4H37A

Crystal structure of a voltage-gated k+ channel pore domain in a closed state in lipid membranes
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
NGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2059 protein
publication title Crystal Structure of a Voltage-gated K+ Channel Pore Module in a Closed State in Lipid Membranes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Membrane protein
total genus 24
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4h37A00
4KFMA 4MTOA 2QKSA 3E83A 4GX0A 3EFFK 3K03A 4XDJA 3STZC 5EC1C 1QLEC 2BOCC 4H33A 4X89A 3E89A 2EIMC 2IH3C 3BEHA 3TETA 4J9ZB 1R3IC 2DYSC 2W0FC 3AG1C 3T4DA 2BOBC 1J95A 2IH1C 2K1EA 4RUFA 3ASNC 3AG2C 4MTGA 4WFGA 4XDLA 1K4CC 2ITDC 1XL6A 4BW5A 3F7YC 4RO2A 3ZRSA 1S5HC 2QTOA 4MVSA 3RVYA 2ZD9A 2WLKA 3ASOC 1BL8A 1R3JC 3R65A 2P7TC 4QE9A 2HVJC 2ATKC 4MVMA 3T2MA 3K04A 4LBEC 4PA9A 4R50A 3SPCA 3SYQA 4PDRA 3TCUA 4CBCA 3E8HA 4MVOA 5B1BC 3K0GA 3SYCA 3OGCC 3IFXA 1M57C 1JVMA 2WLLA 4MTFA 4MS2A 2DYRC 2WLMA 3SPJA 3VOUA 1OCOC 4MW3A 5KUKA 3STLC 5CBFA 1XL4A 4MVZA 5B1AC 4PDVA 2WLNA 3UKMA 5EK0A 3SPIA 4PDLA 3SPGA 4R8CA 3LDDA 3LDEA 4JTAB 2HG5C 2WLJA 4J9YB 4QE7A 5EBMC 3UM7A 3OUSA 3K08A 2H8PC 3HPLC 3PJSK 3SJQC 3IGAC 2ZXWC 3E8GA 4GX5A 2HJFC 3FB6C 4MW8A 2EINC 3K0DA 4ZBMA 3T1CA 3OR7C 4MSWC 1OCZC 3ABMC 4MVRA 2WLHA 4I9WA 4HZ3A 2DWDC 2EILC 3JYCA 2JK5C 4F4LA 4GX1A 3ZJZA 2AHYA 4X8AA 4WFEA 4LCUC 2WLIB 2ITCC 3ABKC 4XDKA 3WG7C 3KG2A 4LP8A 1M56C 4G27B 4P9OA 2Q67A 2KB1A 2Q68A 3LNMB 2HFEC 4JTCB 4PDMA 4RAIA 2NLJC 4X88A 3FB7C 3E86A 3RBZA 4GX2A 2Q69A 1LNQA 2OCCC 2Y69C 5EBLC 1KKDA 1ZWIC 4P9PA 3E8FA 4DXWA 3T4ZA 2X6AA 2X6CA 3FB8C 1OCRC 4UUJC 1G4YB 4PA3A 4WFHA 1ORQC 4H37A 3RW0A 3K06A 3LUTB 3E8BA 3F7VC 5BZBA 4PA7A 5CBGA 5IY5C 2EIJC 3AG4C 2X6BA 4P2ZA 4WFFA 1R3LC 2A0LA 2YEVA 4RUEA 2AHZA 3GB7C 4OXSA 4R7CA 1OCCC 4QNHB 4PA6A 1R3KC 5J9PC 3SYPA 3LDCA 5EC2C 3F5WC 2A79B 4MVUA 3FB5C 4PA4A 5B3SC 4JTDB 4TWKA 1K4DC 1P7BA 2R9RB 5KUMA 1V54C 5E1AC 2WLLB 3OUFA 2EIKC 4G28B 5EBWC 3ABLC 2DWEC 2HVKC 3RVZA 3SYOA 2Q6AA 5CBHA 3X2QC 1V55C 2WLIA 2A9HA 4R6ZA 4MVQA 4P30A 3SYAA 4HYOA 3OR6C 4EKWA 3SPHA 3AG3C
chains in the Genus database with same CATH superfamily
4KFMA 5GTHZ 3K03A 4LFBO 5K1PA 4FLTA 1N4CA 1R3IC 3CYOA 2IH1C 2EULA 1JCHA 1H38A 2CDYA 3ZRSA 2UXXA 2DMXA 1V54B 4YIOA 2HVJC 4FFKA 3CE2A 3ZS8C 1THZA 4DV6O 3K59A 3JAWB 4MVOA 2UUAB 2LJ2A 3OGCC 1ZLZA 5FL7G 1JVMA 2QSAA 1L1FA 1XMQO 1Q86W 3M99B 5D5PA 4B3SO 4WFBV 3UM7A 4DR3B 4IIJB 1NU1H 3ZN1A 2EINC 3CSXA 4I4TA 4ZI7B 2EILC 4KL1A 3BA9A 4TQFA 1H2KA 1QVGU 1XMOO 4LF5B 3CC2V 3JASA 2NNUA 2UUAO 3GWOA 4ZHQB 1YSCA 3FB7C 2MK3A 4GX2A 2Q69A 1B3QA 4O2BA 3B4SA 2G38A 3AG7A 1K92A 4FLWA 5JCOC 4TT3G 3L75H 2LW1A 2AGAA 3AK3A 1Q6IA 2GSMB 3S3XA 2O57A 1XQ8A 1G6UA 2N74A 4JI6B 2CTQA 2DE0X 2QGNA 1VQLV 3ABMB 1H2LA 3IC9A 4TOIA 3WB0A 4NB5A 3RN4A 3J7AU 2VQFO 2UUBO 1YZBA 4B3TB 3MHHC 1K3EA 3UQ8A 2W6JG 4PI2A 3ABLC 2H94A 3JAWA 1FJGO 4L8JA 2VQEB 1N33B 4O2AA 4EB6B 3C90A 2ZQMA 3OEHG 2HHHO 5H6RA 3BAAA 4XDJA 1PNLA 4HAMA 1YTFD 3E89A 4NR1A 1PL4A 2KSDA 3D3IA 3AG2C 1HNWO 4XDLA 3APOA 1N34B 1YCIA 4IGGA 5H2FZ 4BW5A 2D3OW 3F7YC 4ZI7A 4JI4O 3JSLA 4J7KA 2QTOA 4B3TO 3ASOC 3VBBA 2JGUA 3ETQA 1PM9A 4LBEC 2QDOA 5JQGB 1K97A 4ZHQA 3E35A 5B1NA 3MAQA 3IAYA 2YEVB 2CTWA 2LFSA 2YIBD 1JFFA 1YITV 4DR4O 1R6KA 5FPRA 1B04A 3JARB 4LF9O 3JCUZ 4UVCA 1BHAA 3CC4V 4D7SA 4DV3O 1VIBA 5B1BB 4NTYA 1GM9A 5IYBO 1NTZH 4E4EA 1FXKA 2DYRB 3E86A 1QQCA 4EB6A 1HR0B 4DK0A 4UCOA 4EEQA 4FZ1A 3P3PA 4QPKA 4E2LA 3CRQA 3E8BA 1DLBA 4YHHO 3BVOA 1SC5B 2Y4UA 1P7GA 4LWSB 3HKCB 5KUMA 4GKKO 2OCHA 1M56B 1NR7A 1XOUA 5L3EA 4DV4B 5JQGA 2QEXV 1PKXA 3H1LH 2WLIA 2A9HA 1VP7A 3FKSG 4P30A 3OR6C 4J80A 1WB8A 5JJJB 4X9QA 2QWRB 1KUQA 1H2MA 4WCEV 2W6IG 2IU3A 4TUYB 1OJHA 3JARA 3THOA 4LF8O 2GUZB 2ZD9A 5EZYB 1AVMA 2CH7B 1X59A 2YC0A 4QE9A 1AJNA 3K04A 4PA9A 3ZRWB 4YY3B 4JI7B 4IT5A 1ZSPA 4FMTA 2ADPA 3STLC 4R8CA 3I56V 3CX5F 1J5EB 2Q8VA 1NR1A 4JASA 1R6TA 3IGAC 4K3AA 1K7DA 2CTRA 2VWKA 2ZM6B 4LWSA 3IC7A 5KLVH 3DC6A 4NKGB 2UXBO 4GX1A 2RMKB 1XNQB 1KU9A 1OCOB 2Y69C 4DV1B 3E8FA 3N2GA 5KAIZ 5LP6C 1X4TA 3JAMN 1N8RW 1YJNV 4WFHA 1ORQC 4H37A 1J5EO 2QTSA 2QE7G 4UVBA 1ZUQA 4WFFA 3CXHF 4JAUA 4QPJA 2ZM6O 2C2AA 2UUCO 2GUZA 1VARA 4UCUA 5EZYA 4YIPA 4LR3A 1OCCB 1WA8B 4X65B 4FZ0A 1P49A 3CMEV 4NTXA 2Y0PA 2JGDB 5BR8B 3ABUA 1V55C 5CA0B 1EN4A 2QWOB 1HP8A 4CC6A 4B3RO 3CCRV 1JJ2U 1I7FA 2F95B 3IJ4A 3B40A 4H33A 4DW0A 3NR7A 1GH6A 1R73A 4A5UB 4YXWG 4HBNA 2M6YA 3AG1C 1L0LH 2BCCH 5B3SB 4DYLA 4DV5B 4ICGA 2WLKA 1I0HA 3R65A 3RYCB 1EN5A 2Q7HA 4MVMA 4UCVA 3G6EV 1CXZB 4LFAO 2F23A 1IURA 1XUQA 1M93A 2ZR2A 2Q73A 2A7WA 1GM8A 1LUVA 1SQGA 3BCCH 3AK2A 2DN9A 3ZMTA 3HPLC 3T1YB 3HR0A 1H2NA 4AQYB 3FB6C 1YEWA 1Y66A 1BE3H 1D5NA 2IM9A 1YVWA 3JYCA 2RN9A 1WA8A 3OD4A 5CB4A 1MA1A 1GN3A 2B5UA 1QNMA 2Q67A 5IDJA 2JGDA 3KCXA 2QM8A 1KKDA 5CA0A 4PI0A 4GUNA 2LFRA 3HKDB 3ZMUA 1XREA 4JI1O 4D7TA 4X20B 3LUTB 4UB6Z 2B9ZA 1MSDA 3GB7C 1R3KC 4OGQB 1VEWA 3ZMSA 4BIZA 5JH7B 1K4DC 3ABKB 3RYCA 1V54C 1IBLO 1AP6A 2AZ2A 5IJ9B 2R70A 3ZHVA 5KHGA 1FS0G 3QO5A 3UT5B 1ZL8B 3JALA 3O9OA 2EJ7A 2LP7A 5TISZ 4GZRB 4NTWA 5LYJB 1YI2V 2IJKA 1E79G 3UO3A 5BXZA 4B3MB 1MG1A 1GO3F 1HNXO 1XHZA 2DQ3A 1I5XA 2EIKB 4JV5B 2YICA 1BS3A 3VQYA 5IE9A 1FXHA 3IFXA 1Y74B 2YI9A 5ITZA 3VQWA 3OTOB 2UU9B 3JAKA 4DUZB 3JD4A 1FFTB 3UKMA 4ABMA 4X20A 1QLEB 3K08A 3ZRVA 1NZ6A 4GX5A 4AHCA 3ABMC 4FIPC 3G71V 4DV7O 2YXYA 4WFEA 1TUBA 4LCUC 4LP8A 5EIBD 3CRMA 4W4LA 4NYKA 4O4LB 4DUYO 5EBLC 2CGOA 3UT5A 1ZL8A 3N27A 3P30A 1Q3EA 3D8CA 2PZSA 3RW0A 1S5JA 3F7VC 2F4VB 4FLZA 1E1RG 1D5AA 5IWAO 2JJ2G 2XAQA 3OMNB 4O4HA 4X1IA 4FM1A 4F6EA 5LBQA 3AK1A 3WFVA 4WF9V 3MHSC 1XILA 2Q6AA 1Y74A 5CBHA 4DR2B 1Z5WA 4LF4B 4JI5B 1WNSA 4DR1B 4D6TH 4EFBA 4JYAB 