4H37A

Crystal structure of a voltage-gated k+ channel pore domain in a closed state in lipid membranes
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
NGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Voltage-gated K+ Channel Pore Module in a Closed State in Lipid Membranes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Membrane protein
molecule keywords Lmo2059 protein
total genus 24
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4h37A00
4GX0A 2IH3C 3ABKC 3OR7C 3E8HA 4F4LA 5IY5C 1V55C 2EINC 3GB7C 2BOCC 1M56C 2A0LA 2WLHA 3K06A 4H37A 4MTOA 4MVMA 3E8BA 1R3KC 3E89A 1S5HC 4GX1A 4X8AA 3SYQA 3ASNC 2ATKC 3SJQC 3VOUA 5BZBA 3AG1C 2EIKC 2WLIA 4MVRA 5EBWC 5EC2C 3LDDA 5E1AC 5EK0A 1ORQC 3KG2A 3ASOC 2Q67A 3F7YC 4KFMA 3K0DA 4J9ZB 3AG2C 1BL8A 3F7VC 2WLJA 3OUSA 1K4DC 2WLLA 3FB7C 4QE9A 3RW0A 3E83A 2A9HA 1KKDA 1OCCC 4MVUA 3LUTB 3OUFA 1R3JC 1ZWIC 5EBLC 2W0FC 3T2MA 4MVZA 3LDCA 3BEHA 4MSWC 3WG7C 1K4CC 3SYOA 4PA9A 2DWEC 4P9PA 2DWDC 5J9PC 3SYPA 4EKWA 1P7BA 2AHYA 2NLJC 2AHZA 1M57C 3AG4C 3K08A 3OR6C 5EBMC 2Y69C 3SYCA 3X2QC 2R9RB 4TWKA 4JTCB 4PA4A 1LNQA 3RVZA 4LBEC 5B1AC 2JK5C 4RUEA 1XL4A 3TCUA 3SYAA 1V54C 3E8GA 4JTAB 1OCOC 4PDMA 4WFEA 4XDLA 3TETA 1R3LC 4G28B 2A79B 4GX5A 4HYOA 2BOBC 2HFEC 4PA7A 4PDLA 3T1CA 4J9YB 4LP8A 4LCUC 4MVQA 2EIJC 4HZ3A 1OCRC 2X6BA 4R50A 4QNHB 2DYRC 3SPCA 3EFFK 3ZJZA 5KUKA 4G27B 4X88A 1XL6A 2QKSA 3AG3C 2ZXWC 4MS2A 4P9OA 3RVYA 3SPIA 3ABMC 2WLLB 2HG5C 2WLIB 4QE7A 3ZRSA 2KB1A 4MW8A 2P7TC 2YEVA 1OCZC 2Q6AA 2QTOA 5CBHA 3IFXA 3LNMB 4P30A 2ITCC 2X6CA 3IGAC 3E8FA 3FB8C 4WFFA 3OGCC 1J95A 3R65A 4PDRA 2ITDC 2K1EA 3HPLC 4GX2A 2X6AA 2HJFC 4MTFA 3FB5C 2EIMC 3K03A 3ABLC 3STLC 2Q68A 4MTGA 2WLNA 4X89A 2DYSC 4PDVA 4PA6A 4JTDB 4R7CA 1JVMA 4WFHA 3LDEA 3E86A 4MVOA 2Q69A 4XDJA 4ZBMA 4XDKA 3K0GA 2ZD9A 4I9WA 3UM7A 4MW3A 5CBGA 2EILC 2OCCC 4MVSA 2IH1C 4PA3A 3FB6C 3K04A 4RO2A 4WFGA 1QLEC 3STZC 4DXWA 3T4ZA 4CBCA 4BW5A 5EC1C 3SPGA 4R8CA 4OXSA 3F5WC 3UKMA 3RBZA 2WLMA 4H33A 2HVKC 4RUFA 1G4YB 4RAIA 5B3SC 5CBFA 4R6ZA 2WLKA 2H8PC 1R3IC 3SPJA 3T4DA 5B1BC 3PJSK 3SPHA 4UUJC 2HVJC 3JYCA 4P2ZA 5KUMA
chains in the Genus database with same CATH superfamily
4U7NA 5ITZA 2FKXA 5IYZB 1J5EB 5C8YA 2ATKC 1K9MW 1KB9F 3BRCA 3OD4A 2ZIOA 3ZHSA 1D5NA 1K5SA 1QLNA 4JI8B 4B08A 1S0VA 1ZWIC 5B66Z 4BAYA 3SJBC 2PYLA 3D36C 4ABMA 4DUZO 1BMFG 3ASNB 3RVZA 3K3WA 2UXCB 2BSKA 3L70H 2PZSA 4PDMA 4WFEA 4KHPO 1P4RA 4XDLA 4X1KA 1XMQO 4H0LB 4J9YB 1RM1C 3OM3B 1EN6A 3ZJZA 3CXHF 2GDSA 1HP8A 4PELA 5IYDO 5A9GA 3ZHUA 2ZINA 1BE3H 2N05A 4O2BB 3ABMC 3SJCC 4DV0O 1ROPA 2BTQB 1YJWV 4DV1B 1F51A 4CS3A 3QF7A 1HNXO 4FPPA 4J41A 4TV8B 1CXZB 3JAMN 1HWYA 2XAJA 3FB6C 1K33A 4FLWA 2RMKB 1K34A 2WLMA 1YDXA 1IX9A 2HEPA 4UV9A 1HDJA 1CPYA 5JQGA 2HLDG 3CCVV 4JYAB 3JAWB 1EN4A 4KHPB 1UPGA 2OT5A 1YXBA 3JYCA 4P2ZA 3G71V 2DQ3A 5L3FA 3U11A 3E8HA 3JATA 1QR9A 3WG7B 1I7FA 4MTOA 1H8EG 2Y0PA 1VQ5V 1EN5A 1G6UA 3H1IH 3VOUA 5LA6A 2WLIA 1Y76A 4U7OA 5EK0A 5CA0A 2JEXA 3ZHRA 4LC1A 2A9HA 3U0ZA 3FAVB 1OCCC 3K9AA 1MA1A 5LYJB 1NTMH 5BR8B 5IY5B 2DWEC 5LMUB 4DV0B 1RFYA 3QO7A 3ABLB 5EBMC 4B3MB 1SA0A 1W2BU 2GTAA 2QM8A 5H9CA 4I0XB 3CRRA 1KQSU 2YI9A 4HYOA 4HBNA 4L8JA 1PL4A 3CRMA 1Y74B 3ZN1A 1GM9A 3EFFK 1XL6A 2F66C 4B7KA 3R66A 5IWAB 1FS0G 1FXHA 4JI2B 1OCZC 4LH7A 2WA3A 2E5LB 4P30A 5IYCO 1UFIA 3OGCC 3R65A 1WNSA 1GMGA 2HJFC 2DMXA 4MTFA 4UXNA 3C90A 3CJHA 2Q5ZA 2ZCEA 1N32O 1YIJV 2JEUA 1ZL8B 1Y6XA 4QPJA 1YF2A 4XDKA 2ZXWB 4X65B 3AG2B 4J11A 2Z3YA 1XUQA 5IJ0A 4RAIA 2HJDA 4LFAB 3HKDA 3SPJA 1XHZA 1Z5VA 1GTOA 5KX5A 3CP1A 2Y69B 2DQ0A 3OW2U 2F1MA 2GUZB 1NVPB 2ZE7A 3OR7C 3ABKC 2ZIMA 3IC9A 5JH7A 1GAXA 4O4HA 1QR8A 5FNVB 2WPDG 1AJNA 4JI5B 4X64O 4K0KO 1R3KC 4FFBB 4CS4A 2DN9A 3L75H 4LFAO 1NKDA 3RYFB 4MVRA 2ZNIA 2OCHA 2YS8A 4N21A 4KFMA 1H2NA 1HW7A 2WLJA 4J7KA 1HR0B 1GO3F 3G67A 2QKCA 4UVAA 2B9ZA 1XHXA 2LQTA 3OEHG 2W0FC 1FJGB 5LOVA 4TOIA 1VQ8V 3B8NA 3K5MA 2DE0X 4ZHQA 5DN6G 4ICGA 2DYSB 1WN7A 3OTOB 3MAQA 2QWPB 4FIPC 3RYHB 1COWG 4E2LA 4CH6A 1M4UA 4GT1A 2BOBC 1L0LH 1NH2D 4CH4A 4MVQA 3CC7V 1I94O 4DUYB 3GWOA 4DR6B 3TXSA 1IBMB 4UFZA 3JCZA 1WP7A 1GN3A 4DR1B 3D36A 5C8YB 2IU3A 4UCTA 5CB4A 1VQ7V 1HNWO 1MSDA 4Q6GA 2ZM6O 5LP6C 5A2QN 1W0KG 1JVMA 4XDJA 4WF9V 4ZBMA 2LGWA 1GM8A 3UM7A 4X1KB 2EILC 3JAKB 4WFBV 3ETEA 2XASA 4CC5A 1M90W 2FTKA 1XREA 1LR1A 4O4JA 3VQVA 4O4LA 2ZE6A 1NI8A 2ADPA 2QWRB 4G2KA 2YEVB 5K1XA 4GKKB 3APQA 4WBNB 1H2LA 3ZHVA 1Q6IA 2F95B 3OMIB 1M5IA 1URFA 3TJTA 2FYUH 1N34O 3SJQC 5LGTA 1WB7A 5KHGA 2AZ0A 2OTLV 2BTQA 2ODMA 1YSCA 3AG2C 1I5XA 5EZYB 3W7WA 3DSQA 1EM1A 3LUTB 1Y66A 2Q0AA 2JGDA 4LF6O 5JQGB 3I55V 4I7ZB 3ZMZA 1VIBA 5J9PC 4YJ3B 2UUCB 1WLEA 4KUMA 1KMIZ 3K5LA 3K08A 4BIUA 4O2AB 3ETQA 1H2SB 3FD9A 2JK5C 4DR3O 1OV9A 2UXBB 1SQBH 1GN2A 1JFFB 3QTCA 3JAWA 4LP8A 1Y76B 2DYRC 2ZDIC 4KL1A 1YJ9V 4JV5O 4TV9A 3CSXA 5D5QA 5B1NA 3LSQA 3FAVA 1KKCA 5L3CA 3KCXA 4K3AA 4LF5B 1VARA 3P30A 2NNUA 1US6A 5ITZB 2QEXV 1CP9A 1Z5WA 3K03A 3UT5A 3ETDA 2DYSC 2LFSA 2QM7A 1Q6UA 2DYRB 4JYYA 1MOFA 4DV5O 1BHBA 2CAZC 2P90A 1B06A 2V1DA 1OCZB 2HVKC 2N74A 4FLTA 4W4KA 5B3SC 3G6BA 5H6QA 3M7MX 3ASOB 5D5PA 4GKJB 4AILC 3D3QA 2LGQA 1KP3A 2QWOB 2IH3C 2BSKB 4YHHB 3ZMTA 2HP8A 1QVGU 3GB7C 4H37A 1Y74A 2BOCC 4JI0O 2XNDG 2QTSA 3SYQA 1QHTA 2VQFB 1MMMA 2Q73A 1WP8A 3UCSC 5EBWC 1V54B 5LMNO 3B4SA 1NVPD 4BW9A 5KAFZ 2UXXA 1XBLA 3ZRVA 1TA8A 2EJ7A 2AW9A 3P3PA 3CC4V 4JV5B 4PI2A 1PM9A 2H94A 3OGIB 3H9VA 3BHPA 1GK9A 4OGQB 5IWAO 2EBOA 2R9RB 5AG2A 5H2FZ 2CDYA 1OCOC 4X1IB 1R3LC 2QSAA 2EX3A 4FJCC 3ABMB 1RP3B 4GX5A 5IJ0B 2B1IA 4NXNO 3RFRA 1OCRC 5KX5B 3N2KA 3ZIAG 1VQ6V 5HFMA 4ZI7A 4FVMA 2KB1A 4TUYB 4O4HB 4I55B 5CBHA 5JJNB 1IBLO 1VEWA 3JSNA 4WFFA 5FPRA 1N33O 4GUNA 4JI1B 4NXMO 2M7WA 1GN6A 2RNBA 4B3TB 1FXKC 3H1HH 1FFXB 3W7XA 2IH1C 