4H3XA

Crystal structure of an mmp broad spectrum hydroxamate based inhibitor cc27 in complex with the mmp-9 catalytic domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
164
structure length
164
Chain Sequence
b'GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h3xA00
2WOAA 1PWVA 4XM7A 5H8XA 1SLNA 1G9KA 1OMJA 1HOVA 3EHXA 3AYUA 1Y93A 1H71P 3LQBA 1BKCA 1KUHA 1PWQA 2YIGA 3SHIA 1CAQA 1G12A 3VI1A 2MZHA 1WNIA 3CKIA 3HB2P 3L0TA 2L0RA 2OY4A 1JKYA 3LQ0A 3ELMA 3F1AA 1YP1A 1AYKA 2EROA 3BA0A 4FVLA 1XFWA 3F17A 2X7MA 3LK8A 3WV2A 4XCTA 2JT6A 4WF6A 1MMBA 1I1IP 1DMTA 1B3DA 5D7WA 4PKTA 3EDGA 1XUDA 2AYKA 1HFCA 1B8YA 2Y6CA 1FLSA 1UTTA 4J4MA 2OW0A 2ERQA 3LJZA 1J7NA 1C3IA 2X3BA 2DW2A 3F16A 1MMPA 1XURA 1K7GA 1BKCE 1IAAA 1D5JA 4PKRA 2E3XA 2D1OA 4L6TA 5B5OA 1R54A 5I2ZA 3OHOA 1CGFA 1IADA 4JIJA 5BOTA 1FM1A 1C8TA 3B2ZA 1OM8A 1UEAA 3E8RA 2K2GA 4H84A 4A3WA 2DDFA 4AIGA 2MLRA 2TCLA 2OVZA 3KHIA 2CLTA 1R1IA 3B8ZA 2OI0A 5I3MA 1USNA 3KEKA 1CK7A 3LIKA 2XS4A 1ZXCA 5D1SA 2I47A 4DPEA 2W12A 4H82A 1SU3A 2OXZA 1IABA 3V96B 1BKCI 4XM6A 5D3CA 5LABA 3F19A 1KUGA 3EDIA 4I03A 2DW1A 1G05A 3EDHA 1QJJA 4H2EA 1JAOA 1BIWA 1DTHA 3I7IA 456CA 1BM6A 2YB9A 3K7LA 4FXQA 1OS9A 1XUCA 2SRTA 1XFYA 2OW1A 4GR8A 1I73A 4A7BA 3DPEA 1SMPA 1BUVM 3KEJA 1AKLA 2D1NA 3UVCA 1UMTA 3ZXHA 4PKSA 1XFVA 1D8MA 4HMAA 1EB6A 1OO9A 4IJOA 1BUDA 1XFZA 4CTHA 4H76A 3KECA 5D1TA 4PKVA 1XFUA 4FU4A 4GUYA 4L63A 1ZS0A 2OW9A 1BSWA 3HBUP 4DV8A 1KAPP 3B92A 3TS4A 5I0LA 1OM7A 1HTDA 3HY9A 3EWJA 3LUMA 4FXYP 4JPAA 1QIBA 1GE7A 2OXUA 4DD8A 2CKIA 4JA1A 1ND1A 2J83A 830CA 3N2UA 1G4KA 2FV9A 2O36A 1HFSA 4DF9A 2Z2DA 4IN9A 3LGPA 2J0TA 1O0QA 5D2BA 4PKQA 2WO8A 3ZVSA 1L6JA 1KUIA 3USNA 3LJTA 3TSKA 3AIGA 1R55A 4G9LA 4WZVA 4JP4A 1IAEA 2KRJA 1OM6A 3LEAA 4IUWA 2OVXA 3DNGA 3HYGA 5CZMA 1CGLA 1QICA 3U1RA 4I35A 1GO7P 4WK7A 3LIRA 4H3XA 2E2DA 1PWPA 1FBLA 2DW0A 1BZSA 2Y6DA 1Y0VA 1CXVA 4JQGA 1CIZA 4GR0A 1ZTQA 5CXAA 1QUAA 4AUOA 5BOYA 3RTTA 1JAQA 3EDZA 1CGEA 4HX3A 3AYKA 3HY7A 3HDAP 2OY2A 3K7NA 1Z3JA 2JT5A 1YOUA 2OZRA 4ZR5A 2HU6A 1GE5A 3KRYA 1BQQM 1KUKA 1IACA 2MLSA 1JANA 4Q1LA 2V4BA 2PJTA 3F18A 3WV1A 4WKIA 1HV5A 1EUBA 2RJQA 3HDBA 5BPAA 1GKDA 4GQLA 4AYKA 3LILA 1HY7A 4GR3A 2X3AA 4GWNA 1C7KA 1ASTA 3KMCA 3WV3A 3G5CA 3P1VA 4PKWA 1R1HA 1SATA 2W15A 1QJIA 3HBVP 2JIHA 1ZP5A 3EHYA 3DL1A 3GBOA 1KUFA 1BQOA 3Q2GA 5I12A 1GE6A 4WKEA 3TVCA 3LKAA 1I76A 4GF1A 4ILWD 4ON1A 1GO8P 3LUNA 4PKUA 1ZXVA 1JAPA 1UMSA 2K9CA 2W0DA 3N2VA 1ROSA 1XFXA 3G42A 2X3CA 1O0TA 2JNPA 1SLMA 5L7FA 1EAKA 3KWVC 5B5PA 3OHLA 5CUHA 3I7GA 4H49A 2A8HA 3ZUKA 1RM8A 2N8RA 2MZEA 3F15A 3LMCA 3DWBA 4R3VA 2W14A 1A85A 5I43A 3DSLA 1OS2A 1AF0A 1JK3A 1JIWP 5JMYA 1RMZA 3DPFA 1G49A 1QIAA 3O2XA 1ATLA 2OW2A 1JIZA 1JJ9A 1YQYA 1IAGA 4QKZA 3Q2HA 5I4OA 2W13A 2OXWA 4H30A 2POJA 1S4BP 2WO9A 2ERPA 3VTGA 1SRPA 1KBCA 2RJPA 3NX7A 3TT4A 4AXQA 1D8FA 1UTZA 1K7IA 1JH1A 2QPJA 4L19A 1MMQA 1YCMA 2MZIA 1MMRA 1PWUA 1GXDA 2USNA 3LJGA 3P24A 4EFSA 2O3EA 3MA2A 3O64A 3L0VA 5L79A 1GKCA 1CQRA 4XBHA 4H1QA 3KMEA 3RTSA 4GWMA 1Q3AA 3LE9A 1MNCA 4XM8A 2XS3A 5D1UA 1A86A 4G0DA 2DDYA 2AIGP 1Y8JA 1R1JA 1ZVXA 1D7XA 1PWWA 2FV5A 2JSDA 966CA 1K7QA
