;  1VF6 C;  4FM0 A;  5LP6 A;  3QNE A;  3JCZ A;  3F7V C;  5KHK A;  3OT7 A;  1Y74 B;  4WF9 V;  1YZB A;  4LFB O;  4JI3 O;  1N32 O;  3BA8 A;  4YJ3 A;  3OR7 C;  4DR2 B;  1AR4 A;  3JAL A;  1Q7Y W;  1XIL A;  2UXB B;  1KP3 A;  1XMQ B;  4CH5 A;  2AHZ A;  1KKC A;  3J80 N;  4DV4 O;  2EZP A;  1A32 A;  3UQ8 A;  4KP4 A;  1DGS A;  2CDY A;  1J5E O;  1ZTE A;  4JI5 B;  2Q73 A;  3ETE A;  1YIT V;  1IX9 A;  4FFK A;  1P7B A;  5EBM C;  2WLM A;  4DR5 B;  4E2L A;  4TV9 B;  1XI1 A;  3CCQ V;  4LFA B;  4PJ0 Z;  3SGI A;  4LWS B;  2WLH A;  4JI8 O;  1R1B A;  2PY5 A;  2L35 A;  5E1A C;  2XHB A;  4LF8 B;  3DXR B;  1XMQ O;  4B3S B;  2ITC C;  1Q82 W;  1AR5 A;  3JD1 A;  1YJW V;  1HR0 B;  5BR8 O;  4N23 A;  4YIO A;  2A3Q A;  2OTJ V;  1WNS A;  2DW4 A;  1EFR G;  3VQY A;  1Q81 W;  2WLL A;  2JJ2 G;  4LFC O;  1DK1 A;  3LSQ A;  2JRI A;  3SJC C;  4Z1V A;  1QR9 A;  1IXB A;  3EVK A;  1SZX A;  3K3W A;  2NR5 A;  3ZBH A;  1OCO B;  4LF5 B;  3FAV A;  4DV1 O;  4DV7 O;  1OCO C;  1K7D A;  4DW1 A;  1VQM V;  3X2Q C;  2ZM6 O;  5EZY B;  1VQ8 V;  1LR1 A;  2IJI A;  4WFH A;  5IE9 A;  3FB8 C;  1WB7 A;  5EIB C;  3ZIA G;  1H8H G;  4JI4 B;  1NU1 H;  5LGT A;  4IYH A;  2JEX A;  1N0N A;  3ICX A;  4DV5 O;  2N74 A;  1JMK C;  4BWA A;  1ZLZ A;  1EZV H;  3RYC B;  3CC4 V;  4JI1 B;  4DV3 B; 
#chains in the Genus database with same CATH homology
 4Z1M G;  3E8F A;  3SYO A;  3TET A;  2BOB C;  1Y66 A;  2P67 A;  3JD0 A;  4XDK A;  1S5H C;  4FJC C;  4H33 A;  2XAH A;  3P30 A;  3AG3 B;  3LNM B;  2A0L A;  3E83 A;  3RBZ A;  1WLE A;  2H94 A;  1E1Q G;  1GK9 A;  1OCZ B;  3X2Q B;  1AJP A;  2B5U A;  1VQ4 V;  3ZCC A;  3H01 A;  4QE7 A;  4MVS A;  3ZMV A;  2MK3 A;  2IH1 C;  2A79 B;  1CEZ A;  2IU3 A;  5KUM A;  3SPJ A;  3FB6 C;  3K06 A;  1YI2 V;  3ABM B;  3W7X A;  2IW5 A;  4PDM A;  1R3L C;  3ABK B;  3GB7 C;  4WFE A;  1UJW B;  1ARO P;  1DTO A;  3ABL C;  3CXC U;  1V55 C;  4PA6 A;  5EC2 C;  2HR3 A;  3CMA V;  2EBO A;  1E79 G;  3I56 V;  1PD3 A;  1H8E G;  2IH3 C;  3HB3 B;  4BIU A;  4WFB V;  3OAA G;  1WPX A;  1NR1 A;  1ZWI C;  4MVM A;  2R9R B;  3T1C A;  1AI6 A;  3SYQ A;  1NR7 A;  1HWY A;  2WLL B;  4H37 A;  4MW8 A;  4ZBM A;  1VQ7 V;  3F5W C;  2Y48 A;  1S76 D;  3ABU A;  2JK5 C;  2X0L A;  5DN6 G;  3CPW U;  5B1B C;  3LSS A;  1VQ5 V;  4XDJ A;  3CCJ V;  3SYP A;  3WG7 B;  4PEL A;  1NVP B;  1NQT A;  3QO8 A;  4XBF A;  2HVJ C;  3KG2 A;  5B1O A;  4JGS A;  1FXK B;  4PDR A;  5LHH A;  2NNU A;  4RO2 A;  1YTF B;  3STL C;  3MHS C;  1R3J C;  2EIJ C;  4LP8 A;  1JVM A;  1K4C C;  1VQP V;  3CCS V;  3AEI A;  3BY6 A;  5H6Q A;  2LP7 A;  2Q68 A;  4G28 B;  2DYS B;  1Q86 W;  2X6C A;  1XL6 A;  2BOC C;  3ZRW B;  1G8M A;  2DYR C;  4N21 A;  1W2B U;  3CC2 V;  1SZT A;  1GTO A;  3LUT B;  1QCE A;  4L87 A;  5CA3 A;  3IFX A;  2LFS A;  2WPD G;  1OHH G;  2WLN A;  1YTF D;  1Y4M A;  5KUK A;  2WAM A;  4PDL A;  3T2M A;  3G71 V;  2HFE C;  1M57 C;  5DM6 V;  2D3O W;  3OM3 B;  1K34 A;  3ZRV A;  1BL8 A;  2ZDI C;  1DF5 A;  2F43 G;  3CCU V;  2EIK B;  3ZN0 A;  1SET A;  2Z5U A;  5LGU A;  1G4Y B;  1XL4 A;  2ZD9 A;  1V54 B;  5H9C A;  3DGE A;  2LFR A;  2IU0 A;  3ZN1 A;  4LBE C;  4PA9 A;  2HJF C;  1ENV A;  1AI7 A;  1GO3 F;  4CZZ A;  1MAB G;  3B8M A;  3OEH G;  1FXK C;  5IYD O;  4BW5 A;  3ABK C;  2JJ1 G;  5L3D A;  3ZRX A;  3SPI A;  5BZB A;  5CBG A;  3G6E V;  4WFA V;  4RQF A;  4UVB A;  4PA7 A;  2Q69 A;  3EFF K;  1YHQ V;  2EIK C;  3RW0 A;  1M57 B;  1K5S A;  1BHA A;  2XAS A;  4ASU G;  4GX2 A;  2IJJ A;  3SYC A;  3G4S V;  4FK5 C;  1QLE C;  1GM8 A;  2ZXW C;  1K5Q A;  3P32 A;  4MVZ A;  1JOY A;  1QLN A;  4R6Z A;  5L3G A;  2M7W A;  3LDD A;  4J9Z B;  4JAU A;  3JD3 A;  3ABL B;  2EIL C;  4MTF A;  4BAY A;  1PNK A;  3AG3 C;  3K04 A;  1R73 A;  1R3I C;  5IY5 B;  2YEV B;  3CCL V;  3A0R A;  3FB5 C;  3FYE B;  1ORQ C;  2ZDI A;  1KD1 W;  2QKS A;  3B8N A;  4JTC B;  4X89 A;  1H38 A;  2Y69 B;  3RVZ A;  5LBQ A;  5B1N A;  3W7U A;  4MT8 A;  1K97 A;  1FXH A;  4LCU C;  4UUJ C;  2AHY A;  2H8P C;  3OMN B;  1EZJ A;  5CN0 A;  5IDJ A;  4MTX A;  3E8B A;  3CCM V;  1OCZ C;  1TUE B;  3T4D A;  1M90 W;  2ITD C;  3CCR V;  5CMU A;  2EJR A;  3E8H A;  2NLJ C;  1DF4 A;  2A9H A;  2QTO A;  2XND G;  4HAM A;  4YXW G;  1RPR A;  4UXN