4JI0B 4MTOA 4PD4F 5CMUA 5LMUB 3K57A 1BQ0A 3HKEB 4Q6GA 1DK1A 4RUFA 1BSMA 4NXMB 2L6LA 3M8AA 4JAVA 1AR5A 1HWYA 3CCQV 3B8NA 3RVYA 1Q6UA 1YIJV 3JASB 4U3JA 1JMKC 3T2MA 3E8HA 5LXTB 2XHBA 5B1BC 2WLLA 2DYRC 3SPJA 5LHIA 4JI5O 4QGPA 4MW3A 3AG3B 1M57B 5KUKA 4CH4A 3SPGA 3CCLV 4CS2A 2RCVA 4JTAB 3TGUH 3LNNA 2GBOA 3G6BA 3E8GA 4Z1VA 4BIOA 3CCEV 4NXMO 2QA4V 1F4MA 1IDSA 4RQEA 1YF2A 1VQ4V 2CAZC 4CZZA 1UPGA 1M56C 3T1HO 3E22B 2PF4E 4JTCB 4O2AB 3J80N 3QTCA 3VQVA 3UCSC 2X6CA 2QM4A 4UV9A 4BWAA 3CHXA 1YDXA 2BSKA 1RFYA 3HKEA 2ZNJA 2QJ1A 2VS0A 4GYCB 1AI4A 1ZX3A 2ILMA 3CCUV 3JD0A 3BABA 3ZN0A 1S3JA 3QVNA 1GN4A 1Z5VA 5GTIZ 2R9RB 3QG5A 2IU0A 5LXTA 1K34A 2XAHA 2YXHA 4U7NA 5GW7A 3ZHQA 5CA3A 4IYIA 4DR3O 1GKFA 1JFFB 1D2DA 4B08A 3NXSA 1Q6HA 3FFQA 3STZC 1FKAO 5H5NA 2VRZA 3TETA 3CCJV 3GWKC 2XUMA 4DV2B 4JYBA 1K4CC 2ITDC 1BZKA 4AILC 4LF5O 2JEXA 1AILA 3C3SA 4ZOLB 2P7TC 1FXKB 3E22A 3QO8A 2Q4PA 3U11A 4JPRA 1OCOC 1BCCH 5JVDB 4JI6O 5L3GA 2WLJA 1YTFB 3WB1A 1CEZA 2RJZA 4FM0A 1Q7YW 2OTLV 4HNAB 2ARHA 1TVKA 3U0ZA 1K33A 2WLHA 1M1KW 5A2QN 2AHYA 2LGWA 4TQDA 2WLIB 1FYJA 1LR1A 2VQEO 1N33O 2KB1A 5KHHA 4G2KA 4I50B 2ZE6A 4X88A 1HNZB 3OFNG 2JS5A 4IHJB 1PP9H 2Z5UA 5KA5A 1OHHG 5IYCO 2ZINA 5IJ0A 3SJAC 4WBNB 3RGBA 1GTOA 1N34O 4LF7B 1EZJA 5B66Z 4RUEA 1WAZA 4R7CA 1W0JG 3K3WA 1N36B 2PYLA 4PA4A 5B3SC 1US6A 3LSQA 4ZOLA 4GKJB 3ZBHA 2IBZH 4DK1A 1MNGA 2HVKC 2IJJA 2OCCB 4DV0B 2Y4TA 2XASA 1K73W 3DGEA 1PNMA 5JVDA 3ZCCA 1OCRB 3RYFB 1JPXA 4LC1A 4EFEA 1NH2D 4HNAA 3OM3B 1NH2B 1Y4MA 1VMGA 3OT7A 4X1KB 4J7ZA 1S5HC 4MVSA 5FNVB 4GKJO 1NI8A 4TV8A 3W7WA 4JF3A 3RYIB 1AI7A 3N2GB 4I50A 3WB2A 2GDSA 1HR0O 3L71H 3CCVV 3DSQA 3L73H 4IHJA 2JDIG 1S76D 4PDLA 2P5OA 2XAGA 4WBNA 2YDEA 5IYDO 2EIMB 5HFLA 4FK5C 2Q7GA 4NXNB 1BQZA 1Y76B 3ASNB 5B5EZ 3D36A 1YJWV 2CGNA 5LGTA 1SF9A 4CS3A 1H8EG 2IJHA 1Q8IA 3B77A 4DV4O 4X8AA 3F5TA 3ABKC 2A3QA 1L8DA 1LNQA 4QIWF 4TSFG 3RYFA 3FB8C 1VF5B 4BR6A 3PN1A 1IX9A 2A06H 4X64B 5LHHA 1I08A 3ZMVA 5IYZA 1HDJA 4N21A 4X1KA 5EC2C 3FB5C 5FNVA 5LHGA 4YY3O 2EIKC 2X0LA 4JI7O 3RYIA 5LMNB 4LH6A 2PI5A 4CH6A 1H2GA 4MVQA 2WA4A 3W7SA 5L3FA 2CE4A 2BTOA 3DTUB 2QKSA 5LGUA 4GX0A 3EFFK 1Q43A 3R66A 2PYJA 2K9PA 1QLEC 2BOCC 4X89A 1M4UA 2EIJB 4X64O 3TJTA 4DO2A 4UCSA 1AB3A 2QR4A 1Y76A 4JZGA 4O4IB 4WFGA 5KHIA 1Z2GA 5CB4B 1ENVA 3JD3A 2GHYA 2ADQB 3MD0A 1XNQO 5K1XA 4JGSA 2CK3G 1N0NA 2JEUA 3FD9A 4ZIBA 4DV1O 3CEIA 4X62B 5EIBC 1XI1A 5AG2A 4PDVA 3SPIA 2EZPA 3W7TA 4LFCB 2CUGA 4UXNA 4UCRA 5JCOA 3SJQC 1VQNV 5FLXN 1RPOA 1WB7A 1EBOA 4X65O 3OR7C 5LL6Y 1IZ3A 2DWDC 1F4NA 4F4LA 4OPAA 5BR8O 2OYQA 4JI3B 3CXCU 4RAIA 1K5SA 3OE7G 1WP7A 5DEDA 3JALB 2OWOA 2YS8A 1N32B 2WAMA 5J2TB 1KYOF 4FLYA 1IXMA 1VQ9V 3LSUA 4O4JB 4N23A 2A0LA 5KHKA 4DV5O 2CTPA 4O4IA 1OCZB 1VQ5V 3F5WC 4MVUA 2GV9A 1Y67A 4FLUA 2EBOA 2DWEC 2V7QG 3RVZA 5F2VO 5ITZB 1QCEA 2AW9A 5CN0A 3JAKB 4RWUA 3APQA 3P3NA 3SDLA 3H01A 3DC5A 2E74B 1GAXA 3AG3C 3H1IH 3T1YO 4AQYO 4JI8B 1URFA 3AG4B 2WWWA 3BEHA 1NTKH 2W0FC 3ZRXA 4GT1A 4BW9A 3ZHTA 1TUBB 4JAAA 1IBKB 4I55B 2OTJV 2ZE8A 4DR6B 3CD6V 1SQBH 1VF6A 3CRCA 1PPJH 2FL4A 5B1OA 3SPCA 4UFZA 1QBZA 2DQ0A 4CBCA 1SQPH 3K0GA 3SYCA 1Q90D 2JVDA 5EYPA 3VOUA 2PUSA 1XL4A 3CJHB 5IT9N 4MT8A 5J2TA 1VQOV 4J11A 5EBMC 4DR5B 4JI2B 2DYSB 5FPOA 1SA0B 4O4JA 4Z2WA 4JZ2A 2P67A 2QKCA 4K8XA 2F1MA 4O4HB 5BY1A 4X1IB 4MVRA 4GCZA 2N05A 2F93B 4CH5A 1KQSU 5H6QA 2GTAA 1FD9A 1U96A 1O9HA 1SS3A 3ZEDA 1FAFA 2PTMA 1EZVH 5LOVB 4B7KA 2IJIA 4K0KB 3A0HZ 2GTSA 3ZMZA 5L3CA 2QKAA 3VQXA 1I94B 4B3MO 1OV9A 5CBGA 1VQ8V 3BFRA 1XNRB 4CH3A 2WPDG 4U3JB 3TXSA 3CS5A 2WSSG 3SR2C 4K8ZA 4JV5O 4Z1MG 4I55A 1AJPA 3H9VA 2X7RB 3FAVB 3RT3C 5LGNA 5BMVB 2WLLB 5E79Z 2V1DA 1FXKC 3U10A 3SYOA 3OTOO 2UU9O 4DUZO 3ETEA 3ZHUA 1Q81W 4X1YA 3SYAA 4WFAV 4EKWA 3CJHA 3SPHA 1IBMB 1N0JA 1BHBA 3FYEB 1SA0A 2H3OA 3T4DA 4LNUB 3CWBH 4J10A 1S77D 4MTGA 5J2UA 3D3QA 2QM7A 2DOSA 1NJIW 4I5SA 3B8MA 1XHXA 3L9DA 3X2QB 1NS1A 2HJDA 1EM1A 2E5LB 3HKBA 2BSKB 5LOVA 1NTMH 4MVZA 2F4VO 3LDDA 2XAFA 4J9YB 2UXCB 4QE7A 1TAEA 1H2SB 3S3WA 4I0XB 1YJ9V 1RSOB 2ODMA 4KP4A 2V4DA 2QWPB 3T1CA 5DM6V 4JYYA 3D36C 4LFBB 4K35A 3OGIB 2P4VA 3FAVA 5BMVA 4DR2O 4LF4O 4CS4A 4G27B 4DR1O 3JD2A 4JYAO 2ETNA 1KB9F 4JI0O 1H8HG 5LMUO 1XBLA 2OCCC 4UCTA 4DV6B 2E5LO 2P90A 1QHTA 3T4ZA 1OCRC 3MDSA 1WN7A 2P4KA 2ZDIA 1G4YB 1XMQB 2YXLA 3K06A 3QO7A 4PA7A 4B3SB 4LNUA 4QJFB 4QNHB 1BT8A 1F7YA 3SYPA 3H1KH 1QVFU 1UFIA 3EHBB 4TWKA 3EXAA 1MABG 2FTKA 1RPRA 1XMOB 2QWNB 1HW7A 1KMIZ 2L35A 2ZE7A 5LA6A 3JATB 4B7EA 2FYUH 1TVKB 3JSNA 2EJRA 1SESA 2YUAA 5EC1C 2ZIMA 2EIMC 4I0XA 1RSOA 3K5NA 3L72H 3K9SA 4TV9A 2JJ1G 2K1EA 3ASNC 1QR8A 3TK1A 4X66B 1RM1B 4FJCC 5KX5A 3TCUA 2VQFB 2UUBB 2UXDB 1M90W 2ZR3A 4J42A 4H44B 2DW4A 5IJ0B 1T5EA 3OTFA 1VQ7V 1W2BU 1FJGB 5KAFZ 3LDEA 3K9AA 2EX3A 1JJOA 2RNBA 2HHHB 3QF7A 1L0NH 2BTQB 1PV0A 4X66O 1EFRG 3ZJZA 1HNWB 3BRCA 4FVMA 4JI4B 2UXDO 5DN6G 1KKCA 3DXRB 1V9PA 1Q82W 4GLXA 1AI5A 2WA3A 2R72A 5B1AB 1GK9A 4PHZA 1B06A 3JATA 1WLEA 4PA3A 4H0LB 4DV2O 1YHQV 2ZXWB 2F66C 3BY6A 1MOFA 2EIJC 3BA8A 1R3LC 1AI6A 1AJQA 1OCCC 4IIJA 1K5QA 4I7ZB 4TV8B 2E3CA 3HB3B 3A0RA 2PGGA 5JJNB 1QR9A 4DR4B 3LSSA 3WG7B 3I55V 1P4RA 4G28B 4LF9B 2PY5A 3ABTA 1BGYH 2XTAA 4DV3B 3TXQA 1G8MA 2YI8A 3CMAV 2Y0IA 2UXNA 5IY5B 3L74H 3K79A 2BOBC 4AI8A 3ZHSA 3G80A 1IVSA 1XL6A 3K58A 4Q20A 2BTQA 1FXVA 4YHHB 1R3JC 2Q9LA 2ZCEA 2ZKOA 2JRIA 1VF6C 4PJ0Z 1R1BA 2AXTZ 1HNZO 1E1QG 4GKKB 3DXRA 1WPBA 2AZ0A 2WLMA 1VF7A 3P32A 4LF7O 4F6RB 1NVPD 1QU7A 1A32A 4U3FH 5IYZB 1NVPB 2Y48A 1N36O 1FPOA 2KKWA 2FMLA 1AR1B 1OCZC 5GONB 4I9WA 1G1XB 2D2CB 3JD1A 1SZTA 1XEQA 4DV0O 2ITCC 2IW5A 5CA1B 4P9OA 2Q68A 4LF8B 2HFEC 1JQ0A 3ICXA 2R9IA 1GN6A 1KP2A 1ZWIC 1UJWB 2X6AA 3KKYA 1K8AW 2ZIOA 4BAYA 1MSWD 4PV1B 3AG4C 4P2ZA 1CP9A 2EINB 1JR9A 5L3BA 4KHPB 2YEVA 3WU2Z 4PA6A 3CPWU 