4H4IA

Oye1-w116v complexed with the dismutation product of (s)-carvone
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLVVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4h4iA00
4EWND 3LHTA 3NQCA 4GNJA 5I3JA 2X1RA 3U6WA 3GKAA 1L6YA 4DXVA 3LERA 4JX4A 3VKJA 3NZRA 3ZR4A 4BWLA 3ATZA 3PS7A 4LV9A 4BI5A 4QIUA 2Y62A 2WPBA 3MI6A 2CLHA 3BV4A 3IEBA 3W83A 1OFRA 4UTKA 2VC6A 1YXCA 1M5WA 1AW2A 4NZJA 1XXXA 4FX8A 2FB2A 4Y90A 1TPUA 1MXSA 4GUJA 5FI8A 4O11A 1L9WA 3QSTA 3C4UA 4BK9A 1TRDA 1QDSA 3GDRA 4NJHA 4X22A 3WK0A 1PL9A 5HWJA 1IXOA 1OFQA 2R94A 3EX2A 1T99A 4DPPA 4Q33A 3VI2A 2Q8LA 1K8XA 1R2RA 4X9SA 1A5SA 1QWGA 1ZFJA 2ZRVA 1TMHA 4AF0B 1H7OA 5KTLA 3W07A 2PRLA 3TE9A 5J5RA 2DZSA 1SW3A 1V5XA 4Y8FA 4QQ3A 2YX0A 3MUXA 3PBUA 4JIQA 1W3IA 1ZHAA 3L2IA 1M7OA 3BG9A 1CI1A 3TNOA 3W73A 2JK2A 3CEPA 4RV8A 4YMZA 5AHEA 1WDWA 4N9BA 3INPA 3I7RA 3EKLA 2Y88A 1AK5A 5D30A 5H91A 4ML9A 3CB8A 1KA9F 3W7EA 4WXYA 2ZA3A 3FYPA 3SGZA 5ABTA 1XUZA 2B7OA 2E09A 3G3MA 4EF8A 3FJLA 3IVUA 2GQ8A 3SW6A 1HFBA 5KZEA 3EWWA 3S1VA 2NX9A 1K02A 1VLIA 4NJJA 1Q3NA 2FIQA 3QZEA 4GC4A 2YZRA 3TUUA 1LDCA 4FNUA 4BWLC 2P1FA 4Y6GA 3O6CA 3W7NA 2PRMA 1GPWA 4ZQOA 4O53A 2CFFA 2W79A 4UMAA 3QF0A 1L6WA 5U4NA 3QMTA 3MMTA 3A24A 3LOTA 3C61A 3C8FA 2ZZ4A 5HR7A 4JN6A 2GPTA 2V30A 3LCLA 2KZHA 1UB3A 1R30A 3NQFA 4WY0B 1H60A 3CWOX 1O94A 4OT7A 3W84A 2ZBTA 1GG0A 4LVFA 4MKNA 5CPLA 2F7FA 5F2IA 5G4EA 2TPSA 2RDUA 4KFOA 3NOEA 1SU5A 2Z1BA 3IGUA 3STCA 3WK3A 1A5CA 5HWNA 4JICA 3CTLA 4FB7A 5KITA 1EP1A 1X6UA 3DHFA 1YDNA 1TIMA 3O05A 1SZFA 3CHVA 4XWUA 1OX5A 3OVQA 4U4MA 3P60A 3GR8A 1UUOA 1FDZA 1RV8A 3UQNA 3NQAA 4FXRA 4JX6A 2FTPA 5EL1A 3N2MA 1TPEA 3UYCA 1HO4A 