4LNUB 3E35A 3VQWA 5EC1C 3SPGA 4OXSA 1AR1B 1OCCB 1G4YB 4FMTA 2JIZG 3J80N 1M1KW 1XQ8A 2GHYA 4UCVA 4JI7B 2VQEB 1BCCH 2Y0IA 4UCOA 1WAZA 1OJHA 2KSDA 2EINC 1LUVA 2A0LA 4GYCB 2JGUA 2AXTZ 4O4IB 4KP4A 4LF6B 1Y4MA 2LFRA 1G1XB 2LW1A 4DW0A 1FXKB 4AQYB 1AP6A 2RN9A 2XAQA 4NTXA 4JI2O 4QE9A 1FXVA 4MVUA 3SR2C 2YXYA 5EBLC 1NR7A 2VQEO 1XNQO 1K4CC 4TSFG 3DXRB 1X4TA 3W7TA 3CS5A 3SGIA 1XL4A 2WWWA 2BCCH 1FPOA 3OT7A 1KBHA 2A3QA 2F43G 1CEZA 3T1CA 4D6TH 1SESA 4OX9B 3FKSG 2ZE8A 4GZRB 1AI6A 2UXCO 3TXQA 3JASA 3RVYA 2HR3A 2XAFA 3FYIB 1OHHG 3GVMA 3CMAV 1RM1B 4DR6O 5DM6V 4YJ3A 1AI5A 1AP5A 2YIDA 5JH7B 4JI8O 3BY6A 1AILA 2X6AA 1VF5B 5FNVA 3CC2V 3VQYA 4X64B 4JI5O 1S3JA 4WFHA 5EZYA 4LFBO 4MW3A 4LF9B 4FZ1A 3AK1A 1D5AA 1JFFA 4D7TA 4QIWF 2PTMA 4LF4O 3F5WC 3OE7G 5KHKA 3B77A 4TV9B 4D7SA 1TUBB 4ZHQB 2PUSA 5L3GA 3HKCA 5K1PA 4UVBA 3EVKA 4UCSA 4UV8A 1QLEB 3RYHA 2QJ1A 4XBFA 1X59A 1S5HC 2DW4A 5BZBA 4DR4O 4DV7O 1HNXB 5IDJA 1ORQC 3ZS8C 1N34B 4K35A 1MZEA 1V55B 2B1GA 4LF7O 2JS5A 2HHHO 1KKDA 4X1YA 3B40A 5FL7G 3UT5B 4MVZA 3AG3B 3P32A 3T1YO 1VQNV 3SYPA 1P7BA 3LNNA 2NLJC 2VWKA 2AHZA 1M57C 1JJOA 3SYCA 4IYHA 4LBEC 4RUEA 4C7UA 1Q8IA 1MZFA 4AI8A 1N32B 4LFCB 3CCQV 3B09A 4JI4O 2CTWA 3I5DA 4IYIA 2WA4A 2EIJC 2KG7A 3N2GB 1Q6HA 1QCEA 4G27B 5L3DA 5CN0A 4YHHO 4FLUA 4QE7A 4OPAA 2YEVA 3JD2A 3F5TA 1XNRB 3D8CA 2W6IG 1QU7A 3FB5C 3ABLC 2Q68A 2WLNA 2E3CA 4X89A 3K59A 5JCOC 4JAAA 4N23A 1IVSA 4H44B 5IT9N 3K04A 1QLEC 1EZJA 2W6JG 4BW5A 1SQVH 4RUFA 1Z2GA 2WAMA 4HAMA 1KYOF 3QVNA 3SPHA 4QGPA 3CRAA 3AG1B 2Q7HA 5GTIZ 3HKBA 1SQQH 4YIOA 5IJ9A 1NQTA 2YIBA 3E89A 3OFNG 2R72A 1H38A 1EBOA 3LSSA 2UUBB 3QNEA 4TUYA 4ASUG 1BZKA 3PN1A 1I08A 2XHBA 4K0KB 2Y4TA 5B1BB 1JA8A 4QPKA 3AG7A 3MHHC 1IZ3A 3BEHA 4X66O 2OIEA 4YY3O 2O57A 4JYCA 4DV5B 1FFXA 3AG4C 2Y69C 2QGNA 1LNQA 3E8GA 4DR7B 2YSUB 1ZTEA 1U97A 5FLXN 4X65O 4I50B 1Y67A 1U96A 1NU1H 2YC0A 4B3RO 4QNHB 2DJVA 5LBQA 4A5UB 4P9OA 1VQMV 1VF7A 2CTPA 4KXRA 4J10A 5JVDA 4ZOLB 3H01A 1PL0A 2IBZH 3BA8A 3H1KH 3BFRA 2K1EA 2P22C 1XMOO 5KHJA 1M57B 3K5OA 1JX9A 3I56V 2YXHA 1VQKV 1PP9H 3JALA 1OCRB 2Q69A 2EULA 1R6TA 1RPOA 1ZSPA 5CBGA 2OCCC 4RO2A 2CGOA 3B2EE 3BVOA 2D2CB 4RQEA 3OTFA 3E22B 2PI5A 1JOYA 3ETGA 1H2MA 3PJSK 4BIZA 2OIGA 4DV4O 4GX0A 2B5UA 2IJHA 4DUZB 4X1IA 2QE7G 1K73W 4PDLA 1QBZA 3JASB 4TQFA 3ZMSA 3N2KB 4QJFB 3C3SA 1BL8A 3OUSA 3CEIA 2PGGA 3RN4A 2MK3A 4LWSA 2XAHA 4WCEV 4I55A 1XEQA 5KA5A 3WG7C 1J5EO 2CH7B 1PNLA 2DWDC 2CUGA 3X2QC 3HKCB 5HFLA 4JTCB 2EIKB 5DEDA 5FPOA 3BPZA 3OAAG 1R73A 3NR7A 1R1BA 4G28B 2P4VA 5LXTA 1IXBA 1M93A 4JI4B 3AG4B 5TISZ 5KHHA 4X88A 3AG3C 4B3RB 2F4VB 2XTAA 4X1YB 1AVMA 5IYZA 3A8TA 2X6CA 3IGAC 5JJEB 1TUEB 4L87A 3HPLC 3MHSC 4JYBA 3N27A 2YI8A 1R6NA 1S76D 3K5NA 2ZD9A 3WB0A 3MD0A 2IJKA 3JSLA 5GONB 1JJ2U 2UU9O 1PV0A 2ZQMA 3C3TA 2IJJA 1HR0O 4DO2A 1VQ9V 4F6RA 1S5JA 5CA1B 4K8ZA 4FLYA 2OYQA 5B1OA 3T1HB 4U3JB 1PPJH 3N2GA 5L3BA 4R50A 1M56C 2C2AA 3ZCCA 2ARHA 1HNZO 4O2BA 5IYBO 1BHAA 3UQ8A 4LF9O 4NXNB 1O9GA 1DK1A 3S3WA 5KMGB 4UB6Z 2UUAB 3DGEA 2EINB 5KA6A 3T1YB 3CCJV 2JS3A 4DW1A 3OUFA 1EZVH 2CGNA 5LMUO 3ZMUA 1A32A 3OR6C 1DF4A 3IAYA 2YICA 4DV2B 1YEWA 4JAVA 1UJWB 5KLVH 3L73H 4PV1B 1B3QA 2Z0AA 1SQFA 4RWUA 1ZX3A 1KP2A 5GW7A 1FD9A 5LP6A 4YJ2B 2CTRA 4Z1VA 1P84F 4PD4F 1SQXH 4JI0B 3Q4HB 2LW7A 5EIBD 1IDSA 4J7ZA 4TT3G 1YVWA 4FFBA 2PI4A 4IIJB 2ZT9B 2UXBO 4TQDA 2P7TC 1NBMG 2AGAA 4GKJO 1SKVA 3FB8C 4NB5A 2R70A 4YIPA 2K9PA 4DRXA 4EEQA 2EIMC 4GLXA 2UUCO 3DC5A 3MDSA 3CYOA 5JCOA 3E86A 3WB2A 3HB3B 3AK3A 2YIBD 2V4DA 4B3TO 4GCZA 3G4SV 2RDCA 3T1HO 1XILA 1N33B 3IJ4A 4PJ0Z 4FZ0A 3L72H 1YCIA 2E76B 4UCRA 1W59A 2GV9A 3W7UA 3S3XA 4DV1O 3J81N 2E75B 2R9AA 3UO3A 2QA4V 1VMGA 3DC6A 5H6RA 5KUMA 4ZKIA 4I50A 3KKYA 1AI7A 2EILB 2WLHA 1N36O 3L71H 3BA9A 1VP7A 1O9HA 2X0LA 3G6EV 3LDDA 4B7EA 4FLVA 2Q67A 4DR7O 4X20A 4EFBA 1XMOB 1F4NA 2KKWA 2MW2B 4IT5A 1I5YA 2Q9LA 2NR5A 1N36B 3CRCA 3JALB 4P9PA 2Y48A 3D3IA 4J7JA 1JQ0A 3RWRD 1L8DA 2P5OA 1AJQA 4O4JB 4IL6Z 4F6EA 1K92A 1V54C 2EZPA 2XT9A 4BR6A 3ZRXA 4DV6O 5EIBC 5E79Z 3QG5A 3E22A 4WBNA 3H1LH 2UUBO 2XOKG 1R6KA 3TK1A 3OMNB 4DUYO 4MS2A 3B8MA 2WLLB 2HG5C 4X62B 1NH2B 1NJIW 3CCRV 4NTWA 3THOA 2ITCC 1Q90D 3CB2A 2CH7A 2QWNB 4B3SO 1N0JA 4CH3A 4PDRA 3ZHQA 1WB8A 1I0HA 2GSMB 3CX5F 1AJPA 5JWPA 2Q8VA 5BMVA 3CXCU 1K3EA 3M8AA 3W7SA 3K0GA 1WPBA 4PA3A 4DR5B 1Q7YW 4JGSA 1P49A 5DECA 5BR8O 3BABA 5CBFA 3K57A 1KECA 3K58A 3T4DA 1GKFA 3CE2A 2RQ6A 1E1QG 4LR3A 1MSWD 5F2VO 1PNKA 3ZBHA 5CA3A 4K8XA 1KD1W 2OTJV 3IC7A 3UO2A 1S77D 4JI3O 4LH6A 2JJ1G 2L6LA 5JVDB 3EXAA 1KUQA 4EB6B 5LHGA 3SYOA 4DR2O 3ZRWA 5LHIA 1L1FA 2ZR2A 2GBOA 3H1JH 1YTFD 2IJIA 5GONA 1JR9A 1K97A 2YUAA 4LF8O 1Q43A 4U3JA 2UXDO 5BXZA 2X7RB 4I4TB 2L35A 2EJRA 2HFEC 1VQPV 5J2UA 1VQOV 5BY1A 3JARB 1YTFB 1MG1A 2X6BA 1FFTB 1AR4A 2QDOA 3RT3C 1SRYA 2VWJA 1RSOA 3A0RA 2QR4A 1JCHA 2BE3A 1K8AW 4EFEA 4B3SB 2CE4A 2Q6AA 1IBKB 1BQ0A 3RYCA 1FAFA 1Q5OA 2LJ2A 3L9DA 4MVSA 4HNAA 2JGDB 4CBCA 5LP6B 1SZXA 2EZOA 4R8CA 4YJ2A 4FM0A 3CMEV 1NTKH 4H33A 3A0BZ 1ZLZA 2F23A 1NTZH 1ZAUA 2VS0A 1Q82W 4GKKO 4IIJA 1OZ0A 1VF6C 2E5LO 3CCLV 3RYIB 3HKEA 3K06A 4X8AA 2Q4PA 3Q4HA 4NTYA 1BSMA 5B1AB 1K5QA 5EYPA 1JMKC 1YITV 5EC2C 2CK3G 3ASOC 1BS3A 4J9ZB 3AEIA 4I5SA 4BIOA 1QNMA 3RW0A 2JJ2G 2ZM6B 1WA8A 5LGNA 5C93A 1W0JG 4LNUA 2IM9A 3RGBA 1GH6A 3CCSV 4JYAO 4TWKA 1IBMO 3TCUA 1E79G 4DR4B 2LP7A 2AZ2A 3TETA 3VQXA 1YZBA 4LF8B 3AK2A 2ZNJA 4PA7A 3U10A 3ZMVA 2ZKOA 1M9NA 2PF4E 4LCUC 4IHJA 1LUWA 3SPCA 1SERA 4FFKA 4O4IA 3LSUA 3ABTA 4X20B 3J7AU 4U3FH 3P3NA 2F93B 4F6RB 2QTOA 3ZHTA 5CA1A 1SQPH 3E8FA 4DV3B 4JAUA 2PY5A 4NXMB 1Q86W 4JZ2A 2HHHB 1AROP 2UXDB 1ZUQA 4MTGA 1NT2B 1GN4A 4R7CA 4X66B 1RPRA 3O65A 1OCOB 1WPXA 4I9WA 5KMGA 3ICXA 3JD4A 1N0NA 1XNRO 4DR2B 4CZZA 1D2DA 1QVFU 2A06H 2P6JA 1FJGO 3QO8A 3ZN0A 2ZE5A 1TVKB 