4H3PA

Crystal structure of human erk2 complexed with a mapk docking peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
349
structure length
342
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLAFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Protein-peptide complex crystallization: a case study on the ERK2 mitogen-activated protein kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 342
sequence length 349
chains with identical sequence D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4h3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4h3pA01
4DA5A 4O0YA 3R8VA 1PXMA 4O38A 1GZKA 2C0IA 2GU8A 3OWKA 3GC7A 2F4JA 3W55A 1ZOEA 4BDFA 4OGRA 3UVPA 5IH4A 4BCQA 5EH0A 4LUDA 4HGLA 3WI6A 3IDPA 4QMWA 1SM2A 4APCA 4BFMA 1FVVA 3CD8A 4MXAA 4BCHA 1OECA 3LCTA 4L67A 3VRYA 4QMVA 1A06A 1CKPA 3OEZA 4NJ3A 4FSMA 1JKLA 5I5ZA 3JY9A 4YHJA 3MS9A 2VN9A 4JAJA 4QYGA 4XG8A 5TOZA 5EI8A 4D2TA 2BTRA 1FINA 1LR4A 5J1VA 2OFUA 5AUXA 3BHTA 3OHTA 2PMOX 1H1RA 3P86A 2PHKA 5E8WA 5FQDC 5ANDA 2XJ2A 3MB6A 5I9UA 3JUHA 2ZM4A 2ZB0A 2ZYBA 3NNXA 2X8IA 4MQ1A 1XHAA 5IPJA 1YWRA 3AMBA 3NUXA 4P5QA 4LOOA 3SX9A 3E7VA 4YPSA 2XUUA 2W17A 2R9SA 3QQJA 4FSYA 3CPBA 3ORNA 4M84A 3TV4A 2JKQA 3TZ9A 3AXWA 4ACCA 5EM6A 3PSDA 4EUUA 5E8SA 5IA2A 1ZOHA 3MPTA 2GCDA 1IASA 3GVUA 1AD5A 1LUFA 1XH4A 5FBNC 2C5YA 3UBDA 4Y8DA 5AP6A 4CFUA 1E9HA 2HOGA 2W4OA 3F61A 4XV2A 4F70A 1JLUE 1UNLA 2WTKC 3E3BX 3E92A 3QZHA 4DGGA 5J7BA 2BALA 4YTCA 3FPQA 2UZWE 2C6EA 3DGKA 3FV8A 3EQDA 3P7CA 4O7VA 3KREA 1OBDA 3DKFA 5E4HA 1Q8WA 3OW4A 4G3GA 4DTBA 5AWMA 2ZAZA 2VO0A 4IDTA 1FVTA 4IMYA 4ZY4A 4EH5A 5C8MA 4O7RA 3TUDA 2OXDA 5HIDA 4C3RA 3BHHA 5AAGA 1BLXA 2PVHA 1OBGA 5JRSA 4EOMA 1H0WA 5AUUA 3WF5A 2VTRA 2VX0A 3LM5A 4H3BA 4QP1A 2XK9A 3DAEA 3R7IA 4G5JA 2I0VA 4QYYA 4FVPA 4IM3A 4FTRA 2YHVA 2GTNA 4GK2A 3ZS5A 4G6NA 4I1ZA 3DFAA 1Y6AA 2YERA 3DBCA 3GOKA 3G0EA 3W2SA 2BR1A 2GFSA 4JBQA 3FLSA 3ZONA 5AA8A 5DPVA 2UZBA 5FP5A 4C4IA 5CXZA 4XYFA 5T3QA 2B9JA 4XUFA 5C01A 4F7LA 2ITTA 4BTMA 2SRCA 3ET7A 2PPQA 2CGVA 2W1CA 4J1RA 5BQ0A 4U42A 4RC4A 1UWHA 1OI9A 2XNNA 3BGQA 3CE3A 3UPXA 1QPJA 4DT8A 3MIAA 4QTDA 4RVMA 3TG1A 1YI3A 3R8ZA 1OITA 4ANQA 3D7TB 3QC4A 1FMKA 1X8BA 2C6TA 3H9RA 3K5UA 4DEDA 5GHVA 3IOKA 2XIKA 3D7TA 4FTUA 3FYKX 4GMYA 3BU5A 5DEWA 2VO3A 4QO9A 5D12A 3T9IA 4GKIA 3MN3A 3P4KA 2QQ7A 3R00A 3RNIA 2PMIA 4CTBA 4FV5A 4WO5A 5A4TA 5BX0A 2PTKA 4Q5EA 4IAKA 4HNIA 1GOLA 2BTSA 1YOMA 3PVUA 4BDDA 3UNKA 3IOPA 5HCXA 3MV5A 4D58A 4GG5A 2OH0E 4YPDA 4YHFA 5AUTA 1PKGA 2XKDA 4F1OA 2J4ZA 1FGKA 3PUPA 4ZSJA 3ZUVA 1U5RA 2C69A 3BX5A 2IZRA 2QHNA 2ITVA 4RLLA 2YACA 5LWNA 4EONA 4BDEA 4U44A 3ERKA 1R0PA 2WELA 3WARA 4RJ5A 3NWWA 2JC6A 4AOJA 4FL3A 2W5AA 3ZHPC 3ZMMA 1AGWA 5JEBA 1UKHA 3CIKA 4QMNA 4UN0C 1GIHA 4YLJA 4AE9A 2YJRA 2FSMX 2CKOA 3VS0A 2NO3A 1PMUA 2QOIA 3MFTA 4V05A 2QU5A 4JAIA 3S4QA 4ZS4A 2E9NA 4YTHA 4DEEA 4PNKA 3VBVA 3QCSA 3E8EA 4GK4A 4FTAA 4FYOA 5M44A 3HVCA 2UUEA 3EYHA 4O1PA 4FOBA 4OBQA 3EZVA 4NU1A 2Q0NA 3S1HA 3NLBA 4RJ3A 1TVOA 3PJ8A 5B2LA 2WMUA 3LVPA 4C3FA 2JDSA 1IAJA 3ORTA 3KY2A 3FI8A 3OF0A 1H07A 3OMVA 2XNGA 2I0HA 3KULB 3O7LB 4XNEA 4ZTQA 1JKKA 2B52A 3HMIA 4ALWA 4CQEA 2WQBA 3KB7A 3KULA 1EH4A 2JIVA 2UZLA 4TNBA 2IVUA 4GL9A 5DG5A 4I20A 5AUWA 4K18A 2JIIA 4HYUA 3LMHA 4FV1A 3FMNA 1PMVA 1BYGA 4FV0A 1V1KA 1YOLA 4LI5A 5FXQA 3PE1A 5I3OA 4HGEA 2PVYA 1SNXA 1UU9A 3UIBA 5AP0A 1DI8A 2YDIA 2RL5A 3BE2A 2HYYA 3QLGA 4I0SA 4M7IA 4TWPA 2YISA 2BZHB 2O5KA 1ZYCA 2JAVA 2OBJA 4ANLA 5IDPA 5CT7A 5CZHA 3F66A 2GNGA 3VUIA 1WBVA 3E8NA 2O0UA 2OJ9A 3NEWA 2IVVA 2YIXA 4AU8A 2X4FA 4AGCA 3PA3A 4FT7A 2VNYA 4LGDA 3DTCA 1MP8A 5CF5A 1CMKE 3EFKA 4FTCA 4YUQA 3QX2A 3UC3A 3G2FA 3UG1A 4A9YA 3FPMA 4CZYB 4AAAA 3O51A 3QQLA 1U46A 2PZYA 4J95A 2C5XA 4XG2A 5GZAA 3FI2A 4IB3A 5FD2A 4TYJA 3O8UA 2RFSA 4O0VA 1KE8A 3PIZA 3COMA 4GFMA 3IW6A 4KIKB 3WE8A 1Y91A 2J2IB 4AFJA 2IZTA 4RVTA 3HNGA 3EN9A 4BI0A 4M15A 3U6IA 3PZEA 3LHJA 4BDJA 3PXKA 4I22A 2HCKA 4I92A 4W9WA 3C51A 5EHOA 2J9MA 3LJ1A 4JRNA 1TKIA 5F95A 4O81A 4GIIA 3QZGA 5K9IA 4XV3A 5A4QA 5KHWA 4NUSA 3Q6UA 5K0KA 1B38A 3Q60A 4YHTA 3HV6A 2FO0A 2VD5A 2XJ1A 4E20A 5HTIA 4C35A 5KBQA 3CBLA 4RX9A 4ALUA 4FSWA 3JXWA 3S0OA 5T6KA 4F6WA 5M56A 4PPCA 3IGOA 4F09A 4AS0A 5HE2A 3PSBA 4F1TA 1Q61A 3TNHA 1I09A 3I1AA 3RBWA 2XZSA 4DGOA 5JKGA 2Y0AA 4RIXB 3OZ6A 2BILB 1OPJA 4GIHA 4OTPA 4PTGA 5ANGA 2UZDA 1OL6A 4DH8A 4CG9A 2AC5A 3MPMA 2XIZA 4NM5A 4D5HA 4ZTHA 3SOAA 3TV6A 4DINA 3DT1A 3BYMA 4GU9A 3QLFA 5C8KA 4FKQA 4FEUA 1ZYDA 1L3RE 3FMKA 3SW4A 2C6MA 3O0GA 1KE5A 2WTKB 3FWQA 4G3CA 2Q83A 3OS3A 4IX6A 5FTQA 5HGIA 4CZTA 3NUAA 4RWLA 2EU9A 2R64A 4FC0A 4JR7A 4OW8A 3K54A 5J87A 1XR1A 3BHUA 4FIFA 4AN3A 4GKHA 1R3CA 4XRLA 2J0KA 2C30A 4PDSA 5HE1A 3VULA 2J50A 5IA4A 4UZDA 4KBAA 3FHIA 2UZUE 5KE0A 4PTCA 4WNKA 3BWFA 4BN1A 3FDNA 4QQTA 3KU2A 2OLCA 4YR8A 5JFVA 5CAPA 1H8FA 3C7QA 3E8CA 2VGPA 3HLLA 1NVSA 4D28A 5DN3A 4EJNA 3AMYA 4CZUA 1DM2A 1E1VA 2GS7A 2IZSA 3VBYA 2ZM1A 3IKAA 3OWLA 5EQEA 2UZVA 3ZEPA 3O8PA 4BDKA 1A9UA 3EN7A 3KVWA 1Q3WA 3ALNA 5C9CA 2OGVA 1PXOA 4I5MA 3M11A 4I5HA 2XNBA 3QX4A 2BVAA 2GNJA 4EBWA 5CTPA 3ENHA 1QPDA 4FUXA 5EDPA 