4H37A

Crystal structure of a voltage-gated k+ channel pore domain in a closed state in lipid membranes
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
b'NGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRCK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2059 protein
publication title Crystal Structure of a Voltage-gated K+ Channel Pore Module in a Closed State in Lipid Membranes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Membrane protein
total genus 24
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4h37A00
1K4CC 4MTOA 4MVSA 3HPLC 2KB1A 4QE9A 3UM7A 4MS2A 2Q69A 4P30A 4J9ZB 3E83A 2ZD9A 3T2MA 3E89A 2A9HA 2Q67A 2W0FC 4MTGA 4F4LA 2P7TC 2WLIB 4RO2A 4MW3A 5B3SC 3FB5C 5KUMA 2AHYA 4LCUC 4XDKA 2EINC 2EIJC 3SPGA 2EIMC 3T4ZA 2X6AA 2DWDC 1G4YB 2YEVA 1OCRC 1ZWIC 3PJSK 1XL4A 2AHZA 2WLNA 5EBMC 2R9RB 3K03A 4BW5A 3IGAC 4R50A 3KG2A 3TCUA 1KKDA 4R6ZA 4MVUA 3AG4C 4G27B 2WLLB 4PA4A 5IY5C 4RUFA 5EBLC 4P9OA 2QTOA 3T4DA 4MVMA 4PDLA 1QLEC 4GX5A 2DWEC 4X89A 3K0DA 4GX0A 3SYAA 4QNHB 2WLJA 4MTFA 3SYCA 4DXWA 2IH3C 3K0GA 1M57C 1M56C 3K04A 2QKSA 4XDJA 4KFMA 5E1AC 3WG7C 2Q6AA 4G28B 3EFFK 2BOBC 5CBGA 3AG3C 2Q68A 3FB7C 4ZBMA 4LP8A 4QE7A 2WLIA 3RBZA 3K08A 3SYQA 2HFEC 3IFXA 3OR6C 1BL8A 4GX2A 4HYOA 4HZ3A 1JVMA 5B1AC 3ASOC 4WFGA 3LDDA 4H33A 1OCZC 2WLHA 4X8AA 1K4DC 4JTDB 2X6BA 3ZRSA 2WLLA 3ABKC 3STZC 2HJFC 3AG2C 3SPHA 2EIKC 3E8FA 3E8HA 3F7YC 2ITDC 4PDRA 4RUEA 3RVYA 1LNQA 1V54C 3AG1C 1XL6A 2HVKC 4EKWA 3LUTB 2Y69C 4PA7A 1S5HC 3E86A 2HG5C 5EC2C 3F7VC 2JK5C 4R7CA 3SPIA 5CBFA 4WFFA 3OGCC 2H8PC 4PA6A 4P2ZA 4JTCB 4TWKA 1OCOC 4XDLA 2NLJC 2WLKA 5EBWC 4JTAB 2BOCC 2HVJC 4PDMA 2EILC 3ASNC 3F5WC 2A0LA 1J95A 2K1EA 3SPCA 3VOUA 4I9WA 4X88A 4MVOA 3RVZA 3R65A 4GX1A 4MVRA 2DYRC 4J9YB 3LDCA 3TETA 4MW8A 1R3LC 2ATKC 3SYOA 4PDVA 3RW0A 4CBCA 5CBHA 4PA3A 3LDEA 4MVZA 1R3JC 3FB8C 4WFEA 3OUFA 3ABLC 1P7BA 5EC1C 3T1CA 4MVQA 3STLC 4H37A 2DYSC 3LNMB 5EK0A 3BEHA 1OCCC 4WFHA 3ABMC 3OR7C 2A79B 2X6CA 5J9PC 2OCCC 3OUSA 1R3IC 4LBEC 3K06A 4OXSA 4RAIA 3E8GA 3ZJZA 4UUJC 2ZXWC 5KUKA 4MSWC 3X2QC 3SYPA 3JYCA 3SJQC 1ORQC 2WLMA 1R3KC 1V55C 2IH1C 3FB6C 3E8BA 2ITCC 4P9PA 3SPJA 3GB7C 4PA9A 5B1BC 3UKMA 4R8CA 5BZBA
chains in the Genus database with same CATH superfamily
3HPLC 4QE9A 3MHHC 3LNNA 2DN9A 4TUYB 2KKWA 5IJ0B 1UFIA 4LF5O 2ZXWB 1DF5A 2PYLA 1YVWA 4DO2A 1MNGA 2WLNA 5C8YA 1KKDA 5TISZ 3QO5A 4BWAA 2AW9A 1W59A 3K0DA 1IDSA 4GX0A 5HFMA 1H2LA 5CA0A 5L3FA 2FB5A 3IC9A 5FL7G 4LF6O 2BOBC 3OEEG 1FYJA 2GTSA 1YF2A 1Q7YW 2BE3A 5KX5B 3ZMUA 2QM8A 2HVKC 1Y76A 3FD9A 1N32O 3K5NA 1SQVH 1AROP 4KL1A 4R7CA 2K9PA 2RMKB 3OGCC 1OCOC 3ZHSA 2WLKA 1OCZB 4PDMA 3SDLA 4X66B 3ZHTA 5JWPA 1TA8A 1Q3EA 2GBOA 3H01A 3OT7A 2KG7A 1LUVA 1MMMA 3CX5F 5GTIZ 3RW0A 3SJAC 5J2TA 4MVQA 1FFXB 4IHJA 3I55V 4KUMA 4DR5O 1GN3A 4O4LA 2OCCC 3A0BZ 5LGTA 4ASUG 3G71V 3ZJZA 2F23A 4JI0B 4FM1A 1VQNV 4O2AA 2ARHA 1MZFA 1HWYA 4PA9A 1M5IA 5IYDO 3FKSG 1XDCA 3CRRA 2AZ0A 1ENVA 1SS3A 1W0JG 4DR6O 1WB7A 3X2QB 4FZ1A 5BR8O 1ZL8B 4JYAB 4X1KB 4ZOLB 2YEVA 2XAGA 3JSNA 4R50A 4GZRB 4JZ2A 1CXZB 2WLLB 5H6QA 3BA8A 2EZPA 3VQWA 1N0NA 1FPOA 1WA8A 1Y74A 4KP4A 2AZ2A 4EB6A 4Q20A 1K97A 3T1YB 2CUGA 3N27A 4DV0O 3K9AA 2ZIMA 4B3RO 3K5LA 1DGSA 4JI3B 1KD1W 1WJZA 2X7RB 1EN4A 1H2MA 1MSWD 2B1GA 1NH2D 1VQMV 1RFYA 4L87A 1S0VA 1SQFA 4PELA 4JTDB 4JI8O 3SPHA 4DRXB 2EIKC 4PV1B 5F2VO 1M57B 1J5EO 2IBZH 3BHPA 1MA1A 4YJ3B 1R6NA 2P4KA 1BGYH 2A06H 2HG5C 3JAKB 4JI6O 5LBQA 4TWKA 3QVNA 4XDLA 3W7TA 2HVJC 3D36C 1FS0G 1H8EG 1NTZH 4KXRA 3ZMZA 2UXBB 2Q0OC 1BQ0A 5CN0A 2QDOA 4JAVA 1IBKB 3TETA 2OWOA 1Z5VA 1CPYA 1LR1A 4PA3A 4CZZA 2LGQA 2VQFO 1S3JA 3JASB 1IVSA 5H6RA 1K5SA 4DV7O 5H9CA 2VS0A 4HNAA 1K3EA 5L3GA 5EZYA 3SJQC 5ITZB 1VARA 5FNVB 4C7UA 3ZIAG 4AHCA 4FM0A 1RM1B 2BTOA 1O9HA 4JI0O 4R8CA 1IBLB 1ZLZA 1K4CC 3OMNB 3DXRA 1RPRA 2XAHA 3OE7G 5KHJA 2FYUH 1TGOA 4MS2A 1BCCH 1Q5OA 2PUSA 4CH5A 5JVDA 1KP3A 1YSCA 3ZMTA 3R66A 1ZSPA 2EJ7A 3JSLA 3K03A 4G27B 4X64O 2YI8A 3CXHF 4OPAA 1YJNV 3T4DA 4UCSA 4MVMA 4DUYB 3W7WA 2WLJA 1MABG 3K0GA 1S76D 1XHXA 4UVCA 2QKSA 1IXMA 5CBGA 3EFFK 1EZVH 4WBNB 4ZBMA 4DUZB 1G6UA 3RBZA 5B1OA 5H5NA 5IY5B 4I9QA 1YZBA 2ZE6A 3D3QA 1GAXA 3STZC 1F4NA 3RVYA 3CC2V 4NB5A 4FM2A 4EKWA 3CJHA 4O2BB 3HKEB 3ZCCA 1IURA 2VRZA 3AEIA 2NLJC 1QNMA 1WPBA 5JCOC 4FLVA 4DR4B 2CDYA 2OCHA 3F5WC 2A0LA 1BHAA 2UXCO 2YUAA 1VQKV 1W0KG 4OGQB 1Y6XA 2JGDB 4MVRA 3BAAA 1GN2A 5K1XA 2ATKC 3S3WA 2JIZG 3WB2A 3FB8C 5LP6B 3T1CA 2NNUA 3JD1A 4CH6A 3CCVV 3ASNB 4LC1A 5IT9N 4CS3A 5J2UA 1FXKC 3DC6A 1S72V 2BTQB 1ORQC 4DR1B 3SPJA 2WWWA 3UT5B 4X62B 3FAVB 1AP5A 5EIBC 1EBOA 5BZBA 3SR2C 4LF9O 3O9OA 2JS3A 1GH6A 1KU9A 3HB3B 2X0LA 4X65B 4JASA 3U0ZA 1NKDA 3TXSA 1G4YB 2CAZC 1GN4A 4I5SA 2EJRA 1QR8A 3ETGA 5IDJA 2YXYA 4JI7B 4YHHO 3J81N 3FX7A 3SYAA 2CGNA 1M56C 4JAUA 3WG7C 1NS1A 1SESA 3FB7C 5KA6A 1L8DA 3G6BA 3ASOC 2RJZA 2IU3A 4H33A 2D3OW 4LF7O 4TV9B 3G6EV 3H1LH 4DUZO 1WP8A 3ABKC 3E8FA 2JDIG 2V7QG 2FKXA 4I4TB 3JAWB 1NTMH 4D7SA 5JH7A 4UCUA 4NVPA 4X20A 1Y66A 1XMQB 4D7TA 5JQGA 4UV9A 5B3SB 4B3MO 1PNLA 5GONB 5CA1B 2BOCC 4OX9B 1R6KA 4JZGA 3EHBB 2OYQA 3JARA 4F6RB 2ZR2A 4DR4O 4LH6A 1HR0B 1I08A 3RYCB 1DTOA 5EC1C 1OCOB 1QVFU 4U3JA 4TV8A 3K06A 4PD4F 1KBHA 2BSKB 2P4VA 2EX3A 1YJWV 4DV4B 2GUZB 1H2NA 1V55C 5KMGA 3K58A 5IJ9A 4DR1O 2CH7B 4E2LA 3CCSV 2OCCB 2Y0IA 4UXNA 5C93A 2EINC 2IM9A 4YIOA 5EYPB 2UUAB 4ZIBA 4P9OA 1V9PA 1QLEC 1SF9A 1G8MA 4X9QA 3K59A 1GN6A 3CCJV 4DXWA 1BE3H 1URFA 1AI4A 4JI5B 1XQ8A 4JI7O 2Q6AA 4G28B 4DV6O 1JJ2U 2GDSA 4CC6A 2WLIA 4GLXA 4HYOA 4LFBO 1RSOB 2XAQA 2QWOB 5DEDA 3CHXA 1QBZA 2Q73A 4JI1O 2ZE8A 3M7MX 4J11A 4RQFA 5KX5A 4PDRA 2N04A 4QPKA 4BR6A 1VQLV 2NN4A 1K92A 3L75H 4PA7A 1HW7A 2IJHA 1HNWO 2F4VO 1VP7A 3ZHUA 4DV3O 3N2KA 3ZX6A 2QA4V 2EILC 4NXMB 2EIKB 1DLBA 