chains in the Genus database with same CATH superfamily
2WOAA 1PWVA 4XM7A 5H8XA 1SLNA 1G9KA 1OMJA 1HOVA 3EHXA 3AYUA 1XM5A 1Y93A 1H71P 1TVIA 3LQBA 1BKCA 1KUHA 1PWQA 2YIGA 3SHIA 1CAQA 1G12A 3VI1A 2MZHA 1WNIA 3CKIA 3HB2P 3L0TA 2L0RA 2OY4A 1JKYA 3LQ0A 3ELMA 3F1AA 3DTIA 1YP1A 1AYKA 2EROA 3BA0A 4FVLA 1XFWA 3F17A 2X7MA 3LK8A 3WV2A 4XCTA 2JT6A 4WF6A 1MMBA 1I1IP 1DMTA 1B3DA 5D7WA 4PKTA 3EDGA 1XUDA 2AYKA 1HFCA 1B8YA 2Y6CA 1FLSA 1UTTA 4J4MA 2OW0A 2ERQA 3LJZA 1J7NA 1C3IA 2X3BA 2DW2A 3F16A 1MMPA 1XURA 1K7GA 1BKCE 3DTEA 1IAAA 1D5JA 4PKRA 2E3XA 2D1OA 4L6TA 5B5OA 1R54A 5I2ZA 3OHOA 1CGFA 1IADA 4JIJA 5BOTA 1FM1A 1C8TA 3B2ZA 1OM8A 1UEAA 3E8RA 2K2GA 4H84A 4A3WA 2DDFA 4AIGA 2MLRA 2TCLA 2OVZA 3KHIA 2CLTA 1R1IA 3B8ZA 2OI0A 5I3MA 1USNA 3KEKA 1CK7A 3LIKA 2XS4A 1ZXCA 5D1SA 2I47A 4DPEA 2W12A 4H82A 1SU3A 2OXZA 1IABA 3V96B 1BKCI 4XM6A 5D3CA 5LABA 3F19A 1KUGA 3EDIA 4I03A 2DW1A 1G05A 3EDHA 1QJJA 4H2EA 1JAOA 1BIWA 1DTHA 3I7IA 456CA 1BM6A 2YB9A 3K7LA 4FXQA 1OS9A 1XUCA 2SRTA 1XFYA 2OW1A 4GR8A 1I73A 4A7BA 3DPEA 1SMPA 1BUVM 3KEJA 1AKLA 2D1NA 3UVCA 1UMTA 3ZXHA 4PKSA 1XFVA 1D8MA 1OZ9A 4HMAA 1EB6A 1OO9A 4IJOA 1BUDA 1XFZA 4CTHA 4H76A 3KECA 5D1TA 4PKVA 1XFUA 4FU4A 4GUYA 4L63A 1ZS0A 2OW9A 1BSWA 3HBUP 4DV8A 1KAPP 3B92A 3TS4A 5I0LA 1OM7A 1HTDA 3HY9A 3EWJA 3LUMA 4FXYP 4JPAA 1QIBA 1GE7A 2OXUA 4DD8A 2CKIA 4JA1A 1ND1A 2J83A 830CA 3N2UA 1G4KA 2FV9A 2O36A 1HFSA 4DF9A 2Z2DA 4IN9A 3LGPA 2J0TA 1O0QA 5D2BA 4PKQA 2WO8A 3ZVSA 1L6JA 1KUIA 3USNA 3LJTA 3TSKA 3AIGA 1R55A 4G9LA 4WZVA 4JP4A 1IAEA 2KRJA 1OM6A 3LEAA 4IUWA 2OVXA 3DNGA 3HYGA 5CZMA 1CGLA 1QICA 3U1RA 4I35A 1GO7P 4WK7A 3LIRA 4H3XA 2E2DA 1PWPA 1FBLA 2DW0A 1BZSA 2Y6DA 1Y0VA 1CXVA 4JQGA 1CIZA 4GR0A 2YUFA 1ZTQA 5CXAA 1QUAA 4AUOA 5BOYA 3RTTA 1JAQA 3EDZA 1CGEA 4HX3A 3AYKA 3HY7A 3HDAP 2OY2A 3K7NA 1Z3JA 2JT5A 1YOUA 2OZRA 4ZR5A 2HU6A 1GE5A 3KRYA 1BQQM 1KUKA 1IACA 2MLSA 1JANA 4Q1LA 2V4BA 2PJTA 3F18A 3WV1A 4WKIA 1HV5A 1EUBA 2RJQA 3HDBA 5BPAA 1GKDA 4GQLA 4AYKA 3LILA 1HY7A 4GR3A 2X3AA 4GWNA 1C7KA 1XAXA 1ASTA 3KMCA 3WV3A 3G5CA 3P1VA 4PKWA 1R1HA 1SATA 2W15A 1QJIA 3HBVP 2JIHA 1ZP5A 3EHYA 3DL1A 3GBOA 1KUFA 1BQOA 3Q2GA 5I12A 1GE6A 3DTKA 4WKEA 3TVCA 3LKAA 1I76A 4GF1A 4ILWD 4ON1A 1GO8P 3LUNA 4PKUA 1ZXVA 1JAPA 1UMSA 2K9CA 2W0DA 3N2VA 1ROSA 1XFXA 3G42A 2X3CA 1O0TA 2JNPA 1SLMA 5L7FA 1EAKA 3KWVC 4L7AA 5B5PA 3OHLA 5CUHA 3I7GA 4H49A 2A8HA 3ZUKA 1RM8A 2N8RA 2MZEA 3F15A 