4H3PA

Crystal structure of human erk2 complexed with a mapk docking peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
349
structure length
342
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLAFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Protein-peptide complex crystallization: a case study on the ERK2 mitogen-activated protein kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 342
sequence length 349
chains with identical sequence D
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4h3pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4h3pA01
1UWHA 4JG8A 3RJCA 5KBRA 2QOFA 3PSCA 4J53A 5HORA 1UU3A 3PYYA 5C8NA 2FYSA 4FKRA 5E8WA 4ACGA 4Q2AA 4JQ7A 5HU3A 3ZXZA 3FKOA 3CKWA 3CTJA 3DFCB 4AU8A 3KK9A 1DI9A 4KA3A 2NPQA 2VTTA 3CJFA 3DDQA 3GUBA 3WF6A 3ZCLA 4BYIA 3L8VA 3QZGA 4O6EA 5JZNA 3DS6A 3QCXA 4I0RA 1URWA 3FSKA 3W2CA 1G3NA 2R4BA 5HLPA 2GTNA 5CALA 5HNGA 4Y95A 5AP6A 2VAGA 3L9LA 3DKGA 3AMBA 4I24A 5K4JA 3ZUTA 3HAVA 2PVNA 2Z7SA 3DBEA 5AMNA 1LEZA 4MBJA 3MB6A 2QOLA 3DK3A 4GL9A 4M68A 4GIIA 3DXNA 3H10A 3ORIA 3PVGA 4FIJA 4ZTNA 3EB0A 1PRYA 5CEKA 5AM7A 5IUHA 4IWPA 4DAWA 3HUBA 1SVGA 2XNBA 4FVQA 2XNPA 4QPSA 3HV4A 2GNHA 1NY3A 5H3QA 4Y46A 4EK5A 3FLSA 4L7FA 2P2HA 2VRXA 5DA3A 3FZRA 5AX9A 5B2KA 2UZDA 3UNJA 2YCQA 3ZC6A 1ZOEA 1V1KA 4LMUA 4DFYA 3WARA 4YHTA 4G2FA 5CF6A 4O84A 4ZZOA 1OIRA 4AZEA 3L9NA 2UZWE 4FUYA 4FKPA 4UY9A 4JI9A 4FICA 2LAVA 3AC4A 2NO3A 4D2WA 5JGAA 4ZLYA 5IDPA 5LWNA 4L67A 5IA1A 3Q2JA 3EN9A 4CCUA 4NJ3A 4FUXA 3SKCA 5AR7A 4JRVA 2BTRA 1JNKA 2GMXA 3C5UA 3Q2MA 3JVRA 3OXIA 4YZNA 3V01A 3C0HA 3V8SA 4GMYA 3NDMA 5KMOA 5LVNA 1Z57A 1G8AA 4E6QA 3BLQA 4IZYA 3LFNA 2X2MA 4IVBA 4ASEA 4YTIA 3UZRA 5E8SA 1BLXA 2OJGA 3HA8A 4I21A 2HZNA 4PL4A 3PLSA 4UXLA 4ZZMA 4C2VA 5F4NA 2XKEA 3RAWA 3VAPA 1H28A 4EHVA 4BCGA 4IFGA 4K0YA 4U81A 5AP4A 4LGGA 3ZDIA 4E73A 1R0PA 2XIRA 4EH3A 4OAVB 3CP9A 3LCKA 2HYYA 4A9SA 2PUNA 2VWVA 5BVWA 4YURA 4ANOA 4EC8A 5M08A 5HX6A 4YBJA 4F1MA 4J52A 1AQ1A 4K1BA 3VRZA 3EQPA 3FJQE 4O7VA 3QUEA 4BIDA 1WBSA 1R3CA 2PHKA 3QUDA 4CFUA 2X1NA 5CI7A 1KWPA 4AA0A 3THBA 1OB3A 5JKGA 4FSQA 4DT8A 1PXJA 5IH6A 1TQPA 4FKUA 4HGTA 3ZFYA 4FKSA 2YWVA 1XKKA 5GJDA 2W4OA 3ZLSA 5JFWA 4MHAA 2GDOA 2VTMA 1CKPA 3GI3A 2A19B 3QL8A 4O2ZA 3CGFA 1JAMA 1VJYA 3IW8A 5IMEA 4G6NA 5I3OA 1OL6A 4MXZA 3R8PA 3BLHA 4I6FA 3QBNA 4JOAA 3LFQA 3SGCA 4YJNA 1R1WA 3KF7A 3NNVA 3OXZA 4RFYA 5DEWA 4C3PA 2ERKA 5HCXA 5F1ZA 2J5FA 2ZMDA 4JBOA 2B7AA 4I1ZA 3JY0A 4BC6A 3ROCA 3TG1A 3E5AA 1JSUA 3LM5A 3R0TA 4AWIA 4BDCA 1TKIA 4KSPA 3OWJA 4P7EA 4B6LA 4L6QA 5CZHA 3HKOA 4QMQA 1JKTA 1H4LA 4DG3E 5L2WA 4EHEA 3VJNA 5FTOA 1OL5A 3VULA 2UUEA 4X21A 2CNUA 5IQBA 4ACCA 4ZLZA 4FEWA 3DBCA 1KE8A 3NWWA 4L42A 3GU8A 4RT7A 4IAYA 5EI6A 3MVJA 2XIYA 5HBEA 2B9JA 4D55A 2YM6A 3E7OA 4BDJA 3NVKI 2QLUA 4MF1A 5CVGA 2OLCA 4BTKA 4M0YA 4EI4A 2IVUA 3BYMA 3U9CA 1X8BA 2PZYA 3PA5A 1WMKA 4OW8A 3V5PA 2O2UA 4IBMA 1Y8GA 3RCJA 3Q4CA 3H9FA 5HE2A 4RIWA 1Q4LA 3PPKA 4J1RA 4YJRA 4JBVA 4UYAA 2QLQA 4E3CA 2FGIA 3F3VA 4FKOA 2HY81 2V22A 3KKVA 4F9YA 4BKJA 3MPAA 3O7LB 4NFNA 2OZAB 3IOKA 4UMPA 1MRUA 5G6VA 3PSBA 3ZC5A 4AW0A 4WO5A 2WTCA 4G3EA 1S9JA 3UPXA 4DFNA 1ZOHA 5CSHA 4C4JA 3F2NA 4O0VA 4CTCA 1NVRA 2CKOA 3ZM4A 3S4QA 4TWOA 4BCQA 1J7IA 5EDPA 4HYIA 1KV2A 4QD6A 3VUHA 4DG0E 3ALOA 4O1OA 5AR3A 3A61A 1M17A 1BL7A 2JGZA 3O8TA 5AV2A 3ATSA 2VWIA 2ZV7A 2WU7A 4O0WA 4AE9A 4BCPA 5ANJA 4KSQA 2E9NA 2WQOA 3DV3A 1WVWA 4F70A 4MKCA 4NCTC 3SG9A 3QZIA 4RPVA 3VW8A 1UNHA 3WZEA 3ORMA 3BHVA 4LOQA 4EOMA 4FSTA 2PU8A 3OCBA 4MBIA 3CEKA 3NNXA 4EKKA 2YDIA 4YC8A 4F1TA 4UV0A 4QP1A 3TZ8A 1SNUA 2QOQA 5EW9A 3BGQA 2RGPA 1RDQE 2J90A 4NH1A 2UZTA 1U46A 3JXWA 2BKZA 3QQHA 3VF8A 2QHNA 3P7AA 2R2PA 4ENYA 4F9CA 3GFWA 4BVUA 1W0XC 3PTGA 2OJ9A 2XNOA 2WU6A 3G9NA 5FQDC 1Q97A 3R8ZA 4EORA 2YA9A 4R5SA 3E3BX 4BZDA 3R63A 5JSMA 3SXFA 1OITA 1OIUA 4RA5A 2C5NA 2JBOA 2JKMA 5HO8A 1JQHA 4YZCA 1FPUA 4CFFA 2WTVA 3UIBA 3VBWA 4NU1A 3ULZA 2QG5A 4F0FA 3AT2A 4XJ0A 3DT1A 4MXAA 3KB7A 1CM8A 4YJPA 4P2KA 5KKRC 3KRWA 5AUZA 2YIRA 3NUUA 5FGKA 4ZSJA 3FI8A 3BHHA 4Q5HA 3NRMA 4QTAA 3UG1A 4OUCA 5A14A 4QTDA 4G3CA 3QRKA 3KL8A 4E6DA 1TVOA 4FT7A 5CSXA 4F7LA 2ETRA 4FV7A 1OZ1A 3HRCA 5FXQA 4EHZA 2IVTA 4XV2A 4GYGA 5HO6A 4XLIA 5CXZA 5F20A 3M11A 1B38A 1S9IA 2VO3A 4AAAA 3PPJA 5AA9A 4GKHA 2JD5A 2C4GA 4RWJA 4HZSA 2J4ZA 5DIAA 5HG5A 5AADA 2OIDA 5ITAA 5E9EA 1YOJA 3DBQA 5CVHA 4C4IA 4FSZA 4TXCA 1BX6A 4GV1A 4L9IA 3TUCA 5HKMA 4WA9A 2VTLA 2QU5A 4ACDA 4ZZNA 4I5HA 4BBMA 2UW9A 4DGMA 4GU9A 5FDXA 4RLLA 4RZVA 2QO7A 3Q5ZA 4OTFA 3ZFMA 5EI8A 5C27A 4ERKA 5JT2A 1K2PA 3TCPA 1XH9A 1PMEA 4IM2A 1H27A 4QOXA 4USDA 3VIDA 4BBEA 4J98A 4IDTA 2OK1A 4Q9ZA 3FEGA 3HMMA 2XK6A 3BIZA 3KQ7A 2OZOA 4FYNA 4CKJA 2XJ1A 3VS4A 1Q3DA 1OL1A 5FWKK 3V6SA 5HG9A 3NIZA 1O6YA 3OD6X 3S2PA 4DH7A 4D9TA 4AA5A 3DNDA 2OXDA 3SX9A 5DHJA 4AZWA 3ZO4A 3R02A 4RWIA 5DWRA 1MUOA 1FQ1B 4AP7A 2C6DA 4V05A 4BGHA 4O22A 1KV1A 3MJ1A 5HI2A 2J0LA 2J6MA 4HCUA 2ETKA 3DXPA 3PJCA 4AG8A 5C03A 2OIBA 5H2UA 4AGCA 3DAKA 5AAEA 3RM7A 4EHGA 2VN9A 4WRSA 2P0CA 4CTBA 3R7UA 3DAJA 3EWHA 4O0XA 3QTXA 4U79A 4R78A 4JBPA 3G6GA 1XBAA 4BCIA 2R3FA 