4X88A 1N34B 4MVOA 3RVZA 1WPXA 1TVKA 4NTWA 1I0HA 1IBMB 3HKCB 3QF7A 1Q6UA 4MW8A 1X59A 3SYOA 4PDVA 3ZS8C 3CYOA 1KMIZ 2ZCEA 2Y4UA 2JEXA 3MDSA 3WB1A 1YI2V 3M8AA 4LBEC 3AK2A 1BQZA 4O4IB 1YTFB 4JV5B 4LNUA 2YIBD 1F23A 4AQYB 1I94O 1PV0A 5KAFZ 2YXLA 2Q4PA 4J9ZB 5E79Z 1D5AA 3T2MA 1ROPA 3ZMVA 2WSSG 4MW3A 3GWKC 4BAYA 1YHQV 3CRCA 4UCRA 2DWDC 4ZOLA 1NJIW 1XL4A 4BW5A 3OMAB 3D8CA 2Q0AA 2DYRB 4H13B 1W2BU 4PDLA 4DR7B 3ZRWA 3SJBC 2YS8A 2UUAO 2PI4A 3CRMA 5BMVB 2V4DA 1XMOB 3DSQA 1F4MA 2Q68A 2QWNB 5GTHZ 4IT5A 3W7SA 4I50B 3KKYA 1BL8A 1TUEB 2AGAA 1Y4MA 2DJVA 2WLHA 2CTPA 2JVDA 2P5OA 1Q90D 1JX9A 3RYIB 3L71H 3A8TA 3E8HA 4RUEA 4DRXA 1VF6A 1KP2A 5L3CA 3IC7A 3H9VA 1EM1A 2XASA 3F7VC 3JAKA 2WPDG 4JAAA 1UPGA 2EULA 2C2AA 3K3WA 4NXNB 2LJ2A 3OTOB 1BZKA 4JI4B 2ZDIA 1P4RA 3APOA 1N36O 2Y0PA 4DV1B 4F6EA 1ZUQA 1IBMO 1EN6A 1P7GA 3LNMB 3ABMC 2LW7A 3IJ4A 4RAIA 2HHHB 1VQ8V 3ZN0A 2F95B 3CCEV 5ITZA 2CGOA 4FFBB 2ILMA 3UKMA 3ZMSA 3BRCA 2CK3G 3UM7A 1SC5B 4P30A 1PNKA 4JV5O 4UB8Z 1QLNA 4YIPA 4CH3A 2UXDB 1FXKB 1MZEA 1AJPA 1XNRO 2Z0AA 2AHZA 1XI1A 5LYJB 3KZIZ 5B66Z 4N21A 5CB4B 1L0NH 1IX9A 3B09A 1Q6IA 3RYFB 3D3IA 2GHYA 3CRAA 1SQPH 3ABLB 4MTFA 4QPJA 3IAYA 2UU9O 3KCYA 1JCHA 2VQEB 4IGGA 2V1DA 2QWPB 1KUQA 3SYQA 4GUNA 2HFEC 1FD9A 2B1IA 2BCCH 1VQ5V 1OV9A 1VEWA 3LDDA 1XMOO 5IYCO 4J41A 5IYZB 1YJ9V 2HJFC 3CCRV 3AK3A 2PYJA 3WG7B 2HEPA 4ZI7B 3OMIB 5EC2C 2LP7A 2H8PC 4PA6A 4JTCB 3ASOB 4PHZA 2OTJV 4UCVA 1K5QA 3RN4A 3HKBB 1YXBA 1H2KA 3ABKB 1AR5A 5K1PA 3VOUA 2JGDA 1BHBA 1NI8A 3JCZA 4NXNO 3P3NA 2PGGA 4LWSA 2UUBB 2QWQB 1XNQB 4FFKA 2X6CA 1WP7A 3E8GA 4LF8B 1OZ0A 1JFFB 4UUJC 2ZQMA 3CC4V 1YEWA 4WFBV 2BTQA 4O4HA 2WLMA 3FB6C 3H1HH 5CA0B 4X66O 5LXTA 1R73A 1D5NA 2Q67A 1EFRG 2ZE5A 5LHIA 1SETA 2Z3YA 1V55B 4R6ZA 2M7WA 2XTAA 5KHKA 2UXDO 1X4TA 3JAMN 3G67A 2ZNIA 4K8XA 1Y76B 5L3DA 4W4KA 4DR3B 1U96A 1I5XA 1S5JA 5E1AC 2XNDG 1A32A 2UUCB 1BMFG 4LP8A 5B1AC 4ABMA 2VQEO 4KHPB 4L8JA 1SKVA 1XBLA 1QLEB 2W6JG 3FYIB 4WFAV 1P49A 4J10A 2P22C 3JD0A 4JYAO 1YITV 1LNQA 2DQ3A 2R9AA 5J2TB 1G1XB 4UCTA 3JAWA 4GCZA 1UJWB 4IHJB 4BW9A 3OAAG 3BA9A 3Q4HA 4O2AB 4CH4A 1VQ7V 5KLVH 2HR3A 3AG4B 4MTXA 3T1YO 1SQQH 3SPCA 3G80A 2ZINA 1F51A 4JI3O 3A0RA 3P30A 2RCVA 1PNMA 5KHGA 3E22A 1XHZA 2DYSC 1CP9A 2H3OA 2EILB 3CS5A 2YEVB 3OM3B 3C3SA 2UUBO 4FLYA 2DQ0A 3NR7A 3SJCC 4DK0A 3PN1A 5DM6V 4NYKA 2MK3A 3ZRXA 4DV5B 2JJ2G 1Y74B 2HLDG 2H94A 4IIJA 4EB6B 3C3TA 1GM7A 2CH7A 2UXBO 1L0LH 4UB6Z 3N2GA 1IBKO 1HNXB 4DK1A 2EIJC 2XAFA 1F7YA 3L74H 1IXBA 3PJSK 1XILA 1ZWIC 3E35A 5IWAB 3ZRVA 5LOVA 5EYPA 2N74A 3QTCA 4K3AA 3HKDB 3JD2A 2YIDA 1Q8IA 2JEUA 5BXZA 2IH3C 2EZOA 2OIEA 4NR1A 1IBLO 4DR3O 5LMNB 4HZ3A 1K7DA 5B1BB 1I5YA 2YIAA 2L6LA 3UO3A 2Q5ZA 1V54C 1YTFD 4I55B 2Y69C 5JJNB 3K79A 4UVAA 4DUYO 2QGNA 4JTAB 3CSXA 2OIGA 4HNAB 5EZYB 3VQXA 3RFRA 2P06A 2PZSA 2AXTZ 1N33B 3VQVA 3JALA 4I0XB 4MVZA 3FYEB 3M99B 1P7BA 1DF4A 3STLC 4GKKB 1SQXH 1JOYA 2UXNA 4MT8A 3AG7A 4FLXA 4O4IA 2ADQB 1SA0A 2VWKA 1SZTA 1AJNA 2ZKOA 4FK5C 1M93A 3CC7V 1NU1H 4U3FH 1VF6C 1YIJV 4O4JA 4JI2B 1M90W 2A9HA 3ICXA 4QIWF 4DV5O 3CWBH 4QGPA 3CPWU 3CCLV 2QKCA 2B5UA 2D2CB 4B3TB 2EIMC 2ZM6B 2X6AA 4FLTA 3DGEA 2FTKA 5EBMC 2M6YA 4MVUA 4YJ2A 4ZHQA 2ZDIC 1AVMA 4X89A 5IWAO 1FJGB 3CJHB 4RWUA 2Q9LA 1O9GA 2HJDA 4X1YA 1YDXA 4KFMA 4Z1MG 4X62O 5BMVA 4TUYA 5IJ0A 3K08A 4GX2A 3ZBHA 4I50A 5FLXN 4WFGA 3UCSC 1THZA 4X65O 1D2DA 5LMNO 1ZX3A 1IZ3A 1S5HC 5AG2A 3OGIB 4ZKIA 1MG1A 2LGWA 4WFFA 3C90A 3QO7A 2DW4A 3JATB 1K8AW 4LFCB 1Q82W 3SGIA 1GTOA 2JS5A 1M9NA 4J9YB 3LDCA 1R3LC 1KECA 1RP3B 2ODMA 5EIBD 2QR4A 1KC8W 1OCCC 2A3QA 4K0KB 1OJHA 3ZHVA 1XMQO 2P6JA 2IH1C 4FFBA 4LF6B 3J7AU 4YXWG 1QHTA 2GSMB 1AP6A 4OX9O 1NVPD 3OW2U 3ML0A 2ADPA 3FFQA 3B40A 3CD6V 3ETEA 5LA6B 4DYLA 1FFXA 5LGUA 2R72A 1KB9F 2MW2B 4XDKA 1HR0O 4JI2O 4JGSA 2R9RB 2CTQA 1N32B 1VQ4V 4RUFA 1EZJA 1GO3F 2HKOA 2JGUA 4XBFA 3RYFA 2ZM6O 4B7EA 2N05A 2QE7G 3BCCH 5JH7B 4X20B 4DV4O 5JQGB 4XDJA 2RN9A 3BABA 2ZR3A 2XHBA 1N0JA 1FJGO 1VF5B 3EXAA 3ETDA 1JVMA 2DE0X 4AILC 5B5EZ 1ZL8A 4X1KA 3JARB 2YSUB 4UFZA 1AILA 1K4DC 3ZRSA 1Z5WA 4DR5B 2WLLA 1CEZA 5IYZA 5JJJB 1HP8A 3AG1C 2DOSA 3OTFA 2E74B 4N23A 5KA5A 4U3JB 3CEIA 4TV8B 5B1AB 2YIBA 4K35A 2R9IA 3RGBA 4JI5O 2K1EA 3BY6A 3E2EA 5KHIA 1K9MW 2YI9A 2OTLV 1RPOA 3T1HB 4U7NA 5BR8B 3RYHB 4LFCO 4WFEA 1R3JC 1PL4A 2PF4E 3L72H 4YJ3A 3CCUV 1MSDA 2LW1A 5J9PC 3H1IH 3A2FA 2Z5UA 1Q6HA 1JFFA 4PI0A 4Z1VA 1COWG 3JYCA 3E8BA 2ITCC 4K0KO 4DV0B 3OD4A 3P32A 4B3RB 4FPPA 2Y4TA 1U97A 4NXMO 2E5LB 4A5UB 1R6TA 2DYSB 3E83A 4X1IB 4UCOA 1N34O 1VQ9V 3WB0A 4F4LA 2E75B 2WLIB 3JASA 3OEHG 4JI8B 5B3SC 4GT1A 4LH7A 2DMXA 1J5EB 1OCRC 5CBFA 4YY3B 1ZAUA 1GRJA 4B08A 1N8RW 3THOA 1WLEA 5FNVA 3ETQA 4JI6B 4GX5A 4QNHB 2Q7HA 1EN5A 1WNSA 1H38A 2LFRA 1I7FA 2EIJB 3N2KB 4AQYO 2IU0A 2E3CA 3AK1A 4NTXA 1N4CA 3CMAV 5HFLA 3WU2Z 1QR9A 2XAJA 4FMTA 5L3EA 1TVKB 2QKAA 2WA3A 2VQFB 1Y67A 4H0LB 4DR6B 1PPJH 4LR3A 3AG2C 5LMUB 2FMLA 1M4UA 4DV7B 4DR2B 4ICGA 4PI2A 2RNBA 5LHHA 3DTUB 5H2FZ 4DR7O 5L3BA 1H2SB 1TUBB 5EBWC 4WBNA 1NVPB 3VQYA 1FFTB 4LNUB 1V54B 4WCEV 4W4LA 1M1KW 2Y69B 3BFRA 3TK1A 3ZHRA 1M56B 3LDEA 4FVMA 3B4SA 3B8MA 4O2BA 3HKEA 4EEQA 5EK0A 3T1HO 4X64B 3P3PA 4GKJB 2A79B 3H1JH 2Q7EA 1JA8A 1T5EA 2XOKG 5KUKA 3SYPA 4BIUA 5LL6Y 1PM9A 3ZRWB 3GB7C 5IE9A 1B04A 3G4SV 4IL6Z 4MTOA 3WFVA 3A0HZ 2KB1A 3OTOO 1PL0A 2P90A 2XUMA 2Q69A 4JI4O 1NQTA 2ZIOA 4J7ZA 5KAIZ 5LP6A 3E89A 1OHHG 5KHHA 3ABUA 4BIZA 1WAZA 2F93B 2E5LO 2AHYA 2IJJA 3SPGA 4DV1O 5C8YB 1BS3A 1K33A 3IGAC 4FZ0A 2QTOA 4DW1A 1Q86W 2YICA 4JPRA 3HKDA 1B6QA 2HHHO 5B1NA 2WA4A 3UT5A 3FAVA 4E4EA 4YY3O 3UQ8A 1FXVA 1GMGA 1TAEA 1Z2GA 2Y48A 4NKGB 1SQBH 1SZXA 2UXCB 2EIMB 3AG3C 1AI6A 3B2EE 2E76B 2Q8VA 4K8ZA 4LF4B 2CTWA 2F66C 2X6BA 3UO2A 2ITDC 4DW0A 1XL6A 4GYCB 4I55A 3CRQA 5LMUO 3L70H 4J42A 2KSDA 2EINB 4P2ZA 