2HLDG 2EILB 2YIAA 3LDCA 1DGSA 3RWRD 2YIBA 4H13B 2P6JA 2UXBB 1S72V 3B09A 3OEEG 3SJCC 3K5LA 1KBHA 1R6NA 1SQQH 1RP3B 4F6RA 4NXNO 3E83A 3CCMV 2ZNIA 1FFXB 2FKXA 4PELA 2JS3A 3OW2U 4FPPA 3A0BZ 2DYSC 4KHPO 3C3TA 1VQ6V 5GONA 1ZAUA 1PNKA 3A2FA 3FX7A 3ABLB 5CA1A 2UUCB 3HKCA 1KD1W 3SYQA 5L3DA 1SQVH 2QWQB 5EK0A 1KC8W 3A8TA 5HFMA 3OUSA 4B3RB 1K9MW 1O9GA 2NN4A 3AG2B 1SERA 3K0DA 2E76B 4ZBMA 1COWG 3ASOB 1AR4A 3JCZA 5LMNO 4DW1A 3OMIB 5A9GA 4TUYA 1WJZA 3CP1A 5C8YB 3LNMB 2CH7A 1SRYA 1XDCA 3ZRWA 4LFAB 4KXRA 2YSUB 1YXBA 4L87A 4YJ2B 2VWJA 2Z3YA 4UUJC 1F23A 1FFXA 2Q5ZA 3L70H 2ZDIC 2Q0AA 1KECA 1JOYA 5BZBA 3ETDA 2N04A 1Q5OA 2AHZA 1JX9A 1AROP 1SETA 3H1HH 3RFRA 1TUEB 2A79B 4U7OA 1P7BA 3B2EE 5E1AC 4BIUA 4UB8Z 5EYPB 4X62O 2KG7B 1B6QA 2P06A 1PL0A 4W4KA 4LH7A 2FB5A 3X2QC 4DRXB 2Q0OC 2W0XA 3GVMA 4R6ZA 4LFCO 3SGIA 1IXBA 1W0KG 4HYOA 2LQTA 2RDCA 2Q7EA 3ZHRA 2ZT9B 2EZOA 2OT5A 5JJEB 1I5YA 2MW2B 3AEIA 3Q4HB 4JI1B 4J9ZB 1SQFA 5D5QA 1J95A 4OX9B 1TA8A 4FLVA 4JI3O 3BPZA 2B1IA 1BL8A 2BE3A 1ROPA 1N32O 1LUWA 4R50A 4PDRA 1EN6A 5C8YA 4DR7B 1S5LZ 1M57C 3H1JH 4MTFA 2OIGA 1IBLB 1QLNA 3W7UA 2OIEA 2ZE5A 3KCYA 5KHJA 5CBFA 1WP8A 3CB2A 4YJ2A 2WLNA 3K5OA 2PI4A 4JYCA 2HKOA 3I5DA 3QNEA 1TGOA 3CRRA 4IL6Z 2HJFC 1Y6XA 4MW8A 4XBFA 1GN2A 4OX9O 2P22C 4MSWC 2JIZG 1BMFG 4RQFA 4HZ3A 2DJVA 3OAAG 1CPYA 1KP3A 1NBMG 2F43G 3BHPA 1NT2B 2KG7A 2Z0AA 1HNXB 4X1YB 4I9QA 4DR7O 4PDMA 4UV8A 2NLJC 4DRXA 3RBZA 1JA8A 1VQKV 2NR5A 4JI8O 4P9PA 4FLXA 4DXWA 3UO2A 3CCSV 1VQMV 1U97A 1DTOA 5C93A 3G4SV 2YIDA 3Q4HA 4LF6B 1IBKO 4OPHA 4YJ3B 4DR6O 4ASUG 5J2UB 4FFBB 3ETGA 4KUMA 5J9PC 1ZTEA 4ZKIA 4JTDB 1P84F 2LW7A 3FYIB 1M9NA 3E2EA 3OUFA 2LGQA 5EBWC 1RM1C 4DV7B 3HKBB 5H9CA 2Y69B 1AP5A 5LP6B 4DR5O 4JI2O 1SKVA 1VQPV 4DUYB 2KQXA 1MZFA 1WPXA 3OMAB 3HKDA 3G67A 1F51A 4LF6O 1NQTA 2IH3C 3EVKA 1GMGA 3K5MA 3RYHB 2XAJA 3KZIZ 4RO2A 1SQXH 2B1GA 3N2KB 5IWAB 3W7XA 5JWPA 2XNDG 2ATKC 2HP8A 4MTXA 3J81N 1V55B 5JH7A 5KMGB 4K0KO 1DF5A 2LO1A 4MS2A 2HR3A 1S0VA 1I94O 5B1AC 4C7UA 1PD3A 5IJ9A 4IYHA 4FM2A 1XNRO 1M5IA 2HG5C 5DECA 3CRAA 4NVPA 2H8PC 3PJSK 2HEPA 2E75B 5KA6A 3AG1B 4YJ3A 2ZXWC 4FFBA 3SJBC 5LYJA 2XOKG 2RQ6A 1OZ0A 2JK5C 3M7MX 4XDKA 3WG7C 3KG2A 3CC7V 3ML0A 4J7JA 1IBMO 5LA6B 3ZIAG 1W59A 5LP6A 1GRJA 1MZEA 4TV9B 5IY5C 2X6BA 3RYHA 4OXSA 1MMMA 4I4TB 5KX5B 4J41A 1NKDA 3ZX6A 3N2KA 2XT9A 1DF4A 5KMGA 2M7WA 1GM7A 4CC5A 4UVAA 3T1HB 2UXCO 2R9AA 4O2BB 3O65A 4O4LA 1SZXA
chains in the Genus database with same CATH topology
4KFMA 3DTUB 1G8MA 2QKSA 4GX0A 5LGUA 3CMAV 3EFFK 3K03A 2LP7A 1QLEC 2BOCC 2UXNA 4X89A 5IY5B 2EIJB 1YI2V 2IJKA 1E79G 4DO2A 1R3IC 3K79A 2BOBC 3CYOA 2IH1C 4WFGA 1JCHA 1ENVA 1MG1A 1XL6A 2GHYA 1GO3F 3JD3A 3MD0A 4Q20A 1FXVA 1H38A 3ZRSA 2UXXA 2DQ3A 1V54B 1I5XA 1R3JC 2EIKB 2HVJC 4JGSA 2CK3G 2JEUA 1THZA 1FXHA 4MVOA 1E1QG 3OGCC 3IFXA 5FL7G 1JVMA 2WLMA 1L1FA 3P32A 1Q86W 4PDVA 3JD4A 1FFTB 3M99B 3SPIA 2EZPA 3UKMA 3W7TA 1NVPD 4UXNA 4WFBV 1QLEB 3UM7A 3K08A 3SJQC 1NVPB 2Y48A 3ZRVA 1VQNV 4GX5A 1RPOA 3ZN1A 2EINC 1EBOA 1AR1B 3OR7C 1OCZC 3ABMC 4FIPC 4I9WA 2DWDC 1F4NA 2EILC 4F4LA 3G71V 3JD1A 4WFEA 4LCUC 1SZTA 2ITCC 2IW5A 1QVGU 4LP8A 3CXCU 4P9OA 2Q68A 3CC2V 2HFEC 2NNUA 3GWOA 4RAIA 1JQ0A 1K5SA 3OE7G 1YSCA 2R9IA 3FB7C 2MK3A 4GX2A 2Q69A 5EBLC 1KP2A 1ZWIC 2WAMA 1UJWB 2X6AA 1K92A 3P30A 4TT3G 1IXMA 3RW0A 2GSMB 1K8AW 1VQ9V 3F7VC 4BAYA 1MSWD 3AG4C 1CP9A 4P2ZA 2EINB 4N23A 1E1RG 2A0LA 2YEVA 5L3BA 1VQLV 1OCZB 3ABMB 4PA6A 1VQ5V 2JJ2G 2XAQA 2HLDG 3CPWU 3OMNB 2EILB 3LDCA 3F5WC 4MVUA 3MHHC 1K3EA 2EBOA 5LBQA 2W6JG 3WFVA 3ABLC 2DWEC 2P6JA 2V7QG 2H94A 3RVZA 1QCEA 5CN0A 4WF9V 3MHSC 2Q6AA 5CBHA 1S72V 3OEEG 3H01A 1R6NA 3AG3C 4MTOA 3E83A 2ZQMA 5CMUA 3OEHG 5H6RA 3CCMV 4XDJA 4PELA 1PNLA 4HAMA 3OW2U 3AG4B 3E89A 1YTFD 4FPPA 2WWWA 3BEHA 2DYSC 2W0FC 3ZRXA 1VQ6V 4GT1A 3D3IA 4RUFA 3AG2C 4XDLA 4JAVA 4BW5A 2OTJV 2D3OW 3F7YC 3CD6V 1HWYA 3CCQV 1PNKA 2QTOA 3B8NA 3RVYA 1YIJV 3ASOC 3VBBA 3ABLB 3T2MA 5B1OA 3SPCA 4LBEC 1KD1W 1QBZA 3SYQA 2DQ0A 4CBCA 3E8HA 5B1BC 3K0GA 1K97A 3SYCA 2WLLA 5L3DA 2DYRC 3SPJA 3VOUA 3E35A 5LHIA 4MW3A 3AG3B 1M57B 5KUKA 1XL4A 4MT8A 5B1NA 5EK0A 1VQOV 1KC8W 3SPGA 3CCLV 2YEVB 4JTAB 2LFSA 5EBMC 5HFMA 3OUSA 1K9MW 2DYSB 3E8GA 2P67A 3CCEV 3AG2B 1YITV 1SERA 3K0DA 4ZBMA 1R6KA 2QA4V 1F4MA 4MVRA 4GCZA 1KQSU 1COWG 5H6QA 4UVCA 4RQEA 1BHAA 3ASOB 3CC4V 3JCZA 4CZZA 3OMIB 1M56C 5B1BB 3CP1A 3LNMB 1GM9A 4JTCB 5IYBO 1SRYA 1FXKA 2DYRB 3E86A 3ZRWA 2YSUB 2IJIA 2X6CA 4L87A 2Z3YA 4UUJC 3ZMZA 4UV9A 1F23A 5L3CA 2ZDIC 4QPKA 4E2LA 1KECA 1JOYA 3E8BA 5BZBA 1DLBA 5CBGA 1VQ8V 3ETDA 1AI4A 2AHZA 2WPDG 3CCUV 3JD0A 1JX9A 1AROP 2WSSG 3ZN0A 1SETA 1S3JA 4Z1MG 1AJPA 1TUEB 2A79B 4U7OA 2X7RB 5LGNA 1P7BA 2R9RB 5KUMA 5E1AC 1M56B 2WLLB 4BIUA 2IU0A 2V1DA 1NR7A 1FXKC 1B6QA 3SYOA 5L3EA 1PL0A 1K34A 2XAHA 3ETEA 2QEXV 1PKXA 4U7NA 3X2QC 1Q81W 2WLIA 5GW7A 2A9HA 4R6ZA 5CA3A 3FKSG 4P30A 3SYAA 1W0KG 4HYOA 3OR6C 4WFAV 4EKWA 1GKFA 3SPHA 2EZOA 2OT5A 3NXSA 1BHBA 1I5YA 3AEIA 3STZC 3FYEB 4WCEV 3TETA 2W6IG 3CCJV 4J9ZB 3T4DA 1J95A 2IU3A 1S77D 4JYBA 4MTGA 1K4CC 2ITDC 2JEXA 2QM7A 2ZD9A 2B1IA 1BL8A 2P7TC 4QE9A 1NJIW 1FXKB 1ROPA 1AJNA 4I5SA 3B8MA 3K04A 4PA9A 4R50A 3ZRWB 4PDRA 3X2QB 3QO8A 1M57C 4MTFA 1QLNA 3W7UA 4JPRA 1OCOC 4FMTA 3STLC 5CBFA 4MVZA 2WLNA 2PI4A 4R8CA 3LDDA 3I56V 5L3GA 2XAFA 2WLJA 4J9YB 4QE7A 4JYCA 2HKOA 1YTFB 1CEZA 3QNEA 1NR1A 4JASA 1Q7YW 2OTLV 3IGAC 1YJ9V 1K7DA 2HJFC 4MW8A 4XBFA 4KP4A 3T1CA 4MSWC 5DM6V 2JIZG 1BMFG 1K33A 4RQFA 2WLHA 3IC7A 1M1KW 4HZ3A 3OAAG 1CPYA 4GX1A 1KP3A 2AHYA 1NBMG 2WLIB 2F43G 4G27B 2KB1A 3JD2A 4PDMA 4G2KA 4UV8A 2NLJC 4X88A 1H8HG 3RBZA 1OCOB 2OCCC 2Y69C 1VQKV 3OFNG 4P9PA 2Z5UA 3E8FA 2P90A 4DXWA 3T4ZA 5KA5A 1OCRC 1OHHG 5IYCO 3CCSV 1VQMV 1N8RW 1DTOA 2ZDIA 5C93A 1G4YB 1YJNV 3G4SV 4WFHA 1ORQC 4H37A 1GTOA 