4OTHA 4V0GB 2ITYA 3HEGA 3Q9XA 4W4WA 3SAYA 3TIZA 3VW8A 4HYIA 5CU2A 4QRCA 4V0GA 5CT0A 2PZPA 3KRXA 1YW2A 2VWBA 4EK5A 4ZZNA 2HZNA 5DVRA 4BBEA 2W1ZA 3UP7A 4X2FA 4NT4A 3CLYA 4RFYA 1BL7A 3G90X 4F6SA 2NRYA 5D7VA 1KE9A 4YBKA 2QKRA 4Y85A 4FTTA 3ZO2A 4CFVA 1G8AA 3POOA 3Q96A 3EFJA 4RWIA 3I0OA 2AC3A 4YTIA 1CSNA 1CM8A 4IX5A 5LVNA 5IMEA 5M08A 3NCZA 1OKYA 2A0CX 4J97A 5DR6A 4QP4A 1Q62A 3KF4A 3ZO3A 4YZ9A 1YXVA 1M7QA 2E2BA 2ZJWA 4ORKA 1ZZLA 3UGCA 4O7TA 2VTSA 1H01A 4EZ3A 2JBOA 2ZV9A 2VO7A 4FT3A 4KKEA 5CZIA 5LCKA 2C5NA 4KIOA 4NTTA 3U4UA 4ANNA 5AADA 1KUTA 3DQWA 3RCJA 1WCCA 2C5OA 4AG8A 4DH1A 3SGCA 3V8SA 3WBLA 4DG0E 3QD0A 5E7RA 5IG1A 1DAWA 4NSTA 2PMLX 3ROCA 1HCLA 1PW2A 4G3FA 4J71A 4C38A 3EHAA 3R6XA 3DPKA 4EJ7A 4RFMA 1GZNA 3VHKA 2OIQA 2OJIA 4KB8A 4W4YA 4BDIA 4KS8A 5BVNA 4ZMFA 4FSUA 3TKUA 4EHEA 3SQQA 4PMMA 3FQSA 3VRZA 2XEYA 3I6UA 2F57A 5HG7A 4USFA 1Q8ZA 1H08A 4AF3A 1LEWA 2YAAA 1BX6A 2QOLA 3KL8A 3OD6X 4L42A 5D1JA 5AJQA 4FV3A 5EKOA 5HVYA 2O64A 3ZUUA 4D9TA 5CYIA 4IM0A 3KKVA 3NNWA 4FSRA 4M97A 3EN6A 1F3MC 1WVXA 2G2FA 2R4BA 2R2PA 3UJGA 4H1MA 1RJBA 4TXCA 3NUYA 4BYJA 4OAUC 3Q3BA 1KWPA 1WBSA 3SXRA 1YXXA 2B55A 2B9FA 4LMUA 4GT5A 1OKVA 4U40A 3ZM4A 4ZLYA 3JR1A 4S31A 4APPA 4WHZA 1ZOGA 1VYZA 1XBCA 5TR6A 4TKSA 4TYHB 2GNLA 3DXPA 4BGQA 4Y95A 4E3CA 4EH8A 2XYUA 2XK8A 4C02A 2EXCX 2X4ZA 3AD4A 4FTOA 3VN9A 2JEDA 3GOPA 4NYEA 5FTOA 3QTXA 1JVPP 4R6VA 4U5JA 4X21A 4UWCA 3V3VA 3II5A 1UKIA 3DTWA 3DZOA 3F69A 3ZDIA 2R3MA 2QNJA 3P08A 4J8MA 3DA6A 5AR5A 3FL4A 5ACKA 4HOKA 5AP5A 3UODA 2J7TA 3EQPA 5KMMA 2CCIA 3OT3A 3HX4A 3U6JA 5ANKA 3F2RA 4IM2A 1K3AA 4AZWA 4FKSA 5LJJA 2I7QA 3ZOSA 3VWAA 5BVFA 4ITHA 2BZIB 3KRWA 2G9XA 1U5QA 5CVHA 3DOGA 3MFUA 4U7ZA 4Q2AA 3W2RA 3OC1A 4HPTE 3SC1A 3MESA 1WVWA 4QTEA 3ULIA 4X0MA 3W10A 3QWJA 4IW0A 1OVEA 3IS5A 3QKKA 4RQVA 5IEVA 3BEAA 3R9HA 2PYWA 3HKOA 3MJ1A 4IZAA 1QMZA 4J8NA 4G31A 4ID7A 5JGAA 5AMNA 3VQUA 2V0DA 4FGBA 4U0IA 1XH7A 3P5KA 4MWIA 5E8YA 1Q4LA 3CJGA 5KMKA 5E1EA 4LFIA 2XKFA 4C3PA 5LWMA 3RWQA 4YZCA 5CANA 4FNXA 4AOIA 3G6HA 3ACKA 3ODZX 2LGCA 3F82A 3QRUA 2Z2WA 2O2UA 2B53A 4YMJA 1PRYA 2ZMDA 1H28A 5GJDA 2G01A 4LV8A 3SRVB 3KXXA 3PRFA 1OUKA 3WF9A 3SRVA 4ENXA 4DGMA 3MJ2A 2CLXA 4GJ2A 1BMKA 5KMOA 4RPVA 5ETCA 4F9CA 2I6LA 4OTFA 1H0VA 3BV2A 3COIA 3LZBA 3M42A 3HRCA 5ETIA 1WBNA 4D5KA 2XS0A 3FZSA 5AAEA 3A4PA 1VR2A 2GSFA 3I60A 4AZFA 4YTFA 5HX8A 5M09A 4BGGA 4HPUE 2HW7A 4BBFA 4BCFA 3FQHA 4JDKA 4UMRA 4ITJA 4QQJA 4B8LA 4ZLOA 4IWPA 3PA5A 1ZY4A 3R7OA 3NIEA 2YDJA 3OTVA 2O65A 4D55A 4IH8A 4GRBA 2PVFA 4YLLA 4O0SA 3KXGA 4IVDA 3UDBA 2A4LA 3PPKA 4FTLA 4NZWB 5DBXA 5HIEA 4KUJA 4H39A 5AM7A 3E64A 2CPKE 5AR8A 3R9OA 2WHBA 3BEGA 4FL1A 3ZZWA 5CU4A 1FGIA 2FGIA 4I6BA 3HMPA 3LCOA 3QHRA 5L6PA 3DV3A 4NM7A 5HO8A 3LE6A 4QMLA 4I0RA 3WE4A 4RJ7A 3U8WA 4XOYA 4HCTA 3V04A 3GP0A 3GU6A 3HA8A 2XKCA 3ROYA 5F4NA 3OBJA 4CCBA 5DI1A 5JT2A 4JOAA 5HCYA 4YO4A 3EL7A 5L6WL 2XBJA 3HL7A 4QPAA 4KKHA 5BVKA 1ATPE 2VX3A 2FVDA 3LQ3A 4Z7GA 4M68A 4JS8A 2X8EA 5CI6A 2X7OA 3TNWA 2P55A 2Z7SA 4GFGA 4DFBA 3ORKA 4R3PA 3RVGA 3D5XA 1J7UA 3THBA 5C4LA 4A07A 2H34A 1JBPE 4MF1A 2EVAA 4TYGA 4G3EA 3TM0A 3WF6A 1PYXA 3ATSA 4E26A 3OEFX 1F0QA 2DYLA 5E8XA 4IFCA 4ANBA 4R77A 3KCKA 4KSPA 3E3PA 5JZNA 1O6KA 3S3IA 5D41A 3T3VA 5J5SA 3QTIA 4HZSA 3E62A 4X2NA 1S9JA 2VTJA 2X0GA 3TJDA 2OZOA 3MH2A 4EUTA 1JSUA 4KABA 4OTQA 4ZXTA 4JRVA 4C57A 4FEVA 4IB0A 3KXZA 1OPLA 1GZOA 2BIKB 4ZIMA 3TJCA 2PVLA 3SDJA 2HXLA 3MFSA 3RALA 3MDYA 1OMWA 4K33A 4YJUA 2HZIA 3ZEWA 3RZBA 3NDMA 3QALE 4O7SA 3HZTA 4IX3A 4KIQA 3OOGA 5BMSA 4U80A 3M2WA 4YZBA 4S32A 4ENYA 4S2ZA 1J7IA 5E9EA 1YHWA 3IO7A 2PULA 3O71A 1KE6A 1JWHA 4FSZA 4E5BA 4JX3A 3C5UA 4ZJJA 4ALVA 3GGFA 5HVKA 3TUCA 5FG8A 5AP7A 2OO8X 3KXNA 2QG7A 3LLTA 4GU6A 4O7YA 1Q97A 3VF9A 3WZDA 4NJDA 4PF4A 1H1WA 4DH3A 5EM7A 4G34A 4C4JA 2W1DA 5GZ8A 3C5IA 2B9IA 4MKCA 4OTGA 4RX8A 4YJTA 4CT1A 4MAOA 3A7IA 4PWNA 5KHXA 4IANA 2GS6A 4BIBA 2O63A 4YNOA 3UOKA 4EH3A 4F7SA 4MEDA 4EI4A 2JDRA 1ZLTA 2JKOA 3M1SA 5C8NA 3A60A 5E90A 3JYAA 3D2KA 3OCGA 2RFEA 4LG4A 3BGPA 3ZYAA 3WF7A 1XH6A 2BIYA 3DDPA 2VX1A 1WVYA 3MIYA 4MBJA 1J91A 5IA0A 4W8EA 2WMTA 3Q4CA 2X2KA 3AC8A 5EI2A 3OBGA 4LL5A 2C3KA 2HIWA 4JQEA 4FTNA 4YC8A 2HY0A 2PZRA 2XP2A 4WUNA 4KBCA 1Q8UA 5CY3A 5LCJA 3UP2A 4E4MA 4AW1A 3UO6A 4GEOA 4JBOA 3RK9A 2NPQA 4ANOA 4L01A 3QCXA 1IAHA 2EXEA 3G51A 1YOJA 4BZDA 3CGOA 2VUWA 3F7ZA 4LQMA 2HK5A 3Q4TA 3LMIA 1KOAA 2F7ZE 4ASEA 2ZVAA 4TYIA 2RF9A 3ZLWA 4FBXA 4AW5A 4IC7A 5JFWA 3KN6A 3EN5A 3FBVA 4B4LA 4CEGA 4BICA 3BPRA 3R01A 1DS5A 4QP6A 3OG7A 2QR8A 3ZC6A 3D7ZA 2YIYA 3PLAE 2P2IA 4B7TA 4ZY6A 1WBWA 1J3HA 2HWPA 3V6RA 1V0BA 1WBOA 3QGYA 3OXZA 1UU8A 3VAPA 2WEIA 3V8WA 3TTIA 4QP9A 4BIDA 3HUCA 2Z02A 3PA4A 4J98A 1PHKA 2E9PA 1YHVA 3DB8A 5TE0A 5LXMA 4IADA 3QUEA 3F88A 1K9AA 3DKCA 3LM0A 5FXSA 3HV3A 2UW0A 4D9UA 5ETFA 4I23A 1TQMA 1FOTA 1IA9A 1UU7A 4FYNA 5JGDA 2XMYA 2QKWB 3DBEA 4H58A 1AQ1A 3P0MA 4AA5A 5A14A 4PPBA 5B2KA 3NW6A 3TCPA 4FZ7A 4MNEB 4X2KA 1XH8A 2CGWA 3AD5A 1P5EA 3NIZA 3PPZA 3E7OA 4HGTA 4HYHA 2R3RA 4D0WA 4MNEA 4PTEA 5B7VA 3VF8A 4TZRA 4UV0A 4TW9A 2W06A 3MVJA 2HXQA 3IONA 4GUEA 1J7LA 2PL0A 5AUVA 5IQCA 3TN8A 4O86A 