2IJKA 3DC5A 4DR2O 3GVMA 4LF9B 2L35A 3J80N 5LHGA 1J95A 4WF9V 1H8HG 4TV9A 3R65A 4GX1A 4LFAB 1SRYA 2DYRC 2KG7B 3GWOA 4UV8A 5CBHA 4OPHA 5IYBO 2HP8A 1JPXA 4I0XA 3BPZA 4I4TA 2QSAA 4H37A 1QU7A 1VQOV 1YCIA 4JYCA 5DN6G 3BEHA 4O4LB 5JJEB 3OUSA 4BIOA 4EFEA 1R3IC 3K5MA 4YHHB 5GONA 3CCQV 2ZXWC 4JYBA 5CA1A 4MSWC 2W0XA 4UVBA 3APQA 1B3QA 2EBOA 1L1FA 2RQ6A 1JJOA 3JCUZ 4GKJO 3TXQA 2XT9A 2WAMA 2KQXA 3U11A 2NR5A 4F6RA 1OCCB 3RYCA 4LF7B 1S77D 3HR0A 3MAQA 3EVKA 4JYYA 5FPRA 1P84F 2CE4A 1ZTEA 1AI5A 1QCEA 3U10A 5A9GA 2BSKA 3KG2A 3TCUA 1XNQO 2GUZA 4B3MB 4LF8O 2QJ1A 1WA8B 1NT2B 1PKXA 5A2QN 1GM9A 3L73H 3CXCU 1Q43A 4EFBA 4FLZA 2IJIA 3ABTA 3OR6C 2F43G 2R70A 4CS2A 1OCZC 2QTSA 5CMUA 1XUQA 4DV2B 4LF4O 4LWSB 4RQEA 4AI8A 2YC0A 4J80A 1B06A 2PI5A 2JK5C 3SPIA 4CC5A 1HNZB 2RDCA 3LSUA 4G2KA 1GM8A 3MHSC 3JATA 1KQSU 3CCMV 1RSOA 4O4HB 3AG1B 2UUCO 5LXTB 2JRIA 4KHPO 4CBCA 1FXHA 2G38A 1NH2B 3OUFA 3ABLC 2LO1A 4LFAO 4WFHA 2F1MA 3B8NA 1NBMG 1AB3A 1AR1B 1H2GA 1SERA 3X2QC 1VQ6V 5D5QA 3ZEDA 4I7ZB 1NTKH 1R3KC 2UXXA 3RT3C 1LUWA 4Q6GA 4DV6B 1FKAO 4IYHA 3DXRB 4MVSA 3HKCA 1E1RG 3QNEA 1AR4A 4LFBB 1E79G 4MTGA 4JI1B 4FJCC 2OT5A 5JVDB 2GTAA 5LA6A 4LCUC 2JJ1G 3D36A 1VF7A 3T4ZA 2QEXV 4TSFG 2FL4A 2ZNJA 4H44B 5EBLC 4QJFB 1HNWB 1R1BA 2F4VB 2DWEC 4DV3B 2YXHA 3W7UA 4FLUA 1M57C 3ABMB 1VQPV 4CS4A 3Q4HB 1OCRB 4TT3G 1BT8A 1BSMA 5GW7A 3IFXA 5FPOA 3CP1A 2ZE7A 2W6IG 4X8AA 3I5DA 1QVGU 1HNXO 4PJ0Z 4TQFA 2A7WA 3E22B 3TGUH 3B77A 3CB2A 3BVOA 5D5PA 3CE2A 4DV2O 1WB8A 1I94B 1S5LZ 1Q81W 2GV9A 3AG2B 1HNZO 4FLWA 5BY1A 4JF3A 4Z2WA 3RWRD 4IIJB 3RYIA 1RM1C 3RYHA 2LQTA 2CTRA 3JD4A 4B3SB 1PD3A 3JD3A 3N2GB 3OFNG 1VIBA 4TQDA 1PP9H 5CA3A 1AI7A 3O65A 1WN7A 3NXSA 1XEQA 2B9ZA 2YDEA 3KCXA 2PTMA 5J2UB 5LOVB 4HBNA 2ZT9B 2IW5A 4P9PA 1NZ6A 1JR9A 2QM4A 3ZHQA 4LF5B 1FAFA 2ETNA 1KYOF 1VMGA 1KKCA 1JMKC 2ZD9A 1K34A 4X1IA 2W0FC 2P7TC 4RO2A 5JCOA 1N33O 3FB5C 5KUMA 3W7XA 4B7KA 3ZN1A 3I56V 3AG4C 4PA4A 5IY5C 1SQGA 2LFSA 4TOIA 4GKKO 3MD0A 2O57A 3L9DA 3SYCA 3K04A 3TJTA 2PY5A 4D6TH 2QWRB 3LSSA 3K57A 4QE7A 1FXKA 1AJQA 1N36B 3LSQA 5LYJA 1QQCA 3K5OA 5CB4A 4B3TO 3K9SA 3F7YC 1GK9A 3JALB 4J7JA 3LUTB 4IYIA 3AG3B 4J7KA 1US6A 3E86A 1DK1A 5LP6C 1E1QG 5LGNA 1TUBA 2VWJA 3F5TA 1SA0B 4HAMA 3ASNC 1K73W 2P67A 4I9WA 2Q7GA 4U7OA 1JQ0A 4NTYA 1NR7A 1MOFA 4O4JB 3VBBA 1XNRB 3CMEV 3QO8A 3S3XA 4ZI7A 1XOUA 3H1KH 3OR7C 1HDJA 2QM7A 3QG5A 1NR1A 4FIPC 4OXSA 4YJ2B 4ZHQB 4B3SO 3HKBA 2UU9B 1GKFA 5KMGB 5IJ9B 5DECA 5B1BC 1XREA 4X1YB
chains in the Genus database with same CATH topology
4MTOA 3WFVA 2H94A 3HPLC 2KB1A 4QE9A 1PL0A 2P90A 3MHHC 1GM7A 2Q69A 4E2LA 1NQTA 3CCSV 2OCCB 3E89A 1OHHG 4UXNA 3ABUA 2ZXWB 4BIZA 1DF5A 2AHYA 5C93A 2EINC 2EIJC 2IJJA 2XAFA 3SPGA 4DO2A 3PJSK 1ZWIC 3E35A 2WLNA 1K33A 3ZRVA 3IGAC 1KKDA 3QO5A 4P9OA 2QTOA 1Q86W 3JD2A 4JPRA 1B6QA 1QLEC 1G8MA 3K0DA 4GX0A 5B1NA 2JEUA 5HFMA 3CCJV 4DXWA 5L3FA 1FXVA 1GMGA 2Y48A 2IH3C 1AI4A 2EZOA 5FL7G 2Q6AA 2EIMB 4G28B 2BOBC 3AG3C 3OEEG 1AI6A 1JJ2U 2WLIA 4HYOA 4HZ3A 2XAQA 1Q7YW 1QBZA 1K7DA 5B1BB 1I5YA 2X6BA 4RQFA 4PDRA 2ITDC 4QPKA 2QM8A 3ZMUA 1V54C 1XL6A 2HVKC 1YTFD 1VQLV 1K92A 2Y69C 4PA7A 3K79A 2IJHA 4UVAA 1AROP 4R7CA 3OGCC 2EINB 4P2ZA 1OCOC 2IJKA 2WLKA 4JTAB 1OCZB 2QA4V 4PDMA 2EILC 5LHGA 1J95A 2EIKB 3H01A 4WF9V 1DLBA 4X88A 4MVOA 1H8HG 3RVZA 1WPXA 3R65A 4GX1A 1SRYA 2DYRC 3GWOA 4MW8A 4UV8A 3SYOA 5CBHA 4PDVA 3RW0A 5IYBO 4MVZA 1JPXA 3CYOA 3FYEB 3M99B 1P7BA 1DF4A 4MVQA 3STLC 4H37A 3I55V 4KUMA 1VQOV 2JEXA 5DN6G 4JYCA 3BEHA 2OCCC 1YI2V 3OUSA 1JOYA 1R3IC 2UXNA 4LBEC 4ASUG 5LGTA 3G71V 3ZJZA 3CCQV 4MT8A 2ZXWC 4JYBA 1VQNV 1YTFB 4MSWC 4UVBA 2EBOA 1L1FA 1SZTA 1HWYA 2WAMA 4PA9A 1AJNA 1F23A 5IYDO 4FK5C 3FKSG 3CC7V 1YIJV 1OCCB 4J9ZB 1ENVA 1W0JG 3T2MA 1M90W 1ROPA 2A9HA 4QIWF 1S77D 3ZMVA 3CPWU 3CCLV 2WSSG 2B5UA 4MW3A 4BAYA 3X2QB 1YHQV 2EIMC 2X6AA 2DWDC 2YEVA 3DGEA 1AI5A 2FTKA 2XAGA 1QCEA 1XL4A 5EBMC 4BW5A 1NJIW 3OMAB 4R50A 3KG2A 3TCUA 4MVUA 2WLLB 5H6QA 2DYRB 1W2BU 2ZDIC 4PDLA 3ZRWA 2EZPA 4X89A 1PKXA 4KP4A 1GM9A 3CXCU 2PI4A 4Q20A 1K97A 4KFMA 3K9AA 4Z1MG 1F4MA 2Q68A 2IJIA 3ABTA 3K08A 1KD1W 3W7SA 2X7RB 3OR6C 1BL8A 1TUEB 4GX2A 2F43G 1MSWD 2B1GA 4WFGA 1NH2D 1Y4MA 1VQMV 1OCZC 2WLHA 4L87A 1S0VA 1THZA 4PELA 4JTDB 5CMUA 1JX9A 3SPHA 2EIKC 3E8HA 4RUEA 1M57B 1KP2A 5L3CA 3IC7A 4RQEA 1R6NA 1S5HC 2HG5C 2XASA 3F7VC 2JK5C 2PI5A 3SPIA 4ZKIA 1MG1A 4WFFA 2WPDG 5LBQA 4TWKA 3QO7A 4G2KA 1GM8A 2DW4A 3MHSC 4XDLA 3W7TA 2HVJC 1K8AW 1KQSU 2C2AA 3K3WA 3CCMV 1FS0G 1Q82W 1H8EG 2ZDIA 3ZMZA 1GTOA 1P4RA 3AG1B 5CN0A 1M9NA 4JAVA 4J9YB 3LDCA 3TETA 1R3LC 1KECA 1CPYA 4CBCA 1FXHA 4PA3A 4CZZA 1NH2B 3OUFA 3ABLC 1S3JA 1KC8W 3LNMB 1OCCC 4WFHA 3ABMC 5H6RA 1K5SA 3B8NA 4RAIA 1NBMG 1AR1B 1H2GA 5H9CA 1SERA 3X2QC 1VQ8V 1K3EA 1VQ6V 3ZN0A 5L3GA 3SJQC 3CCEV 2P6JA 1R3KC 2UXXA 2IH1C 3ZIAG 1RM1B 4YXWG 3UKMA 2GSMB 4R8CA 3OMNB 1K4CC 4MVSA 3ZMSA 1NVPD 3OW2U 1RPRA 2XAHA 1E1RG 3QNEA 3OE7G 2CK3G 1E79G 3ML0A 3UM7A 4MS2A 4P30A 1PNKA 4MTGA 3CD6V 3ETEA 2OT5A 4FJCC 1QLNA 1KP3A 1YSCA 5LGUA 3ZMTA 1FXKB 4LCUC 4XDKA 1AJPA 2JJ1G 3D36A 3T4ZA 2QEXV 4TSFG 2AHZA 4JGSA 2R9RB 3K03A 1VQ4V 4G27B 4N21A 4RUFA 5EBLC 1EZJA 1YJNV 1GO3F 4QJFB 3T4DA 2HKOA 4MVMA 4XBFA 3D3IA 3W7WA 2DWEC 2GHYA 2QE7G 3ABLB 2WLJA 3W7UA 1MABG 4MTFA 4QPJA 3K0GA 1M57C 1S76D 1JCHA 4XDJA 4UVCA 2QKSA 3ABMB 1IXMA 1VQPV 2ZR3A 2V1DA 5CBGA 3EFFK 1OCRB 4TT3G 4ZBMA 3RBZA 3SYQA 5GW7A 2HFEC 2B1IA 3IFXA 5B1OA 3ETDA 5IY5B 1JVMA 1VQ5V 3CP1A 2W6IG 3LDDA 2YSUB 5IYCO 4X8AA 1K4DC 3ZRSA 2WLLA 3STZC 1YJ9V 1QVGU 2HJFC 1CEZA 1F4NA 3CCRV 3RVYA 3CC2V 3AG1C 4EKWA 3WG7B 3ZCCA 3OMIB 3B77A 4N23A 5EC2C 5KA5A 2LP7A 2H8PC 4PA6A 5B1AB 3AEIA 3ASOB 4JTCB 2NLJC 2OTJV 2R9IA 1K5QA 1Q81W 3ABKB 2A0LA 3F5WC 3AG2B 2K1EA 1BHAA 3BY6A 3VOUA 3E2EA 1VQKV 1W0KG 4JF3A 1K9MW 2OTLV 1RPOA 1BHBA 4MVRA 