3K06A 3QO7A 4PA7A 2QE7G 1EZJA 4UVBA 4WFFA 4ASUG 3ETGA 4QJFB 4RUEA 4JAUA 4KUMA 4R7CA 1W0JG 4QPJA 3K3WA 4QNHB 2C2AA 5J9PC 3SYPA 1QVFU 4ZKIA 4PA4A 5B3SC 3EHBB 1OCCB 3LSQA 4JTDB 4TWKA 3FYIB 1M9NA 3CMEV 3E2EA 3OUFA 1MABG 5EBWC 1RM1C 2HVKC 2FTKA 5H9CA 1RPRA 3ABUA 1V55C 2IJJA 2OCCB 2Y69B 2XASA 1K73W 3DGEA 1PNMA 3ZCCA 1OCRB 3CCRV 1JJ2U 1JPXA 1VQPV 4LC1A 1WPXA 2EJRA 1SESA 3OMAB 5EC1C 4H33A 1NH2D 1F51A 1R73A 1NQTA 2EIMC 4YXWG 2IH3C 3OM3B 1GMGA 3AG1C 2JJ1G 1NH2B 2K1EA 3ASNC 1QR8A 2XAJA 1Y4MA 5B3SB 4RO2A 2B1GA 1S5HC 4MVSA 3TK1A 2WLKA 3R65A 3W7XA 2XNDG 3W7WA 1RM1B 2ATKC 4FJCC 4JF3A 4MVMA 3G6EV 4MTXA 3TCUA 1AI7A 1M90W 2ZR3A 1V55B 1DF5A 3CCVV 2ZR2A 2DW4A 4MS2A 2HR3A 1S0VA 1GM8A 1VQ7V 1W2BU 2JDIG 5B1AC 1S76D 1PD3A 4PDLA 3LDEA 2XAGA 2HG5C 3ZMTA 5IYDO 2EIMB 2H8PC 3HPLC 3K9AA 3PJSK 5HFLA 5KA6A 3AG1B 4FK5C 2ZXWC 3ASNB 3FB6C 1YJWV 3D36A 1Y66A 5LGTA 1H8EG 2IJHA 2XOKG 1OZ0A 3JYCA 2JK5C 1EFRG 3B77A 3ZJZA 4X8AA 4XDKA 2B5UA 3ABKC 3WG7C 3KG2A 2Q67A 5IDJA 3CC7V 3ML0A 5DN6G 2QM8A 3ZIAG 1Q82W 1LNQA 4QIWF 1KKDA 1AI5A 4TSFG 5B1AB 2LFRA 1GK9A 3ZMUA 3FB8C 1WLEA 4PA3A 1YHQV 3LUTB 2ZXWB 5LHHA 3BY6A 5IY5C 1MOFA 2EIJC 2X6BA 1R3LC 1AI6A 3ZMVA 1AJQA 3GB7C 4OXSA 1OCCC 1K5QA 1R3KC 3HB3B 4N21A 3A0RA 5EC2C 1NKDA 3FB5C 3ZMSA 4BIZA 5LHGA 1K4DC 1QR9A 3ABKB 3LSSA 3WG7B 1V54C 1P4RA 3I55V 2EIKC 2X0LA 4G28B 1DF4A 3ABTA 2M7WA 2PI5A 1GM7A 4UVAA 1H2GA 4MVQA 3W7SA 5L3FA 1FS0G 3QO5A 1VQ4V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KFM A;  4MTO A;  2QKS A;  3E83 A;  4GX0 A;  3EFF K;  3K03 A;  4XDJ A;  3STZ C;  5EC1 C;  1QLE C;  2BOC C;  4H33 A;  4X89 A;  3E89 A;  2EIM C;  2IH3 C;  3BEH A;  3TET A;  4J9Z B;  1R3I C;  2DYS C;  2W0F C;  3AG1 C;  3T4D A;  2BOB C;  1J95 A;  2IH1 C;  2K1E A;  4RUF A;  3ASN C;  3AG2 C;  4MTG A;  4WFG A;  4XDL A;  1K4C C;  2ITD C;  1XL6 A;  4BW5 A;  3F7Y C;  4RO2 A;  3ZRS A;  1S5H C;  2QTO A;  4MVS A;  3RVY A;  2ZD9 A;  2WLK A;  3ASO C;  1BL8 A;  1R3J C;  3R65 A;  2P7T C;  4QE9 A;  2HVJ C;  2ATK C;  4MVM A;  3T2M A;  3K04 A;  4LBE C;  4PA9 A;  4R50 A;  3SPC A;  3SYQ A;  4PDR A;  3TCU A;  4CBC A;  3E8H A;  4MVO A;  5B1B C;  3K0G A;  3SYC A;  3OGC C;  3IFX A;  1M57 C;  1JVM A;  2WLL A;  4MTF A;  4MS2 A;  2DYR C;  2WLM A;  3SPJ A;  3VOU A;  1OCO C;  4MW3 A;  5KUK A;  3STL C;  5CBF A;  1XL4 A;  4MVZ A;  5B1A C;  4PDV A;  2WLN A;  3UKM A;  5EK0 A;  3SPI A;  4PDL A;  3SPG A;  4R8C A;  3LDD A;  3LDE A;  4JTA B;  2HG5 C;  2WLJ A;  4J9Y B;  4QE7 A;  5EBM C;  3UM7 A;  3OUS A;  3K08 A;  2H8P C;  3HPL C;  3PJS K;  3SJQ C;  3IGA C;  2ZXW C;  3E8G A;  4GX5 A;  2HJF C;  3FB6 C;  4MW8 A;  2EIN C;  3K0D A;  4ZBM A;  3T1C A;  3OR7 C;  4MSW C;  1OCZ C;  3ABM C;  4MVR A;  2WLH A;  4I9W A;  4HZ3 A;  2DWD C;  2EIL C;  3JYC A;  2JK5 C;  4F4L A;  4GX1 A;  3ZJZ A;  2AHY A;  4X8A A;  4WFE A;  4LCU C;  2WLI B;  2ITC C;  3ABK C;  4XDK A;  3WG7 C;  3KG2 A;  4LP8 A;  1M56 C;  4G27 B;  4P9O A;  2Q67 A;  2KB1 A;  2Q68 A;  3LNM B;  2HFE C;  4JTC B;  4PDM A;  4RAI A;  2NLJ C;  4X88 A;  3FB7 C;  3E86 A;  3RBZ A;  4GX2 A;  2Q69 A;  1LNQ A;  2OCC C;  2Y69 C;  5EBL C;  1KKD A;  1ZWI C;  4P9P A;  3E8F A;  4DXW A;  3T4Z A;  2X6A A;  2X6C A;  3FB8 C;  1OCR C;  4UUJ C;  1G4Y B;  4PA3 A;  4WFH A;  1ORQ C;  4H37 A;  3RW0 A;  3K06 A;  3LUT B;  3E8B A;  3F7V C;  5BZB A;  4PA7 A;  5CBG A;  5IY5 C;  2EIJ C;  3AG4 C;  2X6B A;  4P2Z A;  4WFF A;  1R3L C;  2A0L A;  2YEV A;  4RUE A;  2AHZ A;  3GB7 C;  4OXS A;  4R7C A;  1OCC C;  4QNH B;  4PA6 A;  1R3K C;  5J9P C;  3SYP A;  3LDC A;  5EC2 C;  3F5W C;  2A79 B;  4MVU A;  3FB5 C;  4PA4 A;  5B3S C;  4JTD B;  4TWK A;  1K4D C;  1P7B A;  2R9R B;  5KUM A;  1V54 C;  5E1A C;  2WLL B;  3OUF A;  2EIK C;  4G28 B;  5EBW C;  3ABL C;  2DWE C;  2HVK C;  3RVZ A;  3SYO A;  2Q6A A;  5CBH A;  3X2Q C;  1V55 C;  2WLI A;  2A9H A;  4R6Z A;  4MVQ A;  4P30 A;  3SYA A;  4HYO A;  3OR6 C;  4EKW A;  3SPH A;  3AG3 C; 
#chains in the Genus database with same CATH topology
 4KFM A;  5GTH Z;  3K03 A;  4LFB O;  5K1P A;  4FLT A;  1N4C A;  1R3I C;  3CYO A;  2IH1 C;  2EUL A;  1JCH A;  1H38 A;  2CDY A;  3ZRS A;  2UXX A;  2DMX A;  1V54 B;  4YIO A;  2HVJ C;  4FFK A;  3CE2 A;  3ZS8 C;  1THZ A;  4DV6 O;  3K59 A;  3JAW B;  4MVO A;  2UUA B;  2LJ2 A;  3OGC C;  1ZLZ A;  5FL7 G;  1JVM A;  2QSA A;  1L1F A;  1XMQ O;  1Q86 W;  3M99 B;  5D5P A;  4B3S O;  4WFB V;  3UM7 A;  4DR3 B;  4IIJ B;  1NU1 H;  3ZN1 A;  2EIN C;  3CSX A;  4I4T A;  4ZI7 B;  2EIL C;  4KL1 A;  3BA9 A;  4TQF A;  1H2K A;  1QVG U;  1XMO O;  4LF5 B;  3CC2 V;  3JAS A;  2NNU A;  2UUA O;  3GWO A;  4ZHQ B;  1YSC A;  3FB7 C;  2MK3 A;  4GX2 A;  2Q69 A;  1B3Q A;  4O2B A;  3B4S A;  2G38 A;  3AG7 A;  1K92 A;  4FLW A;  5JCO C;  4TT3 G;  3L75 H;  2LW1 A;  2AGA A;  3AK3 A;  1Q6I A;  2GSM B;  3S3X A;  2O57 A;  1XQ8 A;  1G6U A;  2N74 A;  4JI6 B;  2CTQ A;  2DE0 X;  2QGN A;  1VQL V;  3ABM B;  1H2L A;  3IC9 A;  4TOI A;  3WB0 A;  4NB5 A;  3RN4 A;  3J7A U;  2VQF O;  2UUB O;  1YZB A;  4B3T B;  3MHH C;  1K3E A;  3UQ8 A;  2W6J G;  4PI2 A;  3ABL C;  2H94 A;  3JAW A;  1FJG O;  4L8J A;  2VQE B;  1N33 B;  4O2A A;  4EB6 B;  3C90 A;  2ZQM A;  3OEH G;  2HHH O;  5H6R A;  3BAA A;  4XDJ A;  1PNL A;  4HAM A;  1YTF D;  3E89 A;  4NR1 A;  1PL4 A;  2KSD A;  3D3I A;  3AG2 C;  1HNW O;  4XDL A;  3APO A;  1N34 B;  1YCI A;  4IGG A;  5H2F Z;  4BW5 A;  2D3O W;  3F7Y C;  4ZI7 A;  4JI4 O;  3JSL A;  4J7K A;  2QTO A;  4B3T O;  3ASO C;  3VBB A;  2JGU A;  3ETQ A;  1PM9 A;  4LBE C;  2QDO A;  5JQG B;  1K97 A;  4ZHQ A;  3E35 A;  5B1N A;  3MAQ A;  3IAY A;  2YEV B;  2CTW A;  2LFS A;  2YIB D;  1JFF A;  1YIT V;  4DR4 O;  1R6K A;  5FPR A;  1B04 A;  3JAR B;  4LF9 O;  3JCU Z;  4UVC A;  1BHA