4H37A

Crystal structure of a voltage-gated k+ channel pore domain in a closed state in lipid membranes
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
NGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2059 protein
publication title Crystal Structure of a Voltage-gated K+ Channel Pore Module in a Closed State in Lipid Membranes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Membrane protein
total genus 24
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4h37A00
2EIMC 4MVMA 3IGAC 3OUSA 1K4CC 4LBEC 3ABMC 4QE7A 5B1AC 3E8FA 2K1EA 3OUFA 4JTCB 5EBLC 5KUMA 3SPGA 1K4DC 4X89A 2WLNA 4LP8A 1JVMA 3HPLC 4HYOA 1R3JC 4MW3A 3SPJA 3OR6C 4WFEA 4GX0A 3F7YC 3F7VC 3K0GA 1OCCC 3LUTB 3SPCA 1LNQA 2EILC 2Q6AA 2WLMA 2HFEC 4J9ZB 4RAIA 2EIKC 5EBWC 5EBMC 4EKWA 2AHYA 4MW8A 4WFFA 3SJQC 5CBGA 2QTOA 3E8HA 4H37A 2HG5C 2QKSA 4MTFA 3TETA 2P7TC 3RW0A 2WLIB 3SYOA 4PA9A 2HVKC 1S5HC 5CBFA 4R6ZA 3SYAA 2KB1A 2WLIA 3T4ZA 4MVOA 1R3KC 3SYQA 1V54C 2EINC 3FB7C 2AHZA 4BW5A 3JYCA 2X6CA 3TCUA 2HJFC 2NLJC 1OCOC 2R9RB 3E8BA 4I9WA 4X8AA 4MVQA 4CBCA 5EC2C 2YEVA 4H33A 3RVZA 4PDMA 3SPHA 3SPIA 3E83A 3GB7C 2JK5C 1M57C 2EIJC 1R3LC 4PA4A 4OXSA 3OR7C 3K04A 5BZBA 4XDKA 3IFXA 2IH1C 1M56C 3F5WC 3RBZA 1P7BA 4LCUC 2ITDC 5EC1C 2A9HA 3LDEA 4MVUA 3SYCA 2W0FC 2ITCC 5B3SC 4DXWA 5CBHA 2OCCC 4PA3A 2WLLB 2ZXWC 3KG2A 3K08A 3X2QC 4UUJC 3UKMA 3AG3C 3AG2C 3EFFK 4X88A 3ZRSA 2BOCC 3UM7A 1XL4A 4QNHB 4RO2A 2WLJA 4MS2A 3STZC 3E8GA 2ZD9A 1V55C 4JTAB 3FB5C 2WLKA 4MVSA 4WFGA 4WFHA 4MVZA 4PDVA 3OGCC 2Y69C 1ORQC 3LDDA 3VOUA 1XL6A 3BEHA 4ZBMA 3T1CA 2A79B 1R3IC 2BOBC 4HZ3A 4MTOA 4F4LA 4R7CA 4XDJA 2X6BA 3PJSK 4QE9A 2H8PC 5B1BC 4P9OA 4G28B 4GX2A 4TWKA 3FB8C 4XDLA 2X6AA 1J95A 5E1AC 5KUKA 2Q69A 2DWDC 4PA7A 1QLEC 4RUFA 1OCRC 3ASNC 4R50A 3T2MA 2IH3C 2WLHA 4GX1A 3K0DA 5EK0A 3R65A 1BL8A 4MTGA 5J9PC 4G27B 3ABLC 2WLLA 2DYRC 3E89A 3WG7C 4P30A 3T4DA 4J9YB 3STLC 2HVJC 5IY5C 3AG4C 4MVRA 3ASOC 3K06A 4P2ZA 2DWEC 3RVYA 3ABKC 1OCZC 4PA6A 4PDLA 4R8CA 3FB6C 2A0LA 2ATKC 4RUEA 3K03A 2DYSC 4GX5A 3LDCA 1KKDA 3AG1C 1ZWIC 4JTDB 4PDRA 3ZJZA 3SYPA 3E86A 4KFMA 3LNMB 4P9PA 4MSWC 2Q68A 2Q67A 1G4YB
chains in the Genus database with same CATH superfamily
1MMMA 1KP2A 4DR5B 4UCRA 1BMFG 4X89A 2QSAA 3HPLC 2VQFO 3OR6C 2IJKA 2P67A 4LH6A 3PN1A 4RQEA 2PY5A 5JQGB 3D36A 2P90A 4J9ZB 4U3JA 1N34B 1VQNV 3ABKB 2F66C 5KHIA 5LYJB 1Q81W 3CWBH 4DV0B 4D6TH 5GW7A 3CCJV 4Z1MG 2AGAA 2OYQA 3ZN0A 3IC9A 3B09A 3ABMB 4PDMA 1MZFA 1DTOA 1FD9A 1CEZA 3SDLA 4CS2A 3WU2Z 1IBLB 1M56C 1NJIW 2YC0A 1V9PA 2WLLB 3IJ4A 4LFAO 3N2KB 3D36C 1XL4A 1QR9A 1ZAUA 3FKSG 2LW7A 4ABMA 2PI5A 4HNAB 2EINB 2QTSA 2KQXA 2XAQA 1XMQO 3KKYA 3OGCC 1UFIA 4DV4O 2OTJV 5IYBO 1IXMA 1TUEB 1SRYA 2LW1A 4HZ3A 4X66B 1N4CA 4O4IB 3VBBA 5HFMA 4OPAA 2W0XA 3W7SA 1S0VA 3J7AU 2ZR2A 1FXKB 2VQEB 4MTGA 5H6RA 1YSCA 2WLLA 3AG2B 1Q7YW 3P30A 3N2KA 4I0XB 2ZM6B 1IZ3A 1PKXA 3ABKC 5IWAO 1DK1A 4HNAA 1NQTA 3T1HB 4CS3A 3JD4A 4WBNA 2JGUA 4P9PA 4O4IA 2YS8A 3CXHF 5IJ0B 4LBEC 3ABMC 4QE7A 2UUBB 4LF4O 1FXKA 2YIBA 3F7YC 1OZ0A 5K1PA 1IX9A 3TETA 1S76D 2YDEA 2ZE8A 4X65O 1EBOA 3C3TA 4PV1B 2WLIA 2MW2B 3H1LH 1R3KC 5LXTB 2EINC 2QM4A 3BRCA 5IJ0A 5BXZA 4FVMA 2R9RB 1BS3A 1LR1A 3KCXA 4ZHQB 4JI8B 2Y48A 1P7BA 2BTOA 4X62B 1JJOA 5BY1A 1FXKC 3JARB 4DUYO 5CN0A 1GH6A 3D8CA 3AG2C 2PYJA 1K97A 5LXTA 2X7RB 1OJHA 1S3JA 3HKCB 4F6RB 1N34O 1VQ9V 1M4UA 3FX7A 2CGOA 5C8YB 3T1YB 4IIJA 3P3NA 4DUZB 4CC5A 2IH3C 1YF2A 4DV1B 1W0KG 1KMIZ 3ZHRA 3CHXA 2EJ7A 5FL7G 2WWWA 4JI5O 4LH7A 4BIOA 2YI8A 4P2ZA 3J80N 1TGOA 4R8CA 1IURA 1IBLO 2FL4A 1RP3B 1AJPA 1K92A 1M93A 3CYOA 3W7TA 1Q5OA 3HKCA 4CZZA 4F6RA 3E22B 5LBQA 1N8RW 2YXYA 1B04A 4IGGA 5B1OA 5C8YA 2E75B 4A5UB 3OUFA 1JR9A 1NVPB 5JJNB 1AP5A 1YI2V 3ZHUA 3LUTB 1JCHA 3OMIB 5DECA 2Q6AA 3JCUZ 4QIWF 4UFZA 4E4EA 3QO7A 4DR3B 3UQ8A 3UO2A 2AZ0A 1FFXB 1M90W 3LSSA 2P4KA 2HVKC 1H38A 4R6ZA 3JSLA 2VQEO 3E22A 3RGBA 1YJ9V 2UUCB 4X64B 1EM1A 3A0BZ 1Q6UA 4DK1A 2P06A 3F5WC 3P32A 1AI5A 4JZ2A 5LL6Y 2W0FC 2ITCC 1D2DA 2NR5A 3B8MA 4BR6A 1GN3A 1XEQA 2QWRB 2K9PA 1KC8W 1Y74B 1FFXA 3CXCU 4PD4F 1WPBA 1ZTEA 1ORQC 1Y76B 1I5YA 2QWQB 4UVCA 3UT5A 2EIJB 2YIAA 2ZNIA 3DXRB 3SJAC 3DC6A 4DW1A 1NR7A 4JI3B 4JAUA 5EK0A 3D3QA 1ZUQA 3ZBHA 4N21A 1V54B 4DV3O 1Y74A 1Q6IA 4MVRA 3L75H 4JI8O 1AR5A 1PNMA 1MSDA 5J2TB 5A2QN 4B3SB 2UU9B 1Y76A 1QU7A 3DXRA 3BVOA 1PNKA 2FMLA 5L3CA 2L6LA 5IE9A 3AK2A 4BIUA 4FIPC 2EILC 2OIEA 1ZX3A 3ASOB 3CE2A 2AHYA 1SF9A 2HG5C 4I5SA 3RW0A 2RNBA 3T1YO 2IBZH 1JFFB 2Z5UA 5JWPA 4DV7B 4DV1O 3OW2U 3SYQA 2XASA 3UCSC 3FYEB 3ZN1A 3SPHA 3QNEA 5LMUO 2EIJC 2UXBB 2OCHA 3OGIB 5EIBD 4YJ3B 2OIGA 2IH1C 1SC5B 4QPJA 4FFKA 2ZQMA 3CRQA 4FLYA 1XUQA 5L3FA 3KG2A 2QKCA 3B8NA 4NTYA 3UM7A 1GN2A 4MS2A 1S5JA 4MVSA 3DSQA 3CC4V 3M8AA 4PJ0Z 1VEWA 2EULA 2CTPA 4DR3O 3CCEV 5K1XA 4B3MO 1KYOF 1VQ7V 3ZRXA 1VQMV 4PI2A 4YJ3A 2GBOA 4RUFA 4ZIBA 1WLEA 4O4JB 3CCUV 1SS3A 3K0DA 2ADQB 2X0LA 2UUCO 2OTLV 1HWYA 2JDIG 4K8ZA 1GK9A 2QWPB 2QM8A 3ASOC 3K06A 4CS4A 4X64O 1F7YA 3CRMA 2YICA 1GTOA 4GKJB 3L74H 1XNQB 2PTMA 1TAEA 2LO1A 4LFCB 1IBKO 3OUSA 4LFBB 3K5NA 2DW4A 4I50B 1K4DC 2F1MA 3OD4A 4LP8A 1VIBA 1RPOA 4O4JA 4PELA 3F7VC 4TUYA 1SA0A 2Q9LA 2HFEC 5EBMC 1KD1W 2JVDA 4I7ZB 2QKSA 1VQKV 1MG1A 3H1HH 5IDJA 4PA9A 4JI6B 3BABA 2H94A 4U7OA 4D7TA 2FB5A 4UCUA 5B1AB 3G80A 3OEEG 2CTWA 2KG7A 1XMQB 4I50A 1UPGA 3GB7C 3JALB 4TT3G 4DV4B 2ODMA 1H2SB 4FPPA 1GO3F 2DOSA 3JASB 5IY5B 2RN9A 4WFBV 3RYFB 4B3SO 2UU9O 1JMKC 4DR1B 3ZX6A 1WA8A 1XDCA 2BOCC 2P6JA 5GTIZ 4YJ2B 5L3GA 3QF7A 5KHKA 5C93A 2DQ0A 3ETQA 1H8EG 3LDDA 2XUMA 4AQYO 3H1IH 1MNGA 1YVWA 2DQ3A 1K3EA 4U7NA 2NNUA 3JALA 3FB8C 3JASA 1WP7A 1H2MA 3MHSC 4PA7A 3RYFA 4ZI7B 5E79Z 4B7KA 1AJQA 4AILC 4DV7O 1NH2B 3E89A 4Z2WA 5JJJB 4LF8B 2B9ZA 4YJ2A 3KCYA 2YSUB 1KKDA 2DYSC 1ZWIC 1BZKA 3OMNB 3B77A 4FJCC 1B06A 4ZOLB 4ICGA 4UCTA 4LR3A 5CA0B 4X65B 1AROP 3IGAC 5B1AC 3SPGA 5EBLC 4Z1VA 4J41A 1WB7A 1KBHA 4GX0A 3N2GB 3JSNA 1RSOA 1OHHG 3VQVA 1K34A 2VWJA 1HDJA 3E8HA 2Z0AA 5AG2A 4FM2A 2R72A 4ZOLA 3E35A 2AHZA 4BW9A 3JYCA 5CA0A 2W6IG 4I9WA 2D3OW 3W7WA 4MVQA 3RYIA 4TSFG 1VMGA 5EIBC 2JK5C 4NVPA 4FLUA 4H13B 3N2GA 1VQOV 5EC1C 3ZS8C 4DRXA 4MVUA 5KA5A 4GKJO 1XNQO 2C2AA 4LFCO 2XAGA 4LFBO 4K3AA 1Q86W 3ZEDA 1O9HA 1MSWD 2YXLA 4JI5B 2WLKA 4WFGA 2ZIOA 1YTFB 1W2BU 1TVKB 4UV9A 3IAYA 4UCVA 1KQSU 1UJWB 4UCOA 1GN4A 4TWKA 3WB1A 3CD6V 1SKVA 2QE7G 3CRCA 4JI6O 3M99B 3ZMTA 3N27A 4I9QA 3VQXA 4LF7O 4WBNB 5JH7A 1XMOB 1FFTB 3K03A 1AVMA 3ZJZA 5D5PA 1JOYA 1TVKA 4KFMA 2Q68A 4DR1O 3KZIZ 4K35A 1IDSA 4EEQA 2ADPA 1MZEA 4JI4O 2CGNA 5JVDB 5L3EA 1E79G 4K0KO 3U0ZA 1F4MA 4UVAA 2IU3A 1VQ5V 2XHBA 5EBWC 4EKWA 1EZJA 4D7SA 4UCSA 3ETEA 4CC6A 1FPOA 2Y0IA 2WLIB 4RWUA 4FLVA 1XOUA 3CCVV 4KUMA 5GONB 5CA3A 5JJEB 3G6BA 3HKDB 3L70H 4CBCA 2N04A 3J81N 5CB4B 4LF8O 1PD3A 3E83A 5JVDA 2JGDB 3JAKB 4OXSA 1Y6XA 5B5EZ 3CCRV 5B66Z 5L3BA 2PI4A 3ZMVA 4DXWA 1P7GA 2OCCC 1SQFA 4KXRA 2YUAA 4O2BB 2B1IA 2VRZA 1KU9A 3UKMA 2GDSA 1YHQV 2Y0PA 1YZBA 3LSQA 4DV3B 5H6QA 2ETNA 3EVKA 4TQFA 5GONA 4MTOA 3HKDA 1PPJH 3A0HZ 1SQQH 1OV9A 2WPDG 5CB4A 1VARA 2RCVA 4IIJB 2FYUH 3JD0A 2JGDA 4PHZA 1QHTA 3ZRWB 3VQWA 3JAKA 1GM8A 2KSDA 1CPYA 1ZL8B 3DTUB 2WLHA 1U97A 1VF5B 4O2BA 1FXVA 4TQDA 2Y4TA 1PM9A 4UB6Z 3LDCA 1THZA 1NTZH 3MD0A 1I0HA 2X6BA 4G2KA 3ZRWA 3THOA 2M7WA 2CH7B 2K1EA 5KUMA 4YIOA 2PZSA 2WLNA 2JJ2G 4O2AA 1ZL8A 3HKEB 3OT7A 3WG7B 3CC2V 4DR7B 3DC5A 4FFBB 5LMUB 2EIKC 3C3SA 3SJQC 1OCZB 1L1FA 4H37A 1BGYH 5H5NA 2P7TC 4FLZA 1Y66A 2XAFA 4IL6Z 3NR7A 3H9VA 2JEUA 4DK0A 3BY6A 5J2UB 4H33A 3RVZA 2CH7A 3K5OA 1M57C 4CH4A 1XMOO 4K8XA 3CEIA 3W7UA 1WNSA 2ARHA 3HKEA 3RBZA 2A9HA 1HR0B 4FFBA 4L8JA 4B3MB 1WP8A 4GT1A 2VS0A 2UXDB 5LGTA 3OEHG 2XNDG 4KHPO 1IVSA 3ZRSA 2B5UA 4DR4B 2QWOB 3STZC 1WB8A 1D5NA 1N33B 2UXCO 1S5LZ 1FAFA 3UT5B 3VOUA 3OFNG 5DM6V 5J2UA 2H8PC 4JI2O 2ZE5A 1AI4A 2EILB 4U3FH 2HKOA 4FLWA 1VQPV 4R50A 5B1NA 2ZXWB 1IBKB 3FAVB 3ZHQA 3GWOA 3WG7C 4J9YB 1H2GA 3RVYA 2DWEC 1OCZC 4PA6A 1E1RG 3U11A 3CCMV 1NTKH 4X9QA 4WCEV 1W59A 4FLTA 4MSWC 4O4LA 1K4CC 4DR2O 3RT3C 3TJTA 3CB2A 2Q0OC 3SPJA 3RN4A 3ABLB 3ZHTA 1GAXA 1PP9H 1XQ8A 3FAVA 4RAIA 4RQFA 4XBFA 2P4VA 2ZIMA 3Q4HB 4J7JA 1ROPA 1M1KW 5DEDA 1MOFA 2A06H 3ETDA 3GVMA 2G38A 5D5QA 2RQ6A 3TCUA 2IU0A 3ZMZA 4AI8A 3C90A 1SQGA 2RMKB 3A8TA 4CH6A 3QO8A 4AQYB 4LCUC 2RDCA 3ICXA 2D2CB 1AR1B 3SYCA 2LP7A 5B3SC 4PA3A 4JZGA 2ZXWC 5ITZA 3Q4HA 3AG3C 4X88A 4CH5A 3SJBC 2GHYA 2MK3A 4RO2A 3GWKC 2QGNA 2BSKB 1SESA 1V55C 4JTAB 1QVFU 3FFQA 2JRIA 1OCOB 4DR7O 3T1CA 3H01A 3CCQV 2LQTA 4R7CA 5DN6G 3S3WA 2O57A 1HNZB 5E1AC 2LJ2A 1NR1A 4YHHB 3T2MA 3G71V 1QVGU 1F51A 3ABLC 4LF5O 2XTAA 2AXTZ 2ZT9B 5LOVB 3LSUA 1H2KA 2HLDG 2QR4A 5FNVB 2XT9A 4JYAO 2BSKA 2DN9A 3R66A 1EN5A 1K8AW 3ZCCA 2ZCEA 1HR0O 4JAAA 4NR1A 3I56V 2UXDO 4GKKO 3CMAV 1I94O 2UUAO 3K57A 3E8FA 4W4KA 1JQ0A 4TUYB 4YXWG 4DR4O 1N33O 1SA0B 3ETGA 1Y67A 2F23A 1DF4A 1SZTA 2R9IA 2CK3G 2WLMA 3SR2C 5LOVA 4OGQB 4JI1O 5FNVA 2WA4A 3ABTA 3AG1B 1X59A 1R6NA 3OAAG 3H1JH 1K33A 2KG7B 1F4NA 2B1GA 4WFAV 1VQ6V 1K5SA 1OCOC 3E8BA 1RFYA 4AHCA 2KKWA 3SPIA 4L87A 1KUQA 1R73A 3ABUA 1LUVA 2HP8A 4HAMA 1AILA 1WA8B 2DYSB 1VF7A 1XNRB 4H44B 2IM9A 4JI7O 1H8HG 3EFFK 1G8MA 1Q3EA 2GTAA 2E5LO 2ZD9A 1AR4A 4MVZA 4LF7B 2EZPA 5EZYB 2F4VO 1R3IC 4GLXA 1KB9F 4B3RB 5IT9N 1N32B 4P9OA 4ZKIA 3G67A 4LNUB 1EN4A 3ZHVA 1J95A 1FJGO 1YCIA 4IT5A 1IBMO 3FYIB 3IC7A 1SERA 2JS5A 4JI4B 2AZ2A 1KECA 5H9CA 5LA6B 5KHJA 1NT2B 4K0KB 1BSMA 1I5XA 2A0LA 4TV9B 4DV6B 3JCZA 3AG1C 5EZYA 1HNXB 4KP4A 1KP3A 1D5AA 1G4YB 1GM7A 3ML0A 2IJHA 4LNUA 1EFRG 4JTCB 1RSOB 4EFEA 1R3JC 4MW3A 1VQLV 1YEWA 3JD3A 2ZE6A 3F5TA 5BMVB 5LA6A 4NTXA 1QR8A 5CBGA 1U96A 3B2EE 5IYDO 3TXSA 1HNZO 1NBMG 1BCCH 4TV9A 4W4LA 1Y4MA 3S3XA 5CBFA 4YHHO 1Q90D 4MVOA 3RYIB 4JV5B 2JEXA 4LWSA 4X8AA 1MA1A 2CAZC 2A7WA 3VQYA 4DRXB 1TA8A 3OR7C 5CA1B 4H0LB 5BMVA 1WJZA 5KX5B 3X2QC 5FPRA 5EYPB 3U10A 1R1BA 3FB5C 2YIDA 4LC1A 4NXMO 2Q7GA 1QNMA 4ZBMA 1K5QA 2QJ1A 4DV5B 2FTKA 4QE9A 3BFRA 3K58A 2ZNJA 4XDLA 5KLVH 1BQZA 2HR3A 3BA9A 5CA1A 4J11A 3JAMN 1AI6A 1Q8IA 3BA8A 5KX5A 1PV0A 5JH7B 1GKFA 2Q4PA 5EYPA 1AI7A 2CE4A 1DF5A 4B7EA 2Q7EA 1K9MW 2Q73A 3BCCH 5FLXN 4LF6B 1BHBA 3K79A 4NXNB 3LNMB 1XNRO 3O65A 1FYJA 2PYLA 1I08A 2OCCB 3ASNB 4DO2A 4JYYA 3CP1A 1N36B 1GRJA 4KL1A 3CRAA 3AG4B 5JCOA 4B3RO 1N32O 5JQGA 2EBOA 4GUNA 4MTFA 3CMEV 4TV8B 5IYCO 1ZSPA 3SYOA 5LYJA 2KB1A 4KHPB 2DYRB 2BTQB 2EIMB 2NLJC 2RJZA 2UXCB 3G6EV 1QLNA 4B08A 1OCCB 2PGGA 5LMNO 3IFXA 4JI2B 4DV6O 1HNXO 1NKDA 4FZ0A 4DR6O 2IJIA 1X4TA 4TV8A 3W7XA 2WLJA 4JPRA 5JCOC 1NVPD 3E2EA 2Q8VA 1US6A 2IJJA 2V1DA 1ENVA 4PDVA 2GSMB 2BTQA 3UO3A 2ILMA 5H2FZ 4NB5A 4XDJA 4G28B 2BCCH 2EIKB 2DWDC 2E76B 3RYHB 3ASNC 4LF9O 4PI0A 1XHXA 3ZHSA 4BAYA 5LP6B 4DR2B 3OMAB 4JV5O 5BR8B 2N05A 2HVJC 2VWKA 3AG4C 2Z3YA 3L73H 4J7ZA 3OTOO 1JX9A 3TK1A 4I0XA 2ATKC 4RUEA 2EZOA 5LGNA 2QEXV 1FS0G 1M9NA 1M57B 2WSSG 1GMGA 3HR0A 2UXXA 4OPHA 1HNWO 1EN6A 1EZVH 1FXHA 2DYRC 3ZIAG 2EIMC 4O2AB 2YEVB 2H3OA 4TOIA 3RYHA 2V4DA 1O9GA 1L0NH 5LP6A 1OCCC 1J5EB 4QJFB 1XI1A 4DV5O 1VQ8V 4MW8A 4OX9B 1Q82W 1H2NA 1URFA 2E74B 2JJ1G 4UVBA 4FLXA 3WFVA 1XREA 3CPWU 4DR5O 3T4ZA 4J7KA 4UV8A 1PL0A 3EXAA 2YEVA 2F93B 2Y4UA 2PUSA 3OM3B 1R3LC 1YITV 4X1KB 1GN6A 1WPXA 4ZHQA 1Z5VA 5LGUA 2OWOA 2QDOA 2GUZB 2P22C 1SETA 4EB6B 3K9AA 4LF6O 4NYKA 4DV0O 4JYCA 4NXNO 1YXBA 1QCEA 4F6EA 5LP6C 3L9DA 5KMGB 3O9OA 3CCLV 3JARA 1IXBA 1VF6A 4LF5B 3E8GA 4WFHA 3NXSA 4B3TB 1QQCA 1N36O 4JYAB 5IYZB 3A0RA 2LFRA 4MT8A 4X1KA 1NS1A 2L35A 1RM1B 4YY3B 2GUZA 3G4SV 4GKKB 3JATB 4EB6A 4CH3A 3R65A 2Q7HA 5J9PC 1I94B 2UUAB 2EJRA 4J80A 5IJ9B 5KMGA 2LFSA 3B40A 3JD2A 