3JCZA 4U7NA 2ATKC 2JIZG 1RM1C 4WFEA 1R3JC 3FB8C 3T1CA 2NNUA 3JD1A 3JD4A 3CCUV 1PD3A 3JD3A 3OFNG 5CA3A 1AI7A 2X6CA 5J9PC 3NXSA 3ASNB 3CCVV 4LC1A 2Z5UA 3E8GA 1OZ0A 4UUJC 1FXKC 2ZQMA 1COWG 1S72V 3CC4V 3JYCA 4WFBV 1ORQC 2WLMA 2IW5A 3FB6C 4P9PA 2WWWA 3SPJA 3E8BA 2ITCC 3P32A 4FPPA 1EBOA 5BZBA 2DYSB 1R73A 3E83A 2ZD9A 1K34A 3HB3B 1VQ9V 2Q67A 2W0FC 4F4LA 1EFRG 2P7TC 2WLIB 2X0LA 4RO2A 3OEHG 4JASA 5B3SC 1NKDA 3FB5C 4GT1A 5KUMA 5LHIA 3W7XA 3ZN1A 1SETA 3I56V 2Z3YA 1G4YB 1OCRC 1V55B 5CBFA 4I5SA 2EJRA 1QR8A 4R6ZA 2M7WA 3AG4C 3ETGA 4PA4A 5IY5C 1N8RW 2LFSA 1WLEA 5IDJA 3MD0A 4GX5A 5L3DA 3SYAA 4QNHB 1H38A 3SYCA 1M56C 3K04A 4JAUA 2LFRA 1I5XA 5E1AC 2EIJB 3WG7C 2XNDG 1SESA 2IU0A 3LSSA 3FB7C 5KA6A 1BMFG 4LP8A 4QE7A 3CMAV 1FXKA 5B1AC 5HFLA 3ASOC 1QR9A 2XAJA 1AJQA 4FMTA 2IU3A 4H33A 5L3EA 2D3OW 1QLEB 3LSQA 3G6EV 2W6JG 3FYIB 4WFAV 3ABKC 3AG2C 3F7YC 3E8FA 2JDIG 3JD0A 1GK9A 2V7QG 1YITV 1LNQA 2DQ3A 3LUTB 4GCZA 1UJWB 3AG3B 1Y66A 3E86A 5LHHA 3DTUB 4UV9A 5B3SB 3OAAG 1E1QG 1PNLA 5L3BA 5LGNA 5EBWC 1VQ7V 2BOCC 1R6KA 2HR3A 3AG4B 4MTXA 3EHBB 4HAMA 1NVPB 3ASNC 1K73W 1FFTB 2P67A 3SPCA 4I9WA 4U7OA 1V54B 4WCEV 1M1KW 1F51A 1JQ0A 3A0RA 2ZR2A 2Y69B 3P30A 1NR7A 1MOFA 3TK1A 3VBBA 1M56B 1PNMA 3LDEA 1DTOA 3CMEV 3B8MA 3QO8A 5EC1C 1OCOB 1QVFU 2DYSC 5EK0A 1CP9A 3OR7C 2A79B 2EILB 2YEVB 2QM7A 1NR1A 3K06A 3OM3B 4FIPC 4OXSA 2XOKG 5KUKA 2DQ0A 3SYPA 1YJWV 4BIUA 1GKFA 5DM6V 1V55C 3ZRWB 2MK3A 3GB7C 3ZRXA 5B1BC 3G4SV 2JJ2G 2HLDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4C C;  4MTO A;  4MVS A;  3HPL C;  2KB1 A;  4QE9 A;  3UM7 A;  4MS2 A;  2Q69 A;  4P30 A;  4J9Z B;  3E83 A;  2ZD9 A;  3T2M A;  3E89 A;  2A9H A;  2Q67 A;  2W0F C;  4MTG A;  4F4L A;  2P7T C;  2WLI B;  4RO2 A;  4MW3 A;  5B3S C;  3FB5 C;  5KUM A;  2AHY A;  4LCU C;  4XDK A;  2EIN C;  2EIJ C;  3SPG A;  2EIM C;  3T4Z A;  2X6A A;  2DWD C;  1G4Y B;  2YEV A;  1OCR C;  1ZWI C;  3PJS K;  1XL4 A;  2AHZ A;  2WLN A;  5EBM C;  2R9R B;  3K03 A;  4BW5 A;  3IGA C;  4R50 A;  3KG2 A;  3TCU A;  1KKD A;  4R6Z A;  4MVU A;  3AG4 C;  4G27 B;  2WLL B;  4PA4 A;  5IY5 C;  4RUF A;  5EBL C;  4P9O A;  2QTO A;  3T4D A;  4MVM A;  4PDL A;  1QLE C;  4GX5 A;  2DWE C;  4X89 A;  3K0D A;  4GX0 A;  3SYA A;  4QNH B;  2WLJ A;  4MTF A;  3SYC A;  4DXW A;  2IH3 C;  3K0G A;  1M57 C;  1M56 C;  3K04 A;  2QKS A;  4XDJ A;  4KFM A;  5E1A C;  3WG7 C;  2Q6A A;  4G28 B;  3EFF K;  2BOB C;  5CBG A;  3AG3 C;  2Q68 A;  3FB7 C;  4ZBM A;  4LP8 A;  4QE7 A;  2WLI A;  3RBZ A;  3K08 A;  3SYQ A;  2HFE C;  3IFX A;  3OR6 C;  1BL8 A;  4GX2 A;  4HYO A;  4HZ3 A;  1JVM A;  5B1A C;  3ASO C;  4WFG A;  3LDD A;  4H33 A;  1OCZ C;  2WLH A;  4X8A A;  1K4D C;  4JTD B;  2X6B A;  3ZRS A;  2WLL A;  3ABK C;  3STZ C;  2HJF C;  3AG2 C;  3SPH A;  2EIK C;  3E8F A;  3E8H A;  3F7Y C;  2ITD C;  4PDR A;  4RUE A;  3RVY A;  1LNQ A;  1V54 C;  3AG1 C;  1XL6 A;  2HVK C;  4EKW A;  3LUT B;  2Y69 C;  4PA7 A;  1S5H C;  3E86 A;  2HG5 C;  5EC2 C;  3F7V C;  2JK5 C;  4R7C A;  3SPI A;  5CBF A;  4WFF A;  3OGC C;  2H8P C;  4PA6 A;  4P2Z A;  4JTC B;  4TWK A;  1OCO C;  4XDL A;  2NLJ C;  2WLK A;  5EBW C;  4JTA B;  2BOC C;  2HVJ C;  4PDM A;  2EIL C;  3ASN C;  3F5W C;  2A0L A;  1J95 A;  2K1E A;  3SPC A;  3VOU A;  4I9W A;  4X88 A;  4MVO A;  3RVZ A;  3R65 A;  4GX1 A;  4MVR A;  2DYR C;  4J9Y B;  3LDC A;  3TET A;  4MW8 A;  1R3L C;  2ATK C;  3SYO A;  4PDV A;  3RW0 A;  4CBC A;  5CBH A;  4PA3 A;  3LDE A;  4MVZ A;  1R3J C;  3FB8 C;  4WFE A;  3OUF A;  3ABL C;  1P7B A;  5EC1 C;  3T1C A;  4MVQ A;  3STL C;  4H37 A;  2DYS C;  3LNM B;  5EK0 A;  3BEH A;  1OCC C;  4WFH A;  3ABM C;  3OR7 C;  2A79 B;  2X6C A;  5J9P C;  2OCC C;  3OUS A;  1R3I C;  4LBE C;  3K06 A;  4OXS A;  4RAI A;  3E8G A;  3ZJZ A;  4UUJ C;  2ZXW C;  5KUK A;  4MSW C;  3X2Q C;  3SYP A;  3JYC A;  3SJQ C;  1ORQ C;  2WLM A;  1R3K C;  1V55 C;  2IH1 C;  3FB6 C;  3E8B A;  2ITC C;  4P9P A;  3SPJ A;  3GB7 C;  4PA9 A;  5B1B C;  3UKM A;  4R8C A;  5BZB A; 
#chains in the Genus database with same CATH topology
 3HPL C;  4QE9 A;  3MHH C;  3LNN A;  2DN9 A;  4TUY B;  2KKW A;  5IJ0 B;  1UFI A;  4LF5 O;  2ZXW B;  1DF5 A;  2PYL A;  1YVW A;  4DO2 A;  1MNG A;  2WLN A;  5C8Y A;  1KKD A;  5TIS Z;  3QO5 A;  4BWA A;  2AW9 A;  1W59 A;  3K0D A;  1IDS A;  4GX0 A;  5HFM A;  1H2L A;  5CA0 A;  5L3F A;  2FB5 A;  3IC9 A;  5FL7 G;  4LF6 O;  2BOB C;  3OEE G;  1FYJ A;  2GTS A;  1YF2 A;  1Q7Y W;  2BE3 A;  5KX5 B;  3ZMU A;  2QM8 A;  2HVK C;  1Y76 A;  3FD9 A;  1N32 O;  3K5N A;  1SQV H;  1ARO P;  4KL1 A;  4R7C A;  2K9P A;  2RMK B;  3OGC C;  1OCO C;  3ZHS A;  2WLK A;  1OCZ B;  4PDM A;  3SDL A;  4X66 B;  3ZHT A;  5JWP A;  1TA8 A;  1Q3E A;  2GBO A;  3H01 A;  3OT7 A;  2KG7 A;  1LUV A;  1MMM A;  3CX5 F;  5GTI Z;  3RW0 A;  3SJA C;  5J2T A;  4MVQ A;  1FFX B;  4IHJ A;  3I55 V;  4KUM A;  4DR5 O;  1GN3 A;  4O4L A;  2OCC C;  3A0B Z;  5LGT A;  4ASU G;  3G71 V;  3ZJZ A;  2F23 A;  4JI0 B;  4FM1 A;  1VQN V;  4O2A A;  2ARH A;  1MZF A;  1HWY A;  4PA9 A;  1M5I A;  5IYD O;  3FKS G;  1XDC A;  3CRR A;  2AZ0 A;  1ENV A;  1SS3 A;  1W0J G;  4DR6 O;  1WB7 A;  3X2Q B;  4FZ1 A;  5BR8 O;  1ZL8 B;  4JYA B;  4X1K B;  4ZOL B;  2YEV A;  2XAG A;  3JSN A;  4R50 A;  4GZR B;  4JZ2 A;  1CXZ B;  2WLL B;  5H6Q A;  3BA8 A;  2EZP A;  3VQW A;  1N0N A;  1FPO A;  1WA8 A;  1Y74 A;  4KP4 A;  2AZ2 A;  4EB6 A;  4Q20 A;  1K97 A;  3T1Y B;  2CUG A;  3N27 A;  4DV0 O;  3K9A A;  2ZIM A;  4B3R O;  3K5L A;  1DGS A;  4JI3 B;  1KD1 W;  1WJZ A;  2X7R B;  1EN4 A;  1H2M A;  1MSW D;  2B1G A;  1NH2 D;  1VQM V;  1RFY A;  4L87 A;  1S0V A;  1SQF A;  4PEL A;  4JTD B;  4JI8 O;  3SPH A;  4DRX B;  2EIK C;  4PV1 B;  5F2V O;  1M57 B;  1J5E O;  2IBZ H;  3BHP A;  1MA1 A;  4YJ3 B;  1R6N