A;  2EIN B;  3TCU A;  2PI5 A;  3AG2 C;  5B3S B;  1OCR B;  5L3F A;  1AI4 A;  2IJK A;  1BMF G;  3CCE V;  1JJ2 U;  2QM7 A;  2EIM B;  1J95 A;  1OZ0 A;  4MVQ A;  3AG4 B;  2UXN A;  1YIJ V;  2HKO A;  4I5S A;  3SYA A;  1GM7 A;  2IJH A;  1NH2 B;  1ROP A;  4JAV A;  1K92 A;  1OCC C;  1KQS U;  1MOF A;  3VOU A;  2ZR2 A;  5CBF A;  1M56 B;  4PA3 A;  1F51 A;  2X6B A;  4WFG A;  3R65 A;  3CCV V;  4KUM A;  2OCC B;  3SJQ C;  1PKX A;  4FPP A;  3MD0 A;  3ASO B;  3E86 A;  4P9O A;  3AG4 C;  1VQN V;  2QEX V;  5IYC O;  3SPG A;  3SPC A;  4BIZ A;  1L1F A;  2ATK C;  1GMG A;  1PL0 A;  2Q67 A;  1NH2 D;  1RM1 C;  3ML0 A;  1JX9 A;  1NKD A;  2KB1 A;  2WSS G;  4PA4 A;  1IXM A;  4GT1 A;  4R8C A;  4F4L A;  1PNM A;  2EIN C;  1AI5 A;  1M56 C;  4GCZ A;  4MW3 A;  1THZ A;  4MTG A;  2QA4 V;  3IGA C;  5LGN A;  1YJN V;  3SPH A;  3WFV A;  3EHB B;  1R6N A;  1F23 A;  3OE7 G;  2XAQ A;  3ZJZ A;  3CP1 A;  1MG1 A;  2EIM C;  4EKW A;  2EZO A;  4XDL A;  1MSW D;  5KA6 A;  5EC1 C;  2JIZ G;  5H6R A;  4MS2 A;  1K3E A;  2Z3Y A;  1PNL A;  3OMI B;  3MHH C;  2CK3 G;  5EBW C;  3STZ C;  4RQE A;  2B1G A;  3TK1 A;  1RM1 B;  4DO2 A;  3ZMS A;  5IY5 C;  5B1A B;  1VQL V;  3ASN C;  1I5Y A;  1R6K A;  5L3C A;  2DQ3 A;  4RUF A;  1F4M A;  1VQK V;  5L3E A;  3HPL C;  2XOK G;  3ZRW A;  3CD6 V;  3I55 V;  1FS0 G;  1K33 A;  2OCC C;  2GSM B;  1JPX A;  1SRY A;  5J9P C;  1YSC A;  2W6I G;  2Y69 C;  3ABT A;  5HFM A;  3E89 A;  2ZQM A;  2QM8 A;  4RAI A;  4G27 B;  3JD4 A;  3JYC A;  3OUF A;  4QPK A;  2DYR B;  4X8A A;  1BHB A;  1FFT B;  2FTK A;  4CBC A;  3OEE G;  3OUS A;  1GKF A;  3RVY A;  4TSF G;  3K9A A;  4FMT A;  3ZMT A;  1NJI W;  2EIJ B;  2V1D A;  1OCR C;  1N8R W;  3K0G A;  1E1R G;  1QVF U;  4UVA A;  1COW G;  1KC8 W;  4U7O A;  1V54 C;  1SER A;  5IYB O;  1F4N A;  3D36 A;  4P9P A;  1S3J A;  1EBO A;  2P7T C;  3LDE A;  3AG1 C;  5B1B B;  4Q20 A;  4ZKI A;  2JEU A;  4U7N A;  1NBM G;  3CYO A;  3T4Z A;  1K9M W;  5B1A C;  2OTL V;  2P90 A;  4QNH B;  3QNE A;  3JCZ A;  3F7V C;  3W7T A;  3F7Y C;  1VQO V;  2K1E A;  1JQ0 A;  3ETD A;  2R9I A;  2Q6A A;  2OT5 A;  1P4R A;  