A;  3CC4 V;  4D7S A;  4DV3 O;  1VIB A;  5B1B B;  4NTY A;  1GM9 A;  5IYB O;  1NTZ H;  4E4E A;  1FXK A;  2DYR B;  3E86 A;  1QQC A;  4EB6 A;  1HR0 B;  4DK0 A;  4UCO A;  4EEQ A;  4FZ1 A;  3P3P A;  4QPK A;  4E2L A;  3CRQ A;  3E8B A;  1DLB A;  4YHH O;  3BVO A;  1SC5 B;  2Y4U A;  1P7G A;  4LWS B;  3HKC B;  5KUM A;  4GKK O;  2OCH A;  1M56 B;  1NR7 A;  1XOU A;  5L3E A;  4DV4 B;  5JQG A;  2QEX V;  1PKX A;  3H1L H;  2WLI A;  2A9H A;  1VP7 A;  3FKS G;  4P30 A;  3OR6 C;  4J80 A;  1WB8 A;  5JJJ B;  4X9Q A;  2QWR B;  1KUQ A;  1H2M A;  4WCE V;  2W6I G;  2IU3 A;  4TUY B;  1OJH A;  3JAR A;  3THO A;  4LF8 O;  2GUZ B;  2ZD9 A;  5EZY B;  1AVM A;  2CH7 B;  1X59 A;  2YC0 A;  4QE9 A;  1AJN A;  3K04 A;  4PA9 A;  3ZRW B;  4YY3 B;  4JI7 B;  4IT5 A;  1ZSP A;  4FMT A;  2ADP A;  3STL C;  4R8C A;  3I56 V;  3CX5 F;  1J5E B;  2Q8V A;  1NR1 A;  4JAS A;  1R6T A;  3IGA C;  4K3A A;  1K7D A;  2CTR A;  2VWK A;  2ZM6 B;  4LWS A;  3IC7 A;  5KLV H;  3DC6 A;  4NKG B;  2UXB O;  4GX1 A;  2RMK B;  1XNQ B;  1KU9 A;  1OCO B;  2Y69 C;  4DV1 B;  3E8F A;  3N2G A;  5KAI Z;  5LP6 C;  1X4T A;  3JAM N;  1N8R W;  1YJN V;  4WFH A;  1ORQ C;  4H37 A;  1J5E O;  2QTS A;  2QE7 G;  4UVB A;  1ZUQ A;  4WFF A;  3CXH F;  4JAU A;  4QPJ A;  2ZM6 O;  2C2A A;  2UUC O;  2GUZ A;  1VAR A;  4UCU A;  5EZY A;  4YIP A;  4LR3 A;  1OCC B;  1WA8 B;  4X65 B;  4FZ0 A;  1P49 A;  3CME V;  4NTX A;  2Y0P A;  2JGD B;  5BR8 B;  3ABU A;  1V55 C;  5CA0 B;  1EN4 A;  2QWO B;  1HP8 A;  4CC6 A;  4B3R O;  3CCR V;  1JJ2 U;  1I7F A;  2F95 B;  3IJ4 A;  3B40 A;  4H33 A;  4DW0 A;  3NR7 A;  1GH6 A;  1R73 A;  4A5U B;  4YXW G;  4HBN A;  2M6Y A;  3AG1 C;  1L0L H;  2BCC H;  5B3S B;  4DYL A;  4DV5 B;  4ICG A;  2WLK A;  1I0H A;  3R65 A;  3RYC B;  1EN5 A;  2Q7H A;  4MVM A;  4UCV A;  3G6E V;  1CXZ B;  4LFA O;  2F23 A;  1IUR A;  1XUQ A;  1M93 A;  2ZR2 A;  2Q73 A;  2A7W A;  1GM8 A;  1LUV A;  1SQG A;  3BCC H;  3AK2 A;  2DN9 A;  3ZMT A;  3HPL C;  3T1Y B;  3HR0 A;  1H2N A;  4AQY B;  3FB6 C;  1YEW A;  1Y66 A;  1BE3 H;  1D5N A;  2IM9 A;  1YVW A;  3JYC A;  2RN9 A;  1WA8 A;  3OD4 A;  5CB4 A;  1MA1 A;  1GN3 A;  2B5U A;  1QNM A;  2Q67 A;  5IDJ A;  2JGD A;  3KCX A;  2QM8 A;  1KKD A;  5CA0 A;  4PI0 A;  4GUN A;  2LFR A;  3HKD B;  3ZMU A;  1XRE A;  4JI1 O;  4D7T A;  4X20 B;  3LUT B;  4UB6 Z;  2B9Z A;  1MSD A;  3GB7 C;  1R3K C;  4OGQ B;  1VEW A;  3ZMS A;  4BIZ A;  5JH7 B;  1K4D C;  3ABK B;  3RYC A;  1V54 C;  1IBL O;  1AP6 A;  2AZ2 A;  5IJ9 B;  2R70 A;  3ZHV A;  5KHG A;  1FS0 G;  3QO5 A;  3UT5 B;  1ZL8 B;  3JAL A;  3O9O A;  2EJ7 A;  2LP7 A;  5TIS Z;  4GZR B;  4NTW A;  5LYJ B;  1YI2 V;  2IJK A;  1E79 G;  3UO3 A;  5BXZ A;  4B3M B;  1MG1 A;  1GO3 F;  1HNX O;  1XHZ A;  2DQ3 A;  1I5X A;  2EIK B;  4JV5 B;  2YIC A;  1BS3 A;  3VQY A;  5IE9 A;  1FXH A;  3IFX A;  1Y74 B;  2YI9 A;  5ITZ A;  3VQW A;  3OTO B;  2UU9 B;  3JAK A;  4DUZ B;  3JD4 A;  1FFT B;  3UKM A;  4ABM A;  4X20 A;  1QLE B;  3K08 A;  3ZRV A;  1NZ6 A;  4GX5 A;  4AHC A;  3ABM C;  4FIP C;  3G71 V;  4DV7 O;  2YXY A;  4WFE A;  1TUB A;  4LCU C;  4LP8 A;  5EIB D;  3CRM A;  4W4L A;  4NYK A;  4O4L B;  4DUY O;  5EBL C;  2CGO A;  3UT5 A;  1ZL8 A;  3N27 A;  3P30 A;  1Q3E A;  3D8C A;  2PZS A;  3RW0 A;  1S5J A;  3F7V C;  2F4V B;  4FLZ A;  1E1R G;  1D5A A;  5IWA O;  2JJ2 G;  2XAQ A;  3OMN B;  4O4H A;  4X1I A;  4FM1 A;  4F6E A;  5LBQ A;  3AK1 A;  3WFV A;  4WF9 V;  3MHS C;  1XIL A;  2Q6A A;  1Y74 A;  5CBH A;  4DR2 B;  1Z5W A;  4LF4 B;  4JI5 B;  1WNS A;  4DR1 B;  4D6T H;  4EFB A;  4JYA B;  4JI0 B;  4MTO A;  4PD4 F;  5CMU A;  5LMU B;  3K57 A;  1BQ0 A;  3HKE B;  4Q6G A;  1DK1 A;  4RUF A;  1BSM A;  4NXM B;  2L6L A;  3M8A A;  4JAV A;  1AR5 A;  1HWY A;  3CCQ V;  3B8N A;  3RVY A;  1Q6U A;  1YIJ V;  3JAS B;  4U3J A;  1JMK C;  3T2M A;  3E8H A;  5LXT B;  2XHB A;  5B1B C;  2WLL A;  2DYR C;  3SPJ A;  5LHI A;  4JI5 O;  4QGP A;  4MW3 A;  3AG3 B;  1M57 B;  5KUK A;  4CH4 A;  3SPG A;  3CCL V;  4CS2 A;  2RCV A;  4JTA B;  3TGU H;  3LNN A;  2GBO A;  3G6B A;  3E8G A;  4Z1V A;  4BIO A;  3CCE V;  4NXM O;  2QA4 V;  1F4M A;  1IDS A;  4RQE A;  1YF2 A;  1VQ4 V;  2CAZ C;  4CZZ A;  1UPG A;  1M56 C;  3T1H O;  3E22 B;  2PF4 E;  4JTC B;  4O2A B;  3J80 N;  3QTC A;  3VQV A;  3UCS C;  2X6C A;  2QM4 A;  4UV9 A;  4BWA A;  3CHX A;  1YDX A;  2BSK A;  1RFY A;  3HKE A;  2ZNJ A;  2QJ1 A;  2VS0 A;  4GYC B;  1AI4 A;  1ZX3 A;  2ILM A;  3CCU V;  3JD0 A;  3BAB A;  3ZN0 A;  1S3J A;  3QVN A;  1GN4 A;  1Z5V A;  5GTI Z;  2R9R B;  3QG5 A;  2IU0 A;  5LXT A;  1K34 A;  2XAH A;  2YXH A;  4U7N A;  5GW7 A;  3ZHQ A;  5CA3 A;  4IYI A;  4DR3 O;  1GKF A;  1JFF B;  1D2D A;  4B08 A;  3NXS A;  1Q6H A;  3FFQ A;  3STZ C;  1FKA O;  5H5N A;  2VRZ A;  3TET A;  3CCJ V;  3GWK C;  2XUM A;  4DV2 B;  4JYB A;  1K4C C;  2ITD C;  1BZK A;  4AIL C;  4LF5 O;  2JEX A;  1AIL A;  3C3S A;  4ZOL B;  2P7T C;  1FXK B;  3E22 A;  3QO8 A;  2Q4P A;  3U11 A;  4JPR A;  1OCO C;  1BCC H;  5JVD B;  4JI6 O;  5L3G A;  2WLJ A;  1YTF B;  3WB1 A;  1CEZ A;  2RJZ A;  4FM0 A;  1Q7Y W;  2OTL V;  4HNA B;  2ARH A;  1TVK A;  3U0Z A;  1K33 A;  2WLH A;  1M1K W;  5A2Q N;  2AHY A;  2LGW A;  4TQD A;  2WLI B;  1FYJ A;  1LR1 A;  2VQE O;  1N33 O;  2KB1 A;  5KHH A;  4G2K A;  4I50 B;  2ZE6 A;  4X88 A;  1HNZ B;  3OFN G;  2JS5 A;  4IHJ B;  1PP9 H;  2Z5U A;  5KA5 A;  1OHH G;  5IYC O;  2ZIN A;  5IJ0 A;  3SJA C;  4WBN B;  3RGB A;  1GTO A;  1N34 O;  4LF7 B;  1EZJ A;  5B66 Z;  4RUE A;  1WAZ A;  4R7C A;  1W0J G;  3K3W A;  1N36 B;  2PYL A;  4PA4 A;  5B3S C;  1US6 A;  3LSQ A;  4ZOL A;  4GKJ B;  3ZBH A;  2IBZ H;  4DK1 A;  1MNG A;  2HVK C;  2IJJ A;  2OCC B;  4DV0 B;  2Y4T A;  2XAS A;  1K73 W;  3DGE A;  1PNM A;  5JVD A;  3ZCC A;  1OCR