A;  2P4K A;  1BGY H;  2A06 H;  2HG5 C;  3JAK B;  4JI6 O;  5LBQ A;  4TWK A;  3QVN A;  4XDL A;  3W7T A;  2HVJ C;  3D36 C;  1FS0 G;  1H8E G;  1NTZ H;  4KXR A;  3ZMZ A;  2UXB B;  2Q0O C;  1BQ0 A;  5CN0 A;  2QDO A;  4JAV A;  1IBK B;  3TET A;  2OWO A;  1Z5V A;  1CPY A;  1LR1 A;  4PA3 A;  4CZZ A;  2LGQ A;  2VQF O;  1S3J A;  3JAS B;  1IVS A;  5H6R A;  1K5S A;  4DV7 O;  5H9C A;  2VS0 A;  4HNA A;  1K3E A;  5L3G A;  5EZY A;  3SJQ C;  5ITZ B;  1VAR A;  5FNV B;  4C7U A;  3ZIA G;  4AHC A;  4FM0 A;  1RM1 B;  2BTO A;  1O9H A;  4JI0 O;  4R8C A;  1IBL B;  1ZLZ A;  1K4C C;  3OMN B;  3DXR A;  1RPR A;  2XAH A;  3OE7 G;  5KHJ A;  2FYU H;  1TGO A;  4MS2 A;  1BCC H;  1Q5O A;  2PUS A;  4CH5 A;  5JVD A;  1KP3 A;  1YSC A;  3ZMT A;  3R66 A;  1ZSP A;  2EJ7 A;  3JSL A;  3K03 A;  4G27 B;  4X64 O;  2YI8 A;  3CXH F;  4OPA A;  1YJN V;  3T4D A;  4UCS A;  4MVM A;  4DUY B;  3W7W A;  2WLJ A;  1MAB G;  3K0G A;  1S76 D;  1XHX A;  4UVC A;  2QKS A;  1IXM A;  5CBG A;  3EFF K;  1EZV H;  4WBN B;  4ZBM A;  4DUZ B;  1G6U A;  3RBZ A;  5B1O A;  5H5N A;  5IY5 B;  4I9Q A;  1YZB A;  2ZE6 A;  3D3Q A;  1GAX A;  3STZ C;  1F4N A;  3RVY A;  3CC2 V;  4NB5 A;  4FM2 A;  4EKW A;  3CJH A;  4O2B B;  3HKE B;  3ZCC A;  1IUR A;  2VRZ A;  3AEI A;  2NLJ C;  1QNM A;  1WPB A;  5JCO C;  4FLV A;  4DR4 B;  2CDY A;  2OCH A;  3F5W C;  2A0L A;  1BHA A;  2UXC O;  2YUA A;  1VQK V;  1W0K G;  4OGQ B;  1Y6X A;  2JGD B;  4MVR A;  3BAA A;  1GN2 A;  5K1X A;  2ATK C;  3S3W A;  2JIZ G;  3WB2 A;  3FB8 C;  5LP6 B;  3T1C A;  2NNU A;  3JD1 A;  4CH6 A;  3CCV V;  3ASN B;  4LC1 A;  5IT9 N;  4CS3 A;  5J2U A;  1FXK C;  3DC6 A;  1S72 V;  2BTQ B;  1ORQ C;  4DR1 B;  3SPJ A;  2WWW A;  3UT5 B;  4X62 B;  3FAV B;  1AP5 A;  5EIB C;  1EBO A;  5BZB A;  3SR2 C;  4LF9 O;  3O9O A;  2JS3 A;  1GH6 A;  1KU9 A;  3HB3 B;  2X0L A;  4X65 B;  4JAS A;  3U0Z A;  1NKD A;  3TXS A;  1G4Y B;  2CAZ C;  1GN4 A;  4I5S A;  2EJR A;  1QR8 A;  3ETG A;  5IDJ A;  2YXY A;  4JI7 B;  4YHH O;  3J81 N;  3FX7 A;  3SYA A;  2CGN A;  1M56 C;  4JAU A;  3WG7 C;  1NS1 A;  1SES A;  3FB7 C;  5KA6 A;  1L8D A;  3G6B A;  3ASO C;  2RJZ A;  2IU3 A;  4H33 A;  2D3O W;  4LF7 O;  4TV9 B;  3G6E V;  3H1L H;  4DUZ O;  1WP8 A;  3ABK C;  3E8F A;  2JDI G;  2V7Q G;  2FKX A;  4I4T B;  3JAW B;  1NTM H;  4D7S A;  5JH7 A;  4UCU A;  4NVP A;  4X20 A;  1Y66 A;  1XMQ B;  4D7T A;  5JQG A;  4UV9 A;  5B3S B;  4B3M O;  1PNL A;  5GON B;  5CA1 B;  2BOC C;  4OX9 B;  1R6K A;  4JZG A;  3EHB B;  2OYQ A;  3JAR A;  4F6R B;  2ZR2 A;  4DR4 O;  4LH6 A;  1HR0 B;  1I08 A;  3RYC B;  1DTO A;  5EC1 C;  1OCO B;  1QVF U;  4U3J A;  4TV8 A;  3K06 A;  4PD4 F;  1KBH A;  2BSK B;  2P4V A;  2EX3 A;  1YJW V;  4DV4 B;  2GUZ B;  1H2N A;  1V55 C;  5KMG A;  3K58 A;  5IJ9 A;  4DR1 O;  2CH7 B;  4E2L A;  3CCS V;  2OCC B;  2Y0I A;  4UXN A;  5C93 A;  2EIN C;  2IM9 A;  4YIO A;  5EYP B;  2UUA B;  4ZIB A;  4P9O A;  1V9P A;  1QLE C;  1SF9 A;  1G8M A;  4X9Q A;  3K59 A;  1GN6 A;  3CCJ V;  4DXW A;  1BE3 H;  1URF A;  1AI4 A;  4JI5 B;  1XQ8 A;  4JI7 O;  2Q6A A;  4G28 B;  4DV6 O;  1JJ2 U;  2GDS A;  4CC6 A;  2WLI A;  4GLX A;  4HYO A;  4LFB O;  1RSO B;  2XAQ A;  2QWO B;  5DED A;  3CHX A;  1QBZ A;  2Q73 A;  4JI1 O;  2ZE8 A;  3M7M X;  4J11 A;  4RQF A;  5KX5 A;  4PDR A;  2N04 A;  4QPK A;  4BR6 A;  1VQL V;  2NN4 A;  1K92 A;  3L75 H;  4PA7 A;  1HW7 A;  2IJH A;  1HNW O;  2F4V O;  1VP7 A;  3ZHU A;  4DV3 O;  3N2K A;  3ZX6 A;  2QA4 V;  2EIL C;  4NXM B;  2EIK B;  1DLB A;  4X88 A;  1N34 B;  4MVO A;  3RVZ A;  1WPX A;  1TVK A;  4NTW A;  1I0H A;  1IBM B;  3HKC B;  3QF7 A;  1Q6U A;  4MW8 A;  1X59 A;  3SYO A;  4PDV A;  3ZS8 C;  3CYO A;  1KMI Z;  2ZCE A;  2Y4U A;  2JEX A;  3MDS A;  3WB1 A;  1YI2 V;  3M8A A;  4LBE C;  3AK2 A;  1BQZ A;  4O4I B;  1YTF B;  4JV5 B;  4LNU A;  2YIB D;  1F23 A;  4AQY B;  1I94 O;  1PV0 A;  5KAF Z;  2YXL A;  2Q4P A;  4J9Z B;  5E79 Z;  1D5A A;  3T2M A;  1ROP A;  3ZMV A;  2WSS G;  4MW3 A;  3GWK C;  4BAY A;  1YHQ V;  3CRC A;  4UCR A;  2DWD C;  4ZOL A;  1NJI W;  1XL4 A;  4BW5 A;  3OMA B;  3D8C A;  2Q0A A;  2DYR B;  4H13 B;  1W2B U;  4PDL A;  4DR7 B;  3ZRW A;  3SJB C;  2YS8 A;  2UUA O;  2PI4 A;  3CRM A;  5BMV B;  2V4D A;  1XMO B;  3DSQ A;  1F4M A;  2Q68 A;  2QWN B;  5GTH Z;  4IT5 A;  3W7S A;  4I50 B;  3KKY A;  1BL8 A;  1TUE B;  2AGA A;  1Y4M A;  2DJV A;  2WLH A;  2CTP A;  2JVD A;  2P5O A;  1Q90 D;  1JX9 A;  3RYI B;  3L71 H;  3A8T A;  3E8H A;  4RUE A;  4DRX A;  1VF6 A;  1KP2 A;  5L3C A;  3IC7 A;  3H9V A;  1EM1 A;  2XAS A;  3F7V C;  3JAK A;  2WPD G;  4JAA A;  1UPG A;  2EUL A;  2C2A A;  3K3W A;  4NXN B;  2LJ2 A;  3OTO B;  1BZK A;  4JI4 B;  2ZDI A;  1P4R A;  3APO A;  1N36 O;  2Y0P A;  4DV1 B;  4F6E A;  1ZUQ A;  1IBM O;  1EN6 A;  1P7G A;  3LNM B;  3ABM C;  2LW7 A;  3IJ4 A;  4RAI A;  2HHH B;  1VQ8 V;  3ZN0 A;  2F95 B;  3CCE V;  5ITZ A;  2CGO A;  4FFB B;  2ILM A;  3UKM A;  3ZMS A;  3BRC A;  2CK3 G;  3UM7 A;  1SC5 B;  4P30 A;  1PNK A;  4JV5 O;  4UB8 Z;  1QLN A;  4YIP A;  4CH3 A;  2UXD B;  1FXK B;  1MZE A;  1AJP A;  1XNR O;  2Z0A A;  2AHZ A;  1XI1 A;  5LYJ B;  3KZI Z;  5B66 Z;  4N21 A;  5CB4 B;  1L0N H;  1IX9 A;  3B09 A;  1Q6I A;  3RYF B;  3D3I A;  2GHY A;  3CRA A;  1SQP H;  3ABL B;  4MTF A;  4QPJ A;  3IAY A;  2UU9 O;  3KCY A;  1JCH A;  2VQE B;  4IGG A;  2V1D A;  2QWP B;  1KUQ A;  3SYQ A;  4GUN A;  2HFE C;  1FD9 A;  2B1I A;  2BCC H;  1VQ5 V;  1OV9 A;  1VEW A;  3LDD A;  1XMO O;  5IYC O;  4J41 A;  5IYZ B;  1YJ9 V;  2HJF C;  3CCR V;  3AK3 A;  2PYJ A;  3WG7 B;  2HEP A;  4ZI7 B;  3OMI B;  5EC2 C;  2LP7 A;  2H8P C;  4PA6 A;  4JTC B;  3ASO B;  4PHZ A;  2OTJ V;  4UCV A;  1K5Q A;  3RN4 A;  3HKB B;  1YXB A;  1H2K A;  3ABK B;  1AR5 A;  5K1P A;  3VOU A;  2JGD