4HBNA 4C7UA 2F95B 3SJCC 4X66O 4PDLA 2Y69B 2P5OA 2PF4E 4GX5A 3K59A 4O4LB 3LNNA 4Q20A 4JI1B 1VF6C 3SYPA 3ZMSA 5IYZA 4N23A 1DGSA 5B3SB 1SQBH 4NKGB 3AK3A 3CRRA 2HHHB 3ZRVA 3WB0A 1P84F 3K3WA 4X1IB 3AG3B 2LGQA 3JATA 3K5LA 4WFEA 2ZM6O 2F43G 2OT5A 4X1YB 1V55B 3SPCA 5IJ9A 3T1HO 4NTWA 5FPOA 4DYLA 4MTXA 4QGPA 3CCSV 1VP7A 2YXHA 1S5HC 4JI7B 4I4TB 3FB7C 1XHZA 2UUBO 1S77D 1LUWA 1L8DA 2X6CA 5BR8O 2E5LB 5EC2C 3HB3B 4X1IA 5L3DA 2F4VB 4O4HB 1MABG 4X1YA 4JAVA 5ITZB 3LDEA 5GTHZ 1RM1C 5LHIA 3P3PA 5HFLA 4JI0B 4IYHA 2DE0X 4GYCB 5KA6A 3FD9A 1FJGB 4UUJC 1IBMB 1H2LA 2ZE7A 3TGUH 3EHBB 4QNHB 5LHGA 4JYBA 3I55V 1KKCA 5KHHA 5A9GA 1M5IA 1BE3H 4I4TA 2Y69C 1J5EO 1CXZB 2BOBC 2HEPA 4OX9O 4QPKA 3MHHC 4X62O 1HP8A 4O4HA 4BIZA 3APOA 1F23A 1JJ2U 5KUKA 1NU1H 3A2FA 1XBLA 1BL8A 2UXNA 1SZXA 1Q43A 3JAWB 4P30A 3T4DA 2R9AA 3AG7A 3I5DA 2XAHA 4FM1A 3OTFA 1Z5WA 1ZLZA 3HKBB 3FB6C 4GCZA 4DW0A 2JS3A 4ASUG 3DGEA 3CX5F 4PDRA 1N0JA 1AJNA 4DUZO 2Q67A 2CUGA 5J2TA 4MVMA 1QLEB 1CP9A 4FK5C 1JVMA 3AK1A 4B3TO 3QO5A 3K0GA 1RPRA 1W0JG 1T5EA 2XAJA 4IHJB 3JAWA 2M6YA 4FMTA 3K5MA 3RWRD 2QTOA 4E2LA 1XILA 3HKBA 4UXNA 4YY3O 1YDXA 1NH2D 2QWNB 1V54C 1JFFA 4BW5A 2JIZG 3MDSA 3BAAA 1WN7A 2V7QG 2DJVA 1AB3A 3AEIA 4NXMB 4X20B 1QBZA 3APQA 5BZBA 4XDKA 2DMXA 1VQ4V 2ZR3A 2ITDC 4DV2B 2QM7A 4IHJA 2N74A 5KAIZ 1NI8A 1B6QA 4JF3A 1TUBB 2HHHO 1P4RA 2LGWA 2VQFB 2AW9A 3BEHA 4FM0A 4F4LA 1AP6A 1Q6HA 3PJSK 3D3IA 4GX2A 4X20A 2Q0AA 1JPXA 1QLEC 3JD1A 1P49A 1R6TA 1YJWV 1G6UA 3H1KH 4G27B 5CMUA 2IW5A 3BPZA 4YIPA 1TUBA 3STLC 1FKAO 2CTQA 2GTSA 1I7FA 1R6KA 2ZDIA 3WB2A 2HJDA 1Z2GA 2R70A 1L0LH 2E3CA 5B1BB 3CS5A 3L72H 1SQVH 2XOKG 2ZINA 3MAQA 4J42A 3OE7G 3ZMUA 4JI0O 5LHHA 1NTMH 4JI3O 4LFAB 1OCRB 4GZRB 3X2QB 3SGIA 2W6JG 4HYOA 2ZKOA 3L71H 4Q6GA 3TXQA 1YTFD 3CC7V 1LNQA 3QG5A 2WAMA 4IYIA 4WFFA 5LMNB 1G1XB 3QTCA 1BT8A 5TISZ 4DR6B 3SYAA 1N0NA 4LWSB 2ZDIC 4JASA 1A32A 1E1QG 1S72V 1K7DA 2HJFC 5KAFZ 5IWAB 3RYCB 1YJNV 4PA4A 3K04A 2NN4A 1PL4A 1YIJV 4I55B 1SQPH 1COWG 3K9SA 1BQ0A 3M7MX 5CBHA 4J10A 3K08A 1JA8A 4WF9V 3CSXA 1BHAA 4LF9B 1K73W 1SQXH 2YIBD 4EFBA 1DLBA 2QA4V 2QKAA 2BE3A 4LF4B 2EX3A 3CJHB 1XL6A 4UB8Z 2UXBO 2A3QA 2A79B 1NZ6A 3OTOB 1PNLA 3QVNA 5B1BC 5KHGA 3RFRA 3RYCA 1M56B 2X6AA 1HNWB 2CTRA 4FZ1A 2Q69A 2WA3A 1OCRC 3B4SA 4I55A 4GX1A 2Q5ZA 4ZI7A 4U3JB 5IY5C 1HW7A 4BWAA 5F2VO 2YI9A 2GV9A 3CJHA 1GM9A 4JTDB 2FKXA 4JGSA 1WAZA 4DV2O 3E86A 2CDYA 3BHPA 4DUYB 1B3QA
chains in the Genus database with same CATH topology
3ZIAG 1KP2A 2EIMC 3OUSA 1K4CC 2YEVB 1BMFG 2DW4A 1K4DC 4X89A 4LP8A 3HPLC 3SPJA 1RPOA 3ABLB 3OR6C 2IJKA 2P67A 4PELA 3F7VC 1OCCC 4RQEA 4QJFB 3D36A 2P90A 2HFEC 4J9ZB 4RAIA 4RQFA 5EBMC 1KD1W 4MW8A 1VQ8V 1VQNV 3ABKB 4XBFA 2QKSA 1M1KW 1VQKV 1ROPA 1Q81W 1Q82W 1MG1A 2JJ1G 4UVBA 1MOFA 3ETDA 3WFVA 5IDJA 4PA9A 5GW7A 3CCJV 3CPWU 4Z1MG 3T4ZA 2H94A 4U7OA 3ZN0A 4UV8A 1PL0A 5B1AB 3OEEG 3ABMB 3TCUA 2IU0A 3ZMZA 2YEVA 4PDMA 1DTOA 3GB7C 4TT3G 3OM3B 1CEZA 4FPPA 1R3LC 1GO3F 3QO8A 1YITV 5IY5B 1WPXA 5LGUA 1M56C 4WFBV 4LCUC 1AR1B 1NJIW 1SETA 3K9AA 3SYCA 2LP7A 5B3SC 4JYCA 4PA3A 1QCEA 2WLLB 2ZXWC 3AG3C 4X88A 3CCLV 2BOCC 1XL4A 1QR9A 2GHYA 2MK3A 3FKSG 4RO2A 2PI5A 2P6JA 3E8GA 1SESA 1V55C 2EINB 4JTAB 5L3GA 1QVFU 4WFHA 2XAQA 3NXSA 5C93A 2DQ0A 3OGCC 1OCOB 1H8EG 3LDDA 5IYBO 2OTJV 3T1CA 1IXMA 1TUEB 1SRYA 3H01A 3CCQV 4HZ3A 4R7CA 3A0RA 2LFRA 2DQ3A 5DN6G 1K3EA 4U7NA 2NNUA 3VBBA 3FB8C 4MT8A 5HFMA 5E1AC 3MHSC 1RM1B 4PA7A 3W7SA 1NR1A 3G4SV 1S0VA 1AJQA 3T2MA 2ZR2A 1FXKB 3G71V 3R65A 1NH2B 4MTGA 5H6RA 1YSCA 5J9PC 1QVGU 1F51A 2EJRA 2WLLA 3ABLC 3AG2B 3E89A 1Q7YW 3P30A 2LFSA 3JD2A 2HLDG 1PKXA 3ABKC 4PDLA 1NQTA 2Y69B 3JD4A 2YSUB 1KKDA 2DYSC 4GX5A 1K8AW 3ZCCA 1ZWIC 4Q20A 3OMNB 3B77A 3SYPA 4FJCC 3ZMSA 4P9PA 3I56V 4N23A 5B3SB 3CMAV 1AROP 3IGAC 5B1AC 4LBEC 3ABMC 4QE7A 3ZRVA 3E8FA 3SPGA 5EBLC 1JQ0A 3K3WA 4YXWG 3AG3B 3ETGA 1FXKA 4WFEA 4GX0A 2F43G 3F7YC 2OT5A 1DF4A 1SZTA 1OHHG 2R9IA 2CK3G 1V55B 3SPCA 1OZ0A 2WLMA 1K34A 3E8HA 4MTXA 3CCSV 3ABTA 3TETA 1S76D 3AG1B 1R6NA 1S5HC 3OAAG 1EBOA 2WLIA 1R3KC 2EINC 3E35A 1K33A 2AHZA 3FB7C 1S77D 1F4NA 2B1GA 4WFAV 1VQ6V 1K5SA 2X6CA 3JYCA 2W6IG 1OCOC 2R9RB 3E8BA 4I9WA 3W7WA 4MVQA 2D3OW 5EC2C 4TSFG 4L87A 3SPIA 3HB3B 2JK5C 5L3DA 1MABG 1R73A 1VQOV 2Y48A 3ABUA 1P7BA 4JAVA 5EC1C 3LDEA 4HAMA 4MVUA 1RM1C 5LHIA 2DYSB 5KA5A 5HFLA 1FXKC 2C2AA 5CN0A 5KA6A 4UUJC 3AG2C 1H8HG 3EFFK 3EHBB 1G8MA 2XAGA 1Q86W 4QNHB 5LHGA 4JYBA 3I55V 1MSWD 1K97A 2ZD9A 2WLKA 4WFGA 4MVZA 2Y69C 2EZPA 2X7RB 1YTFB 1S3JA 1R3IC 2BOBC 1W2BU 4UV9A 1KQSU 4QPKA 1UJWB 1VQ9V 3MHHC 4P9OA 4TWKA 4ZKIA 4BIZA 1JJ2U 1F23A 1J95A 3CD6V 5KUKA 2QE7G 3FYIB 2IH3C 3M99B 3IC7A 1W0KG 1SERA 5FL7G 3ZMTA 1BL8A 2WWWA 1KECA 2UXNA 5H9CA 4P30A 3T4DA 4P2ZA 2XAHA 4R8CA 1I5XA 4GCZA 3FB6C 2A0LA 1FFTB 3K03A 3JCZA 4ASUG 1AJPA 1K92A 3AG1C 3DGEA 3CYOA 4PDRA 3ZJZA 4KP4A 3W7TA 1JOYA 4KFMA 4CZZA 1AJNA 1KP3A 5LBQA 1N8RW 2Q68A 2Q67A 1G4YB 5B1OA 1GM7A 3ML0A 2IJHA 4MVMA 1QLEB 1CP9A 1EFRG 4JTCB 3OUFA 4FK5C 5L3EA 1NVPB 1JVMA 1R3JC 4MW3A 1E79G 1VQLV 1F4MA 3QO5A 3K0GA 1YI2V 4UVAA 2IU3A 1RPRA 3JD3A 1JCHA 1W0JG 3LUTB 3OMIB 1VQ5V 2Q6AA 2XAJA 1QR8A 4QIWF 4FMTA 5EBWC 4EKWA 1EZJA 5CBGA 2QTOA 3QO7A 3ETEA 4E2LA 5IYDO 1NBMG 2WLIB 1M90W 3LSSA 4UXNA 1Y4MA 2HVKC 1H38A 5CBFA 4R6ZA 4MVOA 3CCVV 1NH2D 1V54C 4KUMA 1YJ9V 5CA3A 4BW5A 2JIZG 2JEXA 4X8AA 4CBCA 2V7QG 1PD3A 3E83A 3AEIA 4OXSA 3OR7C 1QBZA 5BZBA 4XDKA 3F5WC 1VQ4V 2ZR3A 3P32A 3CCRV 2ITDC 1AI5A 2QM7A 2W0FC 2ITCC 5L3BA 2PI4A 3B8MA 3ZMVA 4DXWA 2OCCC 2B1IA 3X2QC 3UKMA 1B6QA 4JF3A 1YHQV 1KC8W 3LSQA 1P4RA 3CXCU 3FB5C 5H6QA 4LC1A 1ORQC 3BEHA 4ZBMA 1K5QA 4F4LA 4MTOA 2FTKA 4QE9A 3PJSK 1I5YA 4UVCA 2WPDG 2EIJB 3D3IA 3JD0A 4GX2A 4XDLA 3ZRWB 2HR3A 1JPXA 1GM8A 1QLEC 1NR7A 3JD1A 1CPYA 1AI6A 1YJWV 3DTUB 2WLHA 4JAUA 