4FSNA 3LFBA 2P4IA 5B0XA 5I3RA 5IA2A 2R3JA 3AC3A 3R6XA 4FTLA 4Y73A 3RCDA 3Q3BA 2J0KA 2XUUA 3W8LA 4AT3A 4EQCA 2VO7A 1U54A 2DS1A 3NCZA 4FZ6A 4UWYA 2B52A 4B4LA 3KCKA 3RNIA 2C1BA 4MNFA 4USFA 2I1MA 4HCVA 3ZXTA 4DA5A 4U3ZA 4FTIA 4NW5A 4G3FA 2PZIA 2XH5A 3OCTA 5CU3A 2BTSA 4KUJA 3DLSA 2HWOA 4UB7A 3QCYA 2BZKB 1OPKA 5KHWA 4FZAB 4C7TA 4F7JA 3NUYA 4KRCA 4NIFB 3FZSA 4ACHA 4UMUA 4O91A 5DFPA 3N9XA 5CT0A 2R5TA 5BVDA 2BHHA 2O64A 3QYZA 3VBVA 3QA0A 4KAOA 4G17A 1Q3WA 3C9WA 2J5EA 4S33A 5J8IA 3VUIA 1QMZA 3ZUVA 5HD7A 3NEWA 3M2WA 5M51A 4JQ8A 5EW3A 5IQHA 3FLQA 3V51A 2ZV2A 5FG8A 3TNQB 4ITJA 2PVJA 3QC4A 3UZTA 3VF9A 3SVVA 2UW3A 5E8XA 4ZTMA 5AV1A 4BYJA 3QRTA 5DT0A 3D5WA 4ZY6A 3DJ7A 3GOKA 1R78A 3VS1A 4ZS4A 2W4KA 3F61A 3FL4A 3G0FA 3QQKA 4DH3A 3D2IA 4KIPA 5J1WA 3QD0A 4I41A 2R3MA 4C4HA 3TTIA 4LV8A 3RZBA 2IZSA 3UMWA 4DCAA 1GZNA 4WHZA 4FC0A 1REKA 4F7SA 4LGHA 4X3FB 3AQVA 2ZB1A 5IEVA 5HTCA 4O6LA 4ACMA 3FBVA 2X6EA 4IAKA 2BZJA 5DR9A 2PE0A 3PVBA 1ZRZA 2YITA 4FKGA 5E7RA 3UGCA 4AZVA 1ZYSA 5LMBA 4O7NA 5F9EA 1V0OA 3UC3A 2QD9A 4O38A 1CKIA 4OBOA 5E1SA 5IG1A 3QA8A 3R9OA 4FYOA 1PKDA 1RQQA 4RIYA 3FV8A 3VBTA 3ZLYA 4EWQA 5KMMA 3HGKA 3EN5A 5IUGA 2JLDA 3QAME 2PMIA 1J1BA 4TWNA 2PVRA 3VW6A 3DB8A 3EL8A 2GFCA 2W06A 3ENHA 3O8PA 3ANQA 3T3UA 1CSNA 3MN3A 5HG8A 5A4EA 4RX9A 4FR4A 2YHVA 2B9IA 3F7WA 3O17A 3IGGA 4FGBA 2W1ZA 3FI3A 4FSYA 4KKHA 5JK3A 1YI4A 2C3IB 1IRKA 4G5PA 5D1JA 4BHZA 2PZRA 3NNUA 3D7TA 4Z7HA 2QR8A 5EYDA 5I9WA 3CD3A 4YJSA 2GHLA 2VTHA 4GS6A 4EOQA 3TJDA 3MFSA 1VYWA 3BKBA 4NEUA 2PE1A 3UODA 3WBLA 2YACA 2WTIA 5CYIA 5LVLA 1NVQA 4G6LA 4RJ6A 4GT5A 2WQNA 4DBXA 4I6BA 1Q61A 4I23A 4U43A 3EH9A 2J2IB 2WIHA 3H9OA 4MYGA 5DGZA 4AN3A 4W8DA 4EOOA 4I93A 5AUUA 5JQ5A 4G16A 1FOTA 2J51A 3L8XA 4GIHA 4OGRA 4ZTRA 5LOHA 3VBQA 5KBQA 3DK6A 2R3RA 2UZNA 5HOAA 5LMKA 3K5UA 3V5LA 3G33A 5CZIA 3AC2A 3MTFA 3SRVA 4MCVA 5L6OA 2PULA 2XNEA 4FBXA 2WTDA 3TZMA 3NW5A 2R3OA 4J96A 1YHWA 4CMTA 3FPMA 3PXYA 3FZPA 4RIXA 3UOHA 3ZRLA 4I5CA 3DDPA 5KMIA 2WQBA 4JQEA 4QYEA 5T3QA 3VUTA 1Y8YA 1ND4A 3O7LD 4CGAA 5HBHA 1FMOE 3UOJA 2G2FA 4AUAA 4DEHA 3A60A 5EDQA 1IG1A 3RNYA 5IEYA 3ZO3A 4IM3A 3ORLA 4IAAA 1LPUA 1PMVA 1I44A 2IW6A 3NUNA 4QYGA 4XS2A 3BX5A 3HA6A 5T68A 1OPJA 4C02A 3U6IA 2V5QA 1XR1A 4E5BA 3KXXA 1QPEA 1YHVA 3N4UA 3OF0A 5AAGA 2A0CX 2R64A 3BLRA 2RF9A 4FTKA 4FV1A 2FUMA 1VYZA 1YQJA 2C47A 4GFGA 4EH4A 3QQFA 3OBJA 4KKGA 2YWPA 3KULB 3ANRA 3AMYA 4OTQA 1ZWSA 2FSMX 1F5QA 1A06A 1Q8TA 3NS9A 2ZYBA 4J97A 4PTEA 3EN4A 3ZEWA 4AGDA 2GNLA 3OOGA 3PE1A 3QALE 5AV0A 4NWMA 3KXHA 3UP2A 4FE2A 4FTTA 4NZWB 3BQCA 5JFXA 4A4OA 5LVPA 2CKQA 4GKIA 4OTPA 2HW7A 2OFUA 3LAUA 1VEBA 4A07A 5FTGA 4QQTA 3R7EA 4ZSEA 2UW7A 3E8CA 1ZMUA 3QTQA 4OBPA 3SXSA 4CLIA 5HNIX 3TNHA 1NXKA 3FHRA 4ZLOA 5HLWA 3CPBA 3VUGA 5D10A 5J9YA 3H0YA 3HP5A 4R1YA 2PZ5A 3V5QA 4WRGA 3EQHA 2YJRA 4YLJA 5ANKA 2I0YA 4MBLA 3QLFA 4IWDA 4QNYA 5LWMA 3HZTA 2J50A 3RWPA 1Q62A 5LVMA 4C4FA 1YDRE 3LE6A 2EXCX 2WMUA 3A7HA 4ZSGA 3TN8A 2GQRA 1H01A 5E4HA 3PWYA 5J7HA 4HVSA 4O7WA 4A06A 3LMIA 5IPJA 4LL0A 2YEXA 2UZBA 3ELJA 3QRJA 2C0IA 5JGDA 1GOLA 2F2CB 5KZIA 3F66A 3IW7A 4X2KA 5CEIA 3ZLWA 5C4KA 3HV7A 2J0IA 1FBNA 3OVVA 1FVRA 3EOCA 4YLKA 1FMKA 3RHXA 2OXXA 3OY1A 5D9HA 3TACA 3FC2A 3ETAA 2XNGA 3D9VA 3PP0A 4KKEA 2R7BA 3BE9A 3Q9WA 3PIXA 5CEOA 3FYKX 2ERZE 3GB2A 4G9RA 4QYYA 2Z7LA 4YP8A 2UZUE 1ZYCA 4IADA 3GU5A 3TWJA 1OIQA 2W1DA 5M56A 4IX5A 4JDIA 3OFMA 4AZTA 4CV9A 2WTKC 4MK0A 3EFJA 2ZVAA 4RX7A 4U80A 3U9NA 4NTSA 4O86A 4BWXA 4DITA 4IB5A 4X3JA 3NMUF 3DY7A 1WBPA 4DEBA 4U41A 3RPOA 3U87A 3ZONA 1FGIA 3G9LX 3DK7A 4LRJA 2IVSA 1KE9A 4J71A 4D4RA 5KZ0A 3MS9A 1MRVA 3UBDA 5AP3A 4FV4A 5L2TA 1O6LA 3O0GA 4L46A 4MH7A 3DTWA 4UN0C 2PVYA 2ITPA 2X7OA 3QQLA 3R04A 1DM2A 4F09A 5KMLA 1ZAOA 3LMHA 2C6OA 4YJQA 3FKNA 4KBCA 3U55A 3DCVA 5JRQA 2ITYA 4L8MA 3HECA 4R77A 1M7NA 3ERKA 4IWOA 4N70A 4QTCA 4A9YA 5CASA 4FT0A 2W5BA 2Z7QA 4DE4A 3I5NA 4BKYA 3W2SA 3LMGA 4II5A 4LFIA 3WE4A 2P33A 4O1PA 4M14A 4PPBA 3SW7A 2UW6A 4YLLA 2WEIA 3L9PA 4FKVA 4BDBA 2OJIA 2XMYA 2WELA 5EDRA 2FSOX 1JVPP 1WZYA 3GQIA 3QQJA 4YJOA 4GK4A 4RG0A 4HYSA 4QMOA 4O7LA 3EFKA 2O65A 4JR3A 3HLLA 3MH0A 4FVRA 5CSVA 2R3GA 2BUJA 5LMAA 1GAGA 4QP7A 5ETIA 3PZHA 3MFTA 5CVFA 4GCJA 3HAMA 4Y8DA 3KU2A 2WHBA 4BB4A 4QQJA 2YLFA 4E5WA 4XG7A 1U54B 1UA2A 3Q4ZA 4DEEA 3CS9A 3E8EA 2KTYA 2WMAA 3R22A 1JBPE 3FY2A 1Q99A 3LXKA 2F2UA 3ODZX 3Q6WA 4JS8A 4RJ5A 4XP2A 4YC3A 5AV4A 4TWCA 5JGBA 3NX8A 1PMUA 2B55A 3GT8A 5D7AA 1BYGA 3C5IA 1YVJA 2ZM3A 2HZIA 2UW0A 2WNTA 3CY2A 4H3QA 3U4UA 5ACBC 3VN9A 3ZOSA 4BCHA 4PUZA 4XP3A 2JIUA 2B9FA 3LCSA 1H00A 5FEDA 4G34A 3KN5A 5HU9A 3IQ7A 4YHFA 3QXOA 3ORKA 2YCSA 3BV2A 2GS7A 5HG7A 3WF8A 3QTWA 2QOOA 2C68A 2ZJWA 3D5XA 3TUBA 4UXQA 2A1AB 4DF3A 4FV0A 2VD5A 4FTJA 2CCHA 2EVAA 4PX6A 4YZBA 3EJ1A 2NRUA 4MEDA 2VGOA 3VHEA 1LUFA 1KSWA 4M67A 4BZOA 2WPAA 4O21A 4U42A 5E8YA 2HWPA 4IJ9A 3NCGA 5FEEA 5H8BA 5CS6A 3OW3A 3ATTA 4O82A 3CQEA 4K6ZA 4U3YA 4QP4A 4BDAA 2ITXA 2YAAA 2Z8CA 4RVMA 3EHAA 1H26A 4TY1A 5E8TA 2R3PA 2EB3A 3B8RA 4IZ7A 3IDCA 5E8UA 2WMWA 3POZA 4R7IA 1XH4A 3QX4A 2DWBA 4WSYA 3A62A 2JDTA 2BDJA 2C69A 4YMJA 2X8DA 5L8KA 1JOWB 4D4SA 2PUUA 2Y4IB 