A;  1BHB A;  1NI8 A;  3JCZ A;  4NXN O;  3P3N A;  2PGG A;  4LWS A;  2UUB B;  2QWQ B;  1XNQ B;  4FFK A;  2X6C A;  1WP7 A;  3E8G A;  4LF8 B;  1OZ0 A;  1JFF B;  4UUJ C;  2ZQM A;  3CC4 V;  1YEW A;  4WFB V;  2BTQ A;  4O4H A;  2WLM A;  3FB6 C;  3H1H H;  5CA0 B;  4X66 O;  5LXT A;  1R73 A;  1D5N A;  2Q67 A;  1EFR G;  2ZE5 A;  5LHI A;  1SET A;  2Z3Y A;  1V55 B;  4R6Z A;  2M7W A;  2XTA A;  5KHK A;  2UXD O;  1X4T A;  3JAM N;  3G67 A;  2ZNI A;  4K8X A;  1Y76 B;  5L3D A;  4W4K A;  4DR3 B;  1U96 A;  1I5X A;  1S5J A;  5E1A C;  2XND G;  1A32 A;  2UUC B;  1BMF G;  4LP8 A;  5B1A C;  4ABM A;  2VQE O;  4KHP B;  4L8J A;  1SKV A;  1XBL A;  1QLE B;  2W6J G;  3FYI B;  4WFA V;  1P49 A;  4J10 A;  2P22 C;  3JD0 A;  4JYA O;  1YIT V;  1LNQ A;  2DQ3 A;  2R9A A;  5J2T B;  1G1X B;  4UCT A;  3JAW A;  4GCZ A;  1UJW B;  4IHJ B;  4BW9 A;  3OAA G;  3BA9 A;  3Q4H A;  4O2A B;  4CH4 A;  1VQ7 V;  5KLV H;  2HR3 A;  3AG4 B;  4MTX A;  3T1Y O;  1SQQ H;  3SPC A;  3G80 A;  2ZIN A;  1F51 A;  4JI3 O;  3A0R A;  3P30 A;  2RCV A;  1PNM A;  5KHG A;  3E22 A;  1XHZ A;  2DYS C;  1CP9 A;  2H3O A;  2EIL B;  3CS5 A;  2YEV B;  3OM3 B;  3C3S A;  2UUB O;  4FLY A;  2DQ0 A;  3NR7 A;  3SJC C;  4DK0 A;  3PN1 A;  5DM6 V;  4NYK A;  2MK3 A;  3ZRX A;  4DV5 B;  2JJ2 G;  1Y74 B;  2HLD G;  2H94 A;  4IIJ A;  4EB6 B;  3C3T A;  1GM7 A;  2CH7 A;  2UXB O;  1L0L H;  4UB6 Z;  3N2G A;  1IBK O;  1HNX B;  4DK1 A;  2EIJ C;  2XAF A;  1F7Y A;  3L74 H;  1IXB A;  3PJS K;  1XIL A;  1ZWI C;  3E35 A;  5IWA B;  3ZRV A;  5LOV A;  5EYP A;  2N74 A;  3QTC A;  4K3A A;  3HKD B;  3JD2 A;  2YID A;  1Q8I A;  2JEU A;  5BXZ A;  2IH3 C;  2EZO A;  2OIE A;  4NR1 A;  1IBL O;  4DR3 O;  5LMN B;  4HZ3 A;  1K7D A;  5B1B B;  1I5Y A;  2YIA A;  2L6L A;  3UO3 A;  2Q5Z A;  1V54 C;  1YTF D;  4I55 B;  2Y69 C;  5JJN B;  3K79 A;  4UVA A;  4DUY O;  2QGN A;  4JTA B;  3CSX A;  2OIG A;  4HNA B;  5EZY B;  3VQX A;  3RFR A;  2P06 A;  2PZS A;  2AXT Z;  1N33 B;  3VQV A;  3JAL A;  4I0X B;  4MVZ A;  3FYE B;  3M99 B;  1P7B A;  1DF4 A;  3STL C;  4GKK B;  1SQX H;  1JOY A;  2UXN A;  4MT8 A;  3AG7 A;  4FLX A;  4O4I A;  2ADQ B;  1SA0 A;  2VWK A;  1SZT A;  1AJN A;  2ZKO A;  4FK5 C;  1M93 A;  3CC7 V;  1NU1 H;  4U3F H;  1VF6 C;  1YIJ V;  4O4J A;  4JI2 B;  1M90 W;  2A9H A;  3ICX A;  4QIW F;  4DV5 O;  3CWB H;  4QGP A;  3CPW U;  3CCL V;  2QKC A;  2B5U A;  2D2C B;  4B3T B;  2EIM C;  2ZM6 B;  2X6A A;  4FLT A;  3DGE A;  2FTK A;  5EBM C;  2M6Y A;  4MVU A;  4YJ2 A;  4ZHQ A;  2ZDI C;  1AVM A;  4X89 A;  5IWA O;  1FJG B;  3CJH B;  4RWU A;  2Q9L A;  1O9G A;  2HJD A;  4X1Y A;  1YDX A;  4KFM A;  4Z1M G;  4X62 O;  5BMV A;  4TUY A;  5IJ0 A;  3K08 A;  4GX2 A;  3ZBH A;  4I50 A;  5FLX N;  4WFG A;  3UCS C;  1THZ A;  4X65 O;  1D2D A;  5LMN O;  1ZX3 A;  1IZ3 A;  1S5H C;  5AG2 A;  3OGI B;  4ZKI A;  1MG1 A;  2LGW A;  4WFF A;  3C90 A;  3QO7 A;  2DW4 A;  3JAT B;  1K8A W;  4LFC B;  1Q82 W;  3SGI A;  1GTO A;  2JS5 A;  1M9N A;  4J9Y B;  3LDC A;  1R3L C;  1KEC A;  1RP3 B;  2ODM A;  5EIB D;  2QR4 A;  1KC8 W;  1OCC C;  2A3Q A;  4K0K B;  1OJH A;  3ZHV A;  1XMQ O;  2P6J A;  2IH1 C;  4FFB A;  4LF6 B;  3J7A U;  4YXW G;  1QHT A;  2GSM B;  1AP6 A;  4OX9 O;  1NVP D;  3OW2 U;  3ML0 A;  2ADP A;  3FFQ A;  3B40 A;  3CD6 V;  3ETE A;  5LA6 B;  4DYL A;  1FFX A;  5LGU A;  2R72 A;  1KB9 F;  2MW2 B;  4XDK A;  1HR0 O;  4JI2 O;  4JGS A;  2R9R B;  2CTQ A;  1N32 B;  1VQ4 V;  4RUF A;  1EZJ A;  1GO3 F;  2HKO A;  2JGU A;  4XBF A;  3RYF A;  2ZM6 O;  4B7E A;  2N05 A;  2QE7 G;  3BCC H;  5JH7 B;  4X20 B;  4DV4 O;  5JQG B;  4XDJ A;  2RN9 A;  3BAB A;  2ZR3 A;  2XHB A;  1N0J A;  1FJG O;  1VF5 B;  3EXA A;  3ETD A;  1JVM A;  2DE0 X;  4AIL C;  5B5E Z;  1ZL8 A;  4X1K A;  3JAR B;  2YSU B;  4UFZ A;  1AIL A;  1K4D C;  3ZRS A;  1Z5W A;  4DR5 B;  2WLL A;  1CEZ A;  5IYZ A;  5JJJ B;  1HP8 A;  3AG1 C;  2DOS A;  3OTF A;  2E74 B;  4N23 A;  5KA5 A;  4U3J B;  3CEI A;  4TV8 B;  5B1A B;  2YIB A;  4K35 A;  2R9I A;  3RGB A;  4JI5 O;  2K1E A;  3BY6 A;  3E2E A;  5KHI A;  1K9M W;  2YI9 A;  2OTL V;  1RPO A;  3T1H B;  4U7N A;  5BR8 B;  3RYH B;  4LFC O;  4WFE A;  1R3J C;  1PL4 A;  2PF4 E;  3L72 H;  4YJ3 A;  3CCU V;  1MSD A;  2LW1 A;  5J9P C;  3H1I H;  3A2F A;  2Z5U A;  1Q6H A;  1JFF A;  4PI0 A;  4Z1V A;  1COW G;  3JYC A;  3E8B A;  2ITC C;  4K0K O;  4DV0 B;  3OD4 A;  3P32 A;  4B3R B;  4FPP A;  2Y4T A;  1U97 A;  4NXM O;  2E5L B;  4A5U B;  1R6T A;  2DYS B;  3E83 A;  4X1I B;  4UCO A;  1N34 O;  1VQ9 V;  3WB0 A;  4F4L A;  2E75 B;  2WLI B;  3JAS A;  3OEH G;  4JI8 B;  5B3S C;  4GT1 A;  4LH7 A;  2DMX A;  1J5E B;  1OCR C;  5CBF A;  4YY3 B;  1ZAU A;  1GRJ A;  4B08 A;  1N8R W;  3THO A;  1WLE A;  5FNV A;  3ETQ A;  4JI6 B;  4GX5 A;  4QNH B;  2Q7H A;  1EN5 A;  1WNS A;  1H38 A;  2LFR A;  1I7F A;  2EIJ B;  3N2K B;  4AQY O;  2IU0 A;  2E3C A;  3AK1 A;  4NTX A;  1N4C A;  3CMA V;  5HFL A;  3WU2 Z;  1QR9 A;  2XAJ A;  4FMT A;  5L3E A;  1TVK B;  2QKA A;  2WA3 A;  2VQF B;  1Y67 A;  4H0L B;  4DR6 B;  1PPJ H;  4LR3 A;  3AG2 C;  5LMU B;  2FML A;  1M4U A;  4DV7 B;  4DR2 B;  4ICG A;  4PI2 A;  2RNB A;  5LHH A;  3DTU B;  5H2F Z;  4DR7 O;  5L3B A;  1H2S B;  1TUB B;  5EBW C;  4WBN A;  1NVP B;  3VQY A;  1FFT B;  4LNU B;  1V54 B;  4WCE V;  4W4L A;  1M1K W;  2Y69 B;  3BFR A;  3TK1 A;  3ZHR A;  1M56 B;  3LDE A;  4FVM A;  3B4S A;  3B8M A;  4O2B A;  3HKE A;  4EEQ A;  5EK0 A;  3T1H O;  4X64 B;  3P3P A;  4GKJ B;  2A79 B;  3H1J H;  2Q7E A;  1JA8 A;  1T5E A;  2XOK G;  5KUK A;  3SYP A;  4BIU A;  5LL6 Y;  1PM9 A;  3ZRW B;  3GB7 C;  5IE9 A;  1B04 A;  3G4S V;  4IL6 Z;  4MTO A;  3WFV A;  3A0H Z;  2KB1 A;  3OTO O;  1PL0 A;  2P90 A;  2XUM A;  2Q69 A;  4JI4 O;  1NQT A;  2ZIO A;  4J7Z A;  5KAI Z;  