5F9EA 4FEWA 1FBNA 3G5DA 5AIRA 4FICA 3S95A 4C2VA 4ZTMA 4ZTRA 3RHXA 4TL0A 4FSNA 5HESA 4QP2A 5A3XA 3HMOA 3CKWA 4A4LA 4CFFA 3G9NA 3NUNA 4O91A 2BCJA 1KE7A 3R7YA 4M3QA 3NR9A 3SA0A 4DEIA 3FKLA 4QP3A 2X2LA 3BLRA 1ND4A 4C4EA 4FX3A 4ERKA 4DTAA 1Y8GA 1M7NA 4BHZA 2W1IA 4MXYA 5M51A 4N0SA 3QBNA 3ZSGA 5J1WA 5TT7A 4E6DA 2H6DA 3RMFA 2X6EA 3EZRA 4IZ7A 4WSQA 3Q9YA 4G5PA 4IVBA 3QRKA 3FC1X 2W9FB 4RJ8A 1SZMA 2A27A 4OTRA 3FMDA 3Q53A 4ZTLA 3FEGA 2A19B 2Y6OA 3E8DA 4O96A 1YWVA 2OF4A 3CY3A 1H4LA 2RKUA 1UWJA 2WMXA 3FLNC 3W1FA 5CQUA 3FSFA 2QOFA 3RPOA 4FNZA 3UZRA 2PUUA 3F3UA 1RE8A 3HMNA 3R71A 4AX8A 1M14A 4BCJA 1URCA 3I79A 5CALA 3EWHA 4IQ6A 2IW9A 2JIUA 4L46A 4TYEA 3EQGA 4FT0A 4XP0A 5D11A 3W2CA 4D4SA 4ONAA 4O7WA 4DCAA 5HI2A 4YZNA 1OL1A 2WTIA 2XH5A 5IA3A 5M57A 3AC4A 2C3JA 4WKQA 3BYSA 4HCUA 4L52A 4FZDB 3O50A 3HMMA 3QD3A 4JT3A 3K2LA 1FMOE 3H9OA 4IFGA 1H1QA 4U3YA 2PZ5A 4YBJA 3N4UA 1U59A 3L8XA 4EOLA 5ACBC 5H8BA 4RX5A 3D94A 5BMMA 1UVRA 3A7GA 3FLYA 3Q4UA 3MVMA 4LOQA 2XRWA 3QA0A 2W9ZB 1XO2B 2W4JA 1RW8A 2ZDUA 2W05A 2CKPA 1JSTA 4Z3VA 3BI6A 4XG6A 3ZH8A 4BCMA 3NNVA 4ACMA 4Z16A 5G6VA 2CN5A 4DC2A 2ZOQA 2BRMA 2BKKA 3U87A 3A4OX 5G1XA 3L1SA 1PXKA 5H8EA 4O6EA 3PJ2A 2QHMA 5ANJA 5CSWA 2JFMA 3QF9A 3D5WA 2V62A 2OSCA 1REKA 3RM7A 3VBQA 2WIPA 1ZYLA 4FKGA 3KA0A 2VWIA 4HVIA 4ZY5A 2XK6A 3RPYA 2ITXA 5K5NA 5KBRA 4TPTA 2ITNA 4XV1A 5CX9A 2PE1A 3LFSA 4RJ4A 4MCVA 1YXTA 1APME 4DEGA 4K77A 3OP5A 4G6LA 3PP1A 4KD1A 2R0IA 4ZSEA 3HUBA 1L8TA 3QTQA 2YM4A 4OAVB 3MVLA 4XV9A 4MD8E 2QC6A 4XMOA 4L7SA 1FPUA 1ZARA 2VTMA 3TV7A 2QOBA 5FTGA 3D15A 3TZ8A 4AZTA 4LOPA 3DCVA 2ITOA 2QONA 3RKBA 1XH9A 4AN9A 3LFDA 4R1VA 3Q9ZA 3IK3A 3BV3A 5EW9A 4HYSA 4GH2A 4ZZMA 5L6OA 3B2WA 3BU3A 4BRXA 3PVGA 4RVLA 3UYSA 2B9HA 4FIEA 3O96A 3ORMA 2WIHA 4FG7A 4BC6A 5IQBA 5J5TA 5ANIA 5A46A 5LVPA 3FMJA 2FUMA 2VWYA 3ZLXA 4IIRA 3UIXA 1JOWB 3GC9A 5DR2A 5HG8A 4BWXA 4EOQA 3P9JA 3MWUA 4MBLA 5AV4A 2XIXA 1M52A 4F63A 3KRJA 2IJMA 1NVRA 4RIOA 5FM3A 3VBTA 1Y6BA 2C4GA 3DBDA 3TDWA 2YIQA 4DFUA 3HDNA 3FKOA 3JY0A 4EH7A 3KGAA 4NH1A 3MI9A 1M2RA 3QQFA 4D2VA 2BRHA 2OH4A 4O7NA 3QTUA 4PDPA 3GEQA 4ZSLA 2GNIA 5K0XA 4QQCA 2R3FA 4BGHA 4CTCA 2XF0A 4DFZE 1ZMVA 3UPZA 4YURA 4F9BA 2EUFB 4DFLA 1GZ8A 1STCE 1YQJA 4A9SA 1W7HA 2WOUA 3F3ZA 4GJ3A 3C0HA 4J53A 4R1YA 3C4FA 2RIOA 2WO6A 5ANOA 5EFQA 3EN4A 5HBHA 4DG2E 4FV4A 3KCFA 4FIJA 2JLDA 5IUGA 4L43A 2WMBA 3VW6A 4WT6A 2RG5A 1Q3DA 3CCNA 1CTPE 5CF4A 3C0GA 3O2MA 4CCUA 4I6HA 4O22A 3QHWA 4R78A 3MSSA 4BHNA 3ZTXA 3Q2JA 5FM2A 4CKJA 2OKRA 3BKBA 5HLPA 1FVRA 3G33A 5JSMA 4ACGA 3ANRA 5DGZA 3LLAA 2BFXA 4ZSGA 4YC6A 1Y57A 3HV7A 2HW6A 5AP3A 2HWOA 3CTQA 5FBOA 1YKRA 4II5A 4FKVA 5KX8A 1MUOA 4K0YA 3ZCLA 2BZJA 2VO6A 1ZRZA 4ZTSA 4QQ5A 5HEZA 3FXZA 4E6AA 5AR2A 4YNEA 3D0EA 2WMVA 3AOXA 4NEUA 4D2SA 4CLJA 3MA3A 4A4OA 3NAYA 5CS6A 4KBKA 3VUDA 4FTKA 4K6ZA 2FYSA 1Z5MA 1YDTE 4KA3A 4P7EA 3BWJA 5JQ5A 1ZAOA 2I0EA 4BYIA 3VVHA 4DT9A 4YSMA 4E6CA 4PP9A 2ITZA 3F5XA 3AMAA 4EYMA 1NW1A 5HTBA 3LQ8A 3PRIA 3PY0A 3P7AA 3V5PA 4G6OA 5KUPA 4PV0A 5F20A 3HYHA 4QT1A 2BAKA 3PWYA 2BAJA 4FMQA 4RVKA 1T46A 4MVFA 4UMQA 4E1ZA 2EXMA 1ZY5A 3GU8A 4EH4A 1MRVA 4FGRA 1E1XA 3QA8A 1HOWA 4Y83A 3ZFMA 3MY0A 2CN8A 3QFVA 1TQIA 3R7UA 5B2MA 1O9UA 3H3CA 4R7HA 4I24A 3QQKA 1PXJA 3NPCA 5CNOA 1OIQA 3WOWA 4L9IA 4AZEA 4YSJA 2CNQA 3OXTA 4CYJA 3LFNA 4A7CA 1PXLA 4EWQA 3JPVA 4U3ZA 1ZYSA 3KK9A 3GCUA 4RRVA 2WKMA 2OJGA 3HA6A 4CFNA 4U41A 1YHSA 4HZRA 5IEYA 3PY3A 2QOCA 2XIYA 1VZOA 1DI9A 4YZDA 4PL4A 3TI1A 4NCTC 4U97A 4XG4A 4O7LA 2YM3A 3Q4ZA 1Q5KA 5IEXA 3EQHA 3UO4A 3P7BA 4G9CA 3F9NA 1SNUA 3PSCA 4FIIA 1V0PA 5AV2A 3BHVA 3UIMA 3VUKA 4DEBA 5CF8A 4J7BA 2Q0BA 2GQSA 2CCHA 2VU3A 3LXLA 1YWNA 4NM3A 3LCSA 4C0TA 5CAVA 5BVEA 5I4NA 3ZO1A 3JS2A 5L2TA 4EQMA 5KMIA 3GI3A 4IB1A 2IZUA 4G2FA 4OT5A 5IF1A 2YM8A 4M13A 3RJCA 1OL2A 4ARKA 4RC3A 3UQGA 2UZOA 5M06A 2CSNA 2FH9A 2BUJA 2BRBA 2YABA 2YZLA 4L00A 3TKHA 4EEVA 3LFCA 5AM6A 4ASZA 3U55A 2ZMCA 3P79A 5AFVA 4TWCA 4YO6A 3E87A 4C4HA 2B0QA 2VTIA 2W1GA 3LQ5A 3PXRA 2WTCA 4BCGA 3NAXA 4QNAA 2ZB1A 4RX7A 1TQPA 4CG8A 3MFRA 4BIEA 2ZV2A 4Y5QA 4FV6A 1IRKA 3DXNA 4PDYA 4MYGA 3AC5A 3ENMA 2YEXA 3SKCA 3UQFA 3FLQA 4EHZA 4QMZA 4YLKA 4YGAA 5HX6A 4IE9A 5GJGA 5CEQA 3LCDA 4EK8A 4C8BA 2C6OA 5EHYA 4R5YA 5KMLA 3QAME 2C0OA 3PJCA 1OKWA 3EQRA 3QU0A 3FQEA 3QCQA 3IECA 3OWPA 4FTJA 2XIRA 2YCFA 2YN8A 4NTSA 4CSVA 1KV1A 5LOHA 5I9WA 2XB7A 2YZAA 4B9DA 4GYIA 3EFWA 3RWPA 5AUYA 4O84A 1ZMUA 4OTDA 2BRGA 4FSQA 3PG1A 4WBOA 3NGAA 4F0IA 4EHGA 5I9YA 2WXVA 3UC4A 5BUIA 5DT4A 3EQFA 2IW6A 2OIBA 3QD2B 4U9AA 4V04A 5E91A 4R5SA 2ZDTA 3E5AA 3VHEA 3TWJA 4GYGA 5CI7A 4GVAA 5KO1A 3CSVA 2XKEA 4Y72A 3A7HA 5J9LA 1PXNA 2R3NA 3F3VA 4JLCA 4EH2A 4I21A 5FDPA 4IVAA 4WIHA 2YLFA 1SVHA 4BL1A 4C62A 4DHFA 1H26A 4AN2A 5D10A 3CY2A 3FYJX 3EH9A 3Q9WA 4GVJA 4R7IA 3NYXA 2Z8CA 3GCQA 4FTIA 3OVVA 4FKRA 4D1SA 3GCVA 1UA2A 3BQCA 3LJ2A 3QXOA 4ACDA 2GHGA 2WAJA 4UMPA 2R3GA 2WQEA 3FLWA 3RGFA 3D9VA 2VTQA 1BI8A 5BVWA 2WMQA 3EMGA 4I41A 3SW7A 4EH9A 5AEPA 2DUVA 4IB5A 2G1TA 4UEUA 4QMQA 3PLSA 5ETAA 4PPAA 4FV2A 4AW2A 2QOKA 2QO9A 4GCJA 1OL5A 4M69A 5HO6A 3DNEA 4CKIA 5E8UA 4F4PA 3F3WA 2ZV8A 2YM5A 4N6ZA 4RWJA 