3LMCA 3DWBA 4R3VA 2W14A 1A85A 5I43A 3DSLA 1OS2A 1AF0A 1JK3A 1JIWP 5JMYA 1RMZA 3DPFA 1G49A 1QIAA 3O2XA 1ATLA 2OW2A 1JIZA 1JJ9A 1YQYA 1IAGA 4QKZA 3Q2HA 5I4OA 2W13A 2OXWA 4H30A 2POJA 1S4BP 2WO9A 2ERPA 3VTGA 1SRPA 1KBCA 2RJPA 3NX7A 3TT4A 4AXQA 1D8FA 1UTZA 1K7IA 1JH1A 2QPJA 4L19A 1MMQA 1YCMA 2MZIA 1MMRA 1PWUA 1GXDA 2USNA 3LJGA 3P24A 4EFSA 2O3EA 3MA2A 3O64A 3L0VA 5L79A 1GKCA 1CQRA 4XBHA 4H1QA 3KMEA 3RTSA 4GWMA 1Q3AA 3LE9A 1MNCA 4XM8A 2XS3A 5D1UA 1A86A 4G0DA 2DDYA 2AIGP 1Y8JA 1R1JA 1ZVXA 1D7XA 1PWWA 2FV5A 2JSDA 966CA 1K7QA
chains in the Genus database with same CATH topology
2WOAA 1PWVA 4XM7A 5H8XA 1SLNA 1G9KA 1OMJA 1HOVA 3EHXA 3AYUA 1Y93A 1H71P 3LQBA 1BKCA 1KUHA 1PWQA 2YIGA 3SHIA 1CAQA 1G12A 3VI1A 2MZHA 1WNIA 3CKIA 3HB2P 3L0TA 2L0RA 2OY4A 1JKYA 3LQ0A 3ELMA 3F1AA 3DTIA 1YP1A 1AYKA 2EROA 3BA0A 4FVLA 1XFWA 3F17A 2X7MA 3LK8A 3WV2A 4XCTA 2JT6A 4WF6A 1MMBA 1I1IP 1DMTA 1B3DA 5D7WA 4PKTA 3EDGA 1XUDA 2AYKA 1HFCA 1B8YA 2Y6CA 1FLSA 1UTTA 4J4MA 2OW0A 2ERQA 3LJZA 1J7NA 1C3IA 2X3BA 2DW2A 3F16A 1MMPA 1XURA 1K7GA 1BKCE 3DTEA 1IAAA 1D5JA 4PKRA 2E3XA 2D1OA 4L6TA 5B5OA 1R54A 5I2ZA 3OHOA 1CGFA 1IADA 4JIJA 5BOTA 1FM1A 1C8TA 3B2ZA 1OM8A 1UEAA 3E8RA 2K2GA 4H84A 4A3WA 2DDFA 4AIGA 2MLRA 2TCLA 2OVZA 3KHIA 2CLTA 1R1IA 3B8ZA 2OI0A 5I3MA 1USNA 3KEKA 1CK7A 3LIKA 2XS4A 1ZXCA 5D1SA 2I47A 4DPEA 2W12A 4H82A 1SU3A 2OXZA 1IABA 3V96B 1BKCI 4XM6A 5D3CA 5LABA 3F19A 1KUGA 3EDIA 4I03A 2DW1A 1G05A 3EDHA 1QJJA 4H2EA 1JAOA 1BIWA 1DTHA 3I7IA 456CA 1BM6A 2YB9A 3K7LA 4FXQA 1OS9A 1XUCA 2SRTA 1XFYA 2OW1A 4GR8A 1I73A 4A7BA 3DPEA 1SMPA 1BUVM 3KEJA 1AKLA 2D1NA 3UVCA 1UMTA 3ZXHA 4PKSA 1XFVA 1D8MA 4HMAA 1EB6A 1OO9A 4IJOA 1BUDA 1XFZA 4CTHA 4H76A 3KECA 5D1TA 4PKVA 1XFUA 4FU4A 4GUYA 4L63A 1ZS0A 2OW9A 1BSWA 3HBUP 4DV8A 1KAPP 3B92A 3TS4A 5I0LA 1OM7A 1HTDA 3HY9A 3EWJA 3LUMA 4FXYP 4JPAA 1QIBA 1GE7A 2OXUA 4DD8A 2CKIA 4JA1A 1ND1A 2J83A 830CA 3N2UA 1G4KA 2FV9A 2O36A 1HFSA 4DF9A 2Z2DA 4IN9A 3LGPA 2J0TA 1O0QA 5D2BA 4PKQA 2WO8A 3ZVSA 1L6JA 1KUIA 3USNA 3LJTA 3TSKA 3AIGA 1R55A 4G9LA 4WZVA 4JP4A 1IAEA 2KRJA 1OM6A 3LEAA 4IUWA 2OVXA 3DNGA 3HYGA 5CZMA 1CGLA 1QICA 3U1RA 4I35A 1GO7P 4WK7A 3LIRA 4H3XA 2E2DA 1PWPA 1FBLA 2DW0A 1BZSA 2Y6DA 1Y0VA 1CXVA 4JQGA 1CIZA 4GR0A 2YUFA 1ZTQA 5CXAA 1QUAA 4AUOA 5BOYA 3RTTA 1JAQA 3EDZA 1CGEA 4HX3A 3AYKA 3HY7A 3HDAP 2OY2A 3K7NA 1Z3JA 2JT5A 1YOUA 2OZRA 4ZR5A 2HU6A 1GE5A 3KRYA 1BQQM 1KUKA 1IACA 2MLSA 1JANA 4Q1LA 2V4BA 2PJTA 3F18A 3WV1A 4WKIA 1HV5A 1EUBA 2RJQA 3HDBA 5BPAA 1GKDA 4GQLA 4AYKA 3LILA 1HY7A 4GR3A 2X3AA 4GWNA 1C7KA 1ASTA 3KMCA 3WV3A 3G5CA 3P1VA 4PKWA 1R1HA 1SATA 2W15A 1QJIA 3HBVP 2JIHA 1ZP5A 3EHYA 3DL1A 3GBOA 1KUFA 1BQOA 3Q2GA 5I12A 1GE6A 3DTKA 4WKEA 3TVCA 3LKAA 1I76A 4GF1A 4ILWD 4ON1A 1GO8P 3LUNA 4PKUA 1ZXVA 1JAPA 1UMSA 