2YW3A 4O12A 2ZZ3A 3W2UA 1LLZA 1G7UA 2NWRA 1KTBA 4O28A 1ZNNA 4O52A 5U7SA 4WX2A 4M7TA 5D2WA 3G1XA 3UWYA 3QMRA 1GVSA 1ME9A 2VENA 2ZRXA 1NAL1 1PCKA 2QF7A 4O57A 2Z2UA 3W7CA 5BMXA 3DGRA 4Z1DA 5CPOA 1A53A 1I8JA 3S6DA 2QUUA 1TRIA 3G8RA 4IPIA 4DO5A 1FY6A 3KRZA 2A4AA 1FXQA 2JGQA 4NXSA 2EF9A 2HTMA 4PL2A 3W1AA 2NUXA 4UMBA 2TRSA 4ZQNA 4AHPA 1WBHA 3U2OA 1XBVA 1TPC1 4OE7A 4K39A 1X7FA 2RDTA 3C3NA 1A5BA 5G2IA 1DQXA 1ICQA 1F2JA 1VYSX 2UV8G 4ORMA 3HPXA 1DKWA 3W1QA 4LUJA 4NVTA 3TX9A 5MHBA 4M19A 1ZAJA 3PF3A 4KWWA 4ADUA 5LKYA 1YTDA 3G24A 4E2DA 1THFD 3W1LA 2A6NA 1AW1A 3BG5A 3ZFHA 4CCEA 1G4SA 1IGSA 2RDWA 3NQEA 2ALDA 3KRUA 4AHQA 2WSRA 1FBAA 3LCXA 4RXFA 4UFKA 3A5FA 4NZFA 3CIWA 3PVFA 3TXVA 1W5MA 2CWNA 2ISSA 3P7YA 1R2SA 1HO1A 3DFNA 1OFAA 3TU9A 1V7YA 2FQIA 4QM1A 3PB2A 1WX0A 1WAUA 2Y70A 1MEWA 1EWEA 3HPSA 1PHWA 4LNYA 4DQWA 1SR9A 4JIPA 4MIMA 1OG0A 3QEZA 4IX0A 3LI1A 4N6EA 1F6KA 4AF0A 2WSYA 4TU1A 3MP4A 2B4GA 3HOJA 3JS3A 2Q3RA 3A21A 5EYWA 3WJXA 1W5OA 1GOXA 3FEMA 4ZQPA 4RX0A 1XL9A 1JVNA 4AWUA 4O54A 3W7MA 2H3BA 3L67A 2QCEA 1LOQA 2FB3A 3T7VA 1I2PA 4M6PA 2C15A 4DELA 4WUIA 1VYRA 4O50A 1IXNA 1W8SA 2C16A 3EKZA 2A2IA 2C19A 4K8EA 1FWSA 1E51A 1C29A 2ZA1A 3SR7A 3AJXA 3DU0A 5F4XA 3IIOA 4MVAA 3WJSA 1EA0A 3M5ZA 2PE4A 3SSJA 2H6RA 3NDOA 5CZTA 3W75A 3B06A 3QM3A 3V1PA 1TPVA 1PVNA 3W85A 1H1YA 1DL3A 1RQHA 5AFDA 1SO6A 4I7UA 3EXRA 4ZVJA 5G1TA 3LCGA 3BW2A 3LV6A 3DKLA 1A50A 1EB3A 4K8HA 2Y7GA 2TYSA 1LZOA 3NPUA 4N9EA 3TJXA 1IF2A 1FWWA 3L21A 4GUHA 4NNCA 3R5EA 1O95A 2V8ZA 1F5ZA 3P8JA 2CLKA 3BLIA 4PODA 4JTKA 3FFSA 4FX6M 3R12A 5FESA 4JTSA 3NA8A 1W54A 5I3GA 3P8IA 1GQNA 3LBCA 3N3MA 3TMQA 1KFEA 2W0UA 3NQ7A 4Z08A 1VLWA 2ZZ6A 