4IZYA 5DMZA 3R9DA 3A7JA 3PJ1A 5HVJA 1OKZA 3OY3A 3VS7A 2CDZA 2W5HA 4XLVA 4O0TA 4PDOA 1YI6A 4QMOA 2PZIA 3LXNA 4IAFA 2VZ6A 2QI8A 1GIIA 4BF2A 3CC6A 1GY3A 1H00A 4D2PA 3UMXA 3RK5A 4ANMA 1LEZA 1NY3A 2OG8A 2GQGA 2PY3A 4GT4A 3W2OA 3CQUA 4FIGA 3S2PA 3UNZA 4E73A 3OCBA 2HELA 2RGPA 3QXPA 4OLIA 1ZZ2A 4QD6A 4ZJIA 4FE2A 1H27A 2P33A 2R7IA 1CKJA 4H3PA 3ORIA 4IXPA 3L9LA 4L68A 2RFNA 3BZ3A 2WTDA 3SG8A 1P2AA 3AG9A 5CSHA 4HCVA 4EKLA 3MGYA 3HRFA 5H2UA 4X3JA 3NMUF 2GS2A 2X7GA 4MXXA 5HG9A 3KFAA 5AR4A 2VTHA 2Y9QA 5EM5A 3C4EA 3O7LD 3TL8A 5IQIA 3GT8A 4JG8A 3OOMA 1A48A 2P4IA 5EOBA 3KN5A 3CS9A 3C13A 5K4JA 4M66A 4WRGA 3NW5A 3POZA 4FTQA 4WG5A 5M4CA 5CSXA 4DLJA 4WNOA 4N70A 4FK3A 3MBLA 2C3LA 5EOLA 5A6NA 4F6UA 5I9XA 1KV2A 2ZM3A 3OUNB 3QGWA 5FGKA 2R3LA 4GS6A 4X2JA 3VUHA 3GCSA 2YLEA 1R0EA 2Z7QA 4IWDA 2UVZA 2B1PA 1OPKA 4EHVA 4XRJA 3Q2MA 5E8VA 4MX9A 3Q52A 4GV1A 3ZRLA 3VJNA 3ZSHA 2JKKA 1YI4A 1H24A 2QU6A 2YWPA 3OCSA 4FKPA 4L44A 4K2RA 3NYOA 2H9VA 2O8YA 5BYLA 4WOVA 3A8WA 5C26A 4BTFA 2VGOA 4C58A 4JBVA 5EYCA 3HECA 4HVGA 4O1OA 1OZ1A 1K2PA 4H3QA 4KS7A 2CGXA 5HNGA 5BYZA 2F9GA 5J79A 3NX8A 3LKMA 1QL6A 3DAJA 5HO7A 3A62A 3C50A 2V22A 4IX4A 3RAWA 4D2RA 2REIA 3VO3A 5HG5A 1WZYA 4M8TA 3NW7A 3I4BA 4ASDA 4IAAA 1XKKA 3V5QA 2BDJA 4EK3A 3KMMA 4NCTA 3FY0A 2YCQA 5CU3A 4MHAA 5CEOA 2JDOA 2KTYA 3N4VA 3TDVA 3KK8A 2F7EE 4I5PA 4EQUA 1WBPA 2GQRA 4EORA 4WG3A 4I0TA 4FNWA 3DKGA 1SMHA 5AV0A 4RT7A 4RSSA 4JQ8A 5CENA 5A4EA 3R1QA 2AYPA 4Q9ZA 4Q5HA 2VWUA 3QRIA 4AFEA 1VEBA 3VQHA 4BR3A 4MNFA 3QD4A 4BY9E 2ESMA 5BYYA 4BDAA 4L8MA 3DK6A 4UZHA 4F9AA 2ITWA 4UWBA 2EB3A 3MW1A 4HVHA 2BPMA 4WG4A 2OI4X 4CNHA 5HBJA 3FZPA 4UMTA 2VWXA 5KKRC 5GIOE 2UZTA 5HE0A 2C68A 2YCRA 3C1XA 3DJ6A 4XP2A 5FEDA 4M0ZA 3WIGA 4EOPA 5JFSA 2YM7A 3ZC5A 1YXSA 4UX9A 3CXWA 3LFFA 5CXHA 2IW8A 2QOQA 2ONLC 5CLPA 2DS1A 3MY1A 4UYNA 1YXUA 2EB2A 3IW5A 3EFLA 3V5TA 1R39A 1PXIA 3NUPA 4P5ZA 1G3NA 3L9NA 3FXWA 4H05A 1W0XC 4DEHA 5ITAA 4P90A 1UV5A 2BFYA 3MTLA 3DY7A 5H8GA 5LVOA 4EK6A 4QMYA 5CSVA 3WIKA 4S30A 4RIWB 4KRDA 2VNWA 4QTAA 2CMWA 5CEPA 4G1WA 4RIWA 1FQ1B 2IVTA 3D4QA 4LM5A 2CGUA 3ALOA 4AZVA 5IISA 4L45A 2J6MA 5GZ9A 4QMPA 4FA2A 2HY81 5LVLA 4DLIA 4R7BA 2A1AB 3A2CA 4FV8A 3V5WA 5DEYA 3VC4A 3COHA 4U8ZA 3BU6A 2XK7A 4I93A 4MTAA 1ZWSA 3VUTA 4X3FA 4YC3A 2NP8A 3IGGA 4EYJA 3ZLYA 4ZMEA 4UMUA 3R63A 4EOIA 2RSVA 4WRSA 5HBEA 5DA3A 4BKJA 2WTJA 4IDVA 1PXPA 1J1BA 2OW3A 3GU5A 3FAAA 3R8MA 4LGGA 3BGZA 2HZ4A 2R0UA 5K4IA 5L4QA 2X6DA 3AC2A 5DH3A 4I5CA 2G15A 1OL7A 4FV9A 3NVMB 4QMTA 1NVQA 4F08A 1P4OA 2CKQA 4WUAA 5EYDA 4D4YA 5FLFA 3L9MA 5AV3A 4DN5A 4DF3A 3FZOA 1UU3A 2R3KA 3C4XA 3ITZA 4QMUA 4RG0A 4HW7A 4FKIA 4DBXA 2X81A 4USDA 3NYVA 2AUHA 4DE4A 3IDBA 2UVXA 3LAUA 3HGKA 4FVRA 4ZS0A 5I0BA 2HZ0A 2BMCA 4JXFA 5IQAA 2IPXA 4OBOA 5AX9A 3QRTA 1IEPA 4YJSA 1I44A 5J8IA 4BZNA 2Z60A 3R2YA 4MQ2A 4C37A 1W8CA 5E92A 4FUYA 3R8UA 1XH5A 3ORLA 5AP1A 2YWVA 4DYMA 3DAKA 3VS1A 4PP7A 3QQUA 3UOLA 5AIKA 5CVFA 5AX3A 4DFYA 3AT4A 2QLQA 5E1SA 2PE2A 4BKZA 1ZYJA 3A61A 3R1NA 3TNPC 4MXCA 4BCOA 5HCZA 4CLIA 4X7QA 4CFWA 2DQ7X 3QQGA 4QPMA 4XBRA 5HZNA 4DCEA 3PJ3A 3UMWA 2J51A 5A9UA 5DYJA 4O0XA 1ZMWA 3TKIA 3R04A 2J0LA 4K9YA 3EB0A 4R3CA 2WGJA 4K1BA 5FEQA 3VNTA 3WZEA 3F2AA 2QVSE 4TWNA 5CSPA 3AC3A 2PVMA 4AE6A 3CR0A 4J99A 4UWYA 5BVDA 2QO2A 5DFPA 5J7HA 4PUZA 3UZTA 2QG5A 3WZJA 4RA5A 5JQ8A 4O0WA 5EQYA 2WQNA 3E93A 3UOJA 2PK9A 3NUUA 2WOTA 1MRUA 4F64A 2Y6MA 4KINA 5IH6A 3DBQA 3AD6A 3L8PA 4FF8A 4D4VA 3RM6A 3QTWA 2GDOA 5AA9A 4MF0A 5L2SA 4L3JA 4DH5A 4MD9E 1VJYA 4N6YA 5EW8A 5L8JA 3U9NA 5EW3A 1MRYA 3CQEA 3QRJA 2H8HA 2B7AA 5I9ZA 4DEAA 4CFMA 4DG3E 4EKKA 1QPCA 3F5GA 5DR9A 3FSKA 5LQFA 3W33A 5IUIA 2W7XA 1URWA 5DT3A 2W1FA 4ZSAA 1YDSE 3FLZA 2UW9A 2JAMA 2JBPA 2C0TA 3SOCA 3F2NA 3U54A 3DJ5A 3DDQA 4K11A 3R8LA 5L8LA 4Z7HA 3BBWA 4QPSA 2Y4IC 5FXRA 2GNHA 5IA5A 2WQOA 4EK4A 4PL5A 4F7NA 4JBPA 3FE3A 3NZ0A 1SVEA 2UZNA 3L8VA 5AV1A 3FMHA 1WBTA 3ULZA 3F5PA 3T8OA 2BKZA 5GJFA 4IC8A 4KWPA 3RAHA 1U4DA 1GIJA 3NS9A 2C1AA 3A8XA 3ZBFA 3HV4A 2YM6A 2QCSA 2I0YA 2J0JA 5DRBA 5K5XA 2VTPA 3ATTA 4GFOA 2LAVA 3MA6A 3VS2A 2WU6A 2F49A 1BKXA 3LFBA 2OWBA 4FK6A 4U43A 3DQXA 4U45A 3SHEA 3WYYA 1P14A 5AP2A 4ZK5A 5JGBA 4MK0A 5CAQA 4XEYA 3A7FA 3HAVA 4OTIA 5LMKA 2Y7JA 2WMSA 3CTJA 2I1MA 3EQBA 3MPAA 5FRIA 3WF8A 4M14A 1OIYA 3L8SA 1BI7A 3TZMA 4AW0A 2R3JA 3QYZA 2GHMA 4HJOA 1BL6A 4QP8A 3W8QA 3QUDA 2XYNA 3VS3A 3UOHA 2G2IA 4TY1A 4DAWA 1REJA 3AT2A 3KRRA 2PU8A 2UZEA 3LJ0A 2C6KA 5HICA 3RZFA 3WILA 3D14A 5HNIX 2OIDA 3UVQA 2B54A 3R30A 4XG7A 4YJNA 4ZEGA 5TF9A 5IDNA 4AP7A 3TACA 3HRBA 3I6WA 3PZHA 3BYUA 4A06A 5ICPA 5EI6A 1OUYA 1OIUA 2OF2A 3B8RA 2CNUA 3D5UA 4PL3A 4AXAA 2XJ0A 2VV9A 4BCIA 4JR3A 4AGDA 4MXZA 3RTPA 5CEKA 4R8QA 3GQIA 3LXPA 5IQEA 2UW7A 3MTFA 4JDJA 4XS2A 4BDHA 5KKRB 5JFXA 2VTAA 4BKYA 4CYIA 4W4VA 3RHKA 1Z9XA 4EC8A 3FZRA 3V5LA 3R7EA 4BTKA 3OXIA 2X9EA 3PWDA 2R5TA 2X39A 4USEA 4PQNA 4O7ZA 4KAOA 2VWVA 4M12A 1UNGA 1T45A 4D1XA 3RINA 3GENA 2ONLA 4QMMA 4ASXA 2PUNA 4W8DA 3W8LA 5TKDA 4C61A 4CXAA 3H9FA 3ZDUA 4EOOA 5EKNA 3QZIA 3ZBXA 4QTCA 4LL0A 4NM0A 3BE9A 4FI1A 4BI2A 1DAYA 2CHLA 4IACA 4P4CA 4U79A 4UB7A 2BHEA 2VTLA 4XJ0A 3SLSA 