4JI1O 1GM7A 2WLKA 4JPRA 5CMUA 4WFAV 1PD3A 4JI3B 3NXSA 1S5LZ 1H8HG 4NVPA 5B5EZ 2QWQB 4J42A 1DLBA 3CPWU 5H5NA 4JI6O 2JVDA 1KU9A 2JDIG 4CH5A 3E8BA 2OWOA 2IU0A 3OEEG 4GX1A 5BMVB 3KZIZ 3ASNC 4ZI7B 4TV8A 2FB5A 2EIKC 2EIJB 3DTUB 3SDLA 1P7GA 1SETA 3G80A 3GWKC 1N8RW 3K0DA 3QO5A 2M6YA 1IURA 4DK0A 3E83A 4DYLA 4PHZA 4MTXA 4X62O 2QKAA 3CCEV 1VF6A 4MSWC 5LL6Y 4PA9A 3CD6V 1PNMA 4DRXB 4PI0A 5J2TB 1B6QA 1N4CA 4PA4A 4ZIBA 3SJAC 4DV7B 3APOA 3JATB 4JTAB 4LF5O 3BCCH 5LMNB 1F4MA 4IGGA 1KC8W 3JD1A 2EIMB 2RJZA 1EFRG 2FL4A 4NYKA 4UB8Z 4HZ3A 2QKSA 4UVCA 2ZXWC 1TGOA 1VQLV 4Q20A 2XUMA 1IXMA 1MABG 1NZ6A 2N04A 2YXLA 3JD3A 4EB6A 4LF4B 2UUAO 1IBKO 1NR1A 2P4KA 4OPHA 1TAEA 1FXKA 1DTOA 1YHQV 3STLC 2F4VO 1XDCA 4JTDB 4MVOA 3K79A 4JI6B 4I0XA 3ABKB 2VQFO 1QQCA 1M56B 4H13B 3T4ZA 4DK1A 3JARA 3ZRWB 4J80A 1YI2V 3DXRA 2RCVA 4YXWG 4BWAA 3E2EA 1R3IC 4DV6B 1BGYH 4NR1A 4I4TA 5J2UB 5IY5C 1V9PA 3KCYA 4YY3B 1V55C 2Y4UA 2PYJA 3CJHB 2D3OW 2R9IA 1GRJA 3L74H 1RSOB 3A0HZ 5GTHZ 3WFVA 3M99B 4HNAB 2ETNA 3KG2A 1YJNV 3O9OA 3F7VC 3CCMV 2H3OA 5KHIA 1K4DC 2WLLA 3FB7C 2W0XA 3ZX6A 3BAAA 3T2MA 3LDCA 4Z2WA 4FK5C 1BQZA 2DOSA 2ZR3A 1B04A 4FM1A 3ZRSA 1E1RG 2ADQB 4JASA 2NN4A 1Q81W 3SYAA 3JD0A 2A79B 3CWBH 3ABUA 2KQXA 4W4LA 3RYFA 4DV3O 2GTSA 1TUBA 4Z1MG 1T5EA 5IJ9B 4JI7O 3JCUZ 5KUKA 2Q7EA 1H2KA 3SPIA 4OX9O 1SZTA 2IW5A 2WLIB 3RYIA 4CS2A 2Z5UA 4MW8A 5CA0B 1DGSA 4AQYO 2Q7GA 5EYPB 4B3MO 1PKXA 1XMQB 4CC6A 4UCUA 5LA6B 4PA6A 2LO1A 1Q3EA 3A2FA 3OMAB 2HKOA 2YDEA 1SA0B 4WFGA 3STZC 1XOUA 4IHJB 1SC5B 2ILMA 5LYJA 4MT8A 1THZA 4R6ZA 2ZDIA 4LFCO 4FLXA 5JJJB 2HVJC 5LGUA 4DR1O 4DV2O 2CTQA 5CB4B 4F4LA 2A7WA 1BT8A 2KG7B 4MVMA 4ZOLA 1XNQB 1H2GA 1NS1A 2P06A 3AG1C 2UXNA 1G8MA 5B3SB 3JAKA 5E1AC 4LF7B 3F7YC 3EHBB 1DF5A 2BTOA 3CCUV 1ZL8A 3CHXA 4FLZA 1R3JC 1TVKA 1HNZB 4I9QA 1L0NH 4X9QA 3RYCB 1ENVA 1F23A 4O4LB 4EKWA 2AHYA 1SF9A 3HKDB 5B1AC 3WU2Z 1FKAO 5IE9A 1I94B 2XAGA 2E74B 2YIAA 4DR5O 2GUZA 3HR0A 4JZGA 3CRQA 3FYEB 4FM2A 4JF3A 1FYJA 1JPXA 3OTOO 4DR3B 2UU9B 1F7YA 2QM4A 3HKBB 4NKGB 3FFQA 4E4EA 3X2QB 4LFBB 3IFXA 3LNMB 2WSSG 3FX7A 2OCCB 1VQ4V 1J95A 1SS3A 2ITDC 1SQGA 4RQFA 3HKEB 4GX2A 4LWSB 1MNGA 5J2TA 2FMLA 1WJZA 4O2AA 1AI4A 1K7DA 1IBLB 3ML0A 3TGUH 2V7QG 4PDVA 1S72V 3WB1A 3LDEA 4AHCA 3ZEDA 4DV4B 2G38A 2Q0OC 3VBBA 5L3EA 4DXWA 1HNWB 5LHHA 2JRIA 1AB3A 3UKMA 3RBZA 1WA8B 2VRZA 5LXTB 1XI1A 2P67A 5KAIZ 5LOVB 2H8PC 5B1BC 1AR5A 3K9SA 4UUJC
chains in the Genus database with same CATH topology
4GX0A 2IH3C 3ZMTA 2B5UA 4U7NA 2IJHA 1QVGU 2QE7G 1K73W 3GB7C 3K06A 4H37A 2BOCC 4PDLA 4X8AA 1QBZA 2XNDG 3SYQA 2ATKC 5B1AB 1K9MW 1K5QA 1YITV 5EBWC 1V54B 3ZMSA 5EC2C 4QJFB 1NVPD 2CK3G 3ASOC 4J9ZB 1BL8A 3AEIA 4I5SA 1K5SA 3OUSA 2UXXA 3RW0A 1QLNA 2JJ2G 2MK3A 2XAHA 5LGNA 3ZRVA 1S0VA 4WCEV 5C93A 1W0JG 1ZWIC 5KA5A 3CC4V 4BAYA 3WG7C 2H94A 1PNLA 2DWDC 1GK9A 3CCSV 3X2QC 2EBOA 1BMFG 5HFLA 2R9RB 4TWKA 3ASNB 4JTCB 3RVZA 2EIKB 3K3WA 3TCUA 1E79G 3OAAG 1R73A 1OCOC 2LP7A 4PDMA 4WFEA 1P4RA 4XDLA 3TETA 1R3LC 4G28B 4FJCC 3ABMB 4GX5A 2B1IA 4PA7A 3ZMVA 3AG4B 1M9NA 4J9YB 4LCUC 1RM1C 3OM3B 1OCRC 3ZJZA 3SPCA 1SERA 4X88A 3AG3C 3ZIAG 4PELA 5IYDO 3ABTA 1VQ6V 5HFMA 3ABMC 2KB1A 2QTOA 5CBHA 1ROPA 2X6CA 3IGAC 1YJWV 3E8FA 4JAUA 4WFFA 1TUEB 1Q86W 1F51A 4L87A 3HPLC 3MHSC 2M7WA 4JYBA 1AROP 4FPPA 4MTGA 4R7CA 1R6NA 1RPRA 1S76D 1OCOB 1WPXA 1FXKC 4I9WA 2ZD9A 3W7XA 1HWYA 3MD0A 2IJKA 2IH1C 2XAJA 3FB6C 3JD4A 1JJ2U 3E35A 4CZZA 1QVFU 5EC1C 3SPGA 1K33A 2P6JA 4OXSA 1AR1B 1K34A 2WLMA 1OCCB 2ZQMA 3QO8A 3ZN0A 1G4YB 4UV9A 1CPYA 2IJJA 1GM7A 2WLKA 2HLDG 4FMTA 2JIZG 4JPRA 3CCVV 5CMUA 1M1KW 4WFAV 1PD3A 2OT5A 3NXSA 4DO2A 1VQ9V 2GHYA 1H8HG 3JYCA 4P2ZA 3G71V 2DQ3A 5B1OA 5L3FA 3E8HA 1QR9A 1DLBA 3WG7B 3CPWU 2EINC 4MTOA 4R50A 1H8EG 1M56C 2A0LA 2JDIG 5L3BA 1VQ5V 2C2AA 3E8BA 2IU0A 3ZCCA 3VOUA 3OEEG 4GX1A 4KP4A 1Y4MA 3ASNC 2LFRA 5IYBO 1BHAA 2EIKC 2WLIA 2EIJB 3DTUB 4U7OA 1FXKB 1SETA 5EK0A 2XAQA 3DGEA 1N8RW 2EINB 3K0DA 5KA6A 2JEXA 3QO5A 3CCJV 4QE9A 3E83A 2A9HA 4LC1A 1OCCC 1FXVA 3K9AA 4MVUA 4MTXA 3OUFA 3CCEV 5EBLC 1NR7A 4MSWC 1K4CC 5IY5B 4PA9A 2DWEC 3ZMUA 3CD6V 4TSFG 1PNMA 3OR6C 3QO7A 3ABLB 5EBMC 1DF4A 3W7TA 1B6QA 4PA4A 1W2BU 1XL4A 2QM8A 4JAVA 1UJWB 2WWWA 4JTAB 5H9CA 1KQSU 1KP2A 1F4MA 5GW7A 4HYOA 1KC8W 3JD1A 2EIMB 2F43G 1CEZA 3T1CA 1SESA 1EFRG 3FKSG 4HZ3A 3ZN1A 1AI6A 1GM9A 3EFFK 3RVYA 1XL6A 2QKSA 4UVCA 2ZXWC 2HR3A 1VQLV 4Q20A 4TT3G 1IXMA 2XAFA 1FS0G 2PI4A 1FXHA 1MABG 3FYIB 1OHHG 3CMAV 2P7TC 1NBMG 1OCZC 1RM1B 4P30A 3JD3A 5IYCO 5DM6V 3FB8C 1NR1A 3OGCC 3R65A 1AI5A 1FXKA 1DTOA 1GMGA 2X6AA 3BY6A 2HJFC 4MTFA 4UXNA 2EIMC 3STLC 1YHQV 3CC2V 1YIJV 4JTDB 1S3JA 2JEUA 3CYOA 4WFHA 3E86A 4MVOA 3K79A 4QPJA 4XDKA 3ABKB 4MW3A 2ZXWB 3HB3B 1M56B 3AG2B 3T4ZA 4QIWF 3ZRWB 3F5WC 4GCZA 3OE7G 1YI2V 2Z3YA 3G4SV 4RAIA 3B77A 4YXWG 3E2EA 3W7UA 1R3IC 3SPJA 1GTOA 3CP1A 2QA4V 5L3GA 2Y69B 2DQ0A 5H6RA 3OW2U 4UVBA 5KUMA 4ZKIA 1NVPB 3OR7C 3ABKC 5IY5C 1AI7A 4UV8A 2EILB 1V55C 1QLEB 2WLHA 1QR8A 2WPDG 4XBFA 1AJNA 1R3KC 2D3OW 1S5HC 2DW4A 2R9IA 5BZBA 1NKDA 2X0LA 4MVRA 3G6EV 3WFVA 4N21A 3M99B 3LDDA 5IDJA 1ORQC 3KG2A 2Q67A 4KFMA 1YJNV 1V55B 2B1GA 3F7VC 3CCMV 2WLJA 1K4DC 2WLLA 3FB7C 1GO3F 1KKDA 1F4NA 4UVAA 3OEHG 5FL7G 1I5YA 2W0FC 3T2MA 4MVZA 3LDCA 4FK5C 3AG3B 2ZR3A 3P32A 4P9PA 1VQNV 2Y48A 1VQ8V 3B8NA 3D3IA 3SYPA 1P7BA 2NLJC 3ZRSA 2AHZA 1M57C 5DN6G 1E1RG 4JASA 3SYCA 1JQ0A 1AJQA 2DYSB 4LBEC 4RUEA 1Q81W 3SYAA 1K92A 1V54C 2EZPA 3JD0A 3ZRXA 3CCQV 4FIPC 1COWG 2A79B 4E2LA 4GT1A 2BOBC 3ABUA 2XOKG 1NH2D 4MVQA 2EIJC 3CC7V 1R6KA 3TK1A 4Z1MG 3GWOA 5KUKA 1QCEA 3OMNB 4G27B 4MS2A 5L3DA 5CN0A 3B8MA 3SPIA 1SZTA 2IW5A 2HG5C 2WLIB 2WLLB 3JCZA 4QE7A 1NH2B 1NJIW 3CCRV 2Z5UA 4MW8A 2YEVA 3D36A 3JD2A 2IU3A 2ITCC 4PDRA 1VQ7V 2W6IG 3FB5C 2GSMB 1PKXA 3ABLC 1AJPA 2Q68A 2WLNA 4X89A 