2C0AA 1SUXA 2O7SA 1Q6LA 1KM4A 3W9ZA 4LVBA 4FNSA 3B04A 2DZTA 5E93A 4JTLA 4IMFA 3E0IA 2WNQA 3TSMA 3T55A 1PIIA 4KWVA 5LZLA 3R13A 1NFBA 4MPQA 4ZMGA 4BI6A 3O1NA 3MJYA 4FHAA 4Z1AA 3MP5A 2CZ5A 3GDKA 3GXTA 1BWKA 3TA6A 1HG3A 1JUKA 1K7FA 2XFWA 3M0ZA 4HNNA 1O5KA 3HQ1A 3UZ5A 4RLIA 3LXCA 4JS3A 5DELA 5AC7A 2CW6A 5EBUA 3DBPA 3TROA 5DN1A 3GDLA 2ABBA 2V82A 1JCNA 3QYQA 4O15A 4ADSA 5F4SA 3SFKA 3RK8A 1YYAA 3DFQA 3HJZA 4CLMA 3S0CA 3WK2A 3PBYA 1OX4B 5IBXA 2DORA 1Z44A 4K38A 3LTYA 1ADOA 4IMGA 1YPIA 3TAKA 1GVQA 1EX5A 3KAOA 4IQLA 3VE7A 3NPWA 2C3ZA 3P5YA 3O63A 3NO5A 3B0PA 5D32A 1EUNA 3PG8A 2HS6A 2VEKA 2JBMA 1KM6A 2YW4A 3CLMA 3IIZA 4Z0SA 1FWRA 2QCLA 1JCXA 1VPXA 4MFEA 5D2TA 3S8HA 1CX9A 4N6FA 2FPTA 1C8VA 2NXHA 1VC4A 5DBUA 4IXXA 3KXQA 5LNVA 4UFJA 5EA9A 2QJIA 4DF1A 5DXYA 1ONRA 4HSNA 3QH2A 1H1ZA 1IIGA 4JNMA 3S5OA 3HIJA 3OBKA 1Q45A 5HR6A 3Q37A 1MO0A 3G0XA 2FPVA 5TBOA 1I2OA 3LXAA 4O4WA 3TV8A 1ZAHA 3W1PA 4DF0A 4M7SA 1IXQA 1JQVA 4ICNA 1QMLA 2G97A 2X16A 4TX9A 1MZHA 1FWNA 2YXGA 4IUOA 1WA3A 3L5AA 4FNQA 3RNDA 4E2BA 3LBMA 3N34A 2QCGA 1LP6A 3W7IA 2RKXA 5CSRA 3JRKA 2A7PA 2ZRZA 5D09A 3W1UA 3Q2DA 3TMLA 1JCJA 4CQAA 3L65A 4O1CA 3USBA 3W86A 1A5AA 4JTEA 3W2LA 3LV5A 5E1QA 3P62A 3VFLA 1DBTA 5D05A 3WJWA 1NVMA 1OYAA 3T4CA 2PURA 3ZS4A 1AG1O 5AN7A 3SY5A 4PC8A 1MEHA 4GUFA 3DHDA 2E6YA 2E6DA 4AEOA 1QOQA 4WXZA 3TDFA 3TH6A 2QCNA 4RKAA 2CZFA 2DU2A 4MLJA 5F1UA 4O1BA 3BPWA 2VFFA 4PFMA 1BWLA 3PAJA 2J9ZA 3L9CA 6TIMA 4GJ1A 4R53A 4OU1A 3NQ2A 5EPDA 4R7JA 2VEMA 1G67A 4RK8A 4K36A 4S1FA 3CEUA 1I4NA 2BWGA 2FDSA 2VOMA 2VFIA 5J5DA 3LLDA 3TK7A 1PHQA 2X1SA 3CU2A 5H2ZA 1TTJA 1PCWA 2ATMA 3JR2A 1H7WA 3DXIA 5G4WA 4J9JA 3BW4A 4AB4A 