3ZSIA 2YA9A 3IW8A 3GC8A 4WA9A 4YJRA 5L2IA 2R3QA 4U81A 3EQCA 5HIBA 4BDBA 4ERWA 5FDXA 5FEEA 2ETRA 2PUPA 2PVJA 4JDIA 4EOJA 1KSWA 4GT3A 4FZAB 2Z7RA 3EIDA 3OROA 2W96B 4CMOA 4TRLA 4XX9A 2YIWA 3DK3A 2IN6A 3ORZA 3N51A 4FT9A 3AC1A 3I0QA 4RZVA 4JIAA 4UXQA 3QCYA 3FHRA 1Q8TA 2VRXA 3DBFA 3W2PA 2R7BA 4RC2A 3DZQA 3BQRA 4NWMA 4UYAA 1B39A 4JL9A 2FSLX 4U6RA 4PMSA 4TN6A 3T3UA 2UV2A 1W83A 3PG3A 4R3RA 3RK7A 2XM9A 4E8AA 3I81A 1PYEA 5KMJA 4X2GA 2CNVA 3SXFA 5IZFA 1IA8A 4DFXE 2OJJA 3QTZA 4JJRA 5DOSA 1B6CB 1RQQA 2J90A 4WSYA 4IAIA 3BHYA 4EZ7A 5DRDA 3LFAA 4KIKA 2Y4PA 4J52A 5J9YA 5D7AA 1LP4A 1W82A 2WMWA 3UTOA 4OR5A 4Q9SA 4HNFA 4IAZA 5JZJA 4RIYB 4QYHA 3ZRKA 3SG9A 1LPUA 4LRKA 3UIUA 4O6LA 3IPHA 4NW6A 5KZ0A 2PMNX 4GW8A 4RIYA 2YCSA 4AACA 5CWZA 4D4RA 2PVNA 5EHLA 1ZXEA 3H10A 3COKA 3OY1A 5EYKA 4EQCA 3V8TA 5BVOA 2UW3A 2W0JA 3OTUA 4J96A 2JKMA 2OXYA 4B8MA 3H30A 3B2TA 3R02A 3ELJA 5J9ZA 1SVGA 4NKAA 1R78A 2UVYA 4C36A 3F5UA 4W4XA 3RPSA 1OIRA 2XNEA 2X7FA 5AUZA 1Z57A 5CEIA 3DLSA 4RIXA 2GPHA 2JD5A 5JH6A 5JMSA 4H36A 3P1AA 3C4ZA 1PF8A 3KEXA 4AGWA 2OZAB 3PXQA 4DGLC 5IMXA 5CASA 3PVBA 1O6LA 3DKOA 2OZAA 3EOCA 4DH7A 4UY9A 5LMBA 4M67A 2X1NA 3Q04A 1Q8YA 5CQWA 4F65A 2C5VA 2OFVA 1CDKA 3BRBA 5LVMA 2V7OA 3R28A 3C4WA 3LMGA 3ORPA 4BCKA 1M2QA 3BLHA 2BDWA 3GFWA 4PX6A 4QYFA 4F1MA 5HU9A 5IU2A 4JDHA 4UXLA 4LV5A 4AGUA 3GU4A 4LGHA 4C33A 3FY2A 3C4CA 2W1HA 2JGZA 3KXHA 3BELA 4Z9LA 2YFXA 3UG2A 4O2ZA 5E8ZA 3JVRA 5EG3A 3RNYA 3H0ZA 2X9FA 4I94A 5B0XA 4GG7A 4DTKA 4E5WA 3PXYA 4P2KA 3BYOA 4Y46A 2QURA 2KULA 2W5BA 5L2QA 5EYMA 4BBMA 3LW0A 5DE2A 3RPRA 2ETKA 4BWPA 4IAYA 4JG7A 4X6QC 3DNDA 3EQIA 3U4WA 3ZM9A 3FC2A 2W99B 5CU0A 1YVJA 1OM1A 3GFEA 4DGNA 2X2MA 4O21A 5GINE 5EK7A 3V6SA 5JN2A 2IWIA 3FJQE 3Q32A 2XNMA 3UNJA 5HU3A 3N4TA 3S00A 4AZSA 5AR7A 3NCGA 3F7WA 3VBWA 2YDKA 3F6XA 5FP6A 2YAKA 2BHHA 4CT2A 5M4IA 3TNQB 4DFNA 2PE0A 2FB8A 2J5FA 1XQZA 3Q6WA 5IQFA 1JKTA 3OWJA 5ANEA 2VTNA 2JFLA 4RLKA 2Y4IB 4FNYA 3TEIA 3SVVA 4F9WA 4FL2A 4O2PA 5DT0A 5HD7A 4WNMA 2BZKB 3CTHA 3FZTA 4WNPA 4CMTA 3IW4A 1R1WA 3KXMA 4CRSA 4CV8A 1PJKA 1SYKA 1GAGA 4QP7A 3UYTA 3V01A 4EH6A 4DITA 3UE4A 3GB2A 2C6IA 1H1SA 4JG6A 1MQBA 1UNHA 5E8TA 3ORXA 3ZZEA 4A9TA 4B6LA 4NFNA 4PMTA 3UQCA 4XH6A 2F7XE 5CNNA 4RA4A 5IA1A 4FZFB 3LCKA 2XM8A 3P23A 5GIPE 3QZFA 3U6HA 4XLIA 1PKDA 1QCFA 2WD1A 3IDCA 2VTTA 3MH1A 3NNUA 2ERZE 4FKOA 4KRCA 4RMZA 1NXKA 3HDMA 3LOKA 5IQGA 3FI4A 2BRNA 4HVSA 2CLQA 2ZV7A 5FWKK 2ITQA 1JNKA 2F2CB 4G16A 1GJOA 4X6RA 3RAIA 1JAMA 3CPCA 4ZTNA 4L6QA 4TT7A 5A4CA 1W84A 2C6LA 4PNIA 4RWKA 3ACJA 3ZFYA 5L8KA 4IHPA 4FOCA 4EWHA 5I9VA 2ITPA 4V01A 2QOOA 2Y8OA 3GNIB 4NKSA 2WPAA 4IZ5A 4RZWA 3QTRA 2B4SB 1JQHA 4GK3A 5AP4A 2OU7A 2C3IB 4FV7A 3R21A 4ZJVA 5CAOA 4E4LA 3KC3A 3GUBA 4JX7A 4CFXA 4H1JA 2XCHA 5H9BA 2V7AA 1XBAA 4FIHA 3BLQA 4KIPA 1W98A 3AGLA 4XP3A 3EJ1A 4RFZA 3RPVA 4C2WA 4D0XA 1MQ4A 3R7GA 5IQHA 4E7WA 5JK3A 3VS6A 2NNWB 2XCKA 2E9UA 4NFMA 5BPYA 3NRMA 4E4NA 3VIDA 3GU7A 3FL5A 4F99A 3ETAA 5EQPA 2RFDA 3KVXA 3B8QA 3DU8A 4FKJA 5T68A 1HCKA 3GCPA 1BUHA 3DB6A 4FG8A 4G9RA 4ANSA 4CVAA 4C4FA 3R9RA 4L7FA 4ZP5A 3UZPA 4NL0A 3A99A 1QPEA 1XWSA 3BBTB 4L53A 4CD0A 4GSBA 4UALA 2C6DA 2QODA 1WFCA 4FT5A 4PRJA 3W2QA 3E63A 3PPJA 4BCNA 1OGUA 1KOBA 4FSTA 4A9UA 1V0OA 1WAKA 3PY1A 3ID6C 3DXQA 2R3PA 4GUBA 4NW5A 4X3FC 4IEBA 4OT6A 4EL9A 4PY1A 3FMMA 3RI1A 2DWBA 2GMXA 3EKKA 4IJPA 1O6YA 4O83A 2GFCA 3WZUA 5J95A 3HV5A 5DWRA 2JDVA 2YJSA 3H4JA 3GC0A 3MYGA 4OUCA 4F7JA 3RCDA 2YITA 4DBNA 1NA7A 3JVSA 5L3AA 3PTGA 3TTJA 2WMAA 5EDQA 4M0YA 3AQVA 3W18A 4AT4A 2RG6A 2UW6A 3R9NA 1WMKA 3CQWA 5M07A 4G17A 2XNOA 4WD5A 4Y73A 4B0GA 4E5AX 5HORA 4FTMA 2GNFA 2NRUA 4F0GA 3EL8A 4YJPA 2PWLA 4HVDA 2R3OA 4YZMA 4LMNA 3DFCB 3PXFA 4TYHA 5CF6A 3TUBA 1RDQE 3LFQA 3CKXA 2BROA 3KRLA 4OBPA 4C59A 4IJ9A 2VAGA 3DS6A 5A4LA 4EBVA 2O3PA 3MVHA 1IG1A 3H0YA 3NYNA 3R83A 4NIFB 4JVGA 4QYEA 2PUIA 2V55A 4XG9A 3EYGA 4NIFA 4MD7E 5F1ZA 3WYXA 2W1EA 2XK3A 4BDGA 5BNJA 5DIAA 4M69B 3QL8A 4NK9A 1P4FA 1G5SA 1JSVA 2CKEA 4YJQA 1Y8YA 3Q5IA 1H25A 4L3LA 2JDTA 4HGSA 4XOZA 1XBBA 4A4XA 4CV9A 4S33A 5C1QB 4XCUA 3VS4A 2PSQA 3DJ7A 5KZIA 3CEKA 4AA4A 4D2WA 5BUJA 4N57A 3ZLSA 3ZXZA 3T9TA 4A9RA 2QD9A 2XA4A 3R22A 4O0UA 4YP8A 2ITUA 3KMUA 3AGMA 5DLSA 5A54A 5HNBA 4FKWA 4I6FA 1PMEA 5AR3A 3FI3A 2WB8A 2E9OA 4MWHA 3ZRMA 4RQKA 3TIYA 3ZU7A 4BB4A 4LUEA 3I5ZA 2P0CA 4TTHB 5M55A 3ZXTA 3LFEA 4E6QA 4ZLZA 5KMNA 1M2PA 2J0IA 5LARA 5IUHA 4IWQA 1H1PA 1Q99A 2QO7A 2BAQA 3E88A 5HLWA 4BDCA 4PMPA 3OUKA 3BCEA 3FUPA 4BWKA 4I3ZA 4MBIA 2GTMA 3V5JA 1JPAA 2X8DA 3KMWA 3IQ7A 5GNKA 3FMLA 4K8AA 2IVSA 2W4KA 3FKNA 3V51A 4FKLA 3NSZA 3W32A 4MXOA 2Z7LA 2PVKA 4CKRA 2ERKA 1F5QA 4JI9A 4AT5A 4AOTA 4IWOA 4BTJA 2H96A 4I4EA 4LYNA 3D83A 4YU2A 3ANQA 4Y5HA 5HLNA 3VJOA 2FA2A 2WEVA 5C27A 4FKUA 2ACXA 3I5NA 3NUSA 3LXKA 4KSQA 3O8TA 3CD3A 1GNGA 3SV0A 3PYYA 4LRMA 4S34A 4ZZOA 4O27B 4L3PA 5TO8A 3TXOA 4FVQA 5M4FA 5IQDA 3O23A 3G9LX 1YDRE 2C1BA 1OB3A 2P3GX 4FG9A 4FKTA 4ITIA 4LRJA 4RGJA 4AT3A 2QOHA 3QYWA 4CMUA 2A2AA 2UW8A 5JRQA 2VWZA 3QQHA 3ZO4A 2P2HA 3VBXA 4AWIA 3LIJA 4W9XA 5K3YA 2OJFE 5I3RA 2F2UA 3FXXA 4IVCA 2OXXA 3PP0A 5EM8A 4IBMA 3HP5A 4YJOA 5A6OA 