3UVQA 5E8ZA 2XYUA 4DEIA 3AD4A 3ROYA 4MD7E 2VTOA 4DT9A 4AT5A 1H0WA 2W0JA 2XB7A 1H1PA 3MIAA 2CMWA 4XUFA 1PY5A 3PY0A 4DFUA 4DYMA 5TF9A 4GUEA 3CSVA 3ZSGA 4U44A 5DBXA 3FUPA 3OROA 5FM3A 3C4EA 1YOMA 4BDKA 3D7TB 2RIOA 3Q9ZA 4JR7A 4RVTA 5KX8A 4I5PA 1UU8A 4L3PA 2VWXA 4O7ZA 2BDFA 4FKLA 3W2OA 3MFUA 4BDIA 4NKSA 5CQWA 5ETCA 5AUVA 2OU7A 3OY3A 4EKLA 3RTPA 2YABA 2CNQA 3ZDUA 3F5UA 3GVUA 2Y6OA 3DGKA 3MY5A 2I6LA 3KRJA 5JZJA 4LUDA 1L8TA 3DKFA 2ZOQA 4FEXA 4NKAA 3FPQA 2ZDTA 3WYYA 5K5NA 3TJCA 3I6WA 5I9YA 3PXZA 3OBGA 3UOKA 2OSCA 3C4ZA 2EU9A 3FWQA 3JYAA 4U5JA 3REPA 2C30A 4AGUA 3AOXA 2ITNA 4CMOA 3FZ1A 3ZSIA 3I0OA 1M2PA 2C5XA 3D15A 3QFVA 4RGJA 4NFMA 4DH8A 4ARKA 3HDNA 5IQFA 2OXYA 2BAKA 3B8QA 3UIMA 3GCSA 3PVWA 5HE3A 3AXWA 3BEAA 3VRYA 4I4FA 5AUYA 3EMGA 3F5XA 3P9JA 4JXFA 4RVKA 2OH0E 4APCA 2A2AA 3IK3A 3RBWA 4ANBA 5K0KA 1XH7A 1H0VA 4PDPA 3G15A 5CU2A 5EFQA 4MNEA 3LPBA 4AN9A 5IA0A 5GIOE 1MRYA 2F7XE 2WFYA 3D94A 4L01A 4CYIA 4C58A 5IZFA 2C1AA 2W5AA 3TNWA 4KBAA 2X9EA 3TIZA 5IQEA 2XNMA 4C4GA 4XG9A 3DLZA 3GGFA 3BWJA 4O0YA 4DG2E 1O9UA 1SYKA 5H9BA 4U45A 3COIA 4PTGA 3FMNA 3OT3A 3E3PA 4H3PA 5EM6A 2CGWA 3F5PA 4I4EA 5EKOA 5JMSA 4D5KA 1WBWA 3I0QA 1ZMWA 3NW6A 4D58A 1UNGA 4QQCA 2PUIA 3B2TA 3VS5A 3R9NA 2XIKA 3QTSA 3ODYX 4PMTA 2W1GA 3UVRA 4X2FA 1J7LA 2WKMA 2I40A 2R3KA 1XJDA 1J3HA 2OF2A 3O50A 4YHJA 2PMOX 2ZB0A 4MX9A 4YZMA 2JDOA 2XA4A 3ORXA 3RZFA 2PWLA 3FLNC 4I92A 4LOPA 3ITZA 5BVKA 5ANOA 3E7VA 3LFEA 4FG8A 4G31A 5L8JA 5FXRA 2VWUA 2XVDA 3O8UA 3SW4A 4CZYB 2WMRA 5H8GA 3PA3A 4EONA 4YSJA 4Z16A 1OBGA 2VV9A 2XP2A 2XRUA 3DQXA 3I4BA 4ONAA 1H1SA 2C3KA 2CN8A 4RJ8A 4XLVA 3HMOA 5ICPA 3GP0A 4FL2A 3OP5A 4BF2A 2P2IA 3K3JA 5CF8A 1OI9A 2QOHA 5EM5A 4OTDA 5FXSA 4W8EA 3ZEPA 4K77A 4IC8A 2YZAA 1URCA 2PVMA 1F0QA 2YM3A 3UNKA 2VX1A 4CCBA 3KRLA 3LJ2A 5CXHA 3RM6A 2JIVA 2RFEA 3ZUUA 4NSTA 4YO4A 3C51A 4QMMA 3W33A 3VS7A 4EOJA 1VZOA 4O0SA 4EJ7A 1LEWA 4QPMA 4QRCA 2WAJA 2DUVA 1QL6A 2JDVA 1GJOA 4FOCA 5H8EA 1W7HA 2W1EA 1ZZ2A 5AUXA 5AR2A 5HIDA 3R1SA 3A8XA 3AC8A 4LI5A 4WBBB 2YZLA 3QHRA 5TO8A 4GVJA 3OZ6A 3BV3A 2XKFA 3Q96A 3JUHA 4V0GB 2UW8A 3F3ZA 2XIXA 4BTFA 1A48A 3PJ1A 4JBQA 4WKQA 5M07A 3UQCA 4RC3A 3MA3A 5EM7A 4E20A 3ZZEA 3R01A 4QP3A 5CU6A 4NM5A 4O7TA 3NYOA 2CDZA 5GZAA 3QC9A 4LGDA 5JFVA 1Q8WA 3ZH8A 4EH6A 3R8VA 1OMWA 3KF4A 5I9UA 1WVYA 4RSSA 3Q60A 3MWUA 3EQFA 4A9UA 3PXRA 4XG6A 4MVFA 2OW3A 5EG3A 3W8QA 2QOCA 4WSQA 4K18A 4R1VA 3DKCA 2XZSA 1Q41A 1PXOA 3OUKA 3LQ8A 3GCPA 4DH1A 1G8SA 2ITOA 2VWBA 1UVRA 3MW1A 2WO6A 4PQNA 4XHKB 2W9FB 4C0TA 5AA8A 5J9LA 2I7QA 2C3LA 2OG8A 3RALA 2Y8OA 4JLCA 3VS0A 3FMMA 2OICA 1YW2A 2X6DA 5J95A 1SNXA 3H30A 4EYJA 2YJSA 2VWZA 3TDVA 1OM1A 4G3GA 3ACJA 2BAQA 5IUIA 5J9ZA 3FDNA 2G2HA 3BRBA 1OKWA 4PDYA 3PG3A 3OCSA 4C2WA 5GZ8A 5AAFA 4F6WA 5DT4A 1EH4A 5LMKC 2B4SB 4L3JA 4QP6A 4E4MA 4ZTHA 2C5VA 3FQSA 4NM0A 3UQFA 3FMLA 4D2RA 3GEQA 2B0QA 2HZ4A 3COKA 1P2AA 3CGOA 4WT6A 3NNWA 4EH5A 3A7FA 3C1XA 2P3GX 4ZSLA 3VS2A 5K9IA 1MQBA 4D28A 5AP2A 3SLSA 2R3QA 5HIEA 4BGGA 2X8IA 3R9HA 4ZSAA 2ZV8A 5HHWA 4E4XA 3ZFXA 2QU6A 5IKWA 4FL3A 3QD4A 3T3VA 3UG2A 1ZLTA 2FSTX 2ONLC 4X2NA 4ZP5A 5TT7A 5DOSA 2C6TA 2WGJA 3N51A 2B54A 1Q24A 4EH7A 4OT6A 3GCVA 1IASA 2BIKB 3IPHA 4BCOA 5L2IA 3LKMA 1GZ8A 1UKHA 5ACKA 1Q5KA 2XEYA 2HXQA 1H24A 1HOWA 3RINA 3ZMMA 4QMNA 4QMLA 5LVOA 2WMQA 2FVDA 4BDDA 3ZRMA 4X2JA 1HCKA 4YGAA 1PHKA 3A4OX 4N57A 3G2FA 5TE0A 5IQDA 3NR9A 2XIZA 3NYXA 4QT1A 3QXPA 1YXXA 3SOAA 4ITIA 2X2LA 3ENMA 4EK8A 3TL8A 1OKVA 4W4YA 1YRPA 5HVYA 4FA2A 3HV3A 4QP8A 2UZEA 5A6OA 3AT4A 4XEYA 4I3ZA 3KMUA 4TTHB 4WBOA 3GXLA 4UZHA 5AX3A 2GNJA 3OS3A 5FD2A 1K9AA 2B1PA 1PXIA 1J91A 2SRCA 5CU0A 5EHLA 3F5GA 1J1CA 2ITVA 3FQEA 2F4JA 1JKLA 1XWSA 4TYJA 1WBOA 5HE0A 4FF8A 3EFWA 3GCQA 3TNPC 5M55A 5IISA 5HVJA 5IH4A 4JL9A 4CKIA 5AP0A 3VUMA 3CCNA 4IE9A 5BVEA 4I5MA 3R8LA 3SC1A 1DAYA 2JDRA 2C0TA 4I20A 3LLAA 3FZTA 5LJJA 4EOLA 1L3RE 2O8YA 3NUXA 4NW6A 1PMNA 5EKNA 3KREA 3TV6A 1M2QA 3KXGA 3NAXA 4BCNA 4ZY4A 3QQUA 5K0XA 4AW1A 3Q4UA 5M06A 4KWPA 2V0DA 4ZTLA 2G9XA 2BZHB 4KIKA 1PYEA 3UE4A 4PP7A 2RFNA 5HCYA 4FV9A 1DAWA 1KE7A 1M7QA 2QONA 2YERA 3C4XA 4FKJA 3JY9A 3TZ7A 1ATPE 3DNEA 4AFJA 4DN5A 5C4LA 3BYSA 3PXKA 2Y7JA 4ANLA 1QPDA 3NYVA 3MY0A 1OGUA 4HCTA 4F63A 2UVZA 3R1NA 5HO7A 3ZHPC 2YM5A 2IVVA 2CGXA 2JEDA 4PTCA 2WTJA 1MQ4A 4RWKA 5DEYA 3OOMA 4C38A 3LQ3A 1ZMVA 3OUNB 4GG7A 2VNWA 2WQEA 2IZTA 3CTQA 3LXPA 3UTOA 4DEAA 1SMHA 4DTAA 4QMSA 4TYEA 3UMXA 3UIUA 3NAYA 2ITUA 3BQRA 3I79A 4W4WA 4GK2A 3RK5A 3IKAA 4WNOA 3EQIA 3HL7A 2H8HA 5AUTA 4AT4A 1KE6A 4QP9A 4BIEA 1YXTA 4DCEA 4NM7A 1ZY5A 2HW6A 4IM0A 4MWIA 5AUWA 1P5EA 3UQGA 2XK7A 4YPSA 2OGVA 4BIBA 2WTKB 3I6UA 4E8AA 3QD2B 4IX3A 4KBKA 2WEVA 4QMXA 3VVHA 3U6HA 2XCKA 3VUDA 2CKPA 4IX6A 1A9UA 1KOAA 5FUTA 3N4TA 3LJ0A 5M44A 4EC9A 2R9SA 2FA2A 3R2BA 2WTWA 4BCFA 4S32A 4H39A 3MBLA 3FI2A 3HMPA 1OBDA 2J7TA 4GW8A 2JITA 3EFLA 1ZARA 3C4FA 3OEFX 3Q53A 5DH3A 1DS5A 4C34A 4K8AA 3E62A 4MNEB 1IEPA 3KN6A 3OXTA 4FTNA 4K11A 2Q0BA 3DBFA 3OWLA 4GK3A 3F88A 3UYSA 2XM8A 2UVXA 3VC4A 4RA4A 4BTMA 4FT9A 1GIJA 2OI4X 3K54A 1M14A 4S31A 5K4IA 1W98A 1KOBA 2YISA 4B8LA 2W17A 4XG2A 3UOLA 5I9ZA 4EK4A 2AUHA 3WI6A 5JH6A 