5EK0A 4G27B 1FXVA 1GKFA 5CMUA 2IW5A 4N21A 1V54B 3STLC 4MVRA 1R6KA 1AI7A 2ZDIA 1DF5A 1K9MW 3LDCA 1PNMA 1THZA 5B1BB 2XOKG 3K79A 1BHBA 3LNMB 3MD0A 3ZMUA 3OE7G 2X6BA 5LHHA 4G2KA 3ZRWA 2OCCB 1OCRB 3ASNB 2M7WA 2K1EA 5KUMA 3X2QB 4DO2A 2WLNA 1PNKA 2W6JG 5L3CA 2JJ2G 4HYOA 3CP1A 3WG7B 3CC2V 4BIUA 1YTFD 4FIPC 3CC7V 1LNQA 2EILC 3AG4B 2EIKC 2WAMA 3ASOB 2AHYA 3SJQC 4WFFA 1OCZB 1L1FA 2EBOA 4H37A 2HG5C 4MTFA 4I5SA 3CMEV 5IYCO 2P7TC 3RW0A 1Y66A 3SYOA 2XAFA 2Z5UA 3SYAA 2KB1A 3OW2U 2DYRB 2ZDIC 4JASA 3SYQA 2JEUA 1E1QG 2XASA 1S72V 2EIMB 3BY6A 1K7DA 2HJFC 2NLJC 3FYEB 4H33A 3ZN1A 3RVZA 3G6EV 1QLNA 3SPHA 3QNEA 1M57C 2EIJC 1YJNV 3W7UA 4PA4A 1OCCB 3K04A 3IFXA 2IH1C 4QPJA 3RBZA 2ZQMA 1YIJV 2A9HA 1COWG 5L3FA 4GT1A 5CBHA 1NKDA 3KG2A 2IJIA 3K08A 3OEHG 5LGTA 2XNDG 4WF9V 1BHAA 3B8NA 1K73W 3W7XA 3ZRSA 1DLBA 2B5UA 3UM7A 2QA4V 2WLJA 4JPRA 4MS2A 1NVPD 3E2EA 3STZC 4MVSA 2IJJA 2V1DA 1ENVA 4PDVA 2GSMB 3VOUA 3CC4V 1XL6A 2A79B 1PNLA 3OFNG 4XDJA 5DM6V 5B1BC 2H8PC 1AI4A 2EILB 4G28B 3CCEV 2EIKB 1M56B 2X6AA 1VQ7V 2HKOA 3ZRXA 1VQMV 2Q69A 2DWDC 4RUFA 1OCRC 3ASNC 1VQPV 4R50A 5B1NA 1WLEA 2ZXWB 3CCUV 4GX1A 3K0DA 4BAYA 2X0LA 3OMAB 2OTLV 1HWYA 2JDIG 3GWOA 3WG7C 4J9YB 2HVJC 1H2GA 1GK9A 5IY5C 3AG4C 2QM8A 2Z3YA 3ASOC 3K06A 2DWEC 3RVYA 1OCZC 1JX9A 4PA6A 3TK1A 2QEXV 2ATKC 4RUEA 1E1RG 2EZOA 5LGNA 1FS0G 1M9NA 1M57B 2WSSG 1GTOA 1GMGA 3CCMV 1GM9A 4JTDB 4JGSA 2UXXA 4WCEV 3E86A 4MSWC 1FXHA 2DYRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIM C;  4MVM A;  3IGA C;  3OUS A;  1K4C C;  4LBE C;  3ABM C;  4QE7 A;  5B1A C;  3E8F A;  2K1E A;  3OUF A;  4JTC B;  5EBL C;  5KUM A;  3SPG A;  1K4D C;  4X89 A;  2WLN A;  4LP8 A;  1JVM A;  3HPL C;  4HYO A;  1R3J C;  4MW3 A;  3SPJ A;  3OR6 C;  4WFE A;  4GX0 A;  3F7Y C;  3F7V C;  3K0G A;  1OCC C;  3LUT B;  3SPC A;  1LNQ A;  2EIL C;  2Q6A A;  2WLM A;  2HFE C;  4J9Z B;  4RAI A;  2EIK C;  5EBW C;  5EBM C;  4EKW A;  2AHY A;  4MW8 A;  4WFF A;  3SJQ C;  5CBG A;  2QTO A;  3E8H A;  4H37 A;  2HG5 C;  2QKS A;  4MTF A;  3TET A;  2P7T C;  3RW0 A;  2WLI B;  3SYO A;  4PA9 A;  2HVK C;  1S5H C;  5CBF A;  4R6Z A;  3SYA A;  2KB1 A;  2WLI A;  3T4Z A;  4MVO A;  1R3K C;  3SYQ A;  1V54 C;  2EIN C;  3FB7 C;  2AHZ A;  4BW5 A;  3JYC A;  2X6C A;  3TCU A;  2HJF C;  2NLJ C;  1OCO C;  2R9R B;  3E8B A;  4I9W A;  4X8A A;  4MVQ A;  4CBC A;  5EC2 C;  2YEV A;  4H33 A;  3RVZ A;  4PDM A;  3SPH A;  3SPI A;  3E83 A;  3GB7 C;  2JK5 C;  1M57 C;  2EIJ C;  1R3L C;  4PA4 A;  4OXS A;  3OR7 C;  3K04 A;  5BZB A;  4XDK A;  3IFX A;  2IH1 C;  1M56 C;  3F5W C;  3RBZ A;  1P7B A;  4LCU C;  2ITD C;  5EC1 C;  2A9H A;  3LDE A;  4MVU A;  3SYC A;  2W0F C;  2ITC C;  5B3S C;  4DXW A;  5CBH A;  2OCC C;  4PA3 A;  2WLL B;  2ZXW C;  3KG2 A;  3K08 A;  3X2Q C;  4UUJ C;  3UKM A;  3AG3 C;  3AG2 C;  3EFF K;  4X88 A;  3ZRS A;  2BOC C;  3UM7 A;  1XL4 A;  4QNH B;  4RO2 A;  2WLJ A;  4MS2 A;  3STZ C;  3E8G A;  2ZD9 A;  1V55 C;  4JTA B;  3FB5 C;  2WLK A;  4MVS A;  4WFG A;  4WFH A;  4MVZ A;  4PDV A;  3OGC C;  2Y69 C;  1ORQ C;  3LDD A;  3VOU A;  1XL6 A;  3BEH A;  4ZBM A;  3T1C A;  2A79 B;  1R3I C;  2BOB C;  4HZ3 A;  4MTO A;  4F4L A;  4R7C A;  4XDJ A;  2X6B A;  3PJS K;  4QE9 A;  2H8P C;  5B1B C;  4P9O A;  4G28 B;  4GX2 A;  4TWK A;  3FB8 C;  4XDL A;  2X6A A;  1J95 A;  5E1A C;  5KUK A;  2Q69 A;  2DWD C;  4PA7 A;  1QLE C;  4RUF A;  1OCR C;  3ASN C;  4R50 A;  3T2M A;  2IH3 C;  2WLH A;  4GX1 A;  3K0D A;  5EK0 A;  3R65 A;  1BL8 A;  4MTG A;  5J9P C;  4G27 B;  3ABL C;  2WLL A;  2DYR C;  3E89 A;  3WG7 C;  4P30 A;  3T4D A;  4J9Y B;  3STL C;  2HVJ C;  5IY5 C;  3AG4 C;  4MVR A;  3ASO C;  3K06 A;  4P2Z A;  2DWE C;  3RVY A;  3ABK C;  1OCZ C;  4PA6 A;  4PDL A;  4R8C A;  3FB6 C;  2A0L A;  2ATK C;  4RUE A;  3K03 A;  2DYS C;  4GX5 A;  3LDC A;  1KKD A;  3AG1 C;  1ZWI C;  4JTD B;  4PDR A;  3ZJZ A;  3SYP A;  3E86 A;  4KFM A;  3LNM B;  4P9P A;  4MSW C;  2Q68 A;  2Q67 A;  1G4Y B; 
#chains in the Genus database with same CATH topology
 1MMM A;  1KP2 A;  4DR5 B;  4UCR A;  1BMF G;  4X89 A;  2QSA A;  3HPL C;  2VQF O;  3OR6 C;  2IJK A;  2P67 A;  4LH6 A;  3PN1 A;  4RQE A;  2PY5 A;  5JQG B;  3D36 A;  2P90 A;  4J9Z B;  4U3J A;  1N34 B;  1VQN V;  3ABK B;  2F66 C;  5KHI A;  5LYJ B;  1Q81 W;  3CWB H;  4DV0 B;  4D6T H;  5GW7 A;  3CCJ V;  4Z1M G;  2AGA A;  2OYQ A;  3ZN0 A;  3IC9 A;  3B09 A;  3ABM B;  4PDM A;  1MZF A;  1DTO A;  1FD9 A;  1CEZ A;  3SDL A;  4CS2 A;  3WU2 Z;  1IBL B;  1M56 C;  1NJI W;  2YC0 A;  1V9P A;  2WLL B;  3IJ4 A;  4LFA O;  3N2K B;  3D36 C;  1XL4 A;  1QR9 A;  1ZAU A;  3FKS G;  2LW7 A;  4ABM A;  2PI5 A;  4HNA B;  2EIN B;  2QTS A;  2KQX A;  2XAQ A;  1XMQ O;  3KKY A;  3OGC C;  1UFI A;  4DV4 O;  2OTJ V;  5IYB O;  1IXM A;  1TUE B;  1SRY A;  2LW1 A;  4HZ3 A;  4X66 B;  1N4C A;  4O4I B;  3VBB A;  5HFM A;  4OPA A;  2W0X A;  3W7S A;  1S0V A;  3J7A U;  2ZR2 A;  1FXK B;  2VQE B;  4MTG A;  5H6R A;  1YSC A;  2WLL A;  3AG2 B;  1Q7Y W;  3P30 A;  3N2K A;  4I0X B;  2ZM6 B;  1IZ3 A;  1PKX A;  3ABK C;  5IWA O;  1DK1 A;  4HNA A;  1NQT A;  3T1H B;  4CS3 A;  3JD4 A;  4WBN A;  2JGU A;  4P9P A;  4O4I A;  2YS8 A;  3CXH F;  5IJ0 B;  4LBE C;  3ABM C;  4QE7 A;  2UUB B;  4LF4 O;  1FXK A;  2YIB A;  3F7Y C;  1OZ0 A;  5K1P A;  1IX9 A;  3TET A;  1S76 D;  2YDE A;  2ZE8 A;  4X65 O;  1EBO A;  3C3T A;  4PV1 B;  2WLI A;  2MW2 B;  3H1L H;  1R3K C;  5LXT B;  2EIN C;  2QM4 A;  3BRC A;  5IJ0 A;  5BXZ A;  4FVM A;  2R9R B;  1BS3 A;  1LR1 A;  3KCX A;  4ZHQ B;  4JI8 B;  2Y48 A;  1P7B A;  2BTO A;  4X62 B;  1JJO A;  5BY1 A;  1FXK C;  3JAR B;  4DUY O;  5CN0 A;  1GH6 A;  3D8C A;  3AG2 C;  2PYJ A;  1K97 A;  5LXT A;  2X7R B;  1OJH A;  1S3J A;  3HKC B;  4F6R B;  1N34 O;  1VQ9 V;  1M4U