5M53A 2WZJA 2IO6A 2HENA 2V5QA 3UO5A 5DHJA 3K5VA 5BUEA 4EOSA 4AQCA 4JNWA 5HHWA 4XG3A 5AAFA 3OFMA 4BI1A 3MB7A 4QNYA 2XEZA 1NT2A 3MH0A 4RJ6A 5LMAA 5H3QA 3VUMA 2BDFA 5KNJA 4C34A 2UW5A 5LMKC 4BCPA 3CP9A 2XBAA 2JITA 2R3IA 4E4XA 3HP2A 5HE3A 3QTSA 2QR7A 4CQGA 3D5VA 3PXZA 3W16A 3L9PA 3GQLA 3RP9A 2XNPA 4G3DA 3KF7A 3R73A 4N4SA 4TWOA 4QOXA 4C4GA 1JKSA 3K3JA 2WU7A 2EWAA 4O82A 4D1ZA 2GHLA 3G15A 3REPA 4OTWA 5HKMA 3TZ7A 4ACHA 5HTCA 3N9XA 3RAKA 3GBZA 3QC9A 3PDTA 2I40A 2E9VA 4I4FA 3BIZA 1M17A 4FZ6A 2PVRA 5M4UA 3K3IA 4FR4A 4CGAA 2VWWA 2WQMA 3QKLA 4I6QA 3VS5A 4UBAA 3PFQA 3FZ1A 3SXSA 2IG7A 3I7CA 3I7BA 2R3HA 3U9CA 3CJFA 3C9WA 4KKGA 3UVRA 3VUGA 1U54B 3R0TA 5CVGA 4EZ5A 2WTWA 5CU6A 1ERKA 4JIKA 1U54A 2WTVA 4MH7A 3F3TA 4ZOGA 3SD0A 3ZFXA 2YIRA 3R2BA 4TNDA 1YRPA 2XK4A 3KQ7A 3PIYA 3TT0A 5IH5A 5EDRA 3MH3A 3ODYX 3OCTA 4JQ7A 2WNTA 3R8PA 3QKMA 3OT8A 4F0FA 5CAUA 4XHKB 5HQ0A 3MY5A 4QTBA 5HOAA 3R1YA 2WFYA 4FEXA 3BYVA 5HD4A 3WZKA 2CJMA 3DLZA 3PIXA 4O0RA 3G0FA 4B99A 4AUAA 2HAKA 3D2IA 4EC9A 2XRUA 2VTOA 3Q5ZA 5D9HA 3IG7A 3R1SA 1S9IA 2WMRA 4YJVA 1PY5A 3CGFA 3GXLA 3FMEA 5DNRA 3QUPA 3EKNA 4CRLA 4Z55A 1IR3A 4KNBA 1Q24A 5CEMA 5L2WA 5FUTA 1CKIA 3NVKI 4XBUA 1XJDA 3O17A 4EOKA 3U51A 4QMXA 3PVWA 4RBLA 5C4KA 3QWKA 4BVUA 2OK1A 3C0IA 5KCVA 3HAMA 3R7VA 4X3FB 4C7TA 2FSOX 3G6GA 3IW7A 4FEQA 3TNIA 5IKWA 1Q41A 2OICA 3LPBA 1VYWA 4WBBB 3ZUTA 2ETMA 2G2HA 4BZOA 2J5EA 2UW4A 4FODA 3DK7A 5F94A 2C47A 3AT3A 5C03A 1G8SA 3PE2A 3OW3A 3P78A 1PMNA 2FSTX 4ZAUA 4AA0A 1J1CA 2QLUA 4QMSA 2XVDA 4E93A 2J0MB 4F9YA
chains in the Genus database with same CATH superfamily
4DA5A 4O0YA 3R8VA 1PXMA 4O38A 1GZKA 2C0IA 2GU8A 3OWKA 3GC7A 2F4JA 3W55A 1ZOEA 4BDFA 4OGRA 3UVPA 5IH4A 4BCQA 5EH0A 4LUDA 2IEWA 4HGLA 3IDPA 3WI6A 4QMWA 1SM2A 4APCA 4BFMA 1FVVA 3CD8A 4MXAA 4BCHA 1OECA 3LCTA 4L67A 3VRYA 4QMVA 1A06A 1CKPA 3OEZA 4NJ3A 4FSMA 1JKLA 5I5ZA 3JY9A 4YHJA 3MS9A 2VN9A 4JAJA 4QYGA 4XG8A 5TOZA 5EI8A 4D2TA 2BTRA 1FINA 1LR4A 5J1VA 2OFUA 5AUXA 3BHTA 3OHTA 2PMOX 1H1RA 3P86A 2PHKA 5E8WA 5FQDC 5ANDA 2XJ2A 3MB6A 5I9UA 3JUHA 2ZM4A 2ZB0A 2ZYBA 3NNXA 2X8IA 4MQ1A 1XHAA 5IPJA 1YWRA 3AMBA 3NUXA 4P5QA 4LOOA 3SX9A 3E7VA 4YPSA 2XUUA 2W17A 2R9SA 3QQJA 4FSYA 3CPBA 3ORNA 4M84A 3TV4A 2JKQA 3TZ9A 3AXWA 4ACCA 5EM6A 3PSDA 4EUUA 5E8SA 5IA2A 1ZOHA 3MPTA 2GCDA 1IASA 3GVUA 4FJVA 1AD5A 1LUFA 1XH4A 5FBNC 2C5YA 3UBDA 4Y8DA 5AP6A 4CFUA 1E9HA 2HOGA 2W4OA 3F61A 4XV2A 4F70A 1JLUE 1UNLA 2WTKC 3E3BX 3E92A 3QZHA 4DGGA 5J7BA 2BALA 4YTCA 3UDTA 3FPQA 2UZWE 2C6EA 3DGKA 3FV8A 3EQDA 3P7CA 4O7VA 3KREA 1OBDA 3DKFA 5E4HA 1Q8WA 3OW4A 4G3GA 4DTBA 5AWMA 2ZAZA 2VO0A 4IDTA 1FVTA 4IMYA 4ZY4A 3P5JC 4EH5A 5C8MA 4O7RA 3TUDA 2OXDA 5HIDA 4C3RA 3BHHA 5AAGA 3NFFB 1BLXA 2PVHA 1OBGA 5JRSA 4EOMA 1H0WA 5AUUA 3WF5A 2VTRA 2VX0A 3LM5A 4H3BA 4QP1A 3AKLA 2XK9A 3DAEA 3R7IA 4G5JA 2I0VA 4QYYA 4FVPA 4IM3A 4FTRA 2YHVA 2GTNA 4GK2A 3ZS5A 4G6NA 4I1ZA 3DFAA 1Y6AA 2YERA 3DBCA 3GOKA 3G0EA 3W2SA 2BR1A 2GFSA 4JBQA 3FLSA 3ZONA 5AA8A 5DPVA 2UZBA 5FP5A 4C4IA 5CXZA 4XYFA 5T3QA 2B9JA 4XUFA 5C01A 4F7LA 2ITTA 4BTMA 2SRCA 3ET7A 2PPQA 2CGVA 2W1CA 4J1RA 5BQ0A 1ST0A 4U42A 4RC4A 1UWHA 1OI9A 2XNNA 3BGQA 3CE3A 3UPXA 1QPJA 4DT8A 3MIAA 4QTDA 4RVMA 3TG1A 1YI3A 3R8ZA 1OITA 4ANQA 3D7TB 3QC4A 1FMKA 1X8BA 2C6TA 3H9RA 3K5UA 4DEDA 5GHVA 3IOKA 2XIKA 3D7TA 4FTUA 3FYKX 4GMYA 3BU5A 5DEWA 2VO3A 4QO9A 5D12A 3T9IA 4GKIA 3MN3A 3P4KA 2QQ7A 3R00A 3RNIA 2PMIA 4CTBA 4FV5A 4WO5A 5A4TA 5BX0A 2PTKA 4Q5EA 4IAKA 4HNIA 1GOLA 2BTSA 1YOMA 3PVUA 4BDDA 3UNKA 2XANA 3IOPA 5HCXA 3MV5A 4D58A 4GG5A 2OH0E 4YPDA 4YHFA 5AUTA 1PKGA 2XKDA 4F1OA 2J4ZA 1FGKA 3PUPA 4ZSJA 3ZUVA 1U5RA 2C69A 3BX5A 2IZRA 2QHNA 2ITVA 4RLLA 2YACA 5LWNA 4EONA 4BDEA 4U44A 3ERKA 1R0PA 2WELA 3WARA 4RJ5A 3NWWA 2JC6A 4AOJA 4FL3A 2W5AA 3ZHPC 3ZMMA 1AGWA 5JEBA 1UKHA 3CIKA 4QMNA 4UN0C 1GIHA 4YLJA 4AE9A 2YJRA 2FSMX 2CKOA 3VS0A 2NO3A 2ZFYA 1PMUA 2QOIA 3MFTA 4V05A 2QU5A 4JAIA 3S4QA 4ZS4A 2E9NA 4YTHA 4DEEA 4PNKA 3VBVA 3QCSA 3E8EA 4GK4A 4FTAA 4FYOA 5M44A 3HVCA 2UUEA 3EYHA 4O1PA 4FOBA 4OBQA 3EZVA 4NU1A 2Q0NA 3S1HA 3NFGB 3NLBA 4RJ3A 1TVOA 3PJ8A 5B2LA 2WMUA 3LVPA 4C3FA 2JDSA 1IAJA 3ORTA 3KY2A 3FI8A 3OF0A 1H07A 3OMVA 2XNGA 2I0HA 3KULB 3O7LB 4XNEA 4ZTQA 1JKKA 2B52A 3HMIA 4ALWA 4CQEA 2WQBA 3KB7A 3KULA 1EH4A 2JIVA 2UZLA 4TNBA 2IVUA 4GL9A 5DG5A 4I20A 5AUWA 4K18A 2JIIA 4HYUA 3LMHA 4FV1A 3FMNA 1PMVA 1BYGA 4FV0A 1V1KA 1YOLA 4LI5A 5FXQA 3PE1A 5I3OA 4HGEA 2PVYA 1SNXA 1UU9A 3UIBA 5AP0A 1DI8A 2YDIA 2RL5A 3BE2A 2HYYA 3QLGA 4I0SA 4M7IA 4TWPA 2YISA 2BZHB 2O5KA 1ZYCA 2JAVA 2OBJA 4ANLA 5IDPA 5CT7A 5CZHA 3F66A 2GNGA 3VUIA 1WBVA 3E8NA 2O0UA 2OJ9A 3NEWA 2IVVA 2YIXA 4AU8A 2X4FA 4AGCA 3PA3A 4FT7A 2VNYA 4LGDA 3DTCA 1MP8A 5CF5A 1CMKE 3EFKA 4FTCA 4YUQA 3QX2A 3UC3A 3G2FA 3UG1A 4A9YA 3FPMA 4CZYB 4AAAA 3O51A 3QQLA 1U46A 2PZYA 4J95A 2C5XA 4XG2A 5GZAA 3FI2A 4IB3A 3PFYA 5FD2A 4TYJA 3O8UA 2RFSA 4O0VA 1KE8A 3PIZA 3COMA 4GFMA 3IW6A 4KIKB 3WE8A 1Y91A 2J2IB 4AFJA 2IZTA 4RVTA 3HNGA 3EN9A 4BI0A 4M15A 3U6IA 3PZEA 4JMQA 3LHJA 4BDJA 3PXKA 4I22A 2HCKA 4I92A 4W9WA 3C51A 5EHOA 2J9MA 3LJ1A 4JRNA 1TKIA 5F95A 4O81A 4GIIA 3QZGA 5K9IA 4XV3A 5A4QA 