4FIEA 4FTQA 2DQ7X 3FMDA 3HV6A 3HV5A 2PPQA 2BIYA 1JLUE 3H9RA 4Z55A 3FMKA 3E64A 3FC1X 4DFLA 4GH2A 4QTBA 3SQQA 2R3IA 2C6MA 2P55A 4Y83A 4DC2A 3OEZA 3F3WA 1FVTA 4TNBA 3Q9XA 4TNDA 4HW7A 3EKKA 3LCOA 2C6IA 3NGAA 4E4NA 2XYNA 3IO7A 2DYLA 4O7YA 4RIWB 3FE3A 3VO3A 4X6QC 5DR2A 3H4JA 5I5ZA 3KRRA 1WAKA 3CR0A 5ANDA 3W2PA 1YI3A 2XKDA 4FK3A 4FIFA 2CGVA 4GU6A 3OTVA 2UZVA 5IQAA 2QKWB 4IJPA 3ORPA 3KC3A 3QD3A 2WQMA 4FNYA 2YDKA 2Z2WA 3HYHA 4CFMA 4RJ4A 3S95A 5IEXA 3LFAA 4TYHA 5LCKA 2JKKA 2REIA 1XBBA 2VWWA 4KNBA 4S30A 3TEIA 3ZBFA 4EBWA 4A9TA 4WG4A 4ANMA 3LFSA 4WNPA 4XP0A 2ONLA 4UMTA 1JSVA 2UV2A 3MFRA 5M4IA 3CE3A 3V8TA 5C26A 3EIDA 4L43A 1E9HA 3F69A 3R71A 5CEMA 4D1XA 5IA4A 5HESA 3RI1A 4HVHA 3P86A 4ZIMA 3VHKA 4IVDA 4XV1A 1P4OA 1FGKA 3EKNA 4E4LA 2G01A 4D9UA 3T9IA 4FTMA 5BYLA 4IW0A 2ITWA 4XOZA 1YOLA 1ZY4A 4RX8A 2WMXA 4FT3A 3RVGA 3CPCA 4BTJA 2PK9A 2IZRA 3I60A 4P4CA 3TTJA 3WOWA 2QCSA 4AS0A 5CX9A 3MIYA 4BBFA 5AP1A 3KFAA 3W32A 3BZ3A 3ORZA 1OVEA 4EBVA 2KULA 5HTIA 4TW9A 1Q8ZA 2CKEA 4AOJA 1UU9A 3CKXA 4FIHA 5CI6A 2XBJA 4USEA 4HGLA 3DB6A 2IJMA 4TRLA 3ZLXA 3PWDA 2JKQA 4QYFA 1KE5A 4CNHA 3HUCA 4PPAA 3EQGA 3GQLA 1R39A 2CSNA 2C5OA 4LL5A 4TYGA 5FM2A 1Y91A 4AX8A 5TOZA 3UNZA 2QO9A 4EWHA 3VJOA 4J8MA 3FLZA 2CCIA 3EZVA 4IWQA 5CT7A 3AGLA 4W9WA 4ZOGA 3RPRA 2XNNA 2A4LA 3R1YA 3D83A 4J99A 3WIKA 2NRYA 2QHMA 3Q6UA 4Z7GA 4R5YA 2QOBA 1OPLA 2H34A 4GYIA 2F49A 4BI0A 5IQGA 5J79A 2VTQA 3IOPA 4ZTSA 3ET7A 3ZZWA 1XHAA 2QO2A 3IW4A 4E5AX 4YPDA 4IAZA 3ZSHA 4IB3A 4Y85A 1XBCA 3RMFA 3P23A 4BN1A 2EUFB 4EH2A 1RW8A 4EOPA 4M15A 5G1XA 2JAMA 5HZNA 4UX9A 5CAVA 5IQCA 2OZAA 2QODA 2UZLA 4IAIA 4RMZA 3R7OA 4CLJA 4F9WA 2IWIA 2ZAZA 3KVWA 3NZ0A 3PIYA 1TQMA 2IZUA 4JG6A 4C62A 5CF4A 2UW5A 3CLYA 3FHIA 1GIHA 3SHEA 2WMTA 2FB8A 5J7BA 1APME 1H8FA 3FL5A 5HIBA 4CFWA 2UVYA 3PRIA 2PVKA 3GC8A 4G6OA 2ZM4A 4GEOA 4C33A 3UO6A 3TT0A 3VBXA 4FG9A 4FV5A 4ERWA 3WILA 1GZKA 3GENA 3LXLA 3Q04A 3FXZA 5J5TA 2CLQA 3P1AA 4IVAA 4DH5A 4ITHA 5K3YA 3FY0A 3COHA 4TN6A 4YZDA 3BE2A 3NUAA 2W9ZB 1V0PA 3C50A 4FKWA 4PMMA 1JKSA 4M8TA 4Q5EA 4X3FC 5AIKA 5D41A 4B0GA 4CV8A 3A7IA 2VX3A 4HJOA 4P5QA 3ORTA 3NVMB 3CIKA 4FNZA 3TKUA 3QF9A 4C37A 1P4FA 3UC4A 3PSDA 3EYHA 3FI4A 2G15A 2YIWA 4FTAA 3GU7A 4AW5A 3EQCA 3GOPA 3NYNA 3W55A 1WBTA 4YNEA 3TV7A 3UDBA 2BRBA 3U54A 5DG5A 2YIYA 2F57A 3QTIA 3RWQA 4YNOA 4L68A 5AP5A 4CRLA 3E8DA 4KD1A 2CHLA 2YLEA 3BHYA 1UU7A 3KK8A 3MYGA 5A54A 5DNRA 3PP1A 3V5TA 4D0WA 4HYHA 1W82A 4KINA 3MH1A 3R2YA 5L2QA 4F6UA 4G1WA 3NW7A 5F95A 2X4ZA 2UZOA 3BYOA 4BICA 4CXAA 4NTTA 5CY3A 4O0RA 4NK9A 3WZKA 4E1ZA 1B39A 4F1OA 4UMRA 2GHMA 2ITZA 3B2WA 3Q52A 2OH4A 5LARA 4ZAUA 5CTPA 4R3CA 5BX0A 4U0IA 3MVHA 1OKYA 4EJNA 1H1WA 2PL0A 3AD6A 3DKOA 4QO9A 1YKRA 2Z02A 3BWFA 1NW1A 1U5QA 4TWPA 5B7VA 5FP6A 2CNVA 3PA4A 1BI7A 3R8UA 5DLSA 5BMSA 2QVSE 2OJFE 3R9DA 3FKLA 2RL5A 3TDWA 4BKZA 4JDHA 3G90X 4QMPA 3PDTA 4FKIA 4FEQA 2QNJA 4XBUA 3DJ6A 4U9AA 1E1XA 2PE2A 1Z5MA 5A4CA 4P90A 2BROA 3VS3A 4TKSA 4KS8A 4F0IA 4KIKB 5EQPA 3HDMA 3KRXA 3DU8A 4OR5A 5KCVA 1WBNA 3I7CA 4IB0A 3NPCA 3V6RA 4QPAA 1ZOGA 3AT3A 2ACXA 2PVLA 2XEZA 2C6KA 4G3DA 3DAEA 5GNKA 4B8MA 2JC6A 3C0GA 3LM0A 4KABA 4FGRA 4ZMFA 1J7UA 3PIZA 3QGWA 1REJA 3G6HA 2IW8A 2VU3A 3GC0A 2GHGA 1PXLA 4CQEA 2OWBA 4GT4A 2BFXA 4MWHA 5A9UA 3W2QA 3UO5A 4TZRA 4C57A 2GS6A 4HVGA 3F82A 5HEZA 5CANA 2VTNA 4F9AA 3E93A 3DOGA 3PPZA 2YM8A 3HEGA 4UEUA 4L45A 4XG3A 2V55A 3OC1A 4M0ZA 2JAVA 4ASXA 5HICA 3TUDA 3QUPA 3OWKA 3L1SA 3RK7A 3O2MA 3SDJA 2VTIA 1Y6BA 3EL7A 4E93A 2X39A 3F3UA 4IC7A 4LRKA 3K5VA 4LG4A 1BI8A 2H96A 4JG7A 4RIYB 4M84A 5ETAA 4CD0A 3MVMA 4GJ2A 4JIAA 4MF0A 5C8MA 4GJ3A 4F65A 3GCUA 1JSTA 3E87A 4FV3A 3ZYAA 4JX3A 5IU2A 2ESMA 3FAAA 1Y57A 3DZOA 4I6HA 3P0MA 5ANIA 5IA5A 4EK6A 5CEPA 5K5XA 3OWPA 2YIXA 2O0UA 3KA0A 1H1QA 2JFMA 1WBVA 4QNAA 2WMSA 4H36A 5E91A 3NIEA 3LFFA 4Y5HA 5KMNA 4CG9A 4IFCA 4JAJA 5F94A 5KKRB 3P7CA 4C8BA 3CJGA 3AMAA 3OTUA 4YJVA 5T6KA 3ALNA 4EUUA 1U5RA 3POOA 3R1QA 3RP9A 1OIYA 3R30A 4AGWA 3BPRA 3NUPA 3MI9A 4K33A 4FTRA 4UALA 4D1ZA 4FKQA 3BBTB 3FXXA 4S34A 5E92A 3FLWA 3TV4A 3ID6C 4O81A 4F08A 4U40A 4MXYA 2GS2A 1PXKA 3D0EA 2Y4PA 4NIFA 3QZFA 2BZIB 3IGOA 2E9PA 4AFEA 1OECA 4J7BA 1U59A 4AN2A 1M52A 3F9NA 3IS5A 4MXXA 5HD4A 3BGZA 3SRVB 5A46A 3BEGA 2BRMA 3A99A 2BRNA 5D7VA 3ZTXA 4UBAA 2FH9A 3ACKA 3NSZA 3FMHA 3OW4A 4RIXB 3H0ZA 5HGIA 2GPHA 2YAKA 2VGPA 4R3PA 3UO4A 4TL0A 3V04A 2WOTA 3AC1A 2O5KA 5HE1A 5CEQA 4GFMA 2HY0A 5DT3A 1XO2B 4RX5A 4DGOA 1YXVA 1T46A 4DGNA 3Q4TA 1Q8UA 5CQUA 2RG6A 4GFOA 4OTIA 4TYHB 4BDHA 5IH5A 4EZ5A 3QQGA 1SVEA 4X3FA 4CMUA 1CMKE 3BYVA 3W1FA 4XYFA 2HOGA 4L7SA 5AIRA 4U7ZA 3IDBA 5M4CA 2QOIA 1XH6A 3O71A 2YDJA 2PVHA 3BYUA 4I94A 3V5WA 4ASZA 3WZUA 3HNGA 5AM6A 2CPKE 2VX0A 3ZO1A 1B6CB 3CQWA 3EQDA 4HZRA 4DGLC 5J1VA 1PJKA 2JBPA 2YIQA 4NUSA 4E6CA 4F9BA 2VNYA 1JKKA 4ID7A 4L44A 4YZ9A 3R00A 3G51A 1I09A 4FZ7A 4H3BA 4ZTQA 5CENA 5HTBA 2R0UA 1IAJA 5D12A 5L6WL 3R8MA 5A6NA 2RFSA 3MDYA 4OTHA 4TPTA 3JR1A 1OUKA 2QURA 2R3LA 3VBYA 2IN6A 4HYUA 4OTWA 3KXZA 3MV5A 2OIQA 3KY2A 4XNEA 5CF5A 2YFXA 2VWYA 3MESA 3P5KA 1XH8A 3ZU7A 3M1SA 1PKGA 5M4UA 1AD5A 3KXNA 3WF7A 2W99B 2OO8X 3LOKA 3IONA 2BALA 