1W0KG 1K3EA 4PA6A 3CXCU 1JVMA 4XDJA 3W7SA 4WF9V 4N23A 4ZBMA 1GM8A 3K0GA 3UM7A 2EILC 4PA3A 3OMAB 2HKOA 4WFBV 3K04A 1Q7YW 3ETEA 4WFGA 1QLEC 1EZJA 3STZC 2XASA 2W6JG 4JGSA 4BW5A 1M90W 4RUFA 2FTKA 5CBFA 2WAMA 4MT8A 1THZA 4R6ZA 1KECA 4HAMA 2ZDIA 3T4DA 1GKFA 4G2KA 3SPHA 2YEVB 2HVJC 3AG1B 5LGUA 3OMIB 4F4LA 1E1QG 1NQTA 4MVMA 1H2GA 1MSWD 3E89A 1PNKA 3OFNG 5CA3A 3SJQC 1H38A 5LGTA 1KD1W 1EBOA 3AG1C 2UXNA 3LSSA 1G8MA 3QNEA 5B3SB 2OTJV 3IC7A 4ASUG 5E1AC 2OTLV 1S77D 3F7YC 3EHBB 3AG2C 1YSCA 1DF5A 1I5XA 2JJ1G 3CCUV 5B1BB 3W7WA 3LUTB 1Y66A 1R3JC 4QPKA 3MHHC 3BEHA 5LHGA 1ENVA 1F23A 3SYOA 3I55V 3ZRWA 3ZMZA 5LHIA 5J9PC 1L1FA 4EKWA 2ZR2A 1WLEA 4JYCA 4KUMA 2AHYA 3AG4C 3K08A 1YTFD 4BIUA 2Y69C 2IJIA 1LNQA 5B1AC 2JK5C 1K97A 3E8GA 2XAGA 2YSUB 2X7RB 2EJRA 2HFEC 1VQPV 1VQOV 3FYEB 4LP8A 1YTFB 1MG1A 2X6BA 4JF3A 4QNHB 1FFTB 2DYRC 2ZDIC 1JPXA 5LBQA 1YJ9V 4P9OA 1VQMV 1SRYA 5B1NA 3LSQA 3A0RA 3X2QB 1JCHA 5L3CA 1K8AW 2Q6AA 3IFXA 3LNMB 3H01A 1PL0A 2WSSG 3P30A 2OCCB 1VQ4V 1J95A 4RQFA 2ITDC 2K1EA 2NNUA 4GX2A 2QEXV 1CP9A 3K03A 1M57B 1AI4A 1JX9A 3I56V 1K7DA 3ETDA 2DYSC 2LFSA 2V7QG 3ML0A 2QM7A 4PDVA 1VQKV 1S72V 3LDEA 1OCRB 2DYRB 2Q69A 1RPOA 5CBGA 1MOFA 2OCCC 4MVSA 1BHBA 4RO2A 2P90A 3VBBA 5L3EA 4DXWA 4CBCA 5LHHA 2EZOA 4R8CA 3UKMA 3CMEV 2V1DA 3RBZA 4H33A 1OCZB 2HVKC 4RQEA 2PI5A 5B3SC 5H6QA 1JOYA 1Q82W 2P67A 3ETGA 3ASOB 2H8PC 5B1BC 3PJSK 1OZ0A 4UUJC 1KP3A 3CCLV 4BIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX0 A;  2IH3 C;  3ABK C;  3OR7 C;  3E8H A;  4F4L A;  5IY5 C;  1V55 C;  2EIN C;  3GB7 C;  2BOC C;  1M56 C;  2A0L A;  2WLH A;  3K06 A;  4H37 A;  4MTO A;  4MVM A;  3E8B A;  1R3K C;  3E89 A;  1S5H C;  4GX1 A;  4X8A A;  3SYQ A;  3ASN C;  2ATK C;  3SJQ C;  3VOU A;  5BZB A;  3AG1 C;  2EIK C;  2WLI A;  4MVR A;  5EBW C;  5EC2 C;  3LDD A;  5E1A C;  5EK0 A;  1ORQ C;  3KG2 A;  3ASO C;  2Q67 A;  3F7Y C;  4KFM A;  3K0D A;  4J9Z B;  3AG2 C;  1BL8 A;  3F7V C;  2WLJ A;  3OUS A;  1K4D C;  2WLL A;  3FB7 C;  4QE9 A;  3RW0 A;  3E83 A;  2A9H A;  1KKD A;  1OCC C;  4MVU A;  3LUT B;  3OUF A;  1R3J C;  1ZWI C;  5EBL C;  2W0F C;  3T2M A;  4MVZ A;  3LDC A;  3BEH A;  4MSW C;  3WG7 C;  1K4C C;  3SYO A;  4PA9 A;  2DWE C;  4P9P A;  2DWD C;  5J9P C;  3SYP A;  4EKW A;  1P7B A;  2AHY A;  2NLJ C;  2AHZ A;  1M57 C;  3AG4 C;  3K08 A;  3OR6 C;  5EBM C;  2Y69 C;  3SYC A;  3X2Q C;  2R9R B;  4TWK A;  4JTC B;  4PA4 A;  1LNQ A;  3RVZ A;  4LBE C;  5B1A C;  2JK5 C;  4RUE A;  1XL4 A;  3TCU A;  3SYA A;  1V54 C;  3E8G A;  4JTA B;  1OCO C;  4PDM A;  4WFE A;  4XDL A;  3TET A;  1R3L C;  4G28 B;  2A79 B;  4GX5 A;  4HYO A;  2BOB C;  2HFE C;  4PA7 A;  4PDL A;  3T1C A;  4J9Y B;  4LP8 A;  4LCU C;  4MVQ A;  2EIJ C;  4HZ3 A;  1OCR C;  2X6B A;  4R50 A;  4QNH B;  2DYR C;  3SPC A;  3EFF K;  3ZJZ A;  5KUK A;  4G27 B;  4X88 A;  1XL6 A;  2QKS A;  3AG3 C;  2ZXW C;  4MS2 A;  4P9O A;  3RVY A;  3SPI A;  3ABM C;  2WLL B;  2HG5 C;  2WLI B;  4QE7 A;  3ZRS A;  2KB1 A;  4MW8 A;  2P7T C;  2YEV A;  1OCZ C;  2Q6A A;  2QTO A;  5CBH A;  3IFX A;  3LNM B;  4P30 A;  2ITC C;  2X6C A;  3IGA C;  3E8F A;  3FB8 C;  4WFF A;  3OGC C;  1J95 A;  3R65 A;  4PDR A;  2ITD C;  2K1E A;  3HPL C;  4GX2 A;  2X6A A;  2HJF C;  4MTF A;  3FB5 C;  2EIM C;  3K03 A;  3ABL C;  3STL C;  2Q68 A;  4MTG A;  2WLN A;  4X89 A;  2DYS C;  4PDV A;  4PA6 A;  4JTD B;  4R7C A;  1JVM A;  4WFH A;  3LDE A;  3E86 A;  4MVO A;  2Q69 A;  4XDJ A;  4ZBM A;  4XDK A;  3K0G A;  2ZD9 A;  4I9W A;  3UM7 A;  4MW3 A;  5CBG A;  2EIL C;  2OCC C;  4MVS A;  2IH1 C;  4PA3 A;  3FB6 C;  3K04 A;  4RO2 A;  4WFG A;  1QLE C;  3STZ C;  4DXW A;  3T4Z A;  4CBC A;  4BW5 A;  5EC1 C;  3SPG A;  4R8C A;  4OXS A;  3F5W C;  3UKM A;  3RBZ A;  2WLM A;  4H33 A;  2HVK C;  4RUF A;  1G4Y B;  4RAI A;  5B3S C;  5CBF A;  4R6Z A;  2WLK A;  2H8P C;  1R3I C;  3SPJ A;  3T4D A;  5B1B C;  3PJS K;  3SPH A;  4UUJ C;  2HVJ C;  3JYC A;  4P2Z A;  5KUM A; 
#chains in the Genus database with same CATH topology
 4U7N A;  5ITZ A;  2FKX A;  5IYZ B;  1J5E B;  5C8Y A;  2ATK C;  1K9M W;  1KB9 F;  3BRC A;  3OD4 A;  2ZIO A;  3ZHS A;  1D5N A;  1K5S A;  1QLN A;  4JI8 B;  4B08 A;  1S0V A;  1ZWI C;  5B66 Z;  4BAY A;  3SJB C;  2PYL A;  3D36 C;  4ABM A;  4DUZ O;  1BMF G;  3ASN B;  3RVZ A;  3K3W A;  2UXC B;  2BSK A;  3L70 H;  2PZS A;  4PDM A;  4WFE A;  4KHP O;  1P4R A;  4XDL A;  4X1K A;  1XMQ O;  4H0L B;  4J9Y B;  1RM1 C;  3OM3 B;  1EN6 A;  3ZJZ A;  3CXH F;  2GDS A;  1HP8 A;  4PEL A;  5IYD O;  5A9G A;  3ZHU A;  2ZIN A;  1BE3 H;  2N05 A;  4O2B B;  3ABM C;  3SJC C;  4DV0 O;  1ROP A;  2BTQ B;  1YJW V;  4DV1 B;  1F51 A;  4CS3 A;  3QF7 A;  1HNX O;  4FPP A;  4J41 A;  4TV8 B;  1CXZ B;  3JAM N;  1HWY A;  2XAJ A;  3FB6 C;  1K33 A;  4FLW A;  2RMK B;  1K34 A;  2WLM A;  1YDX A;  1IX9 A;  2HEP A;  4UV9 A;  1HDJ A;  1CPY A;  5JQG A;  2HLD G;  3CCV V;  4JYA B;  3JAW B;  1EN4 A;  4KHP B;  1UPG A;  2OT5 A;  1YXB A;  3JYC A;  4P2Z A;  3G71 V;  2DQ3 A;  5L3F A;  3U11 A;  3E8H A;  3JAT A;  1QR9 A;  3WG7 B;  1I7F A;  4MTO A;  1H8E G;  2Y0P A;  1VQ5 V;  1EN5 A;  1G6U A;  3H1I H;  3VOU A;  5LA6 A;  2WLI A;  1Y76 A;  4U7O A;  5EK0 A;  5CA0 A;  2JEX A;  3ZHR A;  4LC1 A;  2A9H A;  3U0Z A;  3FAV B;  1OCC C;  3K9A A;  1MA1 A;  5LYJ B;  1NTM H;  5BR8 B;  5IY5 B;  2DWE C;  5LMU B;  4DV0 B;  1RFY A;  3QO7 A;  3ABL B;  5EBM C;  4B3M B;  1SA0 A;  1W2B U;  2GTA A;  2QM8 A;  5H9C A;  4I0X B;  3CRR A;  1KQS U;  2YI9 A;  4HYO A;  4HBN A;  4L8J A;  1PL4 A;  3CRM A;  1Y74 B;  3ZN1 A;  1GM9 A;  3EFF K;  1XL6 A;  2F66 C;  4B7K A;  3R66 A;  5IWA B;  1FS0 G;  1FXH A;  4JI2 B;  1OCZ C;  4LH7 A;  2WA3 A;  2E5L B;  4P30 A;  5IYC O;  1UFI A;  3OGC C;  3R65 A;  1WNS A;  1GMG A;  2HJF C;  