A;  3FX7 A;  2CGO A;  5C8Y B;  3T1Y B;  4IIJ A;  3P3N A;  4DUZ B;  4CC5 A;  2IH3 C;  1YF2 A;  4DV1 B;  1W0K G;  1KMI Z;  3ZHR A;  3CHX A;  2EJ7 A;  5FL7 G;  2WWW A;  4JI5 O;  4LH7 A;  4BIO A;  2YI8 A;  4P2Z A;  3J80 N;  1TGO A;  4R8C A;  1IUR A;  1IBL O;  2FL4 A;  1RP3 B;  1AJP A;  1K92 A;  1M93 A;  3CYO A;  3W7T A;  1Q5O A;  3HKC A;  4CZZ A;  4F6R A;  3E22 B;  5LBQ A;  1N8R W;  2YXY A;  1B04 A;  4IGG A;  5B1O A;  5C8Y A;  2E75 B;  4A5U B;  3OUF A;  1JR9 A;  1NVP B;  5JJN B;  1AP5 A;  1YI2 V;  3ZHU A;  3LUT B;  1JCH A;  3OMI B;  5DEC A;  2Q6A A;  3JCU Z;  4QIW F;  4UFZ A;  4E4E A;  3QO7 A;  4DR3 B;  3UQ8 A;  3UO2 A;  2AZ0 A;  1FFX B;  1M90 W;  3LSS A;  2P4K A;  2HVK C;  1H38 A;  4R6Z A;  3JSL A;  2VQE O;  3E22 A;  3RGB A;  1YJ9 V;  2UUC B;  4X64 B;  1EM1 A;  3A0B Z;  1Q6U A;  4DK1 A;  2P06 A;  3F5W C;  3P32 A;  1AI5 A;  4JZ2 A;  5LL6 Y;  2W0F C;  2ITC C;  1D2D A;  2NR5 A;  3B8M A;  4BR6 A;  1GN3 A;  1XEQ A;  2QWR B;  2K9P A;  1KC8 W;  1Y74 B;  1FFX A;  3CXC U;  4PD4 F;  1WPB A;  1ZTE A;  1ORQ C;  1Y76 B;  1I5Y A;  2QWQ B;  4UVC A;  3UT5 A;  2EIJ B;  2YIA A;  2ZNI A;  3DXR B;  3SJA C;  3DC6 A;  4DW1 A;  1NR7 A;  4JI3 B;  4JAU A;  5EK0 A;  3D3Q A;  1ZUQ A;  3ZBH A;  4N21 A;  1V54 B;  4DV3 O;  1Y74 A;  1Q6I A;  4MVR A;  3L75 H;  4JI8 O;  1AR5 A;  1PNM A;  1MSD A;  5J2T B;  5A2Q N;  4B3S B;  2UU9 B;  1Y76 A;  1QU7 A;  3DXR A;  3BVO A;  1PNK A;  2FML A;  5L3C A;  2L6L A;  5IE9 A;  3AK2 A;  4BIU A;  4FIP C;  2EIL C;  2OIE A;  1ZX3 A;  3ASO B;  3CE2 A;  2AHY A;  1SF9 A;  2HG5 C;  4I5S A;  3RW0 A;  2RNB A;  3T1Y O;  2IBZ H;  1JFF B;  2Z5U A;  5JWP A;  4DV7 B;  4DV1 O;  3OW2 U;  3SYQ A;  2XAS A;  3UCS C;  3FYE B;  3ZN1 A;  3SPH A;  3QNE A;  5LMU O;  2EIJ C;  2UXB B;  2OCH A;  3OGI B;  5EIB D;  4YJ3 B;  2OIG A;  2IH1 C;  1SC5 B;  4QPJ A;  4FFK A;  2ZQM A;  3CRQ A;  4FLY A;  1XUQ A;  5L3F A;  3KG2 A;  2QKC A;  3B8N A;  4NTY A;  3UM7 A;  1GN2 A;  4MS2 A;  1S5J A;  4MVS A;  3DSQ A;  3CC4 V;  3M8A A;  4PJ0 Z;  1VEW A;  2EUL A;  2CTP A;  4DR3 O;  3CCE V;  5K1X A;  4B3M O;  1KYO F;  1VQ7 V;  3ZRX A;  1VQM V;  4PI2 A;  4YJ3 A;  2GBO A;  4RUF A;  4ZIB A;  1WLE A;  4O4J B;  3CCU V;  1SS3 A;  3K0D A;  2ADQ B;  2X0L A;  2UUC O;  2OTL V;  1HWY A;  2JDI G;  4K8Z A;  1GK9 A;  2QWP B;  2QM8 A;  3ASO C;  3K06 A;  4CS4 A;  4X64 O;  1F7Y A;  3CRM A;  2YIC A;  1GTO A;  4GKJ B;  3L74 H;  1XNQ B;  2PTM A;  1TAE A;  2LO1 A;  4LFC B;  1IBK O;  3OUS A;  4LFB B;  3K5N A;  2DW4 A;  4I50 B;  1K4D C;  2F1M A;  3OD4 A;  4LP8 A;  1VIB A;  1RPO A;  4O4J A;  4PEL A;  3F7V C;  4TUY A;  1SA0 A;  2Q9L A;  2HFE C;  5EBM C;  1KD1 W;  2JVD A;  4I7Z B;  2QKS A;  1VQK V;  1MG1 A;  3H1H H;  5IDJ A;  4PA9 A;  4JI6 B;  3BAB A;  2H94 A;  4U7O A;  4D7T A;  2FB5 A;  4UCU A;  5B1A B;  3G80 A;  3OEE G;  2CTW A;  2KG7 A;  1XMQ B;  4I50 A;  1UPG A;  3GB7 C;  3JAL B;  4TT3 G;  4DV4 B;  2ODM A;  1H2S B;  4FPP A;  1GO3 F;  2DOS A;  3JAS B;  5IY5 B;  2RN9 A;  4WFB V;  3RYF B;  4B3S O;  2UU9 O;  1JMK C;  4DR1 B;  3ZX6 A;  1WA8 A;  1XDC A;  2BOC C;  2P6J A;  5GTI Z;  4YJ2 B;  5L3G A;  3QF7 A;  5KHK A;  5C93 A;  2DQ0 A;  3ETQ A;  1H8E G;  3LDD A;  2XUM A;  4AQY O;  3H1I H;  1MNG A;  1YVW A;  2DQ3 A;  1K3E A;  4U7N A;  2NNU A;  3JAL A;  3FB8 C;  3JAS A;  1WP7 A;  1H2M A;  3MHS C;  4PA7 A;  3RYF A;  4ZI7 B;  5E79 Z;  4B7K A;  1AJQ A;  4AIL C;  4DV7 O;  1NH2 B;  3E89 A;  4Z2W A;  5JJJ B;  4LF8 B;  2B9Z A;  4YJ2 A;  3KCY A;  2YSU B;  1KKD A;  2DYS C;  1ZWI C;  1BZK A;  3OMN B;  3B77 A;  4FJC C;  1B06 A;  4ZOL B;  4ICG A;  4UCT A;  4LR3 A;  5CA0 B;  4X65 B;  1ARO P;  3IGA C;  5B1A C;  3SPG A;  5EBL C;  4Z1V A;  4J41 A;  1WB7 A;  1KBH A;  4GX0 A;  3N2G B;  3JSN A;  1RSO A;  1OHH G;  3VQV A;  1K34 A;  2VWJ A;  1HDJ A;  3E8H A;  2Z0A A;  5AG2 A;  4FM2 A;  2R72 A;  4ZOL A;  3E35 A;  2AHZ A;  4BW9 A;  3JYC A;  5CA0 A;  2W6I G;  4I9W A;  2D3O W;  3W7W A;  4MVQ A;  3RYI A;  4TSF G;  1VMG A;  5EIB C;  2JK5 C;  4NVP A;  4FLU A;  4H13 B;  3N2G A;  1VQO V;  5EC1 C;  3ZS8 C;  4DRX A;  4MVU A;  5KA5 A;  4GKJ O;  1XNQ O;  2C2A A;  4LFC O;  2XAG A;  4LFB O;  4K3A A;  1Q86 W;  3ZED A;  1O9H A;  1MSW D;  2YXL A;  4JI5 B;  2WLK A;  4WFG A;  2ZIO A;  1YTF B;  1W2B U;  1TVK B;  4UV9 A;  3IAY A;  4UCV A;  1KQS U;  1UJW B;  4UCO A;  1GN4 A;  4TWK A;  3WB1 A;  3CD6 V;  1SKV A;  2QE7 G;  3CRC A;  4JI6 O;  3M99 B;  3ZMT A;  3N27 A;  4I9Q A;  3VQX A;  4LF7 O;  4WBN B;  5JH7 A;  1XMO B;  1FFT B;  3K03 A;  1AVM A;  3ZJZ A;  5D5P A;  1JOY A;  1TVK A;  4KFM A;  2Q68 A;  4DR1 O;  3KZI Z;  4K35 A;  1IDS A;  4EEQ A;  2ADP A;  1MZE A;  4JI4 O;  2CGN A;  5JVD B;  5L3E A;  1E79 G;  4K0K O;  3U0Z A;  1F4M A;  4UVA A;  2IU3 A;  1VQ5 V;  2XHB A;  5EBW C;  4EKW A;  1EZJ A;  4D7S A;  4UCS A;  3ETE A;  4CC6 A;  1FPO A;  2Y0I A;  2WLI B;  4RWU A;  4FLV A;  1XOU A;  3CCV V;  4KUM A;  5GON B;  5CA3 A;  5JJE B;  3G6B A;  3HKD B;  3L70 H;  4CBC A;  2N04 A;  3J81 N;  5CB4 B;  4LF8 O;  1PD3 A;  3E83 A;  5JVD A;  2JGD B;  3JAK B;  4OXS A;  1Y6X A;  5B5E Z;  3CCR V;  5B66 Z;  5L3B A;  2PI4 A;  3ZMV A;  4DXW A;  1P7G A;  2OCC C;  1SQF A;  4KXR A;  2YUA A;  4O2B B;  2B1I A;  2VRZ A;  1KU9 A;  3UKM A;  2GDS A;  1YHQ V;  2Y0P A;  1YZB A;  3LSQ A;  4DV3 B;  5H6Q A;  2ETN A;  3EVK A;  4TQF A;  5GON A;  4MTO A;  3HKD A;  1PPJ H;  3A0H Z;  1SQQ H;  1OV9 A;  2WPD G;  5CB4 A;  1VAR A;  2RCV A;  4IIJ B;  2FYU H;  3JD0 A;  2JGD A;  4PHZ A;  1QHT A;  3ZRW B;  3VQW A;  3JAK A;  1GM8 A;  2KSD A;  1CPY A;  1ZL8 B;  3DTU B;  2WLH A;  1U97 A;  1VF5 B;  4O2B A;  1FXV A;  4TQD A;  2Y4T A;  1PM9 A;  4UB6 Z;  3LDC A;  1THZ A;  1NTZ H;  3MD0 A;  1I0H A;  2X6B