2K9CA 2W0DA 3N2VA 1ROSA 1XFXA 3G42A 2X3CA 1O0TA 2JNPA 1SLMA 5L7FA 1EAKA 3KWVC 4L7AA 5B5PA 3OHLA 5CUHA 3I7GA 4H49A 2A8HA 3ZUKA 1RM8A 2N8RA 2MZEA 3F15A 3LMCA 3DWBA 4R3VA 2W14A 1A85A 5I43A 3DSLA 1OS2A 1AF0A 1JK3A 1JIWP 5JMYA 1RMZA 3DPFA 1G49A 1QIAA 3O2XA 1ATLA 2OW2A 1JIZA 1JJ9A 1YQYA 1IAGA 4QKZA 3Q2HA 5I4OA 2W13A 2OXWA 4H30A 2POJA 1S4BP 2WO9A 2ERPA 3VTGA 1SRPA 1KBCA 2RJPA 3NX7A 3TT4A 4AXQA 1D8FA 1UTZA 1K7IA 1JH1A 2QPJA 4L19A 1MMQA 1YCMA 2MZIA 1MMRA 1PWUA 1GXDA 2USNA 3LJGA 3P24A 4EFSA 2O3EA 3MA2A 3O64A 3L0VA 5L79A 1GKCA 1CQRA 4XBHA 4H1QA 3KMEA 3RTSA 4GWMA 1Q3AA 3LE9A 1MNCA 4XM8A 2XS3A 5D1UA 1A86A 4G0DA 2DDYA 2AIGP 1Y8JA 1R1JA 1ZVXA 1D7XA 1PWWA 2FV5A 2JSDA 966CA 1K7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOA A;  1PWV A;  4XM7 A;  5H8X A;  1SLN A;  1G9K A;  1OMJ A;  1HOV A;  3EHX A;  3AYU A;  1Y93 A;  1H71 P;  3LQB A;  1BKC A;  1KUH A;  1PWQ A;  2YIG A;  3SHI A;  1CAQ A;  1G12 A;  3VI1 A;  2MZH A;  1WNI A;  3CKI A;  3HB2 P;  3L0T A;  2L0R A;  2OY4 A;  1JKY A;  3LQ0 A;  3ELM A;  3F1A A;  1YP1 A;  1AYK A;  2ERO A;  3BA0 A;  4FVL A;  1XFW A;  3F17 A;  2X7M A;  3LK8 A;  3WV2 A;  4XCT A;  2JT6 A;  4WF6 A;  1MMB A;  1I1I P;  1DMT A;  1B3D A;  5D7W A;  4PKT A;  3EDG A;  1XUD A;  2AYK A;  1HFC A;  1B8Y A;  2Y6C A;  1FLS A;  1UTT A;  4J4M A;  2OW0 A;  2ERQ A;  3LJZ A;  1J7N A;  1C3I A;  2X3B A;  2DW2 A;  3F16 A;  1MMP A;  1XUR A;  1K7G A;  1BKC E;  1IAA A;  1D5J A;  4PKR A;  2E3X A;  2D1O A;  4L6T A;  5B5O A;  1R54 A;  5I2Z A;  3OHO A;  1CGF A;  1IAD A;  4JIJ A;  5BOT A;  1FM1 A;  1C8T A;  3B2Z A;  1OM8 A;  1UEA A;  3E8R A;  2K2G A;  4H84 A;  4A3W A;  2DDF A;  4AIG A;  2MLR A;  2TCL A;  2OVZ A;  3KHI A;  2CLT A;  1R1I A;  3B8Z A;  2OI0 A;  5I3M A;  1USN A;  3KEK A;  1CK7 A;  3LIK A;  2XS4 A;  1ZXC A;  5D1S A;  2I47 A;  4DPE A;  2W12 A;  4H82 A;  1SU3 A;  2OXZ A;  1IAB A;  3V96 B;  1BKC I;  4XM6 A;  5D3C A;  5LAB A;  3F19 A;  1KUG A;  3EDI A;  4I03 A;  2DW1 A;  1G05 A;  3EDH A;  1QJJ A;  4H2E A;  1JAO A;  1BIW A;  1DTH A;  3I7I A;  456C A;  1BM6 A;  2YB9 A;  3K7L A;  4FXQ A;  1OS9 A;  1XUC A;  2SRT A;  1XFY A;  2OW1 A;  4GR8 A;  1I73 A;  4A7B A;  3DPE A;  1SMP A;  1BUV M;  3KEJ A;  1AKL A;  2D1N A;  3UVC A;  1UMT A;  3ZXH A;  4PKS A;  1XFV A;  1D8M A;  4HMA A;  1EB6 A;  1OO9 A;  4IJO A;  1BUD A;  1XFZ A;  4CTH A;  4H76 A;  3KEC A;  5D1T A;  4PKV A;  1XFU A;  4FU4 A;  4GUY A;  4L63 A;  1ZS0 A;  2OW9 A;  1BSW A;  3HBU P;  4DV8 A;  1KAP P;  3B92 A;  3TS4 A;  5I0L A;  1OM7 A;  1HTD A;  3HY9 A;  3EWJ A;  3LUM A;  4FXY P;  4JPA A;  1QIB A;  1GE7 A;  2OXU A;  4DD8 A;  2CKI A;  4JA1 A;  1ND1 A;  2J83 A;  830C A;  3N2U A;  1G4K A;  2FV9 A;  2O36 A;  1HFS A;  4DF9 A;  2Z2D A;  4IN9 A;  3LGP