2DMX A;  4MTF A;  4UXN A;  3C90 A;  3CJH A;  2Q5Z A;  2ZCE A;  1N32 O;  1YIJ V;  2JEU A;  1ZL8 B;  1Y6X A;  4QPJ A;  1YF2 A;  4XDK A;  2ZXW B;  4X65 B;  3AG2 B;  4J11 A;  2Z3Y A;  1XUQ A;  5IJ0 A;  4RAI A;  2HJD A;  4LFA B;  3HKD A;  3SPJ A;  1XHZ A;  1Z5V A;  1GTO A;  5KX5 A;  3CP1 A;  2Y69 B;  2DQ0 A;  3OW2 U;  2F1M A;  2GUZ B;  1NVP B;  2ZE7 A;  3OR7 C;  3ABK C;  2ZIM A;  3IC9 A;  5JH7 A;  1GAX A;  4O4H A;  1QR8 A;  5FNV B;  2WPD G;  1AJN A;  4JI5 B;  4X64 O;  4K0K O;  1R3K C;  4FFB B;  4CS4 A;  2DN9 A;  3L75 H;  4LFA O;  1NKD A;  3RYF B;  4MVR A;  2ZNI A;  2OCH A;  2YS8 A;  4N21 A;  4KFM A;  1H2N A;  1HW7 A;  2WLJ A;  4J7K A;  1HR0 B;  1GO3 F;  3G67 A;  2QKC A;  4UVA A;  2B9Z A;  1XHX A;  2LQT A;  3OEH G;  2W0F C;  1FJG B;  5LOV A;  4TOI A;  1VQ8 V;  3B8N A;  3K5M A;  2DE0 X;  4ZHQ A;  5DN6 G;  4ICG A;  2DYS B;  1WN7 A;  3OTO B;  3MAQ A;  2QWP B;  4FIP C;  3RYH B;  1COW G;  4E2L A;  4CH6 A;  1M4U A;  4GT1 A;  2BOB C;  1L0L H;  1NH2 D;  4CH4 A;  4MVQ A;  3CC7 V;  1I94 O;  4DUY B;  3GWO A;  4DR6 B;  3TXS A;  1IBM B;  4UFZ A;  3JCZ A;  1WP7 A;  1GN3 A;  4DR1 B;  3D36 A;  5C8Y B;  2IU3 A;  4UCT A;  5CB4 A;  1VQ7 V;  1HNW O;  1MSD A;  4Q6G A;  2ZM6 O;  5LP6 C;  5A2Q N;  1W0K G;  1JVM A;  4XDJ A;  4WF9 V;  4ZBM A;  2LGW A;  1GM8 A;  3UM7 A;  4X1K B;  2EIL C;  3JAK B;  4WFB V;  3ETE A;  2XAS A;  4CC5 A;  1M90 W;  2FTK A;  1XRE A;  1LR1 A;  4O4J A;  3VQV A;  4O4L A;  2ZE6 A;  1NI8 A;  2ADP A;  2QWR B;  4G2K A;  2YEV B;  5K1X A;  4GKK B;  3APQ A;  4WBN B;  1H2L A;  3ZHV A;  1Q6I A;  2F95 B;  3OMI B;  1M5I A;  1URF A;  3TJT A;  2FYU H;  1N34 O;  3SJQ C;  5LGT A;  1WB7 A;  5KHG A;  2AZ0 A;  2OTL V;  2BTQ A;  2ODM A;  1YSC A;  3AG2 C;  1I5X A;  5EZY B;  3W7W A;  3DSQ A;  1EM1 A;  3LUT B;  1Y66 A;  2Q0A A;  2JGD A;  4LF6 O;  5JQG B;  3I55 V;  4I7Z B;  3ZMZ A;  1VIB A;  5J9P C;  4YJ3 B;  2UUC B;  1WLE A;  4KUM A;  1KMI Z;  3K5L A;  3K08 A;  4BIU A;  4O2A B;  3ETQ A;  1H2S B;  3FD9 A;  2JK5 C;  4DR3 O;  1OV9 A;  2UXB B;  1SQB H;  1GN2 A;  1JFF B;  3QTC A;  3JAW A;  4LP8 A;  1Y76 B;  2DYR C;  2ZDI C;  4KL1 A;  1YJ9 V;  4JV5 O;  4TV9 A;  3CSX A;  5D5Q A;  5B1N A;  3LSQ A;  3FAV A;  1KKC A;  5L3C A;  3KCX A;  4K3A A;  4LF5 B;  1VAR A;  3P30 A;  2NNU A;  1US6 A;  5ITZ B;  2QEX V;  1CP9 A;  1Z5W A;  3K03 A;  3UT5 A;  3ETD A;  2DYS C;  2LFS A;  2QM7 A;  1Q6U A;  2DYR B;  4JYY A;  1MOF A;  4DV5 O;  1BHB A;  2CAZ C;  2P90 A;  1B06 A;  2V1D A;  1OCZ B;  2HVK C;  2N74 A;  4FLT A;  4W4K A;  5B3S C;  3G6B A;  5H6Q A;  3M7M X;  3ASO B;  5D5P A;  4GKJ B;  4AIL C;  3D3Q A;  2LGQ A;  1KP3 A;  2QWO B;  2IH3 C;  2BSK B;  4YHH B;  3ZMT A;  2HP8 A;  1QVG U;  3GB7 C;  4H37 A;  1Y74 A;  2BOC C;  4JI0 O;  2XND G;  2QTS A;  3SYQ A;  1QHT A;  2VQF B;  1MMM A;  2Q73 A;  1WP8 A;  3UCS C;  5EBW C;  1V54 B;  5LMN O;  3B4S A;  1NVP D;  4BW9 A;  5KAF Z;  2UXX A;  1XBL A;  3ZRV A;  1TA8 A;  2EJ7 A;  2AW9 A;  3P3P A;  3CC4 V;  4JV5 B;  4PI2 A;  1PM9 A;  2H94 A;  3OGI B;  3H9V A;  3BHP A;  1GK9 A;  4OGQ B;  5IWA O;  2EBO A;  2R9R B;  5AG2 A;  5H2F Z;  2CDY A;  1OCO C;  4X1I B;  1R3L C;  2QSA A;  2EX3 A;  4FJC C;  3ABM B;  1RP3 B;  4GX5 A;  5IJ0 B;  2B1I A;  4NXN O;  3RFR A;  1OCR C;  5KX5 B;  3N2K A;  3ZIA G;  1VQ6 V;  5HFM A;  4ZI7 A;  4FVM A;  2KB1 A;  4TUY B;  4O4H B;  4I55 B;  5CBH A;  5JJN B;  1IBL O;  1VEW A;  3JSN A;  4WFF A;  5FPR A;  1N33 O;  4GUN A;  4JI1 B;  4NXM O;  2M7W A;  1GN6 A;  2RNB A;  4B3T B;  1FXK C;  3H1H H;  1FFX B;  3W7X A;  2IH1 C;  4LNU B;  3E35 A;  3VQW A;  5EC1 C;  3SPG A;  4OXS A;  1AR1 B;  1OCC B;  1G4Y B;  4FMT A;  2JIZ G;  3J80 N;  1M1K W;  1XQ8 A;  2GHY A;  4UCV A;  4JI7 B;  2VQE B;  1BCC H;  2Y0I A;  4UCO A;  1WAZ A;  1OJH A;  2KSD A;  2EIN C;  1LUV A;  2A0L A;  4GYC B;  2JGU A;  2AXT Z;  4O4I B;  4KP4 A;  4LF6 B;  1Y4M A;  2LFR A;  1G1X B;  2LW1 A;  4DW0 A;  1FXK B;  4AQY B;  1AP6 A;  2RN9 A;  2XAQ A;  4NTX A;  4JI2 O;  4QE9 A;  1FXV A;  4MVU A;  3SR2 C;  2YXY A;  5EBL C;  1NR7 A;  2VQE O;  1XNQ O;  1K4C C;  4TSF G;  3DXR B;  1X4T A;  3W7T A;  3CS5 A;  3SGI A;  1XL4 A;  2WWW A;  2BCC H;  1FPO A;  3OT7 A;  1KBH A;  2A3Q A;  2F43 G;  1CEZ A;  3T1C A;  4D6T H;  1SES A;  4OX9 B;  3FKS G;  2ZE8 A;  4GZR B;  1AI6 A;  2UXC O;  3TXQ A;  3JAS A;  3RVY A;  2HR3 A;  2XAF A;  3FYI B;  1OHH G;  3GVM A;  3CMA V;  1RM1 B;  4DR6 O;  5DM6 V;  4YJ3 A;  1AI5 A;  1AP5 A;  2YID A;  5JH7 B;  4JI8 O;  3BY6 A;  1AIL A;  2X6A A;  1VF5 B;  5FNV A;  3CC2 V;  3VQY A;  4X64 B;  4JI5 O;  1S3J A;  4WFH A;  5EZY A;  4LFB O;  4MW3 A;  4LF9 B;  4FZ1 A;  3AK1 A;  1D5A A;  1JFF A;  4D7T A;  4QIW F;  2PTM A;  4LF4 O;  3F5W C;  3OE7 G;  5KHK A;  3B77 A;  4TV9 B;  4D7S A;  1TUB B;  4ZHQ B;  2PUS A;  5L3G A;  3HKC A;  5K1P A;  4UVB A;  3EVK A;  4UCS A;  4UV8 A;  1QLE B;  3RYH A;  2QJ1 A;  4XBF A;  1X59 A;  1S5H C;  2DW4 A;  5BZB A;  4DR4 O;  4DV7 O;  1HNX B;  5IDJ A;  1ORQ C;  3ZS8 C;  1N34 B;  4K35 A;  1MZE A;  1V55 B;  2B1G A;  4LF7 O;  2JS5 A;  2HHH O;  1KKD A;  4X1Y A;  3B40 A;  5FL7 G;  3UT5 B;  4MVZ A;  3AG3 B;  3P32 A;  3T1Y O;  1VQN V;  3SYP A;  1P7B A;  3LNN A;  2NLJ C;  2VWK A;  2AHZ A;  1M57 C;  1JJO A;  3SYC A;  4IYH A;  4LBE C;  4RUE A;  4C7U A;  1Q8I A;  1MZF A;  4AI8 A;  1N32 B;  4LFC B;  3CCQ V;  3B09 A;  4JI4 O;  2CTW A;  3I5D A;  4IYI A;  2WA4 A;  2EIJ C;  2KG7 A;  3N2G B;  1Q6H A;  1QCE A;  4G27 B;  5L3D A;  5CN0 A;  4YHH O;  4FLU A;  4QE7 A;  4OPA A;  2YEV A;  3JD2 A;  3F5T A;  1XNR B;  3D8C A;  2W6I G;  1QU7 A;  3FB5 C;  3ABL C;  2Q68 A;  2WLN A;  2E3C A;  4X89 A;  3K59 A;  5JCO C;  4JAA A;  4N23 A;  1IVS A;  4H44 B;  5IT9 N;  3K04 A;  1QLE