2HENA 4H1JA 4I6QA 5EQYA 3SV0A 3R7YA 3LIJA 4E7WA 3V3VA 3MH2A 3KGAA 4RC4A 3UIXA 3KMMA 4B99A 4RBLA 4Y5QA 2BHEA 4RQKA 3D14A 3RAKA 3D2KA 4PNKA 4FEVA 5GIPE 4IXPA 3VNTA 2ETMA 4BDFA 4EOIA 2PMNX 3GC9A 3KXMA 4FT5A 3CQUA 3LXNA 4APPA 1ZXEA 5BMMA 4DTKA 2W05A 4DTBA 4YU2A 4WD5A 4X7QA 2Q0NA 4ALVA 4U6RA 2OBJA 4RLKA 1GZOA 4AQCA 2VUWA 2CLXA 2O63A 2XRWA 1BKXA 1G5SA 4U8ZA 2EXEA 3MSSA 5FTQA 4PF4A 2XK4A 3UYTA 4F6SA 3IECA 2UW4A 3QKKA 4PRJA 3HVCA 4QP2A 1BUHA 3MVLA 5AEPA 1SZMA 4I22A 3IW5A 4MD9E 5BUJA 4J95A 3U51A 3D5VA 3G0EA 1YXUA 4IVCA 4NJDA 2CN5A 3O51A 3BHUA 4U97A 4D2VA 4D5HA 3C4WA 5DN3A 4O83A 4Q9SA 5CAOA 3QTUA 5I4NA 3QX2A 5EOBA 2PTKA 2X81A 3RAIA 4YBKA 3QRUA 5FRIA 2VO0A 5J87A 4GG5A 4AXAA 5GJGA 3PUPA 1H1RA 2GCDA 3VWAA 5BUIA 5DVRA 3ZRKA 4BZNA 1QPCA 4ASDA 4EOSA 5DE2A 3NLBA 4DGGA 3W2RA 5B2MA 4X0MA 5CAUA 3BELA 1STCE 4XX9A 1WFCA 3HX4A 3KULA 1W83A 4JJRA 5HNBA 2QC6A 2XF0A 2XBAA 3FMJA 3MA6A 4NL0A 4CSVA 3V8WA 4AE6A 1T45A 3P4KA 4YJUA 5A3XA 2C5YA 4GVAA 2QR7A 3CTHA 4D2TA 2CJMA 2F7ZE 2QI8A 2V7OA 3HP2A 4CZUA 4OAUC 3WF5A 5J5SA 4A4LA 4CRSA 3W16A 3S1HA 2QKRA 3BU5A 1JPAA 4TYIA 4UYNA 5L6PA 3DZQA 4AZFA 4BDEA 3QHWA 5BVNA 2CGUA 5DRDA 2JKOA 4UZDA 5EHOA 3TZ9A 2EXMA 2GSFA 2BPMA 3FSFA 2GTMA 3G5DA 4M66A 5KNJA 4M69A 3P79A 2Y4IC 2XJ0A 2H6DA 5C1QB 2B53A 2PUPA 3JVSA 2VTPA 4YC6A 3EQBA 4O2PA 3QRIA 4ZJIA 3TXOA 3CY3A 3IDPA 3QCQA 4MAOA 4BI2A 4RJ3A 2QG7A 4L52A 3LCDA 2NNWB 4IB1A 3I5ZA 2JDSA 4BWPA 1CDKA 4NT4A 5AV3A 3UJGA 5BQ0A 4IHPA 2E9VA 5KUPA 3PJ8A 2OKRA 2X7GA 2BDWA 2R3NA 4BHNA 3R83A 4XMOA 2ZDUA 4D1SA 4YJTA 4C4EA 4F7NA 1NA7A 1IAHA 4M7IA 3GNIB 1OL2A 4R7HA 4LMNA 4M97A 4HNIA 3VUKA 4CT1A 2I0HA 1Q8YA 5L4QA 3I7BA 3SOCA 4BCJA 3LZBA 1KUTA 2BR1A 4GT3A 5TKDA 4K2RA 1UKIA 2RKUA 2WZJA 4PNIA 3DA6A 3LVPA 2VTAA 4DFBA 4EUTA 1NVSA 3P08A 2WXVA 3PJ3A 4LUEA 5LCJA 5EYCA 4CKRA 1FINA 3QZHA 3MB7A 4GSBA 4F64A 2E9UA 4A4XA 2HELA 4CFVA 2ZV9A 3O23A 2PZPA 3LJ1A 3AD5A 4FKTA 4FSWA 3UZPA 1E1VA 3Q5IA 3E88A 5EM8A 2BCJA 4HOKA 4V04A 4FTCA 4ZJVA 5JEBA 1GNGA 2R0IA 1GY3A 1RJBA 4IMYA 4GRBA 4LRMA 3A7GA 1QCFA 3PE2A 4AA4A 4EQUA 4DEGA 4ORKA 1SVHA 2BFYA 2WMBA 4PY1A 5A4TA 4MQ1A 3S00A 3BU6A 3DQWA 4ANSA 3EZRA 1HCLA 2QOKA 4DBNA 3MPMA 3C0IA 2WMVA 3CXWA 3TI1A 3HMIA 4WUAA 3M42A 3W10A 5EOLA 3UPZA 4H1MA 2V62A 2GNGA 4FMQA 2HZ0A 3MH3A 5EHYA 4BFMA 2WB8A 5L3AA 1LR4A 4FIGA 2C6LA 4BWKA 4C3FA 4EOKA 4WIHA 5IF1A 1WCCA 2PYWA 4F99A 4H05A 4ZS0A 2Z60A 3D4QA 3R28A 4Z9LA 2AYPA 2R7IA 2OJJA 3QGYA 5L8LA 1H08A 3BCEA 3QCSA 2W1CA 4L3LA 1OL7A 4FEUA 4FVPA 4E26A 2QQ7A 3PXQA 4RC2A 4EZ7A 3FQHA 4RFMA 4CFNA 3DTCA 5M57A 4YTFA 2PSQA 2IO6A 4DLIA 1ERKA 5C8KA 3MJ2A 2YM7A 4DINA 4D0XA 1PW2A 3WE8A 3BI6A 4YTHA 4QQ5A 3OG7A 4FV2A 2AC5A 1PXNA 4XG4A 3KEXA 3LW0A 3GC7A 3ULIA 4IACA 2BKKA 2BAJA 4YR8A 4HPUE 4QMWA 3OHTA 3HRFA 4MXOA 2Y9QA 5AR5A 3EQRA 4D4YA 2I0EA 4IIRA 3II5A 4CYJA 3QTZA 1YWVA 2RFDA 4RIOA 4JDJA 4R3RA 5EH0A 5M09A 3RKBA 4LM5A 5BVOA 4RJ7A 3F7ZA 3ORNA 4IX4A 4KIOA 3FXWA 5BNJA 3E63A 4EH8A 2X0GA 4XH6A 3WYXA 4IEBA 5BVFA 1LP4A 3CBLA 3E92A 3DBDA 4CFXA 1VR2A 4OBQA 3GU6A 4GUBA 1BMKA 3HMNA 3IG7A 3OMVA 1H07A 2E9OA 4IAFA 4FL1A 2LGCA 4FIIA 4V01A 4AZSA 2NP8A 1FVVA 4ANNA 4P5ZA 3QU0A 1Z9XA 2O3PA 4N6YA 5AR4A 4ALUA 4RRVA 4LV5A 3QWKA 1ZZLA 2GNIA 3PLAE 2C3JA 4FI1A 4QMZA 2OF4A 4I0SA 3WF9A 4ANQA 3N4VA 2ZMCA 3U6JA 1YI6A 4WUNA 2C6EA 4EEVA 2E2BA 4BY9E 2IPXA 4PDSA 5JQ8A 4FSMA 4UWBA 3DXQA 3C7QA 4NYEA 3FLYA 3BU3A 2PY3A 4XBRA 5TR6A 2IW9A 2F7EE 4HGEA 3R73A 3R7IA 3VQHA 3PZEA 3L8SA 2GNFA 3A2CA 2HXLA 1XH5A 3I1AA 3VQUA 3A7JA 2I0VA 4NCTA 5GJFA 2X9FA 5M53A 3QLGA 4DFXE 1OUYA 1BL6A 1MP8A 4RVLA 3WIGA 1Y6AA 1IA9A 3LLTA 2HIWA 4WG5A 4FV8A 5E90A 4BR3A 3RK9A 4W9XA 2V7AA 1AGWA 1PF8A 4JIKA 4N6ZA 4QYHA 2OFVA 3P7BA 4RZWA 5HVKA 4FSUA 1P14A 4ZXTA 5HX8A 2GQSA 3JS2A 4FOBA 2BMCA 2YCRA 2W1IA 3C13A 3H3CA 4I0TA 4FODA 5CNNA 4BCKA 5AFVA 3Q32A 2WD1A 5D11A 4WNMA 3BBWA 3A4PA 4IZAA 5JN2A 4FV6A 3OCGA 2R3HA 5CAPA 5FP5A 4B9DA 2IG7A 3QKMA 3FYJX 4MXCA 2B9HA 5CNOA 4O27B 3PXFA 1XQZA 4EYMA 4PP9A 5GHVA 4C35A 2W5HA 4DEDA 1NT2A 5E1EA 2PVFA 3D5UA 5A4QA 2W1FA 4HPTE 2AC3A 4W4VA 3EYGA 5FBOA 4X6RA 4XV9A 4ENXA 4O7RA 5EQEA 2F9GA 1UV5A 3EN7A 3LFCA 3MGYA 4AACA 2X7FA 2XK8A 3GFEA 3K2LA 3R21A 4FNWA 4PDOA 3R9RA 3RGFA 2A27A 4MD8E 3RAHA 3ZBXA 3MTLA 4CEGA 3DPKA 4AW2A 4HVIA 5LQFA 4YSMA 4TT7A 2C0OA 4J8NA 5E8VA 4G9CA 4EH9A 4DFZE 2XK9A 2G2IA 4K9YA 3TM0A 4PMPA 1DI8A 5ANEA 3BHTA 4JVGA 2RG5A 4ZEGA 3L8PA 4M3QA 4BRXA 5FEQA 4OTRA 5KHXA 4OTGA 3PVUA 1YWNA 3TNIA 2JIIA 4ALWA 4F0GA 4E6AA 4FZFB 4EK3A 5HLNA 4XCUA 3RPYA 3MPTA 5KO1A 2ITQA 4XG8A 2XM9A 4JAIA 1JWHA 4IH8A 4FK6A 5AR8A 4M12A 3FMEA 5FDPA 1IA8A 5AJQA 3COMA 5BPYA 5B2LA 4FX3A 4HGSA 5EI2A 2PMLX 3V5JA 3QYWA 2W4JA 1QPJA 4RWLA 4C59A 3WZDA 4FTUA 4L00A 4UWCA 3RPSA 2VTSA 2EWAA 4LOOA 4C61A 5CAQA 3MY1A 4OT5A 2XJ2A 4HNFA 2BRHA 4BCMA 5EK7A 3KCFA 4H58A 2J0JA 4QMYA 5DRBA 2VTRA 3AC5A 3QKLA 3NUSA 4N4SA 3SD0A 3OT8A 4WOVA 3U4WA 3UP7A 4PL3A 5EYKA 3CC6A 3F3TA 2ITTA 3R7GA 4JT3A 4UMQA 3T8OA 4C3RA 3KVXA 2Y0AA 2W96B 5AP7A 3GU4A 5DPVA 3UVPA 4FNXA 5KMJA 5EYMA 4WNKA 4KB8A 3U8WA 4YTCA 5BUEA 4EQMA 1H25A 2HK5A 1K3AA 4BL1A 5HCZA 5IA3A 3S0OA 5DYJA 5M4FA 4MQ2A 