5KHWA 4NUSA 3Q6UA 5K0KA 1B38A 3Q60A 4YHTA 3HV6A 2FO0A 2VD5A 2XJ1A 4E20A 5HTIA 4C35A 5KBQA 3CBLA 4RX9A 4ALUA 4FSWA 3JXWA 3S0OA 5T6KA 4F6WA 5M56A 4PPCA 3IGOA 4F09A 4AS0A 5HE2A 3PSBA 4F1TA 1Q61A 3TNHA 1I09A 3I1AA 3RBWA 2XZSA 4DGOA 5JKGA 2Y0AA 4RIXB 3OZ6A 2BILB 1OPJA 4GIHA 4OTPA 4PTGA 5ANGA 2UZDA 1OL6A 4DH8A 4CG9A 2AC5A 3MPMA 2XIZA 4NM5A 4D5HA 4ZTHA 3SOAA 3TV6A 4DINA 3DT1A 3BYMA 4GU9A 3QLFA 5C8KA 4FKQA 4FEUA 1ZYDA 1L3RE 3FMKA 3SW4A 4BJJB 2C6MA 3O0GA 1KE5A 2WTKB 3FWQA 4G3CA 2Q83A 3OS3A 4IX6A 5FTQA 5HGIA 4CZTA 3NUAA 4RWLA 2EU9A 2R64A 4FC0A 4JR7A 4O4DA 4OW8A 3K54A 5J87A 1XR1A 3BHUA 4FIFA 4AN3A 4GKHA 1R3CA 4XRLA 2J0KA 2C30A 4PDSA 5HE1A 3VULA 2J50A 5IA4A 4UZDA 4KBAA 3FHIA 2UZUE 5KE0A 4PTCA 4WNKA 3BWFA 4BN1A 3FDNA 4QQTA 3KU2A 2OLCA 4YR8A 5JFVA 5CAPA 1H8FA 4I6LA 3C7QA 3E8CA 2VGPA 3HLLA 1NVSA 4D28A 4AXEA 5DN3A 4EJNA 3AMYA 4CZUA 1DM2A 1E1VA 4DHIB 2GS7A 2IZSA 3VBYA 2ZM1A 3IKAA 3OWLA 3TYKA 5EQEA 2UZVA 3ZEPA 3O8PA 4BDKA 1A9UA 3EN7A 3KVWA 1Q3WA 3ALNA 4FRFA 5C9CA 2OGVA 1PXOA 4I5MA 3M11A 4I5HA 2XNBA 3QX4A 2BVAA 2GNJA 4EBWA 5CTPA 3ENHA 1QPDA 4FUXA 5EDPA 4OTHA 4V0GB 2ITYA 3HEGA 3Q9XA 4W4WA 3SAYA 3TIZA 3VW8A 4HYIA 5CU2A 4QRCA 4V0GA 5CT0A 2PZPA 3KRXA 1YW2A 2VWBA 4EK5A 4ZZNA 2HZNA 5DVRA 4BBEA 2W1ZA 3UP7A 4X2FA 4NT4A 3CLYA 4RFYA 1BL7A 3G90X 4F6SA 2NRYA 5D7VA 1KE9A 4YBKA 2QKRA 4Y85A 4FTTA 3ZO2A 4CFVA 1G8AA 3POOA 3Q96A 3EFJA 4RWIA 3I0OA 2AC3A 4YTIA 1CSNA 1CM8A 4IX5A 5LVNA 5IMEA 5M08A 3NCZA 1OKYA 2A0CX 4J97A 5DR6A 4QP4A 1Q62A 3KF4A 3ZO3A 4YZ9A 1YXVA 1M7QA 2E2BA 2ZJWA 4ORKA 4QEBA 1ZZLA 3UGCA 4O7TA 2VTSA 1H01A 4EZ3A 2JBOA 2ZV9A 2VO7A 4FT3A 4KKEA 5CZIA 5LCKA 2C5NA 4KIOA 4NTTA 3U4UA 4ANNA 5AADA 1KUTA 3DQWA 3RCJA 1WCCA 2C5OA 4AG8A 4DH1A 3SGCA 3V8SA 3WBLA 4DG0E 3QD0A 5E7RA 5IG1A 1DAWA 4NSTA 2PMLX 3ROCA 1HCLA 1PW2A 4G3FA 4J71A 4C38A 3EHAA 3R6XA 3DPKA 4EJ7A 4RFMA 1GZNA 3VHKA 2OIQA 2OJIA 4KB8A 4W4YA 4BDIA 4KS8A 5BVNA 4ZMFA 4FSUA 3TKUA 4EHEA 3SQQA 4PMMA 3FQSA 3VRZA 2XEYA 3I6UA 2F57A 5HG7A 4USFA 1Q8ZA 1H08A 4AF3A 1LEWA 2YAAA 1BX6A 2QOLA 3KL8A 3OD6X 4L42A 5D1JA 5AJQA 2A98A 4FV3A 5EKOA 5HVYA 2O64A 3ZUUA 4D9TA 5CYIA 4IM0A 3KKVA 3NNWA 4FSRA 4M97A 3EN6A 1F3MC 1WVXA 2G2FA 2R4BA 2R2PA 3UJGA 2XALA 4H1MA 1RJBA 4TXCA 3NUYA 4BYJA 4OAUC 3O5AA 3Q3BA 1KWPA 1WBSA 3SXRA 1YXXA 4O4CA 2B55A 2B9FA 4LMUA 4GT5A 1OKVA 4U40A 3ZM4A 4ZLYA 3JR1A 4S31A 4APPA 4WHZA 1ZOGA 1VYZA 1XBCA 5TR6A 4TKSA 4TYHB 2GNLA 3DXPA 4BGQA 4Y95A 4E3CA 4EH8A 2XYUA 2XK8A 4C02A 2EXCX 2X4ZA 3AD4A 4FTOA 3VN9A 2JEDA 3GOPA 4NYEA 5FTOA 3QTXA 1JVPP 4R6VA 4U5JA 4X21A 4UWCA 3V3VA 3II5A 1UKIA 3DTWA 3DZOA 3F69A 3ZDIA 2R3MA 2QNJA 3P08A 4J8MA 3DA6A 5AR5A 3FL4A 5ACKA 4HOKA 5AP5A 3UODA 2J7TA 3EQPA 5KMMA 2CCIA 3OT3A 3HX4A 3U6JA 5ANKA 3F2RA 4IM2A 1K3AA 4AZWA 4FKSA 5LJJA 2I7QA 3ZOSA 3VWAA 5BVFA 4ITHA 2BZIB 3KRWA 2G9XA 1U5QA 5CVHA 3DOGA 3MFUA 4U7ZA 4Q2AA 3W2RA 3OC1A 4HPTE 3SC1A 3MESA 1WVWA 4QTEA 3ULIA 4X0MA 3W10A 3QWJA 4IW0A 1OVEA 3IS5A 3QKKA 4RQVA 5IEVA 3BEAA 3R9HA 2PYWA 3HKOA 3MJ1A 4IZAA 1QMZA 4J8NA 4G31A 4ID7A 5JGAA 5AMNA 3VQUA 2V0DA 4FGBA 4U0IA 3KIOC 1XH7A 3P5KA 4MWIA 5E8YA 1Q4LA 3CJGA 5KMKA 5E1EA 4LFIA 2XKFA 4C3PA 5LWMA 3RWQA 4YZCA 5CANA 4FNXA 4AOIA 3G6HA 3ACKA 3ODZX 2LGCA 3F82A 3QRUA 2Z2WA 2O2UA 2B53A 4YMJA 1PRYA 2ZMDA 1H28A 5GJDA 2G01A 4LV8A 3SRVB 3KXXA 3PRFA 1OUKA 3WF9A 3SRVA 4ENXA 4DGMA 3MJ2A 2CLXA 4GJ2A 1BMKA 5KMOA 4RPVA 5ETCA 4F9CA 2I6LA 4OTFA 1H0VA 3BV2A 3COIA 3LZBA 3M42A 3HRCA 5ETIA 1WBNA 4D5KA 2XS0A 3FZSA 5AAEA 3A4PA 1VR2A 2GSFA 3I60A 4AZFA 4YTFA 5HX8A 5M09A 1VLRA 4BGGA 4HPUE 2HW7A 4BBFA 4BCFA 3FQHA 4JDKA 4UMRA 4ITJA 4QQJA 4B8LA 4ZLOA 4IWPA 3PA5A 1ZY4A 3R7OA 3NIEA 2YDJA 3OTVA 2O65A 4D55A 4IH8A 4GRBA 2PVFA 4YLLA 2X0QA 3KXGA 4IVDA 4O0SA 2A4LA 3PPKA 4FTLA 4NZWB 5DBXA 3UDBA 5HIEA 4KUJA 4H39A 5AM7A 3E64A 2CPKE 5AR8A 3R9OA 2WHBA 3BEGA 4FL1A 3ZZWA 5CU4A 1FGIA 2FGIA 4I6BA 3HMPA 3LCOA 3QHRA 5L6PA 3DV3A 4NM7A 5HO8A 3LE6A 4QMLA 4I0RA 3WE4A 4RJ7A 3U8WA 4XOYA 4HCTA 3V04A 3GP0A 3GU6A 3HA8A 2XKCA 3ROYA 5F4NA 3OBJA 4CCBA 5DI1A 5JT2A 4JOAA 5HCYA 4YO4A 3EL7A 5L6WL 2XBJA 3HL7A 4QPAA 4KKHA 5BVKA 1ATPE 2VX3A 2FVDA 3LQ3A 4AAYA 4Z7GA 4M68A 4JS8A 2X8EA 5CI6A 2X7OA 3TNWA 2P55A 2Z7SA 4GFGA 4DFBA 3ORKA 4R3PA 3RVGA 3D5XA 1J7UA 3THBA 5C4LA 4A07A 2H34A 1JBPE 4MF1A 2EVAA 4TYGA 1TFFA 4G3EA 3TM0A 3WF6A 1PYXA 3ATSA 4E26A 3OEFX 1F0QA 2DYLA 5E8XA 4IFCA 4ANBA 4R77A 3KCKA 4KSPA 3E3PA 5JZNA 1O6KA 3S3IA 5D41A 3T3VA 5J5SA 3QTIA 4HZSA 3E62A 4X2NA 1S9JA 2VTJA 2X0GA 3TJDA 2OZOA 3MH2A 4EUTA 1JSUA 4KABA 4OTQA 4ZXTA 4JRVA 4C57A 4FEVA 4IB0A 3KXZA 1OPLA 1GZOA 2BIKB 4ZIMA 3TJCA 2PVLA 3SDJA 2HXLA 3MFSA 3RALA 3MDYA 1OMWA 4K33A 4YJUA 2HZIA 3ZEWA 3RZBA 3NDMA 3QALE 4O7SA 3HZTA 4IX3A 4KIQA 3OOGA 5BMSA 4U80A 3M2WA 3AKKA 4YZBA 4S32A 4ENYA 4S2ZA 1J7IA 5E9EA 1YHWA 3IO7A 2PULA 3O71A 1KE6A 1JWHA 4FSZA 4E5BA 4JX3A 3C5UA 4ZJJA 4ALVA 3GGFA 5HVKA 3TUCA 5FG8A 5AP7A 2OO8X 3KXNA 2QG7A 3LLTA 4GU6A 4O7YA 1Q97A 3VF9A 3WZDA 4NJDA 4PF4A 1H1WA 4DH3A 5EM7A 4G34A 4C4JA 2W1DA 5GZ8A 3C5IA 2B9IA 4MKCA 4OTGA 4RX8A 4YJTA 4CT1A 4MAOA 3A7IA 4PWNA 5KHXA 4IANA 2GS6A 4BIBA 2O63A 4YNOA 3UOKA 4EH3A 4F7SA 4MEDA 