A;  4G2K A;  3ZRW A;  3THO A;  2M7W A;  2CH7 B;  2K1E A;  5KUM A;  4YIO A;  2PZS A;  2WLN A;  2JJ2 G;  4O2A A;  1ZL8 A;  3HKE B;  3OT7 A;  3WG7 B;  3CC2 V;  4DR7 B;  3DC5 A;  4FFB B;  5LMU B;  2EIK C;  3C3S A;  3SJQ C;  1OCZ B;  1L1F A;  4H37 A;  1BGY H;  5H5N A;  2P7T C;  4FLZ A;  1Y66 A;  2XAF A;  4IL6 Z;  3NR7 A;  3H9V A;  2JEU A;  4DK0 A;  3BY6 A;  5J2U B;  4H33 A;  3RVZ A;  2CH7 A;  3K5O A;  1M57 C;  4CH4 A;  1XMO O;  4K8X A;  3CEI A;  3W7U A;  1WNS A;  2ARH A;  3HKE A;  3RBZ A;  2A9H A;  1HR0 B;  4FFB A;  4L8J A;  4B3M B;  1WP8 A;  4GT1 A;  2VS0 A;  2UXD B;  5LGT A;  3OEH G;  2XND G;  4KHP O;  1IVS A;  3ZRS A;  2B5U A;  4DR4 B;  2QWO B;  3STZ C;  1WB8 A;  1D5N A;  1N33 B;  2UXC O;  1S5L Z;  1FAF A;  3UT5 B;  3VOU A;  3OFN G;  5DM6 V;  5J2U A;  2H8P C;  4JI2 O;  2ZE5 A;  1AI4 A;  2EIL B;  4U3F H;  2HKO A;  4FLW A;  1VQP V;  4R50 A;  5B1N A;  2ZXW B;  1IBK B;  3FAV B;  3ZHQ A;  3GWO A;  3WG7 C;  4J9Y B;  1H2G A;  3RVY A;  2DWE C;  1OCZ C;  4PA6 A;  1E1R G;  3U11 A;  3CCM V;  1NTK H;  4X9Q A;  4WCE V;  1W59 A;  4FLT A;  4MSW C;  4O4L A;  1K4C C;  4DR2 O;  3RT3 C;  3TJT A;  3CB2 A;  2Q0O C;  3SPJ A;  3RN4 A;  3ABL B;  3ZHT A;  1GAX A;  1PP9 H;  1XQ8 A;  3FAV A;  4RAI A;  4RQF A;  4XBF A;  2P4V A;  2ZIM A;  3Q4H B;  4J7J A;  1ROP A;  1M1K W;  5DED A;  1MOF A;  2A06 H;  3ETD A;  3GVM A;  2G38 A;  5D5Q A;  2RQ6 A;  3TCU A;  2IU0 A;  3ZMZ A;  4AI8 A;  3C90 A;  1SQG A;  2RMK B;  3A8T A;  4CH6 A;  3QO8 A;  4AQY B;  4LCU C;  2RDC A;  3ICX A;  2D2C B;  1AR1 B;  3SYC A;  2LP7 A;  5B3S C;  4PA3 A;  4JZG A;  2ZXW C;  5ITZ A;  3Q4H A;  3AG3 C;  4X88 A;  4CH5 A;  3SJB C;  2GHY A;  2MK3 A;  4RO2 A;  3GWK C;  2QGN A;  2BSK B;  1SES A;  1V55 C;  4JTA B;  1QVF U;  3FFQ A;  2JRI A;  1OCO B;  4DR7 O;  3T1C A;  3H01 A;  3CCQ V;  2LQT A;  4R7C A;  5DN6 G;  3S3W A;  2O57 A;  1HNZ B;  5E1A C;  2LJ2 A;  1NR1 A;  4YHH B;  3T2M A;  3G71 V;  1QVG U;  1F51 A;  3ABL C;  4LF5 O;  2XTA A;  2AXT Z;  2ZT9 B;  5LOV B;  3LSU A;  1H2K A;  2HLD G;  2QR4 A;  5FNV B;  2XT9 A;  4JYA O;  2BSK A;  2DN9 A;  3R66 A;  1EN5 A;  1K8A W;  3ZCC A;  2ZCE A;  1HR0 O;  4JAA A;  4NR1 A;  3I56 V;  2UXD O;  4GKK O;  3CMA V;  1I94 O;  2UUA O;  3K57 A;  3E8F A;  4W4K A;  1JQ0 A;  4TUY B;  4YXW G;  4DR4 O;  1N33 O;  1SA0 B;  3ETG A;  1Y67 A;  2F23 A;  1DF4 A;  1SZT A;  2R9I A;  2CK3 G;  2WLM A;  3SR2 C;  5LOV A;  4OGQ B;  4JI1 O;  5FNV A;  2WA4 A;  3ABT A;  3AG1 B;  1X59 A;  1R6N A;  3OAA G;  3H1J H;  1K33 A;  2KG7 B;  1F4N A;  2B1G A;  4WFA V;  1VQ6 V;  1K5S A;  1OCO C;  3E8B A;  1RFY A;  4AHC A;  2KKW A;  3SPI A;  4L87 A;  1KUQ A;  1R73 A;  3ABU A;  1LUV A;  2HP8 A;  4HAM A;  1AIL A;  1WA8 B;  2DYS B;  1VF7 A;  1XNR B;  4H44 B;  2IM9 A;  4JI7 O;  1H8H G;  3EFF K;  1G8M A;  1Q3E A;  2GTA A;  2E5L O;  2ZD9 A;  1AR4 A;  4MVZ A;  4LF7 B;  2EZP A;  5EZY B;  2F4V O;  1R3I C;  4GLX A;  1KB9 F;  4B3R B;  5IT9 N;  1N32 B;  4P9O A;  4ZKI A;  3G67 A;  4LNU B;  1EN4 A;  3ZHV A;  1J95 A;  1FJG O;  1YCI A;  4IT5 A;  1IBM O;  3FYI B;  3IC7 A;  1SER A;  2JS5 A;  4JI4 B;  2AZ2 A;  1KEC A;  5H9C A;  5LA6 B;  5KHJ A;  1NT2 B;  4K0K B;  1BSM A;  1I5X A;  2A0L A;  4TV9 B;  4DV6 B;  3JCZ A;  3AG1 C;  5EZY A;  1HNX B;  4KP4 A;  1KP3 A;  1D5A A;  1G4Y B;  1GM7 A;  3ML0 A;  2IJH A;  4LNU A;  1EFR G;  4JTC B;  1RSO B;  4EFE A;  1R3J C;  4MW3 A;  1VQL V;  1YEW A;  3JD3 A;  2ZE6 A;  3F5T A;  5BMV B;  5LA6 A;  4NTX A;  1QR8 A;  5CBG A;  1U96 A;  3B2E E;  5IYD O;  3TXS A;  1HNZ O;  1NBM G;  1BCC H;  4TV9 A;  4W4L A;  1Y4M A;  3S3X A;  5CBF A;  4YHH O;  1Q90 D;  4MVO A;  3RYI B;  4JV5 B;  2JEX A;  4LWS A;  4X8A A;  1MA1 A;  2CAZ C;  2A7W A;  3VQY A;  4DRX B;  1TA8 A;  3OR7 C;  5CA1 B;  4H0L B;  5BMV A;  1WJZ A;  5KX5 B;  3X2Q C;  5FPR A;  5EYP B;  3U10 A;  1R1B A;  3FB5 C;  2YID A;  4LC1 A;  4NXM O;  2Q7G A;  1QNM A;  4ZBM A;  1K5Q A;  2QJ1 A;  4DV5 B;  2FTK A;  4QE9 A;  3BFR A;  3K58 A;  2ZNJ A;  4XDL A;  5KLV H;  1BQZ A;  2HR3 A;  3BA9 A;  5CA1 A;  4J11 A;  3JAM N;  1AI6 A;  1Q8I A;  3BA8 A;  5KX5 A;  1PV0 A;  5JH7 B;  1GKF A;  2Q4P A;  5EYP A;  1AI7 A;  2CE4 A;  1DF5 A;  4B7E A;  2Q7E A;  1K9M W;  2Q73 A;  3BCC H;  5FLX N;  4LF6 B;  1BHB A;  3K79 A;  4NXN B;  3LNM B;  1XNR O;  3O65 A;  1FYJ A;  2PYL A;  1I08 A;  2OCC B;  3ASN B;  4DO2 A;  4JYY A;  3CP1 A;  1N36 B;  1GRJ A;  4KL1 A;  3CRA A;  3AG4 B;  5JCO A;  4B3R O;  1N32 O;  5JQG A;  2EBO A;  4GUN A;  4MTF A;  3CME V;  4TV8 B;  5IYC O;  1ZSP A;  3SYO A;  5LYJ A;  2KB1 A;  4KHP B;  2DYR B;  2BTQ B;  2EIM B;  2NLJ C;  2RJZ A;  2UXC B;  3G6E V;  1QLN A;  4B08 A;  1OCC B;  2PGG A;  5LMN O;  3IFX A;  4JI2 B;  4DV6 O;  1HNX O;  1NKD A;  4FZ0 A;  4DR6 O;  2IJI A;  1X4T A;  4TV8 A;  3W7X A;  2WLJ A;  4JPR A;  5JCO C;  1NVP D;  3E2E A;  2Q8V A;  1US6 A;  2IJJ A;  2V1D A;  1ENV A;  4PDV A;  2GSM B;  2BTQ A;  3UO3 A;  2ILM A;  5H2F Z;  4NB5 A;  4XDJ A;  4G28 B;  2BCC H;  2EIK B;  2DWD C;  2E76 B;  3RYH B;  3ASN C;  4LF9 O;  4PI0 A;  1XHX A;  3ZHS A;  4BAY A;  5LP6 B;  4DR2 B;  3OMA B;  4JV5 O;  5BR8 B;  2N05 A;  2HVJ C;  2VWK A;  3AG4 C;  2Z3Y A;  3L73 H;  4J7Z A;  3OTO O;  1JX9 A;  3TK1 A;  4I0X A;  2ATK C;  4RUE A;  2EZO A;  5LGN A;  2QEX V;  1FS0 G;  1M9N A;  1M57 B;  2WSS G;  1GMG A;  3HR0 A;  2UXX A;  4OPH A;  1HNW O;  1EN6 A;  1EZV H;  1FXH A;  2DYR C;  3ZIA G;  2EIM C;  4O2A B;  2YEV B;  2H3O A;  4TOI A;  3RYH A;  2V4D A;  1O9G A;  1L0N H;  5LP6 A;  1OCC C;  1J5E B;  4QJF B;  1XI1 A;  4DV5 O;  1VQ8 V;  4MW8 A;  4OX9 B;  1Q82 W;  1H2N A;  1URF A;  2E74 B;  2JJ1 G;  4UVB A;  4FLX A;  3WFV A;  1XRE A;  3CPW U;  4DR5 O;  3T4Z A;  4J7K A;  4UV8 A;  1PL0 