3PSVA 3G1AA 3EX4A 3PBVA 3NQMA 3E02A 1F73A 3F03K 2VEPA 4R33A 4OHQA 4MZ8A 3B4UA 2CLLA 1G4EA 4LY8A 2GOUA 5A8GA 3F4NA 2WSQA 3NM1A 4LW7A 1HTIA 5FF2A 3S5YA 1TJPA 3QQ1A 4IMEA 4NJGA 2G95A 1Z41A 3M5YA 2ZA2A 1FXPA 4JY9A 3S1UA 3R2GA 4UFMA 3G3DA 1H62A 1XBXA 2JGYA 1KTNA 3SZ8A 3LTSA 5HMSA 3W6YA 4GUIA 1H61A 3BLEA 2J24A 4KFPA 1VZWA 3DH7A 1NF7A 3C2VA 5FF3A 5BOOA 1SFLA 5FEZA 1K7XA 3NR0A 1ICSA 5HULA 3MBDA 3MI3A 1GTHA 3O07A 3T44A 1K3UA 3LHVA 3O15A 1WOAA 4XKYB 3RU6A 4Q32A 5T26A 3PG9A 1P0KA 1EP3A 3M43A 3MYPA 3M7WA 4JD4A 1OVDA 1OHLA 3B8DA 1SO4A 3CIXA 2QJGA 5I3FA 1GJPA 1GG1A 3NEVA 5KZMA 3T40A 3LHWA 3LI0A 1WV2A 3PB0A 3TW7A 4E0CA 4P2VA 4DO4A 5IBXC 4ZQCA 5AHFA 4MY9A 1RQBA 4OGZA 2AQWA 3BGGA 3GDTA 2A0NA 3NZ1A 3P80A 2CLFA 1QPQA 3UWWA 4O0ZA 1W5QA 5DY2A 2QCCA 5LHFA 1W0MA 2IQTA 2NUYA 3IIPA 1OK6A 1LORA 1AL7A 3WK1A 1LOLA 1JQXA 3N19B 3NL6A 1GYLA 5DCDA 3MWAA 3LCWA 4O18A 4GE8A 3LHZA 4MZYA 3VCRA 2G96A 3BGJA 1L6SA 1ZCOA 2V9DA 2J9XA 3ABOA 1D3HA 3L5LA 5CZ0A 5K4XA 5K4ZA 3R8RA 2D73A 1EWDA 1N55A 1YXDA 4UR8A 3KVMA 3GYEA 1F74A 3PM6A 3PSWA 3C6CA 2NWSA 1KBJA 1QO2A 3I7SA 1P1XA 1ZJIA 3A9IA 2I14A 4UTWA 3W72A 2Q8ZA 1KFLA 4UFHA 4GFSA 1DJQA 4XTIA 1B4EA 1LLWA 2J27A 1X1ZA 2ZTKA 1YXYA 4FIRA 3M5XA 3OVPA 3L0GA 1LOSA 1WBJA 2EKCA 2ZYFA 1ME8A 4LUIA 1FCBA 2A6LA 5BMWA 1LROA 5AOUA 1SFJA 2H3DA 5AC8A 1H5YA 3LHYA 4JYFA 5G2HA 1JULA 3M41A 1ML1A 1DVJA 4XZ9A 1FWTA 2Q3OA 3PUEA 3MI2A 1H51A 2QKFA 1OFEA 1G69A 3G1HA 3NL3A 5D02A 3NYZA 3LGEA 4LRTA 3THQA 4AHOA 3G8EA 3G22A 4B5NA 4JXCA 3Q94A 1K03A 3ATYA 1I45A 3S5NA 5KINA 5DY3A 2V0TA 3THAA 4IGHA 4Q4KA 4CCDA 3GNDA 1QPOA 5KSWA 2EGZA 2WOQA 3FIGA 3QRHA 2QJHA 3LM7A 5C5YA 2E5BA 3NL2A 3UPWA 1X1OA 