B;  3RYF B;  1JPX A;  4LC1 A;  4EFE A;  1NH2 D;  4HNA A;  3OM3 B;  1NH2 B;  1Y4M A;  1VMG A;  3OT7 A;  4X1K B;  4J7Z A;  1S5H C;  4MVS A;  5FNV B;  4GKJ O;  1NI8 A;  4TV8 A;  3W7W A;  4JF3 A;  3RYI B;  1AI7 A;  3N2G B;  4I50 A;  3WB2 A;  2GDS A;  1HR0 O;  3L71 H;  3CCV V;  3DSQ A;  3L73 H;  4IHJ A;  2JDI G;  1S76 D;  4PDL A;  2P5O A;  2XAG A;  4WBN A;  2YDE A;  5IYD O;  2EIM B;  5HFL A;  4FK5 C;  2Q7G A;  4NXN B;  1BQZ A;  1Y76 B;  3ASN B;  5B5E Z;  3D36 A;  1YJW V;  2CGN A;  5LGT A;  1SF9 A;  4CS3 A;  1H8E G;  2IJH A;  1Q8I A;  3B77 A;  4DV4 O;  4X8A A;  3F5T A;  3ABK C;  2A3Q A;  1L8D A;  1LNQ A;  4QIW F;  4TSF G;  3RYF A;  3FB8 C;  1VF5 B;  4BR6 A;  3PN1 A;  1IX9 A;  2A06 H;  4X64 B;  5LHH A;  1I08 A;  3ZMV A;  5IYZ A;  1HDJ A;  4N21 A;  4X1K A;  5EC2 C;  3FB5 C;  5FNV A;  5LHG A;  4YY3 O;  2EIK C;  2X0L A;  4JI7 O;  3RYI A;  5LMN B;  4LH6 A;  2PI5 A;  4CH6 A;  1H2G A;  4MVQ A;  2WA4 A;  3W7S A;  5L3F A;  2CE4 A;  2BTO A;  3DTU B;  2QKS A;  5LGU A;  4GX0 A;  3EFF K;  1Q43 A;  3R66 A;  2PYJ A;  2K9P A;  1QLE C;  2BOC C;  4X89 A;  1M4U A;  2EIJ B;  4X64 O;  3TJT A;  4DO2 A;  4UCS A;  1AB3 A;  2QR4 A;  1Y76 A;  4JZG A;  4O4I B;  4WFG A;  5KHI A;  1Z2G A;  5CB4 B;  1ENV A;  3JD3 A;  2GHY A;  2ADQ B;  3MD0 A;  1XNQ O;  5K1X A;  4JGS A;  2CK3 G;  1N0N A;  2JEU A;  3FD9 A;  4ZIB A;  4DV1 O;  3CEI A;  4X62 B;  5EIB C;  1XI1 A;  5AG2 A;  4PDV A;  3SPI A;  2EZP A;  3W7T A;  4LFC B;  2CUG A;  4UXN A;  4UCR A;  5JCO A;  3SJQ C;  1VQN V;  5FLX N;  1RPO A;  1WB7 A;  1EBO A;  4X65 O;  3OR7 C;  5LL6 Y;  1IZ3 A;  2DWD C;  1F4N A;  4F4L A;  4OPA A;  5BR8 O;  2OYQ A;  4JI3 B;  3CXC U;  4RAI A;  1K5S A;  3OE7 G;  1WP7 A;  5DED A;  3JAL B;  2OWO A;  2YS8 A;  1N32 B;  2WAM A;  5J2T B;  1KYO F;  4FLY A;  1IXM A;  1VQ9 V;  3LSU A;  4O4J B;  4N23 A;  2A0L A;  5KHK A;  4DV5 O;  2CTP A;  4O4I A;  1OCZ B;  1VQ5 V;  3F5W C;  4MVU A;  2GV9 A;  1Y67 A;  4FLU A;  2EBO A;  2DWE C;  2V7Q G;  3RVZ A;  5F2V O;  5ITZ B;  1QCE A;  2AW9 A;  5CN0 A;  3JAK B;  4RWU A;  3APQ A;  3P3N A;  3SDL A;  3H01 A;  3DC5 A;  2E74 B;  1GAX A;  3AG3 C;  3H1I H;  3T1Y O;  4AQY O;  4JI8 B;  1URF A;  3AG4 B;  2WWW A;  3BEH A;  1NTK H;  2W0F C;  3ZRX A;  4GT1 A;  4BW9 A;  3ZHT A;  1TUB B;  4JAA A;  1IBK B;  4I55 B;  2OTJ V;  2ZE8 A;  4DR6 B;  3CD6 V;  1SQB H;  1VF6 A;  3CRC A;  1PPJ H;  2FL4 A;  5B1O A;  3SPC A;  4UFZ A;  1QBZ A;  2DQ0 A;  4CBC A;  1SQP H;  3K0G A;  3SYC A;  1Q90 D;  2JVD A;  5EYP A;  3VOU A;  2PUS A;  1XL4 A;  3CJH B;  5IT9 N;  4MT8 A;  5J2T A;  1VQO V;  4J11 A;  5EBM C;  4DR5 B;  4JI2 B;  2DYS B;  5FPO A;  1SA0 B;  4O4J A;  4Z2W A;  4JZ2 A;  2P67 A;  2QKC A;  4K8X A;  2F1M A;  4O4H B;  5BY1 A;  4X1I B;  4MVR A;  4GCZ A;  2N05 A;  2F93 B;  4CH5 A;  1KQS U;  5H6Q A;  2GTA A;  1FD9 A;  1U96 A;  1O9H A;  1SS3 A;  3ZED A;  1FAF A;  2PTM A;  1EZV H;  5LOV B;  4B7K A;  2IJI A;  4K0K B;  3A0H Z;  2GTS A;  3ZMZ A;  5L3C A;  2QKA A;  3VQX A;  1I94 B;  4B3M O;  1OV9 A;  5CBG A;  1VQ8 V;  3BFR A;  1XNR B;  4CH3 A;  2WPD G;  4U3J B;  3TXS A;  3CS5 A;  2WSS G;  3SR2 C;  4K8Z A;  4JV5 O;  4Z1M G;  4I55 A;  1AJP A;  3H9V A;  2X7R B;  3FAV B;  3RT3 C;  5LGN A;  5BMV B;  2WLL B;  5E79 Z;  2V1D A;  1FXK C;  3U10 A;  3SYO A;  3OTO O;  2UU9 O;  4DUZ O;  3ETE A;  3ZHU A;  1Q81 W;  4X1Y A;  3SYA A;  4WFA V;  4EKW A;  3CJH A;  3SPH A;  1IBM B;  1N0J A;  1BHB A;  3FYE B;  1SA0 A;  2H3O A;  3T4D A;  4LNU B;  3CWB H;  4J10 A;  1S77 D;  4MTG A;  5J2U A;  3D3Q A;  2QM7 A;  2DOS A;  1NJI W;  4I5S A;  3B8M A;  1XHX A;  3L9D A;  3X2Q B;  1NS1 A;  2HJD A;  1EM1 A;  2E5L B;  3HKB A;  2BSK B;  5LOV A;  1NTM H;  4MVZ A;  2F4V O;  3LDD A;  2XAF A;  4J9Y B;  2UXC B;  4QE7 A;  1TAE A;  1H2S B;  3S3W A;  4I0X B;  1YJ9 V;  1RSO B;  2ODM A;  4KP4 A;  2V4D A;  2QWP B;  3T1C A;  5DM6 V;  4JYY A;  3D36 C;  4LFB B;  4K35 A;  3OGI B;  2P4V A;  3FAV A;  5BMV A;  4DR2 O;  4LF4 O;  4CS4 A;  4G27 B;  4DR1 O;  3JD2 A;  4JYA O;  2ETN A;  1KB9 F;  4JI0 O;  1H8H G;  5LMU O;  1XBL A;  2OCC C;  4UCT A;  4DV6 B;  2E5L O;  2P90 A;  1QHT A;  3T4Z A;  1OCR C;  3MDS A;  1WN7 A;  2P4K A;  2ZDI A;  1G4Y B;  1XMQ B;  2YXL A;  3K06 A;  3QO7 A;  4PA7 A;  4B3S B;  4LNU A;  4QJF B;  4QNH B;  1BT8 A;  1F7Y A;  3SYP A;  3H1K H;  1QVF U;  1UFI A;  3EHB B;  4TWK A;  3EXA A;  1MAB G;  2FTK A;  1RPR A;  1XMO B;  2QWN B;  1HW7 A;  1KMI Z;  2L35 A;  2ZE7 A;  5LA6 A;  3JAT B;  4B7E A;  2FYU H;  1TVK B;  3JSN A;  2EJR A;  1SES A;  2YUA A;  5EC1 C;  2ZIM A;  2EIM C;  4I0X A;  1RSO A;  3K5N A;  3L72 H;  3K9S A;  4TV9 A;  2JJ1 G;  2K1E A;  3ASN C;  1QR8 A;  3TK1 A;  4X66 B;  1RM1 B;  4FJC C;  5KX5 A;  3TCU A;  2VQF B;  2UUB B;  2UXD B;  1M90 W;  2ZR3 A;  4J42 A;  4H44 B;  2DW4 A;  5IJ0 B;  1T5E A;  3OTF A;  1VQ7 V;  1W2B U;  1FJG B;  5KAF Z;  3LDE A;  3K9A A;  2EX3 A;  1JJO A;  2RNB A;  2HHH B;  3QF7 A;  1L0N H;  2BTQ B;  1PV0 A;  4X66 O;  1EFR G;  3ZJZ A;  1HNW B;  3BRC A;  4FVM A;  4JI4 B;  2UXD O;  5DN6 G;  1KKC A;  3DXR B;  1V9P A;  1Q82 W;  4GLX A;  1AI5 A;  2WA3 A;  2R72 A;  5B1A B;  1GK9 A;  4PHZ A;  1B06 A;  3JAT A;  1WLE A;  4PA3 A;  4H0L B;  4DV2 O;  1YHQ V;  2ZXW B;  2F66 C;  3BY6 A;  1MOF A;  2EIJ C;  3BA8 A;  1R3L C;  1AI6 A;  1AJQ A;  1OCC C;  4IIJ A;  1K5Q A;  4I7Z B;  4TV8 B;  2E3C A;  3HB3 B;  3A0R A;  2PGG A;  5JJN B;  1QR9 A;  4DR4 B;  3LSS A;  3WG7 B;  3I55 V;  1P4R A;  4G28 B;  4LF9 B;  2PY5 A;  3ABT A;  1BGY H;  2XTA A;  4DV3 B;  3TXQ A;  1G8M A;  2YI8 A;  3CMA V;  2Y0I A;  2UXN A;  5IY5 B;  3L74 H;  3K79 A;  2BOB C;  4AI8 A;  3ZHS A;  3G80 A;  1IVS A;  1XL6 A;  3K58 A;  4Q20 A;  2BTQ A;  1FXV A;  4YHH B;  1R3J