A;  2J0T A;  1O0Q A;  5D2B A;  4PKQ A;  2WO8 A;  3ZVS A;  1L6J A;  1KUI A;  3USN A;  3LJT A;  3TSK A;  3AIG A;  1R55 A;  4G9L A;  4WZV A;  4JP4 A;  1IAE A;  2KRJ A;  1OM6 A;  3LEA A;  4IUW A;  2OVX A;  3DNG A;  3HYG A;  5CZM A;  1CGL A;  1QIC A;  3U1R A;  4I35 A;  1GO7 P;  4WK7 A;  3LIR A;  4H3X A;  2E2D A;  1PWP A;  1FBL A;  2DW0 A;  1BZS A;  2Y6D A;  1Y0V A;  1CXV A;  4JQG A;  1CIZ A;  4GR0 A;  1ZTQ A;  5CXA A;  1QUA A;  4AUO A;  5BOY A;  3RTT A;  1JAQ A;  3EDZ A;  1CGE A;  4HX3 A;  3AYK A;  3HY7 A;  3HDA P;  2OY2 A;  3K7N A;  1Z3J A;  2JT5 A;  1YOU A;  2OZR A;  4ZR5 A;  2HU6 A;  1GE5 A;  3KRY A;  1BQQ M;  1KUK A;  1IAC A;  2MLS A;  1JAN A;  4Q1L A;  2V4B A;  2PJT A;  3F18 A;  3WV1 A;  4WKI A;  1HV5 A;  1EUB A;  2RJQ A;  3HDB A;  5BPA A;  1GKD A;  4GQL A;  4AYK A;  3LIL A;  1HY7 A;  4GR3 A;  2X3A A;  4GWN A;  1C7K A;  1AST A;  3KMC A;  3WV3 A;  3G5C A;  3P1V A;  4PKW A;  1R1H A;  1SAT A;  2W15 A;  1QJI A;  3HBV P;  2JIH A;  1ZP5 A;  3EHY A;  3DL1 A;  3GBO A;  1KUF A;  1BQO A;  3Q2G A;  5I12 A;  1GE6 A;  4WKE A;  3TVC A;  3LKA A;  1I76 A;  4GF1 A;  4ILW D;  4ON1 A;  1GO8 P;  3LUN A;  4PKU A;  1ZXV A;  1JAP A;  1UMS A;  2K9C A;  2W0D A;  3N2V A;  1ROS A;  1XFX A;  3G42 A;  2X3C A;  1O0T A;  2JNP A;  1SLM A;  5L7F A;  1EAK A;  3KWV C;  5B5P A;  3OHL A;  5CUH A;  3I7G A;  4H49 A;  2A8H A;  3ZUK A;  1RM8 A;  2N8R A;  2MZE A;  3F15 A;  3LMC A;  3DWB A;  4R3V A;  2W14 A;  1A85 A;  5I43 A;  3DSL A;  1OS2 A;  1AF0 A;  1JK3 A;  1JIW P;  5JMY A;  1RMZ A;  3DPF A;  1G49 A;  1QIA A;  3O2X A;  1ATL A;  2OW2 A;  1JIZ A;  1JJ9 A;  1YQY A;  1IAG A;  4QKZ A;  3Q2H A;  5I4O A;  2W13 A;  2OXW A;  4H30 A;  2POJ A;  1S4B P;  2WO9 A;  2ERP A;  3VTG A;  1SRP A;  1KBC A;  2RJP A;  3NX7 A;  3TT4 A;  4AXQ A;  1D8F A;  1UTZ A;  1K7I A;  1JH1 A;  2QPJ A;  4L19 A;  1MMQ A;  1YCM A;  2MZI A;  1MMR A;  1PWU A;  1GXD A;  2USN A;  3LJG A;  3P24 A;  4EFS A;  2O3E A;  3MA2 A;  3O64 A;  3L0V A;  5L79 A;  1GKC A;  1CQR A;  4XBH A;  4H1Q A;  3KME A;  3RTS A;  4GWM A;  1Q3A A;  3LE9 A;  1MNC A;  4XM8 A;  2XS3 A;  5D1U A;  1A86 A;  4G0D A;  2DDY A;  2AIG P;  1Y8J A;  1R1J A;  1ZVX A;  1D7X A;  1PWW A;  2FV5 A;  2JSD A;  966C A;  1K7Q A; 
#chains in the Genus database with same CATH topology
 2WOA A;  1PWV A;  4XM7 A;  5H8X A;  1SLN A;  1G9K A;  1OMJ A;  1HOV A;  3EHX A;  3AYU A;  1XM5 A;  1Y93 A;  1H71 P;  1TVI A;  3LQB A;  1BKC A;  1KUH A;  1PWQ A;  2YIG A;  3SHI A;  1CAQ A;  1G12 A;  3VI1 A;  2MZH A;  1WNI A;  3CKI A;  3HB2 P;  3L0T A;  2L0R A;  2OY4 A;  1JKY A;  3LQ0 A;  3ELM A;  3F1A A;  3DTI A;  1YP1 A;  1AYK A;  2ERO A;  3BA0 A;  4FVL A;  1XFW A;  3F17 A;  2X7M A;  3LK8 A;  3WV2 A;  4XCT A;  2JT6 A;  4WF6 A;  