1YDSE 4YUQA 3R7VA 3Q9YA 1R0EA 3CD8A 3ZS5A 4ZMEA 3VS6A 4M69B 3EN6A 2XK3A 1OKZA 4KS7A 3FZOA 4JDKA 2YCFA 3E8NA 3ZO2A 4BI1A 1CTPE 3DJ5A 3W18A 2GFSA 4C36A 3L9MA 3S3IA 1UWJA 4JNWA 3LCTA 2W1HA 2XS0A 4XOYA 4BDGA 5LXMA 4FZDB 4O7SA 4ZY5A 1ZYDA 5CWZA 4HVDA 4OLIA 2J0MB 3ZM9A 5IQIA 4IDVA 5JRSA 5DMZA 5GZ9A 1ZYLA 1PXPA 3PY1A 5CU4A 2G1TA 1W84A 4O0TA 1O6KA 5KE0A 3JPVA 2BILB 1YDTE 4LYNA 2XCHA 3C4CA 2GU8A 3TKIA 3K3IA 4R6VA 3RHKA 1PYXA 5GINE 3O96A 2HCKA 4JX7A 4Y72A 2HAKA 4EL9A 3A8WA 4ZJJA 5C01A 3RPVA 3SAYA 4D2SA 4PL5A 4XRLA 5AWMA 3LQ5A 3I81A 1ZYJA 2H9VA 1CKJA 4RQVA 5DR6A 5ETFA 1PXMA 3AG9A 1YHSA 2VO6A 4B7TA 5EW8A 4CT2A 4XRJA 2YM4A 3TIYA 4AOIA 4ZK5A 2Y6MA 4NM3A 4CVAA 1YWRA 4KIQA 3LFDA 2WOUA 4PMSA 4D4VA 5IDNA 4M13A 2Q83A 4V0GA 4IZ5A 5FBNC 3PFQA 1M2RA 2J9MA 5HBJA 3IW6A 4PV0A 5JFSA 5DI1A 1U4DA 4BGQA 4FG7A 4L53A 3TKHA 5A4LA 3KMWA 1W8CA 3BGPA 3T9TA 3HRBA 5HQ0A 2XKCA 3GBZA 1RE8A 4IQ6A 4O96A 4XV3A 4DLJA 5L2SA 4O0UA 2BRGA 2BVAA 2X4FA 4IANA 1SM2A 5FLFA 4D2PA 3DFAA 4R7BA 3F6XA 2GQGA 4AOTA 4QTEA 5CSPA 4JRNA 4Z3VA 2FSLX 4RFZA 4YO6A 2VTJA 5BYYA 5I9VA 5KMKA 2YN8A 4EZ3A 1UNLA 4DHFA 4KRDA 1YXSA 4X2GA 2RSVA 4F4PA 4AF3A 2EB2A 1TQIA 4QMVA 3F2RA 3QWJA 1IR3A 3SG8A 3WZJA 4FSRA 3AGMA 3F2AA 3SA0A 2ZM1A 3QTRA 4QMTA 4PPCA 3P78A 1F3MC 3PRFA 4FTOA 2VZ6A 4MTAA 4CZTA 4G5JA 4A7CA 5I9XA 3LHJA 2JFLA 5ANGA 2WIPA 1WVXA 2W7XA 3PJ2A 2X2KA 5CSWA 1V0BA 4CG8A 4CQGA 4R8QA 3SXRA 3PG1A 4WG3A 4LQMA 4A9RA 5CLPA 4QMUA 3PY3A 2Z7RA 1GIIA 5C9CA 4W4XA 3D7ZA 5BYZA 2FO0A 5IMXA 4PWNA 4S2ZA 4N0SA 2X8EA 5I0BA
chains in the Genus database with same CATH superfamily
1UWHA 4JG8A 3RJCA 5KBRA 2QOFA 3PSCA 4J53A 5HORA 1UU3A 3PYYA 5C8NA 2FYSA 4FKRA 5E8WA 4ACGA 4Q2AA 4JQ7A 5HU3A 3ZXZA 3FKOA 3CKWA 3CTJA 3DFCB 4AU8A 3KK9A 1DI9A 4KA3A 2NPQA 2VTTA 3CJFA 3DDQA 3GUBA 3WF6A 3ZCLA 4BYIA 3L8VA 3QZGA 4O6EA 5JZNA 3DS6A 3QCXA 4I0RA 1URWA 3FSKA 3TYKA 3W2CA 1G3NA 2R4BA 5HLPA 2GTNA 5CALA 5HNGA 1TFFA 4Y95A 5AP6A 2VAGA 3L9LA 3DKGA 3AMBA 4I24A 5K4JA 3ZUTA 3HAVA 2PVNA 2Z7SA 3DBEA 5AMNA 1LEZA 4MBJA 3MB6A 2QOLA 3DK3A 4GL9A 4M68A 4GIIA 3DXNA 3O5AA 3H10A 3ORIA 3PVGA 4FIJA 4ZTNA 3EB0A 1PRYA 5CEKA 5AM7A 5IUHA 4IWPA 4DAWA 3HUBA 1SVGA 2XNBA 4FVQA 2XNPA 4QPSA 3HV4A 2GNHA 1NY3A 5H3QA 4Y46A 4EK5A 3FLSA 4L7FA 2XARA 2P2HA 2VRXA 5DA3A 3FZRA 5AX9A 5B2KA 2UZDA 3UNJA 2YCQA 3ZC6A 1ZOEA 1V1KA 4LMUA 4DFYA 3WARA 4YHTA 4G2FA 5CF6A 4O84A 4ZZOA 1OIRA 4AZEA 3L9NA 2UZWE 4FUYA 4FKPA 4UY9A 4JI9A 4FICA 2LAVA 3AC4A 2NO3A 4D2WA 5JGAA 4ZLYA 5IDPA 5LWNA 4L67A 5IA1A 3Q2JA 3EN9A 4CCUA 4NJ3A 4FUXA 3SKCA 5AR7A 4JRVA 2BTRA 1JNKA 2GMXA 3C5UA 3Q2MA 3JVRA 3OXIA 4YZNA 3V01A 3C0HA 3V8SA 4GMYA 3NDMA 5KMOA 5LVNA 1Z57A 1G8AA 4E6QA 3BLQA 4IZYA 3LFNA 2X2MA 4IVBA 4ASEA 4YTIA 3UZRA 5E8SA 1BLXA 2OJGA 3HA8A 4I21A 2HZNA 4PL4A 3PLSA 4UXLA 4ZZMA 4C2VA 5F4NA 2XKEA 3RAWA 3VAPA 1H28A 4EHVA 4BCGA 4IFGA 4K0YA 4U81A 5AP4A 4LGGA 3ZDIA 4E73A 1R0PA 2XIRA 4EH3A 4OAVB 3CP9A 3LCKA 2HYYA 4A9SA 2PUNA 2VWVA 5BVWA 4YURA 4ANOA 4EC8A 5M08A 5HX6A 4YBJA 4F1MA 4J52A 1AQ1A 4K1BA 3VRZA 3EQPA 3FJQE 4O7VA 3QUEA 4BIDA 1WBSA 1R3CA 2PHKA 3QUDA 4CFUA 2X1NA 5CI7A 1KWPA 4AA0A 3THBA 1OB3A 5JKGA 4FSQA 4DT8A 1PXJA 5IH6A 1TQPA 4FKUA 4HGTA 3ZFYA 4FKSA 2YWVA 1XKKA 5GJDA 2W4OA 3ZLSA 5JFWA 4MHAA 2GDOA 2VTMA 1CKPA 3GI3A 2A19B 3QL8A 4O2ZA 3CGFA 1JAMA 1VJYA 3IW8A 5IMEA 4G6NA 5I3OA 1OL6A 4MXZA 3R8PA 3BLHA 2IEWA 4I6FA 3QBNA 4JOAA 3LFQA 3SGCA 4YJNA 1R1WA 3KF7A 3NNVA 3OXZA 4RFYA 5DEWA 4C3PA 2ERKA 5HCXA 5F1ZA 2J5FA 2ZMDA 4JBOA 2B7AA 4I1ZA 3JY0A 4BC6A 3ROCA 3TG1A 3E5AA 1JSUA 3LM5A 3R0TA 4AWIA 4BDCA 1TKIA 4KSPA 3OWJA 4P7EA 4F78A 4B6LA 4L6QA 5CZHA 3HKOA 4QMQA 1JKTA 1H4LA 4DG3E 5L2WA 4EHEA 3VJNA 5FTOA 1OL5A 3VULA 2UUEA 4X21A 2CNUA 5IQBA 4ACCA 4ZLZA 4FEWA 3DBCA 1KE8A 3NWWA 4L42A 3GU8A 2XALA 4RT7A 4IAYA 5EI6A 3MVJA 2XIYA 5HBEA 2B9JA 4D55A 2YM6A 3E7OA 4BDJA 3NVKI 2QLUA 4MF1A 5CVGA 2OLCA 4BTKA 4M0YA 4EI4A 2IVUA 3BYMA 3U9CA 1X8BA 2PZYA 3PA5A 1WMKA 4OW8A 3V5PA 2O2UA 4IBMA 1Y8GA 3RCJA 3Q4CA 2XANA 4AXFA 3H9FA 5HE2A 4RIWA 1Q4LA 3PPKA 4J1RA 4YJRA 4MUQA 4JBVA 4UYAA 2QLQA 4E3CA 2FGIA 3F3VA 4FKOA 2HY81 2V22A 3KKVA 4F9YA 4BKJA 3MPAA 3O7LB 4NFNA 2OZAB 3IOKA 4UMPA 1MRUA 5G6VA 3PSBA 3ZC5A 4AW0A 4WO5A 2WTCA 4G3EA 1S9JA 3UPXA 4DFNA 1ZOHA 5CSHA 4C4JA 3F2NA 4O0VA 4CTCA 1NVRA 2CKOA 3ZM4A 3S4QA 4TWOA 4BCQA 1J7IA 5EDPA 4HYIA 1KV2A 4QD6A 3VUHA 4DG0E 3ALOA 4O1OA 5AR3A 3A61A 1M17A 1BL7A 2JGZA 3O8TA 5AV2A 3ATSA 2VWIA 2ZV7A 2WU7A 4O0WA 4AE9A 4BCPA 5ANJA 4KSQA 2E9NA 2WQOA 3DV3A 1WVWA 4F70A 4MKCA 4NCTC 3SG9A 3QZIA 4RPVA 3VW8A 1UNHA 3WZEA 3ORMA 3BHVA 4LOQA 4EOMA 4FSTA 2PU8A 3OCBA 4MBIA 3CEKA 3NNXA 4EKKA 2YDIA 4YC8A 4F1TA 4UV0A 4QP1A 3TZ8A 1SNUA 2QOQA 3BL9A 5EW9A 3BGQA 2RGPA 1RDQE 2J90A 4NH1A 2UZTA 1U46A 3JXWA 2BKZA 3QQHA 3VF8A 2QHNA 3P7AA 2R2PA 4ENYA 4F9CA 3GFWA 4BVUA 1W0XC 3PTGA 2OJ9A 2XNOA 2WU6A 3G9NA 5FQDC 1Q97A 3R8ZA 4EORA 2YA9A 4R5SA 3E3BX 4BZDA 3R63A 5JSMA 3SXFA 1OITA 1OIUA 4RA5A 3W0MA 2C5NA 2JBOA 2JKMA 5HO8A 1JQHA 4YZCA 1FPUA 4CFFA 2WTVA 3UIBA 3VBWA 4NU1A 3ULZA 2QG5A 4F0FA 3AT2A 4XJ0A 3DT1A 4MXAA 3KB7A 1CM8A 4YJPA 4P2KA 5KKRC 3KRWA 5AUZA 2YIRA 3NUUA 5FGKA 