C;  2Q9L A;  2ZCE A;  2ZKO A;  2JRI A;  1VF6 C;  4PJ0 Z;  1R1B A;  2AXT Z;  1HNZ O;  1E1Q G;  4GKK B;  3DXR A;  1WPB A;  2AZ0 A;  2WLM A;  1VF7 A;  3P32 A;  4LF7 O;  4F6R B;  1NVP D;  1QU7 A;  1A32 A;  4U3F H;  5IYZ B;  1NVP B;  2Y48 A;  1N36 O;  1FPO A;  2KKW A;  2FML A;  1AR1 B;  1OCZ C;  5GON B;  4I9W A;  1G1X B;  2D2C B;  3JD1 A;  1SZT A;  1XEQ A;  4DV0 O;  2ITC C;  2IW5 A;  5CA1 B;  4P9O A;  2Q68 A;  4LF8 B;  2HFE C;  1JQ0 A;  3ICX A;  2R9I A;  1GN6 A;  1KP2 A;  1ZWI C;  1UJW B;  2X6A A;  3KKY A;  1K8A W;  2ZIO A;  4BAY A;  1MSW D;  4PV1 B;  3AG4 C;  4P2Z A;  1CP9 A;  2EIN B;  1JR9 A;  5L3B A;  4KHP B;  2YEV A;  3WU2 Z;  4PA6 A;  3CPW U;  2HLD G;  2EIL B;  2YIA A;  3LDC A;  1DGS A;  3RWR D;  2YIB A;  4H13 B;  2P6J A;  2UXB B;  1S72 V;  3B09 A;  3OEE G;  3SJC C;  3K5L A;  1KBH A;  1R6N A;  1SQQ H;  1RP3 B;  4F6R A;  4NXN O;  3E83 A;  3CCM V;  2ZNI A;  1FFX B;  2FKX A;  4PEL A;  2JS3 A;  3OW2 U;  4FPP A;  3A0B Z;  2DYS C;  4KHP O;  3C3T A;  1VQ6 V;  5GON A;  1ZAU A;  1PNK A;  3A2F A;  3FX7 A;  3ABL B;  5CA1 A;  2UUC B;  3HKC A;  1KD1 W;  3SYQ A;  5L3D A;  1SQV H;  2QWQ B;  5EK0 A;  1KC8 W;  3A8T A;  5HFM A;  3OUS A;  4B3R B;  1K9M W;  1O9G A;  2NN4 A;  3AG2 B;  1SER A;  3K0D A;  2E76 B;  4ZBM A;  1COW G;  3ASO B;  1AR4 A;  3JCZ A;  5LMN O;  4DW1 A;  3OMI B;  5A9G A;  4TUY A;  1WJZ A;  3CP1 A;  5C8Y B;  3LNM B;  2CH7 A;  1SRY A;  1XDC A;  3ZRW A;  4LFA B;  4KXR A;  2YSU B;  1YXB A;  4L87 A;  4YJ2 B;  2VWJ A;  2Z3Y A;  4UUJ C;  1F23 A;  1FFX A;  2Q5Z A;  3L70 H;  2ZDI C;  2Q0A A;  1KEC A;  1JOY A;  5BZB A;  3ETD A;  2N04 A;  1Q5O A;  2AHZ A;  1JX9 A;  1ARO P;  1SET A;  3H1H H;  3RFR A;  1TUE B;  2A79 B;  4U7O A;  1P7B A;  3B2E E;  5E1A C;  4BIU A;  4UB8 Z;  5EYP B;  4X62 O;  2KG7 B;  1B6Q A;  2P06 A;  1PL0 A;  4W4K A;  4LH7 A;  2FB5 A;  3X2Q C;  4DRX B;  2Q0O C;  2W0X A;  3GVM A;  4R6Z A;  4LFC O;  3SGI A;  1IXB A;  1W0K G;  4HYO A;  2LQT A;  2RDC A;  2Q7E A;  3ZHR A;  2ZT9 B;  2EZO A;  2OT5 A;  5JJE B;  1I5Y A;  2MW2 B;  3AEI A;  3Q4H B;  4JI1 B;  4J9Z B;  1SQF A;  5D5Q A;  1J95 A;  4OX9 B;  1TA8 A;  4FLV A;  4JI3 O;  3BPZ A;  2B1I A;  1BL8 A;  2BE3 A;  1ROP A;  1N32 O;  1LUW A;  4R50 A;  4PDR A;  1EN6 A;  5C8Y A;  4DR7 B;  1S5L Z;  1M57 C;  3H1J H;  4MTF A;  2OIG A;  1IBL B;  1QLN A;  3W7U A;  2OIE A;  2ZE5 A;  3KCY A;  5KHJ A;  5CBF A;  1WP8 A;  3CB2 A;  4YJ2 A;  2WLN A;  3K5O A;  2PI4 A;  4JYC A;  2HKO A;  3I5D A;  3QNE A;  1TGO A;  3CRR A;  4IL6 Z;  2HJF C;  1Y6X A;  4MW8 A;  4XBF A;  1GN2 A;  4OX9 O;  2P22 C;  4MSW C;  2JIZ G;  1BMF G;  4RQF A;  4HZ3 A;  2DJV A;  3OAA G;  1CPY A;  1KP3 A;  1NBM G;  2F43 G;  3BHP A;  1NT2 B;  2KG7 A;  2Z0A A;  1HNX B;  4X1Y B;  4I9Q A;  4DR7 O;  4PDM A;  4UV8 A;  2NLJ C;  4DRX A;  3RBZ A;  1JA8 A;  1VQK V;  2NR5 A;  4JI8 O;  4P9P A;  4FLX A;  4DXW A;  3UO2 A;  3CCS V;  1VQM V;  1U97 A;  1DTO A;  5C93 A;  3G4S V;  2YID A;  3Q4H A;  4LF6 B;  1IBK O;  4OPH A;  4YJ3 B;  4DR6 O;  4ASU G;  5J2U B;  4FFB B;  3ETG A;  4KUM A;  5J9P C;  1ZTE A;  4ZKI A;  4JTD B;  1P84 F;  2LW7 A;  3FYI B;  1M9N A;  3E2E A;  3OUF A;  2LGQ A;  5EBW C;  1RM1 C;  4DV7 B;  3HKB B;  5H9C A;  2Y69 B;  1AP5 A;  5LP6 B;  4DR5 O;  4JI2 O;  1SKV A;  1VQP V;  4DUY B;  2KQX A;  1MZF A;  1WPX A;  3OMA B;  3HKD A;  3G67 A;  1F51 A;  4LF6 O;  1NQT A;  2IH3 C;  3EVK A;  1GMG A;  3K5M A;  3RYH B;  2XAJ A;  3KZI Z;  4RO2 A;  1SQX H;  2B1G A;  3N2K B;  5IWA B;  3W7X A;  5JWP A;  2XND G;  2ATK C;  2HP8 A;  4MTX A;  3J81 N;  1V55 B;  5JH7 A;  5KMG B;  4K0K O;  1DF5 A;  2LO1 A;  4MS2 A;  2HR3 A;  1S0V A;  1I94 O;  5B1A C;  4C7U A;  1PD3 A;  5IJ9 A;  4IYH A;  4FM2 A;  1XNR O;  1M5I A;  2HG5 C;  5DEC A;  3CRA A;  4NVP A;  2H8P C;  3PJS K;  2HEP A;  2E75 B;  5KA6 A;  3AG1 B;  4YJ3 A;  2ZXW C;  4FFB A;  3SJB C;  5LYJ A;  2XOK G;  2RQ6 A;  1OZ0 A;  2JK5 C;  3M7M X;  4XDK A;  3WG7 C;  3KG2 A;  3CC7 V;  3ML0 A;  4J7J A;  1IBM O;  5LA6 B;  3ZIA G;  1W59 A;  5LP6 A;  1GRJ A;  1MZE A;  4TV9 B;  5IY5 C;  2X6B A;  3RYH A;  4OXS A;  1MMM A;  4I4T B;  5KX5 B;  4J41 A;  1NKD A;  3ZX6 A;  3N2K A;  2XT9 A;  1DF4 A;  5KMG A;  2M7W A;  1GM7 A;  4CC5 A;  4UVA A;  3T1H B;  2UXC O;  2R9A A;  4O2B B;  3O65 A;  4O4L A;  1SZX A; 
#chains in the Genus database with same CATH homology
 4KFM A;  3DTU B;  1G8M A;  2QKS A;  4GX0 A;  5LGU A;  3CMA V;  3EFF K;  3K03 A;  2LP7 A;  1QLE C;  2BOC C;  2UXN A;  4X89 A;  5IY5 B;  2EIJ B;  1YI2 V;  2IJK A;  1E79 G;  4DO2 A;  1R3I C;  3K79 A;  2BOB C;  3CYO A;  2IH1 C;  4WFG A;  1JCH A;  1ENV A;  1MG1 A;  1XL6 A;  2GHY A;  1GO3 F;  3JD3 A;  3MD0 A;  4Q20 A;  1FXV A;  1H38 A;  3ZRS A;  2UXX A;  2DQ3 A;  1V54 B;  1I5X A;  1R3J C;  2EIK B;  2HVJ C;  4JGS A;  2CK3 G;  2JEU A;  1THZ A;  1FXH A;  4MVO A;  1E1Q G;  3OGC C;  3IFX A;  5FL7 G;  1JVM A;  2WLM A;  1L1F A;  3P32 A;  1Q86 W;  4PDV A;  3JD4 A;  1FFT B;  3M99 B;  3SPI A;  2EZP A;  3UKM A;  3W7T A;  1NVP D;  4UXN A;  4WFB V;  1QLE B;  3UM7 A;  3K08 A;  3SJQ C;  1NVP B;  2Y48 A;  3ZRV A;  1VQN V;  4GX5 A;  1RPO A;  3ZN1 A;  2EIN C;  1EBO A;  1AR1 B;  3OR7 C;  1OCZ C;  3ABM C;  4FIP C;  4I9W A;  2DWD C;  1F4N A;  2EIL C;  4F4L A;  3G71 V;  3JD1 A;  4WFE A;  4LCU C;  1SZT A;  2ITC C;  2IW5 A;  1QVG U;  4LP8 A;  3CXC U;  4P9O A;  2Q68 A;  3CC2 V;  2HFE C;  2NNU A;  3GWO A;  4RAI A;  1JQ0 A;  1K5S A;  3OE7 G;  1YSC A;  2R9I A;  3FB7 C;  2MK3 A;  4GX2 A;  2Q69 A;  5EBL C;  1KP2 A;  1ZWI C;  2WAM A;  1UJW B;  2X6A A;  1K92 A;  3P30 A;  4TT3 G;  1IXM A;  3RW0 A;  2GSM B;  1K8A W;  1VQ9 V;  3F7V C;  4BAY A;  1MSW D;  3AG4 C;  1CP9 A;  4P2Z A;  2EIN B;  4N23 A;  1E1R G;  2A0L