3D3I A;  4WF9 V;  3ZRS A;  5HFL A;  1JCH A;  1B6Q A;  1S72 V;  5LHI A;  4UV9 A;  4WCE V;  2WLK A;  4MVU A;  4JF3 A;  3OR7 C;  1K8A W;  1GM9 A;  3CC7 V;  5LHG A;  4JTA B;  4DXW A;  2B1I A;  3E2E A;  3K79 A;  1M9N A;  3AG1 B;  1Q7Y W;  4QPJ A;  2JDI G;  1QBZ A;  1KP3 A;  1QLE B;  1AJQ A;  2AHZ A;  4QJF B;  4X88 A;  4J9Y B;  2EZP A;  2W0F C;  3DTU B;  4KP4 A;  3K08 A;  4MVR A;  5KA5 A;  4WFF A;  1KKD A;  2GHY A;  4P2Z A;  4OXS A;  5EBL C;  3QO5 A;  3ASN B;  1K4D C;  1NVP D;  3JD2 A;  3ETE A;  1YIT V;  1VQ9 V;  5CBH A;  1P7B A;  5EBM C;  2WLM A;  1W0J G;  4E2L A;  3ZMU A;  1FXK A;  3CCQ V;  1SES A;  2DWE C;  2WLI B;  3NXS A;  1OCC B;  2WLH A;  2ZR3 A;  3CME V;  3WG7 C;  3FB7 C;  4UVC A;  2XAG A;  5E1A C;  1H2G A;  3W7W A;  3PJS K;  4RUE A;  3ABM C;  2X6A A;  1DLB A;  4MVO A;  1CP9 A;  4JTD B;  2XAF A;  3UM7 A;  2ITC C;  4MSW C;  1Q82 W;  2YEV A;  3UKM A;  3JD1 A;  4HZ3 A;  1YJW V;  4KFM A;  4FIP C;  2XAJ A;  1R3K C;  4TWK A;  5C93 A;  5B3S C;  3FKS G;  4MTO A;  2QE7 G;  4N23 A;  5FL7 G;  3OW2 U;  3K03 A;  4P30 A;  2OTJ V;  2DW4 A;  1EFR G;  3E8G A;  1Q81 W;  2WLL A;  2JJ2 G;  1QVG U;  4QIW F;  4LC1 A;  3LSQ A;  2DYS C;  3W7S A;  1QR8 A;  4GX5 A;  3ASO C;  1AR1 B;  1QR9 A;  4JYB A;  3FYI B;  3ETG A;  3K3W A;  5EK0 A;  2DQ0 A;  1OCO B;  3OGC C;  1YJ9 V;  4UV8 A;  2X7R B;  1AJN A;  3OMA B;  1OCO C;  3M99 B;  1K7D A;  1VQM V;  3LDC A;  1W0K G;  3QO7 A;  2UXX A;  2WWW A;  2HVK C;  3X2Q C;  2W6J G;  4R50 A;  1S0V A;  1VQ8 V;  2PI4 A;  2V7Q G;  3ZMZ A;  1I5X A;  3BEH A;  2IJI A;  4G2K A;  4WFH A;  3FB8 C;  1FXV A;  4GX0 A;  2EIL B;  3K0D A;  3ZIA G;  4JYC A;  5L3B A;  1H8H G;  4TT3 G;  4I9W A;  1KP2 A;  4HYO A;  1K73 W;  3E35 A;  2DWD C;  3OFN G;  1M1K W;  3AG2 B;  2WLI A;  4R7C A;  2ZXW B;  5GW7 A;  5LGT A;  4QE9 A;  4JPR A;  1S77 D;  2JEX A;  2HG5 C;  1V55 B;  4JAS A;  3VBB A;  2HLD G;  1CPY A;  2P6J A;  2YSU B;  1RPO A;  2WLJ A;  1LNQ A;  4PDV A;  1KEC A;  3OR6 C;  3IC7 A;  2C2A A;  3CC4 V;  4GX1 A;  1VQ6 V;  3GWO A;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...