C;  1EZJ A;  2W6J G;  4BW5 A;  1SQV H;  4RUF A;  1Z2G A;  2WAM A;  4HAM A;  1KYO F;  3QVN A;  3SPH A;  4QGP A;  3CRA A;  3AG1 B;  2Q7H A;  5GTI Z;  3HKB A;  1SQQ H;  4YIO A;  5IJ9 A;  1NQT A;  2YIB A;  3E89 A;  3OFN G;  2R72 A;  1H38 A;  1EBO A;  3LSS A;  2UUB B;  3QNE A;  4TUY A;  4ASU G;  1BZK A;  3PN1 A;  1I08 A;  2XHB A;  4K0K B;  2Y4T A;  5B1B B;  1JA8 A;  4QPK A;  3AG7 A;  3MHH C;  1IZ3 A;  3BEH A;  4X66 O;  2OIE A;  4YY3 O;  2O57 A;  4JYC A;  4DV5 B;  1FFX A;  3AG4 C;  2Y69 C;  2QGN A;  1LNQ A;  3E8G A;  4DR7 B;  2YSU B;  1ZTE A;  1U97 A;  5FLX N;  4X65 O;  4I50 B;  1Y67 A;  1U96 A;  1NU1 H;  2YC0 A;  4B3R O;  4QNH B;  2DJV A;  5LBQ A;  4A5U B;  4P9O A;  1VQM V;  1VF7 A;  2CTP A;  4KXR A;  4J10 A;  5JVD A;  4ZOL B;  3H01 A;  1PL0 A;  2IBZ H;  3BA8 A;  3H1K H;  3BFR A;  2K1E A;  2P22 C;  1XMO O;  5KHJ A;  1M57 B;  3K5O A;  1JX9 A;  3I56 V;  2YXH A;  1VQK V;  1PP9 H;  3JAL A;  1OCR B;  2Q69 A;  2EUL A;  1R6T A;  1RPO A;  1ZSP A;  5CBG A;  2OCC C;  4RO2 A;  2CGO A;  3B2E E;  3BVO A;  2D2C B;  4RQE A;  3OTF A;  3E22 B;  2PI5 A;  1JOY A;  3ETG A;  1H2M A;  3PJS K;  4BIZ A;  2OIG A;  4DV4 O;  4GX0 A;  2B5U A;  2IJH A;  4DUZ B;  4X1I A;  2QE7 G;  1K73 W;  4PDL A;  1QBZ A;  3JAS B;  4TQF A;  3ZMS A;  3N2K B;  4QJF B;  3C3S A;  1BL8 A;  3OUS A;  3CEI A;  2PGG A;  3RN4 A;  2MK3 A;  4LWS A;  2XAH A;  4WCE V;  4I55 A;  1XEQ A;  5KA5 A;  3WG7 C;  1J5E O;  2CH7 B;  1PNL A;  2DWD C;  2CUG A;  3X2Q C;  3HKC B;  5HFL A;  4JTC B;  2EIK B;  5DED A;  5FPO A;  3BPZ A;  3OAA G;  1R73 A;  3NR7 A;  1R1B A;  4G28 B;  2P4V A;  5LXT A;  1IXB A;  1M93 A;  4JI4 B;  3AG4 B;  5TIS Z;  5KHH A;  4X88 A;  3AG3 C;  4B3R B;  2F4V B;  2XTA A;  4X1Y B;  1AVM A;  5IYZ A;  3A8T A;  2X6C A;  3IGA C;  5JJE B;  1TUE B;  4L87 A;  3HPL C;  3MHS C;  4JYB A;  3N27 A;  2YI8 A;  1R6N A;  1S76 D;  3K5N A;  2ZD9 A;  3WB0 A;  3MD0 A;  2IJK A;  3JSL A;  5GON B;  1JJ2 U;  2UU9 O;  1PV0 A;  2ZQM A;  3C3T A;  2IJJ A;  1HR0 O;  4DO2 A;  1VQ9 V;  4F6R A;  1S5J A;  5CA1 B;  4K8Z A;  4FLY A;  2OYQ A;  5B1O A;  3T1H B;  4U3J B;  1PPJ H;  3N2G A;  5L3B A;  4R50 A;  1M56 C;  2C2A A;  3ZCC A;  2ARH A;  1HNZ O;  4O2B A;  5IYB O;  1BHA A;  3UQ8 A;  4LF9 O;  4NXN B;  1O9G A;  1DK1 A;  3S3W A;  5KMG B;  4UB6 Z;  2UUA B;  3DGE A;  2EIN B;  5KA6 A;  3T1Y B;  3CCJ V;  2JS3 A;  4DW1 A;  3OUF A;  1EZV H;  2CGN A;  5LMU O;  3ZMU A;  1A32 A;  3OR6 C;  1DF4 A;  3IAY A;  2YIC A;  4DV2 B;  1YEW A;  4JAV A;  1UJW B;  5KLV H;  3L73 H;  4PV1 B;  1B3Q A;  2Z0A A;  1SQF A;  4RWU A;  1ZX3 A;  1KP2 A;  5GW7 A;  1FD9 A;  5LP6 A;  4YJ2 B;  2CTR A;  4Z1V A;  1P84 F;  4PD4 F;  1SQX H;  4JI0 B;  3Q4H B;  2LW7 A;  5EIB D;  1IDS A;  4J7Z A;  4TT3 G;  1YVW A;  4FFB A;  2PI4 A;  4IIJ B;  2ZT9 B;  2UXB O;  4TQD A;  2P7T C;  1NBM G;  2AGA A;  4GKJ O;  1SKV A;  3FB8 C;  4NB5 A;  2R70 A;  4YIP A;  2K9P A;  4DRX A;  4EEQ A;  2EIM C;  4GLX A;  2UUC O;  3DC5 A;  3MDS A;  3CYO A;  5JCO A;  3E86 A;  3WB2 A;  3HB3 B;  3AK3 A;  2YIB D;  2V4D A;  4B3T O;  4GCZ A;  3G4S V;  2RDC A;  3T1H O;  1XIL A;  1N33 B;  3IJ4 A;  4PJ0 Z;  4FZ0 A;  3L72 H;  1YCI A;  2E76 B;  4UCR A;  1W59 A;  2GV9 A;  3W7U A;  3S3X A;  4DV1 O;  3J81 N;  2E75 B;  2R9A A;  3UO3 A;  2QA4 V;  1VMG A;  3DC6 A;  5H6R A;  5KUM A;  4ZKI A;  4I50 A;  3KKY A;  1AI7 A;  2EIL B;  2WLH A;  1N36 O;  3L71 H;  3BA9 A;  1VP7 A;  1O9H A;  2X0L A;  3G6E V;  3LDD A;  4B7E A;  4FLV A;  2Q67 A;  4DR7 O;  4X20 A;  4EFB A;  1XMO B;  1F4N A;  2KKW A;  2MW2 B;  4IT5 A;  1I5Y A;  2Q9L A;  2NR5 A;  1N36 B;  3CRC A;  3JAL B;  4P9P A;  2Y48 A;  3D3I A;  4J7J A;  1JQ0 A;  3RWR D;  1L8D A;  2P5O A;  1AJQ A;  4O4J B;  4IL6 Z;  4F6E A;  1K92 A;  1V54 C;  2EZP A;  2XT9 A;  4BR6 A;  3ZRX A;  4DV6 O;  5EIB C;  5E79 Z;  3QG5 A;  3E22 A;  4WBN A;  3H1L H;  2UUB O;  2XOK G;  1R6K A;  3TK1 A;  3OMN B;  4DUY O;  4MS2 A;  3B8M A;  2WLL B;  2HG5 C;  4X62 B;  1NH2 B;  1NJI W;  3CCR V;  4NTW A;  3THO A;  2ITC C;  1Q90 D;  3CB2 A;  2CH7 A;  2QWN B;  4B3S O;  1N0J A;  4CH3 A;  4PDR A;  3ZHQ A;  1WB8 A;  1I0H A;  2GSM B;  3CX5 F;  1AJP A;  5JWP A;  2Q8V A;  5BMV A;  3CXC U;  1K3E A;  3M8A A;  3W7S A;  3K0G A;  1WPB A;  4PA3 A;  4DR5 B;  1Q7Y W;  4JGS A;  1P49 A;  5DEC A;  5BR8 O;  3BAB A;  5CBF A;  3K57 A;  1KEC A;  3K58 A;  3T4D A;  1GKF A;  3CE2 A;  2RQ6 A;  1E1Q G;  4LR3 A;  1MSW D;  5F2V O;  1PNK A;  3ZBH A;  5CA3 A;  4K8X A;  1KD1 W;  2OTJ V;  3IC7 A;  3UO2 A;  1S77 D;  4JI3 O;  4LH6 A;  2JJ1 G;  2L6L A;  5JVD B;  3EXA A;  1KUQ A;  4EB6 B;  5LHG A;  3SYO A;  4DR2 O;  3ZRW A;  5LHI A;  1L1F A;  2ZR2 A;  2GBO A;  3H1J H;  1YTF D;  2IJI A;  5GON A;  1JR9 A;  1K97 A;  2YUA A;  4LF8 O;  1Q43 A;  4U3J A;  2UXD O;  5BXZ A;  2X7R B;  4I4T B;  2L35 A;  2EJR A;  2HFE C;  1VQP V;  5J2U A;  1VQO V;  5BY1 A;  3JAR B;  1YTF B;  1MG1 A;  2X6B A;  1FFT B;  1AR4 A;  2QDO A;  3RT3 C;  1SRY A;  2VWJ A;  1RSO A;  3A0R A;  2QR4 A;  1JCH A;  2BE3 A;  1K8A W;  4EFE A;  4B3S B;  2CE4 A;  2Q6A A;  1IBK B;  1BQ0 A;  3RYC A;  1FAF A;  1Q5O A;  2LJ2 A;  3L9D A;  4MVS A;  4HNA A;  2JGD B;  4CBC A;  5LP6 B;  1SZX A;  2EZO A;  4R8C A;  4YJ2 A;  4FM0 A;  3CME V;  1NTK H;  4H33 A;  3A0B Z;  1ZLZ A;  2F23 A;  1NTZ H;  1ZAU A;  2VS0 A;  1Q82 W;  4GKK O;  4IIJ A;  1OZ0 A;  1VF6 C;  2E5L O;  3CCL V;  3RYI B;  3HKE A;  3K06 A;  4X8A A;  2Q4P A;  3Q4H A;  4NTY A;  1BSM A;  5B1A B;  1K5Q A;  5EYP A;  1JMK C;  1YIT V;  5EC2 C;  2CK3 G;  3ASO C;  1BS3 A;  4J9Z B;  3AEI A;  4I5S A;  4BIO A;  1QNM A;  3RW0 A;  2JJ2 G;  2ZM6 B;  1WA8 A;  5LGN A;  5C93 A;  1W0J G;  4LNU A;  2IM9 A;  3RGB A;  1GH6 A;  3CCS V;  4JYA O;  4TWK A;  