A;  2YEV A;  5L3B A;  1VQL V;  1OCZ B;  3ABM B;  4PA6 A;  1VQ5 V;  2JJ2 G;  2XAQ A;  2HLD G;  3CPW U;  3OMN B;  2EIL B;  3LDC A;  3F5W C;  4MVU A;  3MHH C;  1K3E A;  2EBO A;  5LBQ A;  2W6J G;  3WFV A;  3ABL C;  2DWE C;  2P6J A;  2V7Q G;  2H94 A;  3RVZ A;  1QCE A;  5CN0 A;  4WF9 V;  3MHS C;  2Q6A A;  5CBH A;  1S72 V;  3OEE G;  3H01 A;  1R6N A;  3AG3 C;  4MTO A;  3E83 A;  2ZQM A;  5CMU A;  3OEH G;  5H6R A;  3CCM V;  4XDJ A;  4PEL A;  1PNL A;  4HAM A;  3OW2 U;  3AG4 B;  3E89 A;  1YTF D;  4FPP A;  2WWW A;  3BEH A;  2DYS C;  2W0F C;  3ZRX A;  1VQ6 V;  4GT1 A;  3D3I A;  4RUF A;  3AG2 C;  4XDL A;  4JAV A;  4BW5 A;  2OTJ V;  2D3O W;  3F7Y C;  3CD6 V;  1HWY A;  3CCQ V;  1PNK A;  2QTO A;  3B8N A;  3RVY A;  1YIJ V;  3ASO C;  3VBB A;  3ABL B;  3T2M A;  5B1O A;  3SPC A;  4LBE C;  1KD1 W;  1QBZ A;  3SYQ A;  2DQ0 A;  4CBC A;  3E8H A;  5B1B C;  3K0G A;  1K97 A;  3SYC A;  2WLL A;  5L3D A;  2DYR C;  3SPJ A;  3VOU A;  3E35 A;  5LHI A;  4MW3 A;  3AG3 B;  1M57 B;  5KUK A;  1XL4 A;  4MT8 A;  5B1N A;  5EK0 A;  1VQO V;  1KC8 W;  3SPG A;  3CCL V;  2YEV B;  4JTA B;  2LFS A;  5EBM C;  5HFM A;  3OUS A;  1K9M W;  2DYS B;  3E8G A;  2P67 A;  3CCE V;  3AG2 B;  1YIT V;  1SER A;  3K0D A;  4ZBM A;  1R6K A;  2QA4 V;  1F4M A;  4MVR A;  4GCZ A;  1KQS U;  1COW G;  5H6Q A;  4UVC A;  4RQE A;  1BHA A;  3ASO B;  3CC4 V;  3JCZ A;  4CZZ A;  3OMI B;  1M56 C;  5B1B B;  3CP1 A;  3LNM B;  1GM9 A;  4JTC B;  5IYB O;  1SRY A;  1FXK A;  2DYR B;  3E86 A;  3ZRW A;  2YSU B;  2IJI A;  2X6C A;  4L87 A;  2Z3Y A;  4UUJ C;  3ZMZ A;  4UV9 A;  1F23 A;  5L3C A;  2ZDI C;  4QPK A;  4E2L A;  1KEC A;  1JOY A;  3E8B A;  5BZB A;  1DLB A;  5CBG A;  1VQ8 V;  3ETD A;  1AI4 A;  2AHZ A;  2WPD G;  3CCU V;  3JD0 A;  1JX9 A;  1ARO P;  2WSS G;  3ZN0 A;  1SET A;  1S3J A;  4Z1M G;  1AJP A;  1TUE B;  2A79 B;  4U7O A;  2X7R B;  5LGN A;  1P7B A;  2R9R B;  5KUM A;  5E1A C;  1M56 B;  2WLL B;  4BIU A;  2IU0 A;  2V1D A;  1NR7 A;  1FXK C;  1B6Q A;  3SYO A;  5L3E A;  1PL0 A;  1K34 A;  2XAH A;  3ETE A;  2QEX V;  1PKX A;  4U7N A;  3X2Q C;  1Q81 W;  2WLI A;  5GW7 A;  2A9H A;  4R6Z A;  5CA3 A;  3FKS G;  4P30 A;  3SYA A;  1W0K G;  4HYO A;  3OR6 C;  4WFA V;  4EKW A;  1GKF A;  3SPH A;  2EZO A;  2OT5 A;  3NXS A;  1BHB A;  1I5Y A;  3AEI A;  3STZ C;  3FYE B;  4WCE V;  3TET A;  2W6I G;  3CCJ V;  4J9Z B;  3T4D A;  1J95 A;  2IU3 A;  1S77 D;  4JYB A;  4MTG A;  1K4C C;  2ITD C;  2JEX A;  2QM7 A;  2ZD9 A;  2B1I A;  1BL8 A;  2P7T C;  4QE9 A;  1NJI W;  1FXK B;  1ROP A;  1AJN A;  4I5S A;  3B8M A;  3K04 A;  4PA9 A;  4R50 A;  3ZRW B;  4PDR A;  3X2Q B;  3QO8 A;  1M57 C;  4MTF A;  1QLN A;  3W7U A;  4JPR A;  1OCO C;  4FMT A;  3STL C;  5CBF A;  4MVZ A;  2WLN A;  2PI4 A;  4R8C A;  3LDD A;  3I56 V;  5L3G A;  2XAF A;  2WLJ A;  4J9Y B;  4QE7 A;  4JYC A;  2HKO A;  1YTF B;  1CEZ A;  3QNE A;  1NR1 A;  4JAS A;  1Q7Y W;  2OTL V;  3IGA C;  1YJ9 V;  1K7D A;  2HJF C;  4MW8 A;  4XBF A;  4KP4 A;  3T1C A;  4MSW C;  5DM6 V;  2JIZ G;  1BMF G;  1K33 A;  4RQF A;  2WLH A;  3IC7 A;  1M1K W;  4HZ3 A;  3OAA G;  1CPY A;  4GX1 A;  1KP3 A;  2AHY A;  1NBM G;  2WLI B;  2F43 G;  4G27 B;  2KB1 A;  3JD2 A;  4PDM A;  4G2K A;  4UV8 A;  2NLJ C;  4X88 A;  1H8H G;  3RBZ A;  1OCO B;  2OCC C;  2Y69 C;  1VQK V;  3OFN G;  4P9P A;  2Z5U A;  3E8F A;  2P90 A;  4DXW A;  3T4Z A;  5KA5 A;  1OCR C;  1OHH G;  5IYC O;  3CCS V;  1VQM V;  1N8R W;  1DTO A;  2ZDI A;  5C93 A;  1G4Y B;  1YJN V;  3G4S V;  4WFH A;  1ORQ C;  4H37 A;  1GTO A;  3K06 A;  3QO7 A;  4PA7 A;  2QE7 G;  1EZJ A;  4UVB A;  4WFF A;  4ASU G;  3ETG A;  4QJF B;  4RUE A;  4JAU A;  4KUM A;  4R7C A;  1W0J G;  4QPJ A;  3K3W A;  4QNH B;  2C2A A;  5J9P C;  3SYP A;  1QVF U;  4ZKI A;  4PA4 A;  5B3S C;  3EHB B;  1OCC B;  3LSQ A;  4JTD B;  4TWK A;  3FYI B;  1M9N A;  3CME V;  3E2E A;  3OUF A;  1MAB G;  5EBW C;  1RM1 C;  2HVK C;  2FTK A;  5H9C A;  1RPR A;  3ABU A;  1V55 C;  2IJJ A;  2OCC B;  2Y69 B;  2XAS A;  1K73 W;  3DGE A;  1PNM A;  3ZCC A;  1OCR B;  3CCR V;  1JJ2 U;  1JPX A;  1VQP V;  4LC1 A;  1WPX A;  2EJR A;  1SES A;  3OMA B;  5EC1 C;  4H33 A;  1NH2 D;  1F51 A;  1R73 A;  1NQT A;  2EIM C;  4YXW G;  2IH3 C;  3OM3 B;  1GMG A;  3AG1 C;  2JJ1 G;  1NH2 B;  2K1E A;  3ASN C;  1QR8 A;  2XAJ A;  1Y4M A;  5B3S B;  4RO2 A;  2B1G A;  1S5H C;  4MVS A;  3TK1 A;  2WLK A;  3R65 A;  3W7X A;  2XND G;  3W7W A;  1RM1 B;  2ATK C;  4FJC C;  4JF3 A;  4MVM A;  3G6E V;  4MTX A;  3TCU A;  1AI7 A;  1M90 W;  2ZR3 A;  1V55 B;  1DF5 A;  3CCV V;  2ZR2 A;  2DW4 A;  4MS2 A;  2HR3 A;  1S0V A;  1GM8 A;  1VQ7 V;  1W2B U;  2JDI G;  5B1A C;  1S76 D;  1PD3 A;  4PDL A;  3LDE A;  2XAG A;  2HG5 C;  3ZMT A;  5IYD O;  2EIM B;  2H8P C;  3HPL C;  3K9A A;  3PJS K;  5HFL A;  5KA6 A;  3AG1 B;  4FK5 C;  2ZXW C;  3ASN B;  3FB6 C;  1YJW V;  3D36 A;  1Y66 A;  5LGT A;  1H8E G;  2IJH A;  2XOK G;  1OZ0 A;  3JYC A;  2JK5 C;  1EFR G;  3B77 A;  3ZJZ A;  4X8A A;  4XDK A;  2B5U A;  3ABK C;  3WG7 C;  3KG2 A;  2Q67 A;  5IDJ A;  3CC7 V;  3ML0 A;  5DN6 G;  2QM8 A;  3ZIA G;  1Q82 W;  1LNQ A;  4QIW F;  1KKD A;  1AI5 A;  4TSF G;  5B1A B;  2LFR A;  1GK9 A;  3ZMU A;  3FB8 C;  1WLE A;  4PA3 A;  1YHQ V;  3LUT B;  2ZXW B;  5LHH A;  3BY6 A;  5IY5 C;  1MOF A;  2EIJ C;  2X6B A;  1R3L C;  1AI6 A;  3ZMV A;  1AJQ A;  3GB7 C;  4OXS A;  1OCC C;  1K5Q A;  1R3K C;  3HB3 B;  4N21 A;  3A0R A;  5EC2 C;  1NKD A;  3FB5 C;  3ZMS A;  4BIZ A;  5LHG A;  1K4D C;  1QR9 A;  3ABK B;  3LSS A;  3WG7 B;  1V54 C;  1P4R A;  3I55 V;  2EIK C;  2X0L A;  4G28 B;  1DF4 A;  3ABT A;  2M7W A;  2PI5 A;  1GM7 A;  4UVA A;  1H2G A;  4MVQ A;  3W7S A;  5L3F A;  1FS0 G;  3QO5 A;  1VQ4 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...