1MMB A;  1I1I P;  1DMT A;  1B3D A;  5D7W A;  4PKT A;  3EDG A;  1XUD A;  2AYK A;  1HFC A;  1B8Y A;  2Y6C A;  1FLS A;  1UTT A;  4J4M A;  2OW0 A;  2ERQ A;  3LJZ A;  1J7N A;  1C3I A;  2X3B A;  2DW2 A;  3F16 A;  1MMP A;  1XUR A;  1K7G A;  1BKC E;  3DTE A;  1IAA A;  1D5J A;  4PKR A;  2E3X A;  2D1O A;  4L6T A;  5B5O A;  1R54 A;  5I2Z A;  3OHO A;  1CGF A;  1IAD A;  4JIJ A;  5BOT A;  1FM1 A;  1C8T A;  3B2Z A;  1OM8 A;  1UEA A;  3E8R A;  2K2G A;  4H84 A;  4A3W A;  2DDF A;  4AIG A;  2MLR A;  2TCL A;  2OVZ A;  3KHI A;  2CLT A;  1R1I A;  3B8Z A;  2OI0 A;  5I3M A;  1USN A;  3KEK A;  1CK7 A;  3LIK A;  2XS4 A;  1ZXC A;  5D1S A;  2I47 A;  4DPE A;  2W12 A;  4H82 A;  1SU3 A;  2OXZ A;  1IAB A;  3V96 B;  1BKC I;  4XM6 A;  5D3C A;  5LAB A;  3F19 A;  1KUG A;  3EDI A;  4I03 A;  2DW1 A;  1G05 A;  3EDH A;  1QJJ A;  4H2E A;  1JAO A;  1BIW A;  1DTH A;  3I7I A;  456C A;  1BM6 A;  2YB9 A;  3K7L A;  4FXQ A;  1OS9 A;  1XUC A;  2SRT A;  1XFY A;  2OW1 A;  4GR8 A;  1I73 A;  4A7B A;  3DPE A;  1SMP A;  1BUV M;  3KEJ A;  1AKL A;  2D1N A;  3UVC A;  1UMT A;  3ZXH A;  4PKS A;  1XFV A;  1D8M A;  1OZ9 A;  4HMA A;  1EB6 A;  1OO9 A;  4IJO A;  1BUD A;  1XFZ A;  4CTH A;  4H76 A;  3KEC A;  5D1T A;  4PKV A;  1XFU A;  4FU4 A;  4GUY A;  4L63 A;  1ZS0 A;  2OW9 A;  1BSW A;  3HBU P;  4DV8 A;  1KAP P;  3B92 A;  3TS4 A;  5I0L A;  1OM7 A;  1HTD A;  3HY9 A;  3EWJ A;  3LUM A;  4FXY P;  4JPA A;  1QIB A;  1GE7 A;  2OXU A;  4DD8 A;  2CKI A;  4JA1 A;  1ND1 A;  2J83 A;  830C A;  3N2U A;  1G4K A;  2FV9 A;  2O36 A;  1HFS A;  4DF9 A;  2Z2D A;  4IN9 A;  3LGP A;  2J0T A;  1O0Q A;  5D2B A;  4PKQ A;  2WO8 A;  3ZVS A;  1L6J A;  1KUI A;  3USN A;  3LJT A;  3TSK A;  3AIG A;  1R55 A;  4G9L A;  4WZV A;  4JP4 A;  1IAE A;  2KRJ A;  1OM6 A;  3LEA A;  4IUW A;  2OVX A;  3DNG A;  3HYG A;  5CZM A;  1CGL A;  1QIC A;  3U1R A;  4I35 A;  1GO7 P;  4WK7 A;  3LIR A;  4H3X A;  2E2D A;  1PWP A;  1FBL A;  2DW0 A;  1BZS A;  2Y6D A;  1Y0V A;  1CXV A;  4JQG A;  1CIZ A;  4GR0 A;  2YUF A;  1ZTQ A;  5CXA A;  1QUA A;  4AUO A;  5BOY A;  3RTT A;  1JAQ A;  3EDZ A;  1CGE A;  4HX3 A;  3AYK A;  3HY7 A;  3HDA P;  2OY2 A;  3K7N A;  1Z3J A;  2JT5 A;  1YOU A;  2OZR A;  4ZR5 A;  2HU6 A;  1GE5 A;  3KRY A;  1BQQ M;  1KUK A;  1IAC A;  2MLS A;  1JAN A;  4Q1L A;  2V4B A;  2PJT A;  3F18 A;  3WV1 A;  4WKI A;  1HV5 A;  1EUB A;  2RJQ A;  3HDB A;  5BPA A;  1GKD A;  4GQL A;  4AYK A;  3LIL A;  1HY7 A;  4GR3 A;  2X3A A;  4GWN A;  1C7K A;  1XAX A;  1AST A;  3KMC A;  3WV3 A;  3G5C A;  3P1V A;  4PKW A;  1R1H A;  1SAT A;  2W15 A;  1QJI A;  3HBV P;  2JIH A;  1ZP5 A;  3EHY A;  3DL1 A;  3GBO A;  1KUF A;  1BQO A;  3Q2G A;  5I12 A;  1GE6 A;  3DTK A;  4WKE A;  3TVC A;  3LKA A;  1I76 A;  4GF1 A;  4ILW D;  4ON1 A;  