5LP6 A;  3E89 A;  1OHH G;  5KHH A;  3ABU A;  4BIZ A;  1WAZ A;  2F93 B;  2E5L O;  2AHY A;  2IJJ A;  3SPG A;  4DV1 O;  5C8Y B;  1BS3 A;  1K33 A;  3IGA C;  4FZ0 A;  2QTO A;  4DW1 A;  1Q86 W;  2YIC A;  4JPR A;  3HKD A;  1B6Q A;  2HHH O;  5B1N A;  2WA4 A;  3UT5 A;  3FAV A;  4E4E A;  4YY3 O;  3UQ8 A;  1FXV A;  1GMG A;  1TAE A;  1Z2G A;  2Y48 A;  4NKG B;  1SQB H;  1SZX A;  2UXC B;  2EIM B;  3AG3 C;  1AI6 A;  3B2E E;  2E76 B;  2Q8V A;  4K8Z A;  4LF4 B;  2CTW A;  2F66 C;  2X6B A;  3UO2 A;  2ITD C;  4DW0 A;  1XL6 A;  4GYC B;  4I55 A;  3CRQ A;  5LMU O;  3L70 H;  4J42 A;  2KSD A;  2EIN B;  4P2Z A;  2IJK A;  3DC5 A;  4DR2 O;  3GVM A;  4LF9 B;  2L35 A;  3J80 N;  5LHG A;  1J95 A;  4WF9 V;  1H8H G;  4TV9 A;  3R65 A;  4GX1 A;  4LFA B;  1SRY A;  2DYR C;  2KG7 B;  3GWO A;  4UV8 A;  5CBH A;  4OPH A;  5IYB O;  2HP8 A;  1JPX A;  4I0X A;  3BPZ A;  4I4T A;  2QSA A;  4H37 A;  1QU7 A;  1VQO V;  1YCI A;  4JYC A;  5DN6 G;  3BEH A;  4O4L B;  5JJE B;  3OUS A;  4BIO A;  4EFE A;  1R3I C;  3K5M A;  4YHH B;  5GON A;  3CCQ V;  2ZXW C;  4JYB A;  5CA1 A;  4MSW C;  2W0X A;  4UVB A;  3APQ A;  1B3Q A;  2EBO A;  1L1F A;  2RQ6 A;  1JJO A;  3JCU Z;  4GKJ O;  3TXQ A;  2XT9 A;  2WAM A;  2KQX A;  3U11 A;  2NR5 A;  4F6R A;  1OCC B;  3RYC A;  4LF7 B;  1S77 D;  3HR0 A;  3MAQ A;  3EVK A;  4JYY A;  5FPR A;  1P84 F;  2CE4 A;  1ZTE A;  1AI5 A;  1QCE A;  3U10 A;  5A9G A;  2BSK A;  3KG2 A;  3TCU A;  1XNQ O;  2GUZ A;  4B3M B;  4LF8 O;  2QJ1 A;  1WA8 B;  1NT2 B;  1PKX A;  5A2Q N;  1GM9 A;  3L73 H;  3CXC U;  1Q43 A;  4EFB A;  4FLZ A;  2IJI A;  3ABT A;  3OR6 C;  2F43 G;  2R70 A;  4CS2 A;  1OCZ C;  2QTS A;  5CMU A;  1XUQ A;  4DV2 B;  4LF4 O;  4LWS B;  4RQE A;  4AI8 A;  2YC0 A;  4J80 A;  1B06 A;  2PI5 A;  2JK5 C;  3SPI A;  4CC5 A;  1HNZ B;  2RDC A;  3LSU A;  4G2K A;  1GM8 A;  3MHS C;  3JAT A;  1KQS U;  3CCM V;  1RSO A;  4O4H B;  3AG1 B;  2UUC O;  5LXT B;  2JRI A;  4KHP O;  4CBC A;  1FXH A;  2G38 A;  1NH2 B;  3OUF A;  3ABL C;  2LO1 A;  4LFA O;  4WFH A;  2F1M A;  3B8N A;  1NBM G;  1AB3 A;  1AR1 B;  1H2G A;  1SER A;  3X2Q C;  1VQ6 V;  5D5Q A;  3ZED A;  4I7Z B;  1NTK H;  1R3K C;  2UXX A;  3RT3 C;  1LUW A;  4Q6G A;  4DV6 B;  1FKA O;  4IYH A;  3DXR B;  4MVS A;  3HKC A;  1E1R G;  3QNE A;  1AR4 A;  4LFB B;  1E79 G;  4MTG A;  4JI1 B;  4FJC C;  2OT5 A;  5JVD B;  2GTA A;  5LA6 A;  4LCU C;  2JJ1 G;  3D36 A;  1VF7 A;  3T4Z A;  2QEX V;  4TSF G;  2FL4 A;  2ZNJ A;  4H44 B;  5EBL C;  4QJF B;  1HNW B;  1R1B A;  2F4V B;  2DWE C;  4DV3 B;  2YXH A;  3W7U A;  4FLU A;  1M57 C;  3ABM B;  1VQP V;  4CS4 A;  3Q4H B;  1OCR B;  4TT3 G;  1BT8 A;  1BSM A;  5GW7 A;  3IFX A;  5FPO A;  3CP1 A;  2ZE7 A;  2W6I G;  4X8A A;  3I5D A;  1QVG U;  1HNX O;  4PJ0 Z;  4TQF A;  2A7W A;  3E22 B;  3TGU H;  3B77 A;  3CB2 A;  3BVO A;  5D5P A;  3CE2 A;  4DV2 O;  1WB8 A;  1I94 B;  1S5L Z;  1Q81 W;  2GV9 A;  3AG2 B;  1HNZ O;  4FLW A;  5BY1 A;  4JF3 A;  4Z2W A;  3RWR D;  4IIJ B;  3RYI A;  1RM1 C;  3RYH A;  2LQT A;  2CTR A;  3JD4 A;  4B3S B;  1PD3 A;  3JD3 A;  3N2G B;  3OFN G;  1VIB A;  4TQD A;  1PP9 H;  5CA3 A;  1AI7 A;  3O65 A;  1WN7 A;  3NXS A;  1XEQ A;  2B9Z A;  2YDE A;  3KCX A;  2PTM A;  5J2U B;  5LOV B;  4HBN A;  2ZT9 B;  2IW5 A;  4P9P A;  1NZ6 A;  1JR9 A;  2QM4 A;  3ZHQ A;  4LF5 B;  1FAF A;  2ETN A;  1KYO F;  1VMG A;  1KKC A;  1JMK C;  2ZD9 A;  1K34 A;  4X1I A;  2W0F C;  2P7T C;  4RO2 A;  5JCO A;  1N33 O;  3FB5 C;  5KUM A;  3W7X A;  4B7K A;  3ZN1 A;  3I56 V;  3AG4 C;  4PA4 A;  5IY5 C;  1SQG A;  2LFS A;  4TOI A;  4GKK O;  3MD0 A;  2O57 A;  3L9D A;  3SYC A;  3K04 A;  3TJT A;  2PY5 A;  4D6T H;  2QWR B;  3LSS A;  3K57 A;  4QE7 A;  1FXK A;  1AJQ A;  1N36 B;  3LSQ A;  5LYJ A;  1QQC A;  3K5O A;  5CB4 A;  4B3T O;  3K9S A;  3F7Y C;  1GK9 A;  3JAL B;  4J7J A;  3LUT B;  4IYI A;  3AG3 B;  4J7K A;  1US6 A;  3E86 A;  1DK1 A;  5LP6 C;  1E1Q G;  5LGN A;  1TUB A;  2VWJ A;  3F5T A;  1SA0 B;  4HAM A;  3ASN C;  1K73 W;  2P67 A;  4I9W A;  2Q7G A;  4U7O A;  1JQ0 A;  4NTY A;  1NR7 A;  1MOF A;  4O4J B;  3VBB A;  1XNR B;  3CME V;  3QO8 A;  3S3X A;  4ZI7 A;  1XOU A;  3H1K H;  3OR7 C;  1HDJ A;  2QM7 A;  3QG5 A;  1NR1 A;  4FIP C;  4OXS A;  4YJ2 B;  4ZHQ B;  4B3S O;  3HKB A;  2UU9 B;  1GKF A;  5KMG B;  5IJ9 B;  5DEC A;  5B1B C;  1XRE A;  4X1Y B; 
#chains in the Genus database with same CATH homology
 4MTO A;  3WFV A;  2H94 A;  3HPL C;  2KB1 A;  4QE9 A;  1PL0 A;  2P90 A;  3MHH C;  1GM7 A;  2Q69 A;  4E2L A;  1NQT A;  3CCS V;  2OCC B;  3E89 A;  1OHH G;  4UXN A;  3ABU A;  2ZXW B;  4BIZ A;  1DF5 A;  2AHY A;  5C93 A;  2EIN C;  2EIJ C;  2IJJ A;  2XAF A;  3SPG A;  4DO2 A;  3PJS K;  1ZWI C;  3E35 A;  2WLN A;  1K33 A;  3ZRV A;  3IGA C;  1KKD A;  3QO5 A;  4P9O A;  2QTO A;  1Q86 W;  3JD2 A;  4JPR A;  1B6Q A;  1QLE C;  1G8M A;  3K0D A;  4GX0 A;  5B1N A;  2JEU A;  5HFM A;  3CCJ V;  4DXW A;  5L3F A;  1FXV A;  1GMG A;  2Y48 A;  2IH3 C;  1AI4 A;  2EZO A;  5FL7 G;  2Q6A A;  2EIM B;  4G28 B;  2BOB C;  3AG3 C;  3OEE G;  1AI6 A;  1JJ2 U;  2WLI A;  4HYO A;  4HZ3 A;  2XAQ A;  1Q7Y W;  1QBZ A;  1K7D A;  5B1B B;  1I5Y A;  2X6B A;  4RQF A;  4PDR A;  2ITD C;  4QPK A;  2QM8 A;  3ZMU A;  1V54 C;  1XL6 A;  2HVK C;  1YTF D;  1VQL V;  1K92 A;  2Y69 C;  4PA7 A;  3K79 A;  2IJH A;  4UVA A;  1ARO P;  4R7C A;  3OGC C;  2EIN B;  4P2Z A;  1OCO C;  2IJK A;  2WLK A;  4JTA B;  1OCZ B;  2QA4 V;  4PDM A;  2EIL C;  5LHG A;  1J95 A;  2EIK B;  3H01 A;  4WF9 V;  1DLB A;  4X88 A;  4MVO A;  1H8H G;  3RVZ A;  1WPX A;  3R65 A;  4GX1 A;  1SRY A;  2DYR C;  3GWO A;  4MW8 A;  4UV8 A;  3SYO A;  5CBH A;  4PDV A;  3RW0 A;  5IYB O;  4MVZ A;  1JPX A;  3CYO A;  3FYE B;  3M99 B;  1P7B A;  1DF4 A;  4MVQ A;  3STL C;  4H37 A;  