A;  3EXA A;  2YEV A;  2F93 B;  2Y4U A;  2PUS A;  3OM3 B;  1R3L C;  1YIT V;  4X1K B;  1GN6 A;  1WPX A;  4ZHQ A;  1Z5V A;  5LGU A;  2OWO A;  2QDO A;  2GUZ B;  2P22 C;  1SET A;  4EB6 B;  3K9A A;  4LF6 O;  4NYK A;  4DV0 O;  4JYC A;  4NXN O;  1YXB A;  1QCE A;  4F6E A;  5LP6 C;  3L9D A;  5KMG B;  3O9O A;  3CCL V;  3JAR A;  1IXB A;  1VF6 A;  4LF5 B;  3E8G A;  4WFH A;  3NXS A;  4B3T B;  1QQC A;  1N36 O;  4JYA B;  5IYZ B;  3A0R A;  2LFR A;  4MT8 A;  4X1K A;  1NS1 A;  2L35 A;  1RM1 B;  4YY3 B;  2GUZ A;  3G4S V;  4GKK B;  3JAT B;  4EB6 A;  4CH3 A;  3R65 A;  2Q7H A;  5J9P C;  1I94 B;  2UUA B;  2EJR A;  4J80 A;  5IJ9 B;  5KMG A;  2LFS A;  3B40 A;  3JD2 A;  4HBN A;  4C7U A;  2F95 B;  3SJC C;  4X66 O;  4PDL A;  2Y69 B;  2P5O A;  2PF4 E;  4GX5 A;  3K59 A;  4O4L B;  3LNN A;  4Q20 A;  4JI1 B;  1VF6 C;  3SYP A;  3ZMS A;  5IYZ A;  4N23 A;  1DGS A;  5B3S B;  1SQB H;  4NKG B;  3AK3 A;  3CRR A;  2HHH B;  3ZRV A;  3WB0 A;  1P84 F;  3K3W A;  4X1I B;  3AG3 B;  2LGQ A;  3JAT A;  3K5L A;  4WFE A;  2ZM6 O;  2F43 G;  2OT5 A;  4X1Y B;  1V55 B;  3SPC A;  5IJ9 A;  3T1H O;  4NTW A;  5FPO A;  4DYL A;  4MTX A;  4QGP A;  3CCS V;  1VP7 A;  2YXH A;  1S5H C;  4JI7 B;  4I4T B;  3FB7 C;  1XHZ A;  2UUB O;  1S77 D;  1LUW A;  1L8D A;  2X6C A;  5BR8 O;  2E5L B;  5EC2 C;  3HB3 B;  4X1I A;  5L3D A;  2F4V B;  4O4H B;  1MAB G;  4X1Y A;  4JAV A;  5ITZ B;  3LDE A;  5GTH Z;  1RM1 C;  5LHI A;  3P3P A;  5HFL A;  4JI0 B;  4IYH A;  2DE0 X;  4GYC B;  5KA6 A;  3FD9 A;  1FJG B;  4UUJ C;  1IBM B;  1H2L A;  2ZE7 A;  3TGU H;  3EHB B;  4QNH B;  5LHG A;  4JYB A;  3I55 V;  1KKC A;  5KHH A;  5A9G A;  1M5I A;  1BE3 H;  4I4T A;  2Y69 C;  1J5E O;  1CXZ B;  2BOB C;  2HEP A;  4OX9 O;  4QPK A;  3MHH C;  4X62 O;  1HP8 A;  4O4H A;  4BIZ A;  3APO A;  1F23 A;  1JJ2 U;  5KUK A;  1NU1 H;  3A2F A;  1XBL A;  1BL8 A;  2UXN A;  1SZX A;  1Q43 A;  3JAW B;  4P30 A;  3T4D A;  2R9A A;  3AG7 A;  3I5D A;  2XAH A;  4FM1 A;  3OTF A;  1Z5W A;  1ZLZ A;  3HKB B;  3FB6 C;  4GCZ A;  4DW0 A;  2JS3 A;  4ASU G;  3DGE A;  3CX5 F;  4PDR A;  1N0J A;  1AJN A;  4DUZ O;  2Q67 A;  2CUG A;  5J2T A;  4MVM A;  1QLE B;  1CP9 A;  4FK5 C;  1JVM A;  3AK1 A;  4B3T O;  3QO5 A;  3K0G A;  1RPR A;  1W0J G;  1T5E A;  2XAJ A;  4IHJ B;  3JAW A;  2M6Y A;  4FMT A;  3K5M A;  3RWR D;  2QTO A;  4E2L A;  1XIL A;  3HKB A;  4UXN A;  4YY3 O;  1YDX A;  1NH2 D;  2QWN B;  1V54 C;  1JFF A;  4BW5 A;  2JIZ G;  3MDS A;  3BAA A;  1WN7 A;  2V7Q G;  2DJV A;  1AB3 A;  3AEI A;  4NXM B;  4X20 B;  1QBZ A;  3APQ A;  5BZB A;  4XDK A;  2DMX A;  1VQ4 V;  2ZR3 A;  2ITD C;  4DV2 B;  2QM7 A;  4IHJ A;  2N74 A;  5KAI Z;  1NI8 A;  1B6Q A;  4JF3 A;  1TUB B;  2HHH O;  1P4R A;  2LGW A;  2VQF B;  2AW9 A;  3BEH A;  4FM0 A;  4F4L A;  1AP6 A;  1Q6H A;  3PJS K;  3D3I A;  4GX2 A;  4X20 A;  2Q0A A;  1JPX A;  1QLE C;  3JD1 A;  1P49 A;  1R6T A;  1YJW V;  1G6U A;  3H1K H;  4G27 B;  5CMU A;  2IW5 A;  3BPZ A;  4YIP A;  1TUB A;  3STL C;  1FKA O;  2CTQ A;  2GTS A;  1I7F A;  1R6K A;  2ZDI A;  3WB2 A;  2HJD A;  1Z2G A;  2R70 A;  1L0L H;  2E3C A;  5B1B B;  3CS5 A;  3L72 H;  1SQV H;  2XOK G;  2ZIN A;  3MAQ A;  4J42 A;  3OE7 G;  3ZMU A;  4JI0 O;  5LHH A;  1NTM H;  4JI3 O;  4LFA B;  1OCR B;  4GZR B;  3X2Q B;  3SGI A;  2W6J G;  4HYO A;  2ZKO A;  3L71 H;  4Q6G A;  3TXQ A;  1YTF D;  3CC7 V;  1LNQ A;  3QG5 A;  2WAM A;  4IYI A;  4WFF A;  5LMN B;  1G1X B;  3QTC A;  1BT8 A;  5TIS Z;  4DR6 B;  3SYA A;  1N0N A;  4LWS B;  2ZDI C;  4JAS A;  1A32 A;  1E1Q G;  1S72 V;  1K7D A;  2HJF C;  5KAF Z;  5IWA B;  3RYC B;  1YJN V;  4PA4 A;  3K04 A;  2NN4 A;  1PL4 A;  1YIJ V;  4I55 B;  1SQP H;  1COW G;  3K9S A;  1BQ0 A;  3M7M X;  5CBH A;  4J10 A;  3K08 A;  1JA8 A;  4WF9 V;  3CSX A;  1BHA A;  4LF9 B;  1K73 W;  1SQX H;  2YIB D;  4EFB A;  1DLB A;  2QA4 V;  2QKA A;  2BE3 A;  4LF4 B;  2EX3 A;  3CJH B;  1XL6 A;  4UB8 Z;  2UXB O;  2A3Q A;  2A79 B;  1NZ6 A;  3OTO B;  1PNL A;  3QVN A;  5B1B C;  5KHG A;  3RFR A;  3RYC A;  1M56 B;  2X6A A;  1HNW B;  2CTR A;  4FZ1 A;  2Q69 A;  2WA3 A;  1OCR C;  3B4S A;  4I55 A;  4GX1 A;  2Q5Z A;  4ZI7 A;  4U3J B;  5IY5 C;  1HW7 A;  4BWA A;  5F2V O;  2YI9 A;  2GV9 A;  3CJH A;  1GM9 A;  4JTD B;  2FKX A;  4JGS A;  1WAZ A;  4DV2 O;  3E86 A;  2CDY A;  3BHP A;  4DUY B;  1B3Q A; 
#chains in the Genus database with same CATH homology
 3ZIA G;  1KP2 A;  2EIM C;  3OUS A;  1K4C C;  2YEV B;  1BMF G;  2DW4 A;  1K4D C;  4X89 A;  4LP8 A;  3HPL C;  3SPJ A;  1RPO A;  3ABL B;  3OR6 C;  2IJK A;  2P67 A;  4PEL A;  3F7V C;  1OCC C;  4RQE A;  4QJF B;  3D36 A;  2P90 A;  2HFE C;  4J9Z B;  4RAI A;  4RQF A;  5EBM C;  1KD1 W;  4MW8 A;  1VQ8 V;  1VQN V;  3ABK B;  4XBF A;  2QKS A;  1M1K W;  1VQK V;  1ROP A;  1Q81 W;  1Q82 W;  1MG1 A;  2JJ1 G;  4UVB A;  1MOF A;  3ETD A;  3WFV A;  5IDJ A;  4PA9 A;  5GW7 A;  3CCJ V;  3CPW U;  4Z1M G;  3T4Z A;  2H94 A;  4U7O A;  3ZN0 A;  4UV8 A;  1PL0 A;  5B1A B;  3OEE G;  3ABM B;  3TCU A;  2IU0 A;  3ZMZ A;  2YEV A;  4PDM A;  1DTO A;  3GB7 C;  4TT3 G;  3OM3 B;  1CEZ A;  4FPP A;  1R3L C;  1GO3 F;  3QO8 A;  1YIT V;  5IY5 B;  1WPX A;  5LGU A;  1M56 C;  4WFB V;  4LCU C;  1AR1 B;  1NJI W;  1SET A;  3K9A A;  3SYC A;  2LP7 A;  5B3S C;  4JYC A;  4PA3 A;  1QCE A;  2WLL B;  2ZXW C;  3AG3 C;  4X88 A;  3CCL V;  2BOC C;  1XL4 A;  1QR9 A;  2GHY A;  2MK3 A;  3FKS G;  4RO2 A;  2PI5 A;  2P6J A;  3E8G A;  1SES A;  1V55 C;  2EIN B;  4JTA B;  5L3G A;  1QVF U;  4WFH A;  2XAQ A;  3NXS A;  5C93 A;  2DQ0 A;  3OGC C;  1OCO B;  1H8E G;  3LDD A;  5IYB O;  2OTJ V;  3T1C A;  1IXM A;  1TUE B;  1SRY A;  3H01 A;  3CCQ V;  4HZ3 A;  4R7C A;  3A0R A;  2LFR A;  2DQ3 A;  5DN6 G;  1K3E A;  4U7N A;  2NNU A;  3VBB A;  3FB8 C;  4MT8 