1GO8 P;  3LUN A;  4PKU A;  1ZXV A;  1JAP A;  1UMS A;  2K9C A;  2W0D A;  3N2V A;  1ROS A;  1XFX A;  3G42 A;  2X3C A;  1O0T A;  2JNP A;  1SLM A;  5L7F A;  1EAK A;  3KWV C;  4L7A A;  5B5P A;  3OHL A;  5CUH A;  3I7G A;  4H49 A;  2A8H A;  3ZUK A;  1RM8 A;  2N8R A;  2MZE A;  3F15 A;  3LMC A;  3DWB A;  4R3V A;  2W14 A;  1A85 A;  5I43 A;  3DSL A;  1OS2 A;  1AF0 A;  1JK3 A;  1JIW P;  5JMY A;  1RMZ A;  3DPF A;  1G49 A;  1QIA A;  3O2X A;  1ATL A;  2OW2 A;  1JIZ A;  1JJ9 A;  1YQY A;  1IAG A;  4QKZ A;  3Q2H A;  5I4O A;  2W13 A;  2OXW A;  4H30 A;  2POJ A;  1S4B P;  2WO9 A;  2ERP A;  3VTG A;  1SRP A;  1KBC A;  2RJP A;  3NX7 A;  3TT4 A;  4AXQ A;  1D8F A;  1UTZ A;  1K7I A;  1JH1 A;  2QPJ A;  4L19 A;  1MMQ A;  1YCM A;  2MZI A;  1MMR A;  1PWU A;  1GXD A;  2USN A;  3LJG A;  3P24 A;  4EFS A;  2O3E A;  3MA2 A;  3O64 A;  3L0V A;  5L79 A;  1GKC A;  1CQR A;  4XBH A;  4H1Q A;  3KME A;  3RTS A;  4GWM A;  1Q3A A;  3LE9 A;  1MNC A;  4XM8 A;  2XS3 A;  5D1U A;  1A86 A;  4G0D A;  2DDY A;  2AIG P;  1Y8J A;  1R1J A;  1ZVX A;  1D7X A;  1PWW A;  2FV5 A;  2JSD A;  966C A;  1K7Q A; 
#chains in the Genus database with same CATH homology
 2WOA A;  1PWV A;  4XM7 A;  5H8X A;  1SLN A;  1G9K A;  1OMJ A;  1HOV A;  3EHX A;  3AYU A;  1Y93 A;  1H71 P;  3LQB A;  1BKC A;  1KUH A;  1PWQ A;  2YIG A;  3SHI A;  1CAQ A;  1G12 A;  3VI1 A;  2MZH A;  1WNI A;  3CKI A;  3HB2 P;  3L0T A;  2L0R A;  2OY4 A;  1JKY A;  3LQ0 A;  3ELM A;  3F1A A;  3DTI A;  1YP1 A;  1AYK A;  2ERO A;  3BA0 A;  4FVL A;  1XFW A;  3F17 A;  2X7M A;  3LK8 A;  3WV2 A;  4XCT A;  2JT6 A;  4WF6 A;  1MMB A;  1I1I P;  1DMT A;  1B3D A;  5D7W A;  4PKT A;  3EDG A;  1XUD A;  2AYK A;  1HFC A;  1B8Y A;  2Y6C A;  1FLS A;  1UTT A;  4J4M A;  2OW0 A;  2ERQ A;  3LJZ A;  1J7N A;  1C3I A;  2X3B A;  2DW2 A;  3F16 A;  1MMP A;  1XUR A;  1K7G A;  1BKC E;  3DTE A;  1IAA A;  1D5J A;  4PKR A;  2E3X A;  2D1O A;  4L6T A;  5B5O A;  1R54 A;  5I2Z A;  3OHO A;  1CGF A;  1IAD A;  4JIJ A;  5BOT A;  1FM1 A;  1C8T A;  3B2Z A;  1OM8 A;  1UEA A;  3E8R A;  2K2G A;  4H84 A;  4A3W A;  2DDF A;  4AIG A;  2MLR A;  2TCL A;  2OVZ A;  3KHI A;  2CLT A;  1R1I A;  3B8Z A;  2OI0 A;  5I3M A;  1USN A;  3KEK A;  1CK7 A;  3LIK A;  2XS4 A;  1ZXC A;  5D1S A;  2I47 A;  4DPE A;  2W12 A;  4H82 A;  1SU3 A;  2OXZ A;  1IAB A;  3V96 B;  1BKC I;  4XM6 A;  5D3C A;  5LAB A;  3F19 A;  1KUG A;  3EDI A;  4I03 A;  2DW1 A;  1G05 A;  3EDH A;  1QJJ A;  4H2E A;  1JAO A;  1BIW A;  1DTH A;  3I7I A;  456C A;  1BM6 A;  2YB9 A;  3K7L A;  4FXQ A;  1OS9 A;  1XUC A;  2SRT A;  1XFY A;  2OW1 A;  4GR8 A;  1I73 A;  4A7B A;  3DPE A;  1SMP A;  1BUV M;  3KEJ A;  1AKL A;  2D1N A;  3UVC A;  1UMT A;  3ZXH A;  4PKS A;  1XFV A;  1D8M A;  4HMA A;  1EB6 A;  1OO9 