3I55 V;  4KUM A;  1VQO V;  2JEX A;  5DN6 G;  4JYC A;  3BEH A;  2OCC C;  1YI2 V;  3OUS A;  1JOY A;  1R3I C;  2UXN A;  4LBE C;  4ASU G;  5LGT A;  3G71 V;  3ZJZ A;  3CCQ V;  4MT8 A;  2ZXW C;  4JYB A;  1VQN V;  1YTF B;  4MSW C;  4UVB A;  2EBO A;  1L1F A;  1SZT A;  1HWY A;  2WAM A;  4PA9 A;  1AJN A;  1F23 A;  5IYD O;  4FK5 C;  3FKS G;  3CC7 V;  1YIJ V;  1OCC B;  4J9Z B;  1ENV A;  1W0J G;  3T2M A;  1M90 W;  1ROP A;  2A9H A;  4QIW F;  1S77 D;  3ZMV A;  3CPW U;  3CCL V;  2WSS G;  2B5U A;  4MW3 A;  4BAY A;  3X2Q B;  1YHQ V;  2EIM C;  2X6A A;  2DWD C;  2YEV A;  3DGE A;  1AI5 A;  2FTK A;  2XAG A;  1QCE A;  1XL4 A;  5EBM C;  4BW5 A;  1NJI W;  3OMA B;  4R50 A;  3KG2 A;  3TCU A;  4MVU A;  2WLL B;  5H6Q A;  2DYR B;  1W2B U;  2ZDI C;  4PDL A;  3ZRW A;  2EZP A;  4X89 A;  1PKX A;  4KP4 A;  1GM9 A;  3CXC U;  2PI4 A;  4Q20 A;  1K97 A;  4KFM A;  3K9A A;  4Z1M G;  1F4M A;  2Q68 A;  2IJI A;  3ABT A;  3K08 A;  1KD1 W;  3W7S A;  2X7R B;  3OR6 C;  1BL8 A;  1TUE B;  4GX2 A;  2F43 G;  1MSW D;  2B1G A;  4WFG A;  1NH2 D;  1Y4M A;  1VQM V;  1OCZ C;  2WLH A;  4L87 A;  1S0V A;  1THZ A;  4PEL A;  4JTD B;  5CMU A;  1JX9 A;  3SPH A;  2EIK C;  3E8H A;  4RUE A;  1M57 B;  1KP2 A;  5L3C A;  3IC7 A;  4RQE A;  1R6N A;  1S5H C;  2HG5 C;  2XAS A;  3F7V C;  2JK5 C;  2PI5 A;  3SPI A;  4ZKI A;  1MG1 A;  4WFF A;  2WPD G;  5LBQ A;  4TWK A;  3QO7 A;  4G2K A;  1GM8 A;  2DW4 A;  3MHS C;  4XDL A;  3W7T A;  2HVJ C;  1K8A W;  1KQS U;  2C2A A;  3K3W A;  3CCM V;  1FS0 G;  1Q82 W;  1H8E G;  2ZDI A;  3ZMZ A;  1GTO A;  1P4R A;  3AG1 B;  5CN0 A;  1M9N A;  4JAV A;  4J9Y B;  3LDC A;  3TET A;  1R3L C;  1KEC A;  1CPY A;  4CBC A;  1FXH A;  4PA3 A;  4CZZ A;  1NH2 B;  3OUF A;  3ABL C;  1S3J A;  1KC8 W;  3LNM B;  1OCC C;  4WFH A;  3ABM C;  5H6R A;  1K5S A;  3B8N A;  4RAI A;  1NBM G;  1AR1 B;  1H2G A;  5H9C A;  1SER A;  3X2Q C;  1VQ8 V;  1K3E A;  1VQ6 V;  3ZN0 A;  5L3G A;  3SJQ C;  3CCE V;  2P6J A;  1R3K C;  2UXX A;  2IH1 C;  3ZIA G;  1RM1 B;  4YXW G;  3UKM A;  2GSM B;  4R8C A;  3OMN B;  1K4C C;  4MVS A;  3ZMS A;  1NVP D;  3OW2 U;  1RPR A;  2XAH A;  1E1R G;  3QNE A;  3OE7 G;  2CK3 G;  1E79 G;  3ML0 A;  3UM7 A;  4MS2 A;  4P30 A;  1PNK A;  4MTG A;  3CD6 V;  3ETE A;  2OT5 A;  4FJC C;  1QLN A;  1KP3 A;  1YSC A;  5LGU A;  3ZMT A;  1FXK B;  4LCU C;  4XDK A;  1AJP A;  2JJ1 G;  3D36 A;  3T4Z A;  2QEX V;  4TSF G;  2AHZ A;  4JGS A;  2R9R B;  3K03 A;  1VQ4 V;  4G27 B;  4N21 A;  4RUF A;  5EBL C;  1EZJ A;  1YJN V;  1GO3 F;  4QJF B;  3T4D A;  2HKO A;  4MVM A;  4XBF A;  3D3I A;  3W7W A;  2DWE C;  2GHY A;  2QE7 G;  3ABL B;  2WLJ A;  3W7U A;  1MAB G;  4MTF A;  4QPJ A;  3K0G A;  1M57 C;  1S76 D;  1JCH A;  4XDJ A;  4UVC A;  2QKS A;  3ABM B;  1IXM A;  1VQP V;  2ZR3 A;  2V1D A;  5CBG A;  3EFF K;  1OCR B;  4TT3 G;  4ZBM A;  3RBZ A;  3SYQ A;  5GW7 A;  2HFE C;  2B1I A;  3IFX A;  5B1O A;  3ETD A;  5IY5 B;  1JVM A;  1VQ5 V;  3CP1 A;  2W6I G;  3LDD A;  2YSU B;  5IYC O;  4X8A A;  1K4D C;  3ZRS A;  2WLL A;  3STZ C;  1YJ9 V;  1QVG U;  2HJF C;  1CEZ A;  1F4N A;  3CCR V;  3RVY A;  3CC2 V;  3AG1 C;  4EKW A;  3WG7 B;  3ZCC A;  3OMI B;  3B77 A;  4N23 A;  5EC2 C;  5KA5 A;  2LP7 A;  2H8P C;  4PA6 A;  5B1A B;  3AEI A;  3ASO B;  4JTC B;  2NLJ C;  2OTJ V;  2R9I A;  1K5Q A;  1Q81 W;  3ABK B;  2A0L A;  3F5W C;  3AG2 B;  2K1E A;  1BHA A;  3BY6 A;  3VOU A;  3E2E A;  1VQK V;  1W0K G;  4JF3 A;  1K9M W;  2OTL V;  1RPO A;  1BHB A;  4MVR A;  3JCZ A;  4U7N A;  2ATK C;  2JIZ G;  1RM1 C;  4WFE A;  1R3J C;  3FB8 C;  3T1C A;  2NNU A;  3JD1 A;  3JD4 A;  3CCU V;  1PD3 A;  3JD3 A;  3OFN G;  5CA3 A;  1AI7 A;  2X6C A;  5J9P C;  3NXS A;  3ASN B;  3CCV V;  4LC1 A;  2Z5U A;  3E8G A;  1OZ0 A;  4UUJ C;  1FXK C;  2ZQM A;  1COW G;  1S72 V;  3CC4 V;  3JYC A;  4WFB V;  1ORQ C;  2WLM A;  2IW5 A;  3FB6 C;  4P9P A;  2WWW A;  3SPJ A;  3E8B A;  2ITC C;  3P32 A;  4FPP A;  1EBO A;  5BZB A;  2DYS B;  1R73 A;  3E83 A;  2ZD9 A;  1K34 A;  3HB3 B;  1VQ9 V;  2Q67 A;  2W0F C;  4F4L A;  1EFR G;  2P7T C;  2WLI B;  2X0L A;  4RO2 A;  3OEH G;  4JAS A;  5B3S C;  1NKD A;  3FB5 C;  4GT1 A;  5KUM A;  5LHI A;  3W7X A;  3ZN1 A;  1SET A;  3I56 V;  2Z3Y A;  1G4Y B;  1OCR C;  1V55 B;  5CBF A;  4I5S A;  2EJR A;  1QR8 A;  4R6Z A;  2M7W A;  3AG4 C;  3ETG A;  4PA4 A;  5IY5 C;  1N8R W;  2LFS A;  1WLE A;  5IDJ A;  3MD0 A;  4GX5 A;  5L3D A;  3SYA A;  4QNH B;  1H38 A;  3SYC A;  1M56 C;  3K04 A;  4JAU A;  2LFR A;  1I5X A;  5E1A C;  2EIJ B;  3WG7 C;  2XND G;  1SES A;  2IU0 A;  3LSS A;  3FB7 C;  5KA6 A;  1BMF G;  4LP8 A;  4QE7 A;  3CMA V;  1FXK A;  5B1A C;  5HFL A;  3ASO C;  1QR9 A;  2XAJ A;  1AJQ A;  4FMT A;  2IU3 A;  4H33 A;  5L3E A;  2D3O W;  1QLE B;  3LSQ A;  3G6E V;  2W6J G;  3FYI B;  4WFA V;  3ABK C;  3AG2 C;  3F7Y C;  3E8F A;  2JDI G;  3JD0 A;  1GK9 A;  2V7Q G;  1YIT V;  1LNQ A;  2DQ3 A;  3LUT B;  4GCZ A;  1UJW B;  3AG3 B;  1Y66 A;  3E86 A;  5LHH A;  3DTU B;  4UV9 A;  5B3S B;  3OAA G;  1E1Q G;  1PNL A;  5L3B A;  5LGN A;  5EBW C;  1VQ7 V;  2BOC C;  1R6K A;  2HR3 A;  3AG4 B;  4MTX A;  3EHB B;  4HAM A;  1NVP B;  3ASN C;  1K73 W;  1FFT B;  2P67 A;  3SPC A;  4I9W A;  4U7O A;  1V54 B;  4WCE V;  1M1K W;  1F51 A;  1JQ0 A;  3A0R A;  2ZR2 A;  2Y69 B;  3P30 A;  1NR7 A;  1MOF A;  3TK1 A;  3VBB A;  1M56 B;  1PNM A;  3LDE A;  1DTO A;  3CME V;  3B8M A;  3QO8 A;  5EC1 C;  1OCO B;  1QVF U;  2DYS C;  5EK0 A;  1CP9 A;  3OR7 C;  2A79 B;  2EIL B;  2YEV B;  2QM7 A;  1NR1 A;  3K06 A;  3OM3 B;  4FIP C;  4OXS A;  2XOK G;  5KUK A;  2DQ0 A;  3SYP A;  1YJW V;  4BIU A;  1GKF A;  5DM6 V;  1V55 C;  3ZRW B;  2MK3 A;  3GB7 C;  3ZRX A;  5B1B C;  3G4S V;  2JJ2 G;  2HLD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...