1IBM O;  3TCU A;  1E79 G;  4DR4 B;  2LP7 A;  2AZ2 A;  3TET A;  3VQX A;  1YZB A;  4LF8 B;  3AK2 A;  2ZNJ A;  4PA7 A;  3U10 A;  3ZMV A;  2ZKO A;  1M9N A;  2PF4 E;  4LCU C;  4IHJ A;  1LUW A;  3SPC A;  1SER A;  4FFK A;  4O4I A;  3LSU A;  3ABT A;  4X20 B;  3J7A U;  4U3F H;  3P3N A;  2F93 B;  4F6R B;  2QTO A;  3ZHT A;  5CA1 A;  1SQP H;  3E8F A;  4DV3 B;  4JAU A;  2PY5 A;  4NXM B;  1Q86 W;  4JZ2 A;  2HHH B;  1ARO P;  2UXD B;  1ZUQ A;  4MTG A;  1NT2 B;  1GN4 A;  4R7C A;  4X66 B;  1RPR A;  3O65 A;  1OCO B;  1WPX A;  4I9W A;  5KMG A;  3ICX A;  3JD4 A;  1N0N A;  1XNR O;  4DR2 B;  4CZZ A;  1D2D A;  1QVF U;  2A06 H;  2P6J A;  1FJG O;  3QO8 A;  3ZN0 A;  2ZE5 A;  1TVK B;  4JI1 O;  1GM7 A;  2WLK A;  4JPR A;  5CMU A;  4WFA V;  1PD3 A;  4JI3 B;  3NXS A;  1S5L Z;  1H8H G;  4NVP A;  5B5E Z;  2QWQ B;  4J42 A;  1DLB A;  3CPW U;  5H5N A;  4JI6 O;  2JVD A;  1KU9 A;  2JDI G;  4CH5 A;  3E8B A;  2OWO A;  2IU0 A;  3OEE G;  4GX1 A;  5BMV B;  3KZI Z;  3ASN C;  4ZI7 B;  4TV8 A;  2FB5 A;  2EIK C;  2EIJ B;  3DTU B;  3SDL A;  1P7G A;  1SET A;  3G80 A;  3GWK C;  1N8R W;  3K0D A;  3QO5 A;  2M6Y A;  1IUR A;  4DK0 A;  3E83 A;  4DYL A;  4PHZ A;  4MTX A;  4X62 O;  2QKA A;  3CCE V;  1VF6 A;  4MSW C;  5LL6 Y;  4PA9 A;  3CD6 V;  1PNM A;  4DRX B;  4PI0 A;  5J2T B;  1B6Q A;  1N4C A;  4PA4 A;  4ZIB A;  3SJA C;  4DV7 B;  3APO A;  3JAT B;  4JTA B;  4LF5 O;  3BCC H;  5LMN B;  1F4M A;  4IGG A;  1KC8 W;  3JD1 A;  2EIM B;  2RJZ A;  1EFR G;  2FL4 A;  4NYK A;  4UB8 Z;  4HZ3 A;  2QKS A;  4UVC A;  2ZXW C;  1TGO A;  1VQL V;  4Q20 A;  2XUM A;  1IXM A;  1MAB G;  1NZ6 A;  2N04 A;  2YXL A;  3JD3 A;  4EB6 A;  4LF4 B;  2UUA O;  1IBK O;  1NR1 A;  2P4K A;  4OPH A;  1TAE A;  1FXK A;  1DTO A;  1YHQ V;  3STL C;  2F4V O;  1XDC A;  4JTD B;  4MVO A;  3K79 A;  4JI6 B;  4I0X A;  3ABK B;  2VQF O;  1QQC A;  1M56 B;  4H13 B;  3T4Z A;  4DK1 A;  3JAR A;  3ZRW B;  4J80 A;  1YI2 V;  3DXR A;  2RCV A;  4YXW G;  4BWA A;  3E2E A;  1R3I C;  4DV6 B;  1BGY H;  4NR1 A;  4I4T A;  5J2U B;  5IY5 C;  1V9P A;  3KCY A;  4YY3 B;  1V55 C;  2Y4U A;  2PYJ A;  3CJH B;  2D3O W;  2R9I A;  1GRJ A;  3L74 H;  1RSO B;  3A0H Z;  5GTH Z;  3WFV A;  3M99 B;  4HNA B;  2ETN A;  3KG2 A;  1YJN V;  3O9O A;  3F7V C;  3CCM V;  2H3O A;  5KHI A;  1K4D C;  2WLL A;  3FB7 C;  2W0X A;  3ZX6 A;  3BAA A;  3T2M A;  3LDC A;  4Z2W A;  4FK5 C;  1BQZ A;  2DOS A;  2ZR3 A;  1B04 A;  4FM1 A;  3ZRS A;  1E1R G;  2ADQ B;  4JAS A;  2NN4 A;  1Q81 W;  3SYA A;  3JD0 A;  2A79 B;  3CWB H;  3ABU A;  2KQX A;  4W4L A;  3RYF A;  4DV3 O;  2GTS A;  1TUB A;  4Z1M G;  1T5E A;  5IJ9 B;  4JI7 O;  3JCU Z;  5KUK A;  2Q7E A;  1H2K A;  3SPI A;  4OX9 O;  1SZT A;  2IW5 A;  2WLI B;  3RYI A;  4CS2 A;  2Z5U A;  4MW8 A;  5CA0 B;  1DGS A;  4AQY O;  2Q7G A;  5EYP B;  4B3M O;  1PKX A;  1XMQ B;  4CC6 A;  4UCU A;  5LA6 B;  4PA6 A;  2LO1 A;  1Q3E A;  3A2F A;  3OMA B;  2HKO A;  2YDE A;  1SA0 B;  4WFG A;  3STZ C;  1XOU A;  4IHJ B;  1SC5 B;  2ILM A;  5LYJ A;  4MT8 A;  1THZ A;  4R6Z A;  2ZDI A;  4LFC O;  4FLX A;  5JJJ B;  2HVJ C;  5LGU A;  4DR1 O;  4DV2 O;  2CTQ A;  5CB4 B;  4F4L A;  2A7W A;  1BT8 A;  2KG7 B;  4MVM A;  4ZOL A;  1XNQ B;  1H2G A;  1NS1 A;  2P06 A;  3AG1 C;  2UXN A;  1G8M A;  5B3S B;  3JAK A;  5E1A C;  4LF7 B;  3F7Y C;  3EHB B;  1DF5 A;  2BTO A;  3CCU V;  1ZL8 A;  3CHX A;  4FLZ A;  1R3J C;  1TVK A;  1HNZ B;  4I9Q A;  1L0N H;  4X9Q A;  3RYC B;  1ENV A;  1F23 A;  4O4L B;  4EKW A;  2AHY A;  1SF9 A;  3HKD B;  5B1A C;  3WU2 Z;  1FKA O;  5IE9 A;  1I94 B;  2XAG A;  2E74 B;  2YIA A;  4DR5 O;  2GUZ A;  3HR0 A;  4JZG A;  3CRQ A;  3FYE B;  4FM2 A;  4JF3 A;  1FYJ A;  1JPX A;  3OTO O;  4DR3 B;  2UU9 B;  1F7Y A;  2QM4 A;  3HKB B;  4NKG B;  3FFQ A;  4E4E A;  3X2Q B;  4LFB B;  3IFX A;  3LNM B;  2WSS G;  3FX7 A;  2OCC B;  1VQ4 V;  1J95 A;  1SS3 A;  2ITD C;  1SQG A;  4RQF A;  3HKE B;  4GX2 A;  4LWS B;  1MNG A;  5J2T A;  2FML A;  1WJZ A;  4O2A A;  1AI4 A;  1K7D A;  1IBL B;  3ML0 A;  3TGU H;  2V7Q G;  4PDV A;  1S72 V;  3WB1 A;  3LDE A;  4AHC A;  3ZED A;  4DV4 B;  2G38 A;  2Q0O C;  3VBB A;  5L3E A;  4DXW A;  1HNW B;  5LHH A;  2JRI A;  1AB3 A;  3UKM A;  3RBZ A;  1WA8 B;  2VRZ A;  5LXT B;  1XI1 A;  2P67 A;  5KAI Z;  5LOV B;  2H8P C;  5B1B C;  1AR5 A;  3K9S A;  4UUJ C; 
#chains in the Genus database with same CATH homology
 4GX0 A;  2IH3 C;  3ZMT A;  2B5U A;  4U7N A;  2IJH A;  1QVG U;  2QE7 G;  1K73 W;  3GB7 C;  3K06 A;  4H37 A;  2BOC C;  4PDL A;  4X8A A;  1QBZ A;  2XND G;  3SYQ A;  2ATK C;  5B1A B;  1K9M W;  1K5Q A;  1YIT V;  5EBW C;  1V54 B;  3ZMS A;  5EC2 C;  4QJF B;  1NVP D;  2CK3 G;  3ASO C;  4J9Z B;  1BL8 A;  3AEI A;  4I5S A;  1K5S A;  3OUS A;  2UXX A;  3RW0 A;  1QLN A;  2JJ2 G;  2MK3 A;  2XAH A;  5LGN A;  3ZRV A;  1S0V A;  4WCE V;  5C93 A;  1W0J G;  1ZWI C;  5KA5 A;  3CC4 V;  4BAY A;  3WG7 C;  2H94 A;  1PNL A;  2DWD C;  1GK9 A;  3CCS V;  3X2Q C;  2EBO A;  1BMF G;  5HFL A;  2R9R B;  4TWK A;  3ASN B;  4JTC B;  3RVZ A;  2EIK B;  3K3W A;  3TCU A;  1E79 G;  3OAA G;  1R73 A;  1OCO C;  2LP7 A;  4PDM A;  4WFE A;  1P4R A;  4XDL A;  3TET A;  1R3L C;  4G28 B;  4FJC C;  3ABM B;  4GX5 A;  2B1I A;  4PA7 A;  3ZMV A;  3AG4 B;  1M9N A;  4J9Y B;  4LCU C;  1RM1 C;  3OM3 B;  1OCR C;  3ZJZ A;  3SPC A;  1SER A;  4X88 A;  3AG3 C;  3ZIA G;  4PEL A;  5IYD O;  3ABT A;  1VQ6 V;  5HFM A;  3ABM C;  2KB1 A;  2QTO A;  5CBH A;  1ROP A;  2X6C A;  3IGA C;  1YJW V;  3E8F A;  4JAU A;  4WFF A;  1TUE B;  1Q86 W;  1F51 A;  4L87 A;  3HPL C;  3MHS C;  2M7W A;  4JYB A;  1ARO P;  4FPP A;  4MTG A;  4R7C A;  1R6N A;  1RPR A;  1S76 D;  1OCO B;  1WPX A;  1FXK C;  4I9W A;  2ZD9 A;  3W7X A;  1HWY A;  3MD0 A;  2IJK A;  2IH1 C;  2XAJ A;  