5DLCA 2QEZA 3E49A 4Z1CA 1TJRA 2OX1A 4EIVA 4WOZA 1KFJA 3HG3A 1OX6A 1B4KA 2VFHA 1PV8A 4JGDA 1J2WA 1J5TA 1MEIA 3TKFA 4UTJA 1ALDA 3NNTA 1ZENA 2AAMA 1YDOA 2WJZA 3HGOA 4I9AA 4A2SA 1R47A 4BR1A 1JUEA 4NX5A 1VCFA 3FS2A 1ZAIA 1OK4A 5AYYA 3H55A 3W87A 1FUYA 3L0NA 3QW4B 1VHNA 2B7PA 1KFKA 3W2KA 4WY0A 3CC1A 4JTJA 1QNVA 2BXVA 2Y6ZA 3H54A 4FF7A 3TAOA 3S9YA 2EHHA 1YTEA 4K6AA 3A23A 4LVAA 1JCLA 4JX5A 2JKEA 3HPZA 2Y7DA 3STGA 3KVLA 3W1RA 1U83A 5C2XA 2G5WA 1KBIA 4JDYA 1IIHA 1AMKA 5EKYA 3LRKA 4LS2A 1TQXA 5FF7A 4QNWA 1YADA 3C52A 1FDJA 3P61A 1UASA 1TQJA 2QR6A 1VYPX 5AYXA 3UZJA 2E77A 3GNNA 4WJEA 3M9YA 2Y7EA 4JTUA 3W3OA 4IMCA 2V5BA 3VNDA 4UMCA 5CGQA 3HB9A 1G4PA 5KZDA 1U5JA 1R2TA 4XBKA 1NEYA 1LRQA 1GTEA 3HO8A 1PE1A 3NQ8A 4O4VA 3A22A 1HL2A 2OZ0A 4JTFA 3TSDA 4FEZA 3W70A 3W7HA 3RLVA 4UTMA 1W56A 1G6CA 2YYUA 2WNZA 2C18A 2ZQ0A 3UWZA 2ISVA 5AHIA 2CLIA 1TPWA 2ZRYA 3BVJA 2VFEA 3HF3A 4IPJA 4I7WA 4S2CA 3W2NA 5FEWA 2HMCA 5LHEA 3W7PA 2ZZ5A 5AHNA 1FQ0A 1SSDA 5FF4A 4LVGA 1SO5A 3R89A 4KFNA 2XN1A 2RHGA 4FO4A 1GVOA 4L4MA 4OV9A 4AWSA 4L4LA 5DCBA 2QDGA 3ANYA 3F4WA 1N8FA 4QNEA 4GBUA 1XKYA 3EB2A 2HS8A 2YFOA 4UC5A 3KVJA 5F2GA 3GIYA 1FDYA 4MZ1A 3LCHA 4ZQRA 3ABQA 2Y63A 1P4CA 4MUZA 2YR1A 5C6MA 4FNRA 4TO8A 3NG3A 3UWUA 1TREA 2H90A 5DBTA 2V2DA 3MP3A 1F76A 3HG5A 2ZFAA 4ADTA 2GQAA 5FEPA 1RQEA 3PC0A 4TMBA 2NX1A 1L2UA 1SW0A 3B03A 2E5DA 1GYNA 4QJ1A 2RFGA 4X3ZA 1GZGA 5LGXA 2FJKA 1TPB1 2VELA 4OV4A 3L0KA 1TYGA 3FYOA 4ZL1A 3STEA 2NXGA 4PL1A 1JRBA 4BI7A 1Z42A 3E12A 4O13A 3SI9A 3EWXA 1TPH1 1XUUA 1VS1A 4N4QA 3TQVA 5F1VA 3W76A 1F05A 1OF6A 2E5CA 3EWUA 4UTWC 4XQ6A 5BRBA 4LS1A 2TMDA 1VCVA 3B0VC 1YLVA 3GDMA 3LHUA 1DOSA 1W31A 