A;  4IJO A;  1BUD A;  1XFZ A;  4CTH A;  4H76 A;  3KEC A;  5D1T A;  4PKV A;  1XFU A;  4FU4 A;  4GUY A;  4L63 A;  1ZS0 A;  2OW9 A;  1BSW A;  3HBU P;  4DV8 A;  1KAP P;  3B92 A;  3TS4 A;  5I0L A;  1OM7 A;  1HTD A;  3HY9 A;  3EWJ A;  3LUM A;  4FXY P;  4JPA A;  1QIB A;  1GE7 A;  2OXU A;  4DD8 A;  2CKI A;  4JA1 A;  1ND1 A;  2J83 A;  830C A;  3N2U A;  1G4K A;  2FV9 A;  2O36 A;  1HFS A;  4DF9 A;  2Z2D A;  4IN9 A;  3LGP A;  2J0T A;  1O0Q A;  5D2B A;  4PKQ A;  2WO8 A;  3ZVS A;  1L6J A;  1KUI A;  3USN A;  3LJT A;  3TSK A;  3AIG A;  1R55 A;  4G9L A;  4WZV A;  4JP4 A;  1IAE A;  2KRJ A;  1OM6 A;  3LEA A;  4IUW A;  2OVX A;  3DNG A;  3HYG A;  5CZM A;  1CGL A;  1QIC A;  3U1R A;  4I35 A;  1GO7 P;  4WK7 A;  3LIR A;  4H3X A;  2E2D A;  1PWP A;  1FBL A;  2DW0 A;  1BZS A;  2Y6D A;  1Y0V A;  1CXV A;  4JQG A;  1CIZ A;  4GR0 A;  2YUF A;  1ZTQ A;  5CXA A;  1QUA A;  4AUO A;  5BOY A;  3RTT A;  1JAQ A;  3EDZ A;  1CGE A;  4HX3 A;  3AYK A;  3HY7 A;  3HDA P;  2OY2 A;  3K7N A;  1Z3J A;  2JT5 A;  1YOU A;  2OZR A;  4ZR5 A;  2HU6 A;  1GE5 A;  3KRY A;  1BQQ M;  1KUK A;  1IAC A;  2MLS A;  1JAN A;  4Q1L A;  2V4B A;  2PJT A;  3F18 A;  3WV1 A;  4WKI A;  1HV5 A;  1EUB A;  2RJQ A;  3HDB A;  5BPA A;  1GKD A;  4GQL A;  4AYK A;  3LIL A;  1HY7 A;  4GR3 A;  2X3A A;  4GWN A;  1C7K A;  1AST A;  3KMC A;  3WV3 A;  3G5C A;  3P1V A;  4PKW A;  1R1H A;  1SAT A;  2W15 A;  1QJI A;  3HBV P;  2JIH A;  1ZP5 A;  3EHY A;  3DL1 A;  3GBO A;  1KUF A;  1BQO A;  3Q2G A;  5I12 A;  1GE6 A;  3DTK A;  4WKE A;  3TVC A;  3LKA A;  1I76 A;  4GF1 A;  4ILW D;  4ON1 A;  1GO8 P;  3LUN A;  4PKU A;  1ZXV A;  1JAP A;  1UMS A;  2K9C A;  2W0D A;  3N2V A;  1ROS A;  1XFX A;  3G42 A;  2X3C A;  1O0T A;  2JNP A;  1SLM A;  5L7F A;  1EAK A;  3KWV C;  4L7A A;  5B5P A;  3OHL A;  5CUH A;  3I7G A;  4H49 A;  2A8H A;  3ZUK A;  1RM8 A;  2N8R A;  2MZE A;  3F15 A;  3LMC A;  3DWB A;  4R3V A;  2W14 A;  1A85 A;  5I43 A;  3DSL A;  1OS2 A;  1AF0 A;  1JK3 A;  1JIW P;  5JMY A;  1RMZ A;  3DPF A;  1G49 A;  1QIA A;  3O2X A;  1ATL A;  2OW2 A;  1JIZ A;  1JJ9 A;  1YQY A;  1IAG A;  4QKZ A;  3Q2H A;  5I4O A;  2W13 A;  2OXW A;  4H30 A;  2POJ A;  1S4B P;  2WO9 A;  2ERP A;  3VTG A;  1SRP A;  1KBC A;  2RJP A;  3NX7 A;  3TT4 A;  4AXQ A;  1D8F A;  1UTZ A;  1K7I A;  1JH1 A;  2QPJ A;  4L19 A;  1MMQ A;  1YCM A;  2MZI A;  1MMR A;  1PWU A;  1GXD A;  2USN A;  3LJG A;  3P24 A;  4EFS A;  2O3E A;  3MA2 A;  3O64 A;  3L0V A;  5L79 A;  1GKC A;  1CQR A;  4XBH A;  4H1Q A;  3KME A;  3RTS A;  4GWM A;  1Q3A A;  3LE9 A;  1MNC A;  4XM8 A;  2XS3 A;  5D1U A;  1A86 A;  4G0D A;  2DDY A;  2AIG P;  1Y8J A;  1R1J A;  1ZVX A;  1D7X A;  1PWW A;  2FV5 A;  2JSD A;  966C A;  1K7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...