3FB6 C;  3JD4 A;  1JJ2 U;  3E35 A;  4CZZ A;  1QVF U;  5EC1 C;  3SPG A;  1K33 A;  2P6J A;  4OXS A;  1AR1 B;  1K34 A;  2WLM A;  1OCC B;  2ZQM A;  3QO8 A;  3ZN0 A;  1G4Y B;  4UV9 A;  1CPY A;  2IJJ A;  1GM7 A;  2WLK A;  2HLD G;  4FMT A;  2JIZ G;  4JPR A;  3CCV V;  5CMU A;  1M1K W;  4WFA V;  1PD3 A;  2OT5 A;  3NXS A;  4DO2 A;  1VQ9 V;  2GHY A;  1H8H G;  3JYC A;  4P2Z A;  3G71 V;  2DQ3 A;  5B1O A;  5L3F A;  3E8H A;  1QR9 A;  1DLB A;  3WG7 B;  3CPW U;  2EIN C;  4MTO A;  4R50 A;  1H8E G;  1M56 C;  2A0L A;  2JDI G;  5L3B A;  1VQ5 V;  2C2A A;  3E8B A;  2IU0 A;  3ZCC A;  3VOU A;  3OEE G;  4GX1 A;  4KP4 A;  1Y4M A;  3ASN C;  2LFR A;  5IYB O;  1BHA A;  2EIK C;  2WLI A;  2EIJ B;  3DTU B;  4U7O A;  1FXK B;  1SET A;  5EK0 A;  2XAQ A;  3DGE A;  1N8R W;  2EIN B;  3K0D A;  5KA6 A;  2JEX A;  3QO5 A;  3CCJ V;  4QE9 A;  3E83 A;  2A9H A;  4LC1 A;  1OCC C;  1FXV A;  3K9A A;  4MVU A;  4MTX A;  3OUF A;  3CCE V;  5EBL C;  1NR7 A;  4MSW C;  1K4C C;  5IY5 B;  4PA9 A;  2DWE C;  3ZMU A;  3CD6 V;  4TSF G;  1PNM A;  3OR6 C;  3QO7 A;  3ABL B;  5EBM C;  1DF4 A;  3W7T A;  1B6Q A;  4PA4 A;  1W2B U;  1XL4 A;  2QM8 A;  4JAV A;  1UJW B;  2WWW A;  4JTA B;  5H9C A;  1KQS U;  1KP2 A;  1F4M A;  5GW7 A;  4HYO A;  1KC8 W;  3JD1 A;  2EIM B;  2F43 G;  1CEZ A;  3T1C A;  1SES A;  1EFR G;  3FKS G;  4HZ3 A;  3ZN1 A;  1AI6 A;  1GM9 A;  3EFF K;  3RVY A;  1XL6 A;  2QKS A;  4UVC A;  2ZXW C;  2HR3 A;  1VQL V;  4Q20 A;  4TT3 G;  1IXM A;  2XAF A;  1FS0 G;  2PI4 A;  1FXH A;  1MAB G;  3FYI B;  1OHH G;  3CMA V;  2P7T C;  1NBM G;  1OCZ C;  1RM1 B;  4P30 A;  3JD3 A;  5IYC O;  5DM6 V;  3FB8 C;  1NR1 A;  3OGC C;  3R65 A;  1AI5 A;  1FXK A;  1DTO A;  1GMG A;  2X6A A;  3BY6 A;  2HJF C;  4MTF A;  4UXN A;  2EIM C;  3STL C;  1YHQ V;  3CC2 V;  1YIJ V;  4JTD B;  1S3J A;  2JEU A;  3CYO A;  4WFH A;  3E86 A;  4MVO A;  3K79 A;  4QPJ A;  4XDK A;  3ABK B;  4MW3 A;  2ZXW B;  3HB3 B;  1M56 B;  3AG2 B;  3T4Z A;  4QIW F;  3ZRW B;  3F5W C;  4GCZ A;  3OE7 G;  1YI2 V;  2Z3Y A;  3G4S V;  4RAI A;  3B77 A;  4YXW G;  3E2E A;  3W7U A;  1R3I C;  3SPJ A;  1GTO A;  3CP1 A;  2QA4 V;  5L3G A;  2Y69 B;  2DQ0 A;  5H6R A;  3OW2 U;  4UVB A;  5KUM A;  4ZKI A;  1NVP B;  3OR7 C;  3ABK C;  5IY5 C;  1AI7 A;  4UV8 A;  2EIL B;  1V55 C;  1QLE B;  2WLH A;  1QR8 A;  2WPD G;  4XBF A;  1AJN A;  1R3K C;  2D3O W;  1S5H C;  2DW4 A;  2R9I A;  5BZB A;  1NKD A;  2X0L A;  4MVR A;  3G6E V;  3WFV A;  4N21 A;  3M99 B;  3LDD A;  5IDJ A;  1ORQ C;  3KG2 A;  2Q67 A;  4KFM A;  1YJN V;  1V55 B;  2B1G A;  3F7V C;  3CCM V;  2WLJ A;  1K4D C;  2WLL A;  3FB7 C;  1GO3 F;  1KKD A;  1F4N A;  4UVA A;  3OEH G;  5FL7 G;  1I5Y A;  2W0F C;  3T2M A;  4MVZ A;  3LDC A;  4FK5 C;  3AG3 B;  2ZR3 A;  3P32 A;  4P9P A;  1VQN V;  2Y48 A;  1VQ8 V;  3B8N A;  3D3I A;  3SYP A;  1P7B A;  2NLJ C;  3ZRS A;  2AHZ A;  1M57 C;  5DN6 G;  1E1R G;  4JAS A;  3SYC A;  1JQ0 A;  1AJQ A;  2DYS B;  4LBE C;  4RUE A;  1Q81 W;  3SYA A;  1K92 A;  1V54 C;  2EZP A;  3JD0 A;  3ZRX A;  3CCQ V;  4FIP C;  1COW G;  2A79 B;  4E2L A;  4GT1 A;  2BOB C;  3ABU A;  2XOK G;  1NH2 D;  4MVQ A;  2EIJ C;  3CC7 V;  1R6K A;  3TK1 A;  4Z1M G;  3GWO A;  5KUK A;  1QCE A;  3OMN B;  4G27 B;  4MS2 A;  5L3D A;  5CN0 A;  3B8M A;  3SPI A;  1SZT A;  2IW5 A;  2HG5 C;  2WLI B;  2WLL B;  3JCZ A;  4QE7 A;  1NH2 B;  1NJI W;  3CCR V;  2Z5U A;  4MW8 A;  2YEV A;  3D36 A;  3JD2 A;  2IU3 A;  2ITC C;  4PDR A;  1VQ7 V;  2W6I G;  3FB5 C;  2GSM B;  1PKX A;  3ABL C;  1AJP A;  2Q68 A;  2WLN A;  4X89 A;  1W0K G;  1K3E A;  4PA6 A;  3CXC U;  1JVM A;  4XDJ A;  3W7S A;  4WF9 V;  4N23 A;  4ZBM A;  1GM8 A;  3K0G A;  3UM7 A;  2EIL C;  4PA3 A;  3OMA B;  2HKO A;  4WFB V;  3K04 A;  1Q7Y W;  3ETE A;  4WFG A;  1QLE C;  1EZJ A;  3STZ C;  2XAS A;  2W6J G;  4JGS A;  4BW5 A;  1M90 W;  4RUF A;  2FTK A;  5CBF A;  2WAM A;  4MT8 A;  1THZ A;  4R6Z A;  1KEC A;  4HAM A;  2ZDI A;  3T4D A;  1GKF A;  4G2K A;  3SPH A;  2YEV B;  2HVJ C;  3AG1 B;  5LGU A;  3OMI B;  4F4L A;  1E1Q G;  1NQT A;  4MVM A;  1H2G A;  1MSW D;  3E89 A;  1PNK A;  3OFN G;  5CA3 A;  3SJQ C;  1H38 A;  5LGT A;  1KD1 W;  1EBO A;  3AG1 C;  2UXN A;  3LSS A;  1G8M A;  3QNE A;  5B3S B;  2OTJ V;  3IC7 A;  4ASU G;  5E1A C;  2OTL V;  1S77 D;  3F7Y C;  3EHB B;  3AG2 C;  1YSC A;  1DF5 A;  1I5X A;  2JJ1 G;  3CCU V;  5B1B B;  3W7W A;  3LUT B;  1Y66 A;  1R3J C;  4QPK A;  3MHH C;  3BEH A;  5LHG A;  1ENV A;  1F23 A;  3SYO A;  3I55 V;  3ZRW A;  3ZMZ A;  5LHI A;  5J9P C;  1L1F A;  4EKW A;  2ZR2 A;  1WLE A;  4JYC A;  4KUM A;  2AHY A;  3AG4 C;  3K08 A;  1YTF D;  4BIU A;  2Y69 C;  2IJI A;  1LNQ A;  5B1A C;  2JK5 C;  1K97 A;  3E8G A;  2XAG A;  2YSU B;  2X7R B;  2EJR A;  2HFE C;  1VQP V;  1VQO V;  3FYE B;  4LP8 A;  1YTF B;  1MG1 A;  2X6B A;  4JF3 A;  4QNH B;  1FFT B;  2DYR C;  2ZDI C;  1JPX A;  5LBQ A;  1YJ9 V;  4P9O A;  1VQM V;  1SRY A;  5B1N A;  3LSQ A;  3A0R A;  3X2Q B;  1JCH A;  5L3C A;  1K8A W;  2Q6A A;  3IFX A;  3LNM B;  3H01 A;  1PL0 A;  2WSS G;  3P30 A;  2OCC B;  1VQ4 V;  1J95 A;  4RQF A;  2ITD C;  2K1E A;  2NNU A;  4GX2 A;  2QEX V;  1CP9 A;  3K03 A;  1M57 B;  1AI4 A;  1JX9 A;  3I56 V;  1K7D A;  3ETD A;  2DYS C;  2LFS A;  2V7Q G;  3ML0 A;  2QM7 A;  4PDV A;  1VQK V;  1S72 V;  3LDE A;  1OCR B;  2DYR B;  2Q69 A;  1RPO A;  5CBG A;  1MOF A;  2OCC C;  4MVS A;  1BHB A;  4RO2 A;  2P90 A;  3VBB A;  5L3E A;  4DXW A;  4CBC A;  5LHH A;  2EZO A;  4R8C A;  3UKM A;  3CME V;  2V1D A;  3RBZ A;  4H33 A;  1OCZ B;  2HVK C;  4RQE A;  2PI5 A;  5B3S C;  5H6Q A;  1JOY A;  1Q82 W;  2P67 A;  3ETG A;  3ASO B;  2H8P C;  5B1B C;  3PJS K;  1OZ0 A;  4UUJ C;  1KP3 A;  3CCL V;  4BIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...