3LX9A 4UTUA 4P61A 4MY8A 4UNKA 1XDLA 3FLUA 3VE9A 5G2WA 3RFAA 3TXZA 3G1DA 2A1YA 6ALDA 4LRSA 3P5ZA 2Y7FA 3KOFA 3MHFA 3QSRA 3GX9A 3IVSA 3W1NA 1KV8A 1D3GA 4Z0JA 3GVGA 1RD5A 4UCGA 4CQ9A 3HGSA 4H6KA 3IV3A 4N9DA 1GT8A 5D37A 1W37A 2OT0A 4IMDA 4BFAA 2VKZG 4MJMA 2A7RA 1N7KA 1C9DA 2QAPA 4IJBA 3TC7A 1B3OA 4X2RA 4E38A 1SQ7A 4AWTA 2P10A 4JY8A 3W2JA 2EAWA 4POCA 4RXGA 1UCWA 4LT9A 1OJXA 2JKPA 3LDVA 4N02A 2ZCGA 5EY5A 2WNNA 1SSGA 3MBFA 2I9EA 2WV8A 4G1KA 4R34A 4N2YA 3KX6A 4O17A 4PEKA 3DI1A 4O0KA 4NXKA 1SPQA 2E68A 4WOQA 4Y9AA 5BW6A 1QOPA 2VFDA 4HPJA 1DQWA 3W7OA 4DO6A 2TSYA 3NGJA 2WQPA 1EPXA 1KLYA 1FCQA 2DZUA 3MW7A 5GVJA 5A5WA 1QPRA 5LNUA 1W1ZA 4MFDA 4GRSA 3L68A 1D9EA 4NX0A 3FOKA 4JTTA 3S42A 1ZALA 4CQ8A 2CZEA 2QCMA 1BTMA 4MLRA 3W2MA 1Q6OA 3STFA 4RZ6A 1SW7A 4KKXA 1M6JA 4QAIA 2DZPA 3C2FA 5K3VA 1VGAA 2Y85A 3UY8A 3IGXA 4M6QA 3G0SA 2GVGA 1W5PA 1W3NA 2DJXA 1EEPA 2GVJA 4YWIA 1IXPA 1WQ5A 5F2LA 3QW3A 3L5MA 4HPXA 4QSHA 3B0UX 3M1ZA 3B05A 4LVDA 3QJAA 4K37A 1P0NA 3O16A 3LXBA 1O4UA 2YSWA 3F1QA 4PH6A 2V2CA 4IOTA 1GVFA 5SWUA 2J9YA 4NT0A 5D2YA 1OFPA 4IX2A 3W22A 1QAPA 1K7EA 2CZDA 3EWZA 4UFIA 4OBTA 3CT7A 4YCPA 4EOUA 2I1OA 3O6DA 2Z0IA 5C54A 3DKJA 1H63A 3G18A 4JTHA 3RLUA 3OVRA 1OYBA 2QCDA 3N2XA 1OFOA 4UIOA 3UXDA 1QFEA 3PWAA 4LU0A 4RZ5A 3HG4A 3T78A 2DP3A 1KM0A 5HUPA 1LBLA 3P67A 3M44A 2B7NA 1OABA 1YTKA 1VRDA 2Y61A 4DEFA 2R91A 2QDHA 2RH9A 3I68A 5AHMA 3MHUA 3TQ0A 3NAVA 4DBEA 4FXSA 3DFTA 4K7YA 3LRLA 1QR7A 1UUMA 1SZGA 2X1UA 3BK0A 1KFCA 3CWNA 3GB6A 4UUIA 2R8WA 4LV4A 1TTPA 2H8XA 3GXPA 1TO3A 2CLMA 1H7NA 1Q6QA 1Z48A 4JYDA 3ZWSA 1KM1A 1SO3A 5HUOA 4YLWA 3TFXA 1XFBA 1XC4A 2NV2A 3UWVA 3BARA 3P84A 5D38A 2GQ9A 3W7JA