4EI4A 2JDRA 1ZLTA 2JKOA 3M1SA 5C8NA 3A60A 5E90A 3JYAA 3D2KA 3OCGA 2RFEA 4LG4A 3BGPA 3ZYAA 3WF7A 1XH6A 2BIYA 3DDPA 2VX1A 1WVYA 3MIYA 4MBJA 1J91A 5IA0A 4W8EA 2WMTA 3Q4CA 2X2KA 3AC8A 5EI2A 3OBGA 4LL5A 2C3KA 2HIWA 4JQEA 4FTNA 4YC8A 2HY0A 2PZRA 2XP2A 4WUNA 4KBCA 1Q8UA 5CY3A 5LCJA 3UP2A 4E4MA 4AW1A 3UO6A 4GEOA 4JBOA 3RK9A 2NPQA 4ANOA 4L01A 3QCXA 1IAHA 2EXEA 3G51A 1YOJA 4BZDA 3CGOA 2VUWA 3F7ZA 4LQMA 2HK5A 3Q4TA 3LMIA 1KOAA 2F7ZE 4ASEA 2ZVAA 4TYIA 2RF9A 3ZLWA 4FBXA 4AW5A 4IC7A 5JFWA 3KN6A 3EN5A 3FBVA 4B4LA 4CEGA 4BICA 3BPRA 3R01A 1DS5A 4QP6A 3OG7A 3UDZA 2QR8A 3ZC6A 3D7ZA 2YIYA 3PLAE 2P2IA 4B7TA 4ZY6A 1WBWA 1J3HA 2HWPA 3V6RA 1V0BA 1WBOA 3QGYA 3OXZA 1UU8A 3VAPA 2WEIA 3V8WA 3TTIA 4QP9A 4BIDA 3HUCA 2Z02A 3PA4A 4J98A 1PHKA 2E9PA 1YHVA 3DB8A 5TE0A 5LXMA 4IADA 3QUEA 3F88A 1K9AA 3DKCA 3LM0A 5FXSA 3HV3A 2UW0A 3W0SA 4D9UA 5ETFA 4I23A 1TQMA 1FOTA 1IA9A 1UU7A 4FYNA 5JGDA 2XMYA 2QKWB 3DBEA 4H58A 1AQ1A 3P0MA 4AA5A 5A14A 4PPBA 5B2KA 3NW6A 3TCPA 4FZ7A 4MNEB 4X2KA 1XH8A 2CGWA 3AD5A 1P5EA 3NIZA 3PPZA 3E7OA 4HGTA 4HYHA 2R3RA 4D0WA 4MNEA 4PTEA 5B7VA 3VF8A 4TZRA 4UV0A 4TW9A 2W06A 3MVJA 2HXQA 3IONA 4GUEA 1J7LA 2PL0A 5AUVA 5IQCA 3TN8A 4O86A 5F9EA 4FEWA 1FBNA 3G5DA 5AIRA 4FICA 3S95A 4C2VA 4ZTMA 4ZTRA 3RHXA 4TL0A 4FSNA 5HESA 4QP2A 5A3XA 3HMOA 3CKWA 4A4LA 4CFFA 3G9NA 3NUNA 4O91A 2BCJA 1KE7A 3R7YA 4M3QA 3NR9A 3SA0A 4DEIA 3FKLA 4QP3A 2X2LA 3BLRA 1ND4A 4C4EA 4FX3A 4ERKA 4DTAA 1Y8GA 1M7NA 4BHZA 2W1IA 4MXYA 5M51A 4N0SA 3QBNA 3ZSGA 5J1WA 5TT7A 4E6DA 1OGYA 2H6DA 3RMFA 2X6EA 3EZRA 4IZ7A 4WSQA 3Q9YA 4G5PA 4IVBA 3QRKA 3FC1X 2W9FB 4RJ8A 1SZMA 2A27A 4OTRA 3FMDA 3Q53A 2IF8A 4ZTLA 3FEGA 2A19B 2Y6OA 3E8DA 4O96A 1YWVA 2OF4A 3CY3A 1H4LA 2RKUA 1UWJA 2WMXA 3FLNC 3W1FA 5CQUA 3FSFA 2QOFA 3RPOA 4FNZA 3UZRA 2PUUA 3F3UA 1RE8A 3HMNA 3R71A 4AX8A 1M14A 4BCJA 1URCA 3I79A 5CALA 3EWHA 4IQ6A 2IW9A 2JIUA 4L46A 4TYEA 3EQGA 4FT0A 4XP0A 5D11A 3W2CA 4D4SA 4ONAA 4O7WA 4DCAA 5HI2A 4YZNA 1OL1A 2WTIA 2XH5A 5IA3A 5M57A 2AEGA 3AC4A 2C3JA 4WKQA 4AQKA 3BYSA 4HCUA 4L52A 4FZDB 3O50A 3HMMA 3QD3A 4JT3A 3K2LA 1FMOE 3H9OA 4IFGA 1H1QA 4U3YA 2PZ5A 4YBJA 3N4UA 1U59A 3L8XA 4EOLA 5ACBC 5H8BA 4RX5A 5BV3A 3D94A 5BMMA 1UVRA 3A7GA 3FLYA 3Q4UA 3MVMA 4LOQA 2XRWA 3QA0A 2W9ZB 1XO2B 2W4JA 1RW8A 2ZDUA 2W05A 2CKPA 1JSTA 4Z3VA 3BI6A 4XG6A 3ZH8A 4BCMA 3NNVA 4ACMA 4Z16A 5G6VA 2CN5A 4DC2A 2ZOQA 2BRMA 1XMMA 2BKKA 3U87A 3A4OX 5G1XA 3L1SA 1PXKA 5H8EA 4O6EA 3PJ2A 2QHMA 5ANJA 5CSWA 2JFMA 3ML1A 3QF9A 3D5WA 2V62A 2OSCA 1REKA 3RM7A 3VBQA 2WIPA 1ZYLA 4FKGA 3KA0A 2VWIA 4HVIA 4ZY5A 2XK6A 3RPYA 2ITXA 5K5NA 5KBRA 4TPTA 2ITNA 4XV1A 3VONA 5CX9A 2PE1A 3LFSA 4RJ4A 4MCVA 1YXTA 1APME 4DEGA 4K77A 3OP5A 4G6LA 3PP1A 4KD1A 2R0IA 4ZSEA 3HUBA 1L8TA 3QTQA 2YM4A 4OAVB 3MVLA 4XV9A 4MD8E 2QC6A 4XMOA 4L7SA 1FPUA 1ZARA 2VTMA 3TV7A 2QOBA 4AXCA 5FTGA 3D15A 3TZ8A 4AZTA 4LOPA 3DCVA 2ITOA 2QONA 3RKBA 1XH9A 4AN9A 3LFDA 4R1VA 3Q9ZA 3IK3A 3BV3A 5EW9A 4HYSA 4GH2A 4ZZMA 5L6OA 3B2WA 3BU3A 4BRXA 3PVGA 4RVLA 3UYSA 2B9HA 4FIEA 3O96A 3ORMA 2WIHA 4FG7A 4BC6A 5IQBA 5J5TA 5ANIA 5A46A 5LVPA 3FMJA 2FUMA 2VWYA 3ZLXA 4IIRA 3UIXA 1JOWB 3GC9A 5DR2A 5HG8A 4BWXA 4EOQA 3P9JA 3MWUA 4MBLA 5AV4A 2XIXA 1M52A 4F63A 3KRJA 2IJMA 1NVRA 4RIOA 5FM3A 3VBTA 1Y6BA 2C4GA 3DBDA 3TDWA 2YIQA 4DFUA 3HDNA 3FKOA 3JY0A 4EH7A 3KGAA 4NH1A 3MI9A 1M2RA 3QQFA 4D2VA 2BRHA 2OH4A 4O7NA 3QTUA 4PDPA 3GEQA 4ZSLA 2GNIA 5K0XA 4QQCA 2R3FA 4BGHA 4CTCA 2XF0A 4DFZE 1ZMVA 3UPZA 4YURA 4F9BA 2EUFB 4DFLA 1GZ8A 1STCE 1YQJA 4A9SA 1W7HA 2WOUA 3F3ZA 4GJ3A 3C0HA 4J53A 4R1YA 3C4FA 2RIOA 2WO6A 5ANOA 5EFQA 3EN4A 5HBHA 4DG2E 4FV4A 3KCFA 4FIJA 2JLDA 5IUGA 4L43A 2WMBA 3VW6A 4WT6A 2RG5A 1Q3DA 3CCNA 1CTPE 5CF4A 3UDSA 3C0GA 3O2MA 4CCUA 4I6HA 4O22A 3QHWA 4R78A 3MSSA 4BHNA 3ZTXA 3Q2JA 5FM2A 4CKJA 2OKRA 3BKBA 5HLPA 1FVRA 3G33A 5JSMA 4ACGA 3ANRA 5DGZA 3LLAA 2BFXA 4ZSGA 4YC6A 1Y57A 3HV7A 2HW6A 5AP3A 2HWOA 3CTQA 5FBOA 1YKRA 2XAOA 4II5A 4FKVA 5KX8A 1MUOA 4K0YA 3ZCLA 2BZJA 2VO6A 1ZRZA 4ZTSA 4QQ5A 5HEZA 3FXZA 4E6AA 5AR2A 4YNEA 3D0EA 2WMVA 3AOXA 4NEUA 4D2SA 4CLJA 3MA3A 4A4OA 3NAYA 2AQXA 5CS6A 4KBKA 3VUDA 4FTKA 4K6ZA 2FYSA 1Z5MA 1YDTE 4KA3A 4P7EA 3BWJA 5JQ5A 1ZAOA 2I0EA 4BYIA 3VVHA 4DT9A 4YSMA 4E6CA 4PP9A 2ITZA 3F5XA 3AMAA 4EYMA 1NW1A 5HTBA 3LQ8A 3PRIA 3PY0A 3P7AA 3V5PA 4G6OA 5KUPA 4PV0A 5F20A 3HYHA 4QT1A 2BAKA 3PWYA 2BAJA 4FMQA 4RVKA 1T46A 4MVFA 4UMQA 4E1ZA 2EXMA 1ZY5A 3GU8A 4EH4A 1MRVA 4FGRA 1E1XA 3QA8A 1HOWA 4Y83A 3ZFMA 3MY0A 2CN8A 3QFVA 1TQIA 3R7UA 5B2MA 1O9UA 3H3CA 4R7HA 4I24A 3QQKA 1PXJA 3NPCA 5CNOA 1OIQA 3WOWA 4L9IA 4AZEA 4YSJA 2CNQA 3OXTA 4CYJA 3LFNA 4A7CA 1PXLA 4EWQA 3JPVA 4U3ZA 1ZYSA 3KK9A 3GCUA 4RRVA 2WKMA 2OJGA 3HA6A 4CFNA 4U41A 1YHSA 4HZRA 5IEYA 3PY3A 2QOCA 2XIYA 1VZOA 1DI9A 4YZDA 4PL4A 3TI1A 4NCTC 4U97A 4XG4A 4O7LA 2YM3A 3Q4ZA 1Q5KA 5IEXA 3EQHA 3UO4A 4DDGA 3P7BA 4G9CA 3F9NA 1SNUA 3PSCA 4FIIA 1V0PA 5AV2A 3BHVA 3UIMA 3VUKA 4DEBA 5CF8A 4J7BA 2Q0BA 2GQSA 2CCHA 2VU3A 3LXLA 1YWNA 4NM3A 3LCSA 4C0TA 5CAVA 5BVEA 5I4NA 3ZO1A 3JS2A 5L2TA 4EQMA 5KMIA 3GI3A 4IB1A 2IZUA 4G2FA 4OT5A 5IF1A 2YM8A 4M13A 3RJCA 1OL2A 4ARKA 4RC3A 3UQGA 2UZOA 5M06A 2CSNA 2FH9A