4ZSJA 3FI8A 3BHHA 4Q5HA 3NRMA 4QTAA 3UG1A 4OUCA 5A14A 4QTDA 4G3CA 3QRKA 3KL8A 4E6DA 1TVOA 4FT7A 5CSXA 4F7LA 2ETRA 4FV7A 1OZ1A 3HRCA 5FXQA 4EHZA 2IVTA 4XV2A 4GYGA 5HO6A 4XLIA 5CXZA 5F20A 3M11A 1B38A 1S9IA 2VO3A 4AAAA 3PPJA 5AA9A 4GKHA 2JD5A 2C4GA 4RWJA 4HZSA 2J4ZA 5DIAA 5HG5A 5AADA 2OIDA 5ITAA 5E9EA 1YOJA 3DBQA 5CVHA 4C4IA 4FSZA 4TXCA 1BX6A 4GV1A 4L9IA 3TUCA 5HKMA 4WA9A 2VTLA 2QU5A 4ACDA 4ZZNA 4I5HA 4BBMA 2UW9A 4DGMA 4GU9A 5FDXA 4RLLA 4RZVA 2QO7A 3Q5ZA 4OTFA 3ZFMA 5EI8A 5C27A 4ERKA 5JT2A 1K2PA 3TCPA 1XH9A 1PMEA 4IM2A 1H27A 4QOXA 4USDA 3VIDA 4BBEA 4J98A 4IDTA 2OK1A 4Q9ZA 3FEGA 3HMMA 2XK6A 3BIZA 3KQ7A 2OZOA 4FYNA 4CKJA 2XJ1A 3VS4A 1Q3DA 1OL1A 5FWKK 3V6SA 5HG9A 3NIZA 1O6YA 3OD6X 3S2PA 4DH7A 2ZFYA 4D9TA 4AA5A 3DNDA 2OXDA 3SX9A 5DHJA 4AZWA 3ZO4A 3R02A 4RWIA 5DWRA 1MUOA 1FQ1B 4AP7A 2C6DA 4V05A 4BGHA 4O22A 1KV1A 3MJ1A 5HI2A 2J0LA 2J6MA 4HCUA 2ETKA 3DXPA 3PJCA 4AG8A 5C03A 2OIBA 5H2UA 4AGCA 3DAKA 5AAEA 3RM7A 4EHGA 2VN9A 4WRSA 2P0CA 4CTBA 3R7UA 3DAJA 3EWHA 4O0XA 3QTXA 4U79A 4R78A 4JBPA 3G6GA 1XBAA 4BCIA 2R3FA 4FSNA 3LFBA 2P4IA 5B0XA 5I3RA 1ST4A 5IA2A 2R3JA 3AC3A 3R6XA 4FTLA 4Y73A 3RCDA 3Q3BA 2J0KA 2XUUA 3W8LA 4AT3A 4FJVA 4EQCA 2VO7A 1U54A 2DS1A 3NCZA 4FZ6A 4UWYA 2B52A 4B4LA 3KCKA 3RNIA 2C1BA 4MNFA 4USFA 2I1MA 4HCVA 3ZXTA 4DA5A 4U3ZA 4FTIA 4NW5A 4G3FA 2PZIA 2XH5A 3OCTA 5CU3A 2BTSA 4KUJA 3DLSA 2HWOA 4UB7A 3QCYA 2BZKB 1OPKA 5KHWA 4FZAB 4C7TA 4F7JA 3NUYA 4KRCA 4NIFB 3FZSA 4ACHA 4UMUA 4O91A 5DFPA 3N9XA 5CT0A 2R5TA 5BVDA 2BHHA 2O64A 3QYZA 3VBVA 3QA0A 4KAOA 4G17A 1Q3WA 3C9WA 2J5EA 4S33A 5J8IA 3VUIA 1QMZA 3ZUVA 5HD7A 3NEWA 3M2WA 5M51A 4JQ8A 5EW3A 5IQHA 3FLQA 3V51A 2ZV2A 5FG8A 3TNQB 4ITJA 2PVJA 3QC4A 3UZTA 3VF9A 3SVVA 2UW3A 5E8XA 4ZTMA 5AV1A 4BYJA 3QRTA 5DT0A 3D5WA 4ZY6A 3DJ7A 3GOKA 1R78A 3VS1A 4ZS4A 2W4KA 3F61A 3FL4A 3G0FA 3QQKA 4DH3A 3D2IA 4KIPA 5J1WA 3QD0A 4I41A 2R3MA 4C4HA 3TTIA 4LV8A 3RZBA 2IZSA 3UMWA 4DCAA 1GZNA 4WHZA 4FC0A 1REKA 4F7SA 4LGHA 4X3FB 3AQVA 2ZB1A 5IEVA 5HTCA 4O6LA 4ACMA 3FBVA 2X6EA 4IAKA 2BZJA 5DR9A 2PE0A 3PVBA 1ZRZA 2YITA 4FKGA 5E7RA 3UGCA 4AZVA 1ZYSA 5LMBA 4O7NA 5F9EA 1V0OA 3UC3A 2QD9A 4O38A 1CKIA 4OBOA 5E1SA 5IG1A 3QA8A 3R9OA 4O4EA 4FYOA 1PKDA 1RQQA 4RIYA 3FV8A 3VBTA 3ZLYA 4EWQA 5KMMA 3HGKA 3EN5A 5IUGA 2JLDA 3QAME 2PMIA 1J1BA 4TWNA 2PVRA 3VW6A 3DB8A 3EL8A 4O4BB 2GFCA 2W06A 3ENHA 3O8PA 3ANQA 3T3UA 1CSNA 3MN3A 5HG8A 5A4EA 4RX9A 4FR4A 2YHVA 2B9IA 3F7WA 3O17A 3IGGA 4FGBA 2W1ZA 3FI3A 4FSYA 4KKHA 5JK3A 1YI4A 2C3IB 1IRKA 4G5PA 5D1JA 4BHZA 2PZRA 3NNUA 3D7TA 4Z7HA 2QR8A 5EYDA 5I9WA 3CD3A 4YJSA 2GHLA 2VTHA 4GS6A 4EOQA 3TJDA 3MFSA 1VYWA 3BKBA 4NEUA 2PE1A 3UODA 3WBLA 2YACA 2WTIA 5CYIA 5LVLA 1NVQA 4G6LA 4RJ6A 4GT5A 2WQNA 4DBXA 4I6BA 1Q61A 4I23A 4U43A 3EH9A 2J2IB 2WIHA 3H9OA 4MYGA 5DGZA 4AN3A 4W8DA 4EOOA 4I93A 5AUUA 5JQ5A 4G16A 1FOTA 2J51A 3L8XA 4GIHA 4OGRA 4ZTRA 5LOHA 4QDVA 3VBQA 5KBQA 3DK6A 2R3RA 2UZNA 5HOAA 5LMKA 3K5UA 3V5LA 3G33A 5CZIA 3AC2A 3MTFA 3SRVA 4MCVA 5L6OA 2PULA 2XNEA 4FBXA 2WTDA 3TZMA 3NW5A 2R3OA 4J96A 1YHWA 4CMTA 3FPMA 3PXYA 3FZPA 4RIXA 3UOHA 3ZRLA 4I5CA 3DDPA 5KMIA 2WQBA 4JQEA 4QYEA 5T3QA 3VUTA 1Y8YA 1ND4A 3O7LD 4CGAA 5HBHA 1FMOE 3UOJA 2G2FA 4AUAA 4DEHA 3A60A 5EDQA 1IG1A 3RNYA 5IEYA 3ZO3A 4IM3A 3ORLA 4IAAA 4DDGA 1LPUA 1PMVA 1I44A 2IW6A 3NUNA 4QYGA 4XS2A 3BX5A 3HA6A 5T68A 1OPJA 4C02A 3U6IA 2V5QA 1XR1A 4E5BA 3KXXA 1QPEA 1YHVA 3N4UA 3OF0A 5AAGA 2A0CX 2R64A 3BLRA 2RF9A 4FTKA 4FV1A 2FUMA 1VYZA 1YQJA 2C47A 4GFGA 4EH4A 3QQFA 3OBJA 4KKGA 4O4CA 2YWPA 3KULB 3ANRA 3AMYA 4OTQA 1ZWSA 2FSMX 1F5QA 1A06A 1Q8TA 3NS9A 2ZYBA 4J97A 4PTEA 3EN4A 3ZEWA 4AGDA 2GNLA 3OOGA 3PE1A 3QALE 5AV0A 4NWMA 3KXHA 3UP2A 4FE2A 4FTTA 4NZWB 3BQCA 5JFXA 4A4OA 5LVPA 2CKQA 4GKIA 4OTPA 4LV7A 2HW7A 2OFUA 3LAUA 1VEBA 4A07A 5FTGA 4QQTA 3R7EA 4ZSEA 2UW7A 3E8CA 1ZMUA 3QTQA 4OBPA 3SXSA 4CLIA 5HNIX 3TNHA 1NXKA 3FHRA 4ZLOA 5HLWA 3CPBA 3VUGA 5D10A 5J9YA 3H0YA 3HP5A 4R1YA 2PZ5A 3V5QA 4WRGA 3EQHA 2YJRA 4YLJA 5ANKA 2I0YA 4MBLA 3QLFA 4IWDA 4QNYA 5LWMA 3HZTA 2J50A 3RWPA 1Q62A 5LVMA 4C4FA 1YDRE 3LE6A 2EXCX 2WMUA 3A7HA 4ZSGA 3TN8A 2GQRA 1H01A 5E4HA 3PWYA 5J7HA 4HVSA 4O7WA 4A06A 3LMIA 5IPJA 4LL0A 2YEXA 2UZBA 3ELJA 3QRJA 2C0IA 5JGDA 1GOLA 2F2CB 5KZIA 3F66A 3IW7A 4X2KA 5CEIA 3ZLWA 5C4KA 3HV7A 2J0IA 1FBNA 3OVVA 1FVRA 3EOCA 4YLKA 1FMKA 3RHXA 3BLAA 2OXXA 3OY1A 5D9HA 3TACA 3FC2A 3ETAA 2XNGA 3D9VA 3PP0A 4KKEA 2R7BA 3BE9A 3Q9WA 3PIXA 5CEOA 3PFYA 3FYKX 2ERZE 3GB2A 4G9RA 4QYYA 2Z7LA 4YP8A 2UZUE 1ZYCA 4IADA 3GU5A 3TWJA 1OIQA 2W1DA 5M56A 4IX5A 4JDIA 3OFMA 4AZTA 4CV9A 2WTKC 4MK0A 3EFJA 2ZVAA 4RX7A 4U80A 3U9NA 4NTSA 4O86A 4BWXA 4DITA 4IB5A 4X3JA 3UDTA 3NMUF 3DY7A 1WBPA 4DEBA 4U41A 3RPOA 3U87A 3ZONA 1FGIA 3G9LX 3DK7A 4LRJA 2IVSA 1KE9A 4J71A 4D4RA 5KZ0A 3MS9A 1MRVA 3UBDA 5AP3A 4FV4A 5L2TA 1O6LA 3O0GA 4L46A 4MH7A 3DTWA 4UN0C 3AKJA 5C4LA 2PVYA 2ITPA 2X7OA 3QQLA 3R04A 1DM2A 4F09A 5KMLA 1ZAOA 3LMHA 2C6OA 4YJQA 3FKNA 4KBCA 3U55A 3DCVA 5JRQA 2ITYA 4L8MA 3HECA 4R77A 1M7NA 3ERKA 4IWOA 4N70A 4QTCA 4A9YA 5CASA 4FT0A 2W5BA 2Z7QA 4DE4A 3I5NA 4BKYA 3W2SA 3LMGA 4II5A 4LFIA 3WE4A 2P33A 4O1PA 4M14A 4PPBA 3SW7A 4DHZA 