A;  5HFM A;  5E1A C;  3MHS C;  1RM1 B;  4PA7 A;  3W7S A;  1NR1 A;  3G4S V;  1S0V A;  1AJQ A;  3T2M A;  2ZR2 A;  1FXK B;  3G71 V;  3R65 A;  1NH2 B;  4MTG A;  5H6R A;  1YSC A;  5J9P C;  1QVG U;  1F51 A;  2EJR A;  2WLL A;  3ABL C;  3AG2 B;  3E89 A;  1Q7Y W;  3P30 A;  2LFS A;  3JD2 A;  2HLD G;  1PKX A;  3ABK C;  4PDL A;  1NQT A;  2Y69 B;  3JD4 A;  2YSU B;  1KKD A;  2DYS C;  4GX5 A;  1K8A W;  3ZCC A;  1ZWI C;  4Q20 A;  3OMN B;  3B77 A;  3SYP A;  4FJC C;  3ZMS A;  4P9P A;  3I56 V;  4N23 A;  5B3S B;  3CMA V;  1ARO P;  3IGA C;  5B1A C;  4LBE C;  3ABM C;  4QE7 A;  3ZRV A;  3E8F A;  3SPG A;  5EBL C;  1JQ0 A;  3K3W A;  4YXW G;  3AG3 B;  3ETG A;  1FXK A;  4WFE A;  4GX0 A;  2F43 G;  3F7Y C;  2OT5 A;  1DF4 A;  1SZT A;  1OHH G;  2R9I A;  2CK3 G;  1V55 B;  3SPC A;  1OZ0 A;  2WLM A;  1K34 A;  3E8H A;  4MTX A;  3CCS V;  3ABT A;  3TET A;  1S76 D;  3AG1 B;  1R6N A;  1S5H C;  3OAA G;  1EBO A;  2WLI A;  1R3K C;  2EIN C;  3E35 A;  1K33 A;  2AHZ A;  3FB7 C;  1S77 D;  1F4N A;  2B1G A;  4WFA V;  1VQ6 V;  1K5S A;  2X6C A;  3JYC A;  2W6I G;  1OCO C;  2R9R B;  3E8B A;  4I9W A;  3W7W A;  4MVQ A;  2D3O W;  5EC2 C;  4TSF G;  4L87 A;  3SPI A;  3HB3 B;  2JK5 C;  5L3D A;  1MAB G;  1R73 A;  1VQO V;  2Y48 A;  3ABU A;  1P7B A;  4JAV A;  5EC1 C;  3LDE A;  4HAM A;  4MVU A;  1RM1 C;  5LHI A;  2DYS B;  5KA5 A;  5HFL A;  1FXK C;  2C2A A;  5CN0 A;  5KA6 A;  4UUJ C;  3AG2 C;  1H8H G;  3EFF K;  3EHB B;  1G8M A;  2XAG A;  1Q86 W;  4QNH B;  5LHG A;  4JYB A;  3I55 V;  1MSW D;  1K97 A;  2ZD9 A;  2WLK A;  4WFG A;  4MVZ A;  2Y69 C;  2EZP A;  2X7R B;  1YTF B;  1S3J A;  1R3I C;  2BOB C;  1W2B U;  4UV9 A;  1KQS U;  4QPK A;  1UJW B;  1VQ9 V;  3MHH C;  4P9O A;  4TWK A;  4ZKI A;  4BIZ A;  1JJ2 U;  1F23 A;  1J95 A;  3CD6 V;  5KUK A;  2QE7 G;  3FYI B;  2IH3 C;  3M99 B;  3IC7 A;  1W0K G;  1SER A;  5FL7 G;  3ZMT A;  1BL8 A;  2WWW A;  1KEC A;  2UXN A;  5H9C A;  4P30 A;  3T4D A;  4P2Z A;  2XAH A;  4R8C A;  1I5X A;  4GCZ A;  3FB6 C;  2A0L A;  1FFT B;  3K03 A;  3JCZ A;  4ASU G;  1AJP A;  1K92 A;  3AG1 C;  3DGE A;  3CYO A;  4PDR A;  3ZJZ A;  4KP4 A;  3W7T A;  1JOY A;  4KFM A;  4CZZ A;  1AJN A;  1KP3 A;  5LBQ A;  1N8R W;  2Q68 A;  2Q67 A;  1G4Y B;  5B1O A;  1GM7 A;  3ML0 A;  2IJH A;  4MVM A;  1QLE B;  1CP9 A;  1EFR G;  4JTC B;  3OUF A;  4FK5 C;  5L3E A;  1NVP B;  1JVM A;  1R3J C;  4MW3 A;  1E79 G;  1VQL V;  1F4M A;  3QO5 A;  3K0G A;  1YI2 V;  4UVA A;  2IU3 A;  1RPR A;  3JD3 A;  1JCH A;  1W0J G;  3LUT B;  3OMI B;  1VQ5 V;  2Q6A A;  2XAJ A;  1QR8 A;  4QIW F;  4FMT A;  5EBW C;  4EKW A;  1EZJ A;  5CBG A;  2QTO A;  3QO7 A;  3ETE A;  4E2L A;  5IYD O;  1NBM G;  2WLI B;  1M90 W;  3LSS A;  4UXN A;  1Y4M A;  2HVK C;  1H38 A;  5CBF A;  4R6Z A;  4MVO A;  3CCV V;  1NH2 D;  1V54 C;  4KUM A;  1YJ9 V;  5CA3 A;  4BW5 A;  2JIZ G;  2JEX A;  4X8A A;  4CBC A;  2V7Q G;  1PD3 A;  3E83 A;  3AEI A;  4OXS A;  3OR7 C;  1QBZ A;  5BZB A;  4XDK A;  3F5W C;  1VQ4 V;  2ZR3 A;  3P32 A;  3CCR V;  2ITD C;  1AI5 A;  2QM7 A;  2W0F C;  2ITC C;  5L3B A;  2PI4 A;  3B8M A;  3ZMV A;  4DXW A;  2OCC C;  2B1I A;  3X2Q C;  3UKM A;  1B6Q A;  4JF3 A;  1YHQ V;  1KC8 W;  3LSQ A;  1P4R A;  3CXC U;  3FB5 C;  5H6Q A;  4LC1 A;  1ORQ C;  3BEH A;  4ZBM A;  1K5Q A;  4F4L A;  4MTO A;  2FTK A;  4QE9 A;  3PJS K;  1I5Y A;  4UVC A;  2WPD G;  2EIJ B;  3D3I A;  3JD0 A;  4GX2 A;  4XDL A;  3ZRW B;  2HR3 A;  1JPX A;  1GM8 A;  1QLE C;  1NR7 A;  3JD1 A;  1CPY A;  1AI6 A;  1YJW V;  3DTU B;  2WLH A;  4JAU A;  5EK0 A;  4G27 B;  1FXV A;  1GKF A;  5CMU A;  2IW5 A;  4N21 A;  1V54 B;  3STL C;  4MVR A;  1R6K A;  1AI7 A;  2ZDI A;  1DF5 A;  1K9M W;  3LDC A;  1PNM A;  1THZ A;  5B1B B;  2XOK G;  3K79 A;  1BHB A;  3LNM B;  3MD0 A;  3ZMU A;  3OE7 G;  2X6B A;  5LHH A;  4G2K A;  3ZRW A;  2OCC B;  1OCR B;  3ASN B;  2M7W A;  2K1E A;  5KUM A;  3X2Q B;  4DO2 A;  2WLN A;  1PNK A;  2W6J G;  5L3C A;  2JJ2 G;  4HYO A;  3CP1 A;  3WG7 B;  3CC2 V;  4BIU A;  1YTF D;  4FIP C;  3CC7 V;  1LNQ A;  2EIL C;  3AG4 B;  2EIK C;  2WAM A;  3ASO B;  2AHY A;  3SJQ C;  4WFF A;  1OCZ B;  1L1F A;  2EBO A;  4H37 A;  2HG5 C;  4MTF A;  4I5S A;  3CME V;  5IYC O;  2P7T C;  3RW0 A;  1Y66 A;  3SYO A;  2XAF A;  2Z5U A;  3SYA A;  2KB1 A;  3OW2 U;  2DYR B;  2ZDI C;  4JAS A;  3SYQ A;  2JEU A;  1E1Q G;  2XAS A;  1S72 V;  2EIM B;  3BY6 A;  1K7D A;  2HJF C;  2NLJ C;  3FYE B;  4H33 A;  3ZN1 A;  3RVZ A;  3G6E V;  1QLN A;  3SPH A;  3QNE A;  1M57 C;  2EIJ C;  1YJN V;  3W7U A;  4PA4 A;  1OCC B;  3K04 A;  3IFX A;  2IH1 C;  4QPJ A;  3RBZ A;  2ZQM A;  1YIJ V;  2A9H A;  1COW G;  5L3F A;  4GT1 A;  5CBH A;  1NKD A;  3KG2 A;  2IJI A;  3K08 A;  3OEH G;  5LGT A;  2XND G;  4WF9 V;  1BHA A;  3B8N A;  1K73 W;  3W7X A;  3ZRS A;  1DLB A;  2B5U A;  3UM7 A;  2QA4 V;  2WLJ A;  4JPR A;  4MS2 A;  1NVP D;  3E2E A;  3STZ C;  4MVS A;  2IJJ A;  2V1D A;  1ENV A;  4PDV A;  2GSM B;  3VOU A;  3CC4 V;  1XL6 A;  2A79 B;  1PNL A;  3OFN G;  4XDJ A;  5DM6 V;  5B1B C;  2H8P C;  1AI4 A;  2EIL B;  4G28 B;  3CCE V;  2EIK B;  1M56 B;  2X6A A;  1VQ7 V;  2HKO A;  3ZRX A;  1VQM V;  2Q69 A;  2DWD C;  4RUF A;  1OCR C;  3ASN C;  1VQP V;  4R50 A;  5B1N A;  1WLE A;  2ZXW B;  3CCU V;  4GX1 A;  3K0D A;  4BAY A;  2X0L A;  3OMA B;  2OTL V;  1HWY A;  2JDI G;  3GWO A;  3WG7 C;  4J9Y B;  2HVJ C;  1H2G A;  1GK9 A;  5IY5 C;  3AG4 C;  2QM8 A;  2Z3Y A;  3ASO C;  3K06 A;  2DWE C;  3RVY A;  1OCZ C;  1JX9 A;  4PA6 A;  3TK1 A;  2QEX V;  2ATK C;  4RUE A;  1E1R G;  2EZO A;  5LGN A;  1FS0 G;  1M9N A;  1M57 B;  2WSS G;  1GTO A;  1GMG A;  3CCM V;  1GM9 A;  4JTD B;  4JGS A;  2UXX A;  4WCE V;  3E86 A;  4MSW C;  1FXH A;  2DYR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...