2UW6A 4YLLA 2WEIA 3L9PA 4FKVA 4BDBA 2OJIA 2XMYA 2WELA 5EDRA 2FSOX 1JVPP 1WZYA 3GQIA 3QQJA 4YJOA 4GK4A 4RG0A 2XAMA 3W0QA 4HYSA 4QMOA 4O7LA 3EFKA 2O65A 4JR3A 3HLLA 3MH0A 4FVRA 5CSVA 2R3GA 2BUJA 5LMAA 1GAGA 4QP7A 5ETIA 3PZHA 3MFTA 5CVFA 4GCJA 3HAMA 4Y8DA 3KU2A 2WHBA 4BB4A 4QQJA 2NYAA 2YLFA 4E5WA 4XG7A 1U54B 1UA2A 3Q4ZA 4DEEA 3CS9A 3E8EA 2KTYA 2WMAA 3R22A 1JBPE 3FY2A 1Q99A 3LXKA 2F2UA 3ODZX 3Q6WA 4JS8A 4RJ5A 4XP2A 4YC3A 5AV4A 4TWCA 5JGBA 3NX8A 1PMUA 2B55A 3GT8A 5D7AA 1BYGA 3C5IA 1YVJA 2ZM3A 2HZIA 2UW0A 2WNTA 3CY2A 4H3QA 3U4UA 5ACBC 3VN9A 3ZOSA 4BCHA 4PUZA 4XP3A 2JIUA 2B9FA 3LCSA 1H00A 5FEDA 4G34A 3KN5A 5HU9A 3IQ7A 4YHFA 3QXOA 3ORKA 2YCSA 3BV2A 2GS7A 5HG7A 3WF8A 4DHJA 3QTWA 2QOOA 2C68A 2ZJWA 3D5XA 3TUBA 4UXQA 2A1AB 4DF3A 4FV0A 2VD5A 4FTJA 2CCHA 2EVAA 4PX6A 4YZBA 3EJ1A 2NRUA 4MEDA 2VGOA 3VHEA 1LUFA 1KSWA 4M67A 4BZOA 2WPAA 4O21A 4U42A 5E8YA 2HWPA 4IJ9A 3NCGA 5FEEA 5H8BA 5CS6A 3OW3A 3ATTA 4O82A 3CQEA 4K6ZA 4U3YA 4QP4A 4BDAA 2ITXA 2YAAA 2Z8CA 4RVMA 3EHAA 1H26A 4TY1A 5E8TA 2R3PA 2EB3A 3B8RA 4IZ7A 3IDCA 5E8UA 2WMWA 3POZA 4R7IA 1XH4A 3QX4A 2DWBA 4WSYA 3A62A 2JDTA 2BDJA 2C69A 4YMJA 2X8DA 5L8KA 1JOWB 4D4SA 2PUUA 2Y4IB 3UVQA 5E8ZA 2XYUA 4DEIA 3AD4A 3ROYA 4MD7E 2VTOA 4DT9A 4AT5A 1H0WA 2W0JA 2XB7A 1H1PA 3MIAA 2CMWA 4XUFA 1PY5A 3PY0A 4DFUA 4DYMA 5TF9A 4GUEA 3CSVA 4FRFA 3ZSGA 4U44A 5DBXA 3FUPA 3OROA 5FM3A 3C4EA 1YOMA 4BDKA 3D7TB 2RIOA 3Q9ZA 4JR7A 4RVTA 5KX8A 4I5PA 1UU8A 4L3PA 2VWXA 4O7ZA 2BDFA 4FKLA 3W2OA 3MFUA 4BDIA 4NKSA 5CQWA 5ETCA 5AUVA 2OU7A 3OY3A 4EKLA 3RTPA 2YABA 1G8KA 3ZDUA 3F5UA 3GVUA 2CNQA 2Y6OA 3DGKA 3MY5A 2I6LA 3KRJA 5JZJA 4LUDA 1L8TA 3DKFA 2ZOQA 4FEXA 4NKAA 3FPQA 2ZDTA 3WYYA 5K5NA 3TJCA 3I6WA 5I9YA 3PXZA 3OBGA 3UOKA 2OSCA 3C4ZA 2EU9A 3FWQA 3JYAA 4U5JA 3REPA 2C30A 4AGUA 3AOXA 2ITNA 4CMOA 5BV3A 3FZ1A 3ZSIA 3I0OA 1M2PA 2C5XA 2IF8A 3D15A 3QFVA 4NFMA 4RGJA 4DH8A 4ARKA 3HDNA 5IQFA 2OXYA 2BAKA 3B8QA 3UIMA 3GCSA 3PVWA 5HE3A 3AXWA 3BEAA 3VRYA 4I4FA 5AUYA 3EMGA 3F5XA 3P9JA 4JXFA 4RVKA 2OH0E 4APCA 2A2AA 3IK3A 3RBWA 4ANBA 5K0KA 1XH7A 1H0VA 4PDPA 3G15A 5CU2A 5EFQA 4MNEA 3LPBA 4AN9A 5IA0A 5GIOE 1MRYA 2F7XE 2WFYA 3D94A 4L01A 4CYIA 4C58A 5IZFA 2C1AA 2W5AA 3TNWA 4KBAA 2X9EA 3TIZA 3PUFC 5IQEA 2XNMA 4C4GA 4XG9A 3DLZA 3GGFA 3BWJA 4O0YA 4DG2E 1O9UA 1SYKA 5H9BA 4U45A 3COIA 4PTGA 3FMNA 3OT3A 3E3PA 4H3PA 5EM6A 2CGWA 3F5PA 4I4EA 5EKOA 5JMSA 4D5KA 1WBWA 3I0QA 1ZMWA 3NW6A 4D58A 1UNGA 4QQCA 2PUIA 3B2TA 3VS5A 3R9NA 2XIKA 3QTSA 3ODYX 4PMTA 2W1GA 3UVRA 4X2FA 1J7LA 2WKMA 2I40A 2R3KA 1XJDA 1J3HA 2OF2A 3O50A 4YHJA 2PMOX 2ZB0A 4MX9A 4YZMA 2JDOA 2XA4A 3ORXA 3RZFA 2PWLA 3FLNC 4I92A 4LOPA 3ITZA 5BVKA 5ANOA 3E7VA 3LFEA 4FG8A 4G31A 5L8JA 5FXRA 2VWUA 2XVDA 3O8UA 3SW4A 4CZYB 2WMRA 5H8GA 3PA3A 4EONA 4YSJA 4Z16A 1OBGA 2VV9A 2XP2A 2XRUA 3DQXA 3I4BA 4ONAA 1H1SA 2C3KA 2CN8A 4RJ8A 4XLVA 3HMOA 5ICPA 3GP0A 4FL2A 3OP5A 4BF2A 2P2IA 3K3JA 5CF8A 1OI9A 2QOHA 5EM5A 4OTDA 5FXSA 4W8EA 3ZEPA 4K77A 4IC8A 2YZAA 1URCA 2PVMA 1F0QA 2YM3A 3UNKA 2VX1A 4CCBA 3KRLA 3LJ2A 5CXHA 3RM6A 2JIVA 2RFEA 3ZUUA 3W0RA 4NSTA 4YO4A 3C51A 4QMMA 3W33A 3VS7A 4EOJA 1VZOA 4O0SA 4EJ7A 1LEWA 4QPMA 4QRCA 2WAJA 2DUVA 1QL6A 2JDVA 1GJOA 4FOCA 5H8EA 1W7HA 2W1EA 1ZZ2A 5AUXA 5AR2A 5HIDA 3R1SA 3A8XA 3AC8A 4LI5A 4WBBB 2YZLA 3QHRA 5TO8A 4GVJA 3OZ6A 3BV3A 2XKFA 3Q96A 3JUHA 4V0GB 2UW8A 3F3ZA 2XIXA 4BTFA 1A48A 3PJ1A 4JBQA 4WKQA 5M07A 3UQCA 4RC3A 3MA3A 5EM7A 4E20A 3ZZEA 3AKLA 3R01A 4QP3A 5CU6A 4NM5A 4O7TA 3NYOA 2CDZA 5GZAA 3QC9A 4LGDA 5JFVA 1OGYA 1Q8WA 3ZH8A 4EH6A 3R8VA 1OMWA 3KF4A 5I9UA 1WVYA 4RSSA 3Q60A 3MWUA 3EQFA 4A9UA 3PXRA 4XG6A 4MVFA 2OW3A 5EG3A 3W8QA 2QOCA 4WSQA 4K18A 4R1VA 3DKCA 2XZSA 1Q41A 1PXOA 3OUKA 3LQ8A 3GCPA 4DH1A 1G8SA 2ITOA 2VWBA 1UVRA 3MW1A 2WO6A 4PQNA 4XHKB 2W9FB 4C0TA 5AA8A 5J9LA 2I7QA 2C3LA 2OG8A 3RALA 2Y8OA 4JLCA 3VS0A 3FMMA 2OICA 1YW2A 2X6DA 5J95A 1SNXA 3H30A 4EYJA 2YJSA 2VWZA 3TDVA 1OM1A 4G3GA 3ACJA 2BAQA 5IUIA 5J9ZA 3FDNA 2G2HA 3BRBA 1OKWA 4PDYA 3PG3A 3OCSA 4C2WA 5GZ8A 5AAFA 4F6WA 4DHIB 5DT4A 1EH4A 5LMKC 2B4SB 4L3JA 4QP6A 4E4MA 4ZTHA 2C5VA 3FQSA 4NM0A 3UQFA 3FMLA 4D2RA 3GEQA 2B0QA 2HZ4A 3COKA 1P2AA 3CGOA 4WT6A 3NNWA 4EH5A 3A7FA 3C1XA 2P3GX 4ZSLA 3VS2A 5K9IA 1MQBA 4D28A 5AP2A 3SLSA 2R3QA 5HIEA 4BGGA 2X8IA 3R9HA 4ZSAA 2ZV8A 5HHWA 4E4XA 3ZFXA 2QU6A 5IKWA 4FL3A 3QD4A 3T3VA 3UG2A 1ZLTA 2FSTX 2ONLC 4X2NA 4ZP5A 5TT7A 5DOSA 2C6TA 2WGJA 3N51A 2B54A 1Q24A 4EH7A 4OT6A 3GCVA 1IASA 2BIKB 3IPHA 4BCOA 5L2IA 3LKMA 1GZ8A 1UKHA 5ACKA 1Q5KA 2XEYA 2HXQA 1H24A 1HOWA 3RINA 3ZMMA 4QMNA 4QMLA 5LVOA 2WMQA 2FVDA 4BDDA 3ZRMA 4X2JA 1HCKA 4YGAA 1PHKA 3A4OX 4N57A 3G2FA 5TE0A 5IQDA 3NR9A 2XIZA 3NYXA 4QT1A 3QXPA 1YXXA 1XMMA 3SOAA 4ITIA 2X2LA 3ENMA 4EK8A 3TL8A 1OKVA 4W4YA 1YRPA 5HVYA 4FA2A 3HV3A 4QP8A 2UZEA 5A6OA 3AT4A 4XEYA 4I3ZA 3KMUA 4TTHB 1XMLA 4WBOA 3GXLA 4UZHA 3BL7A 5AX3A 2GNJA 3OS3A 5FD2A 1K9AA 2B1PA 1PXIA 1J91A 2SRCA 5CU0A 5EHLA 3F5GA 1J1CA 2ITVA 3FQEA 2F4JA 1JKLA 1XWSA 4TYJA 1WBOA 5HE0A 4FF8A 3EFWA 3GCQA 3TNPC 5M55A 5IISA 5HVJA 5IH4A 4JL9A 4CKIA 5AP0A 3VUMA 3CCNA 4IE9A 5BVEA 4I5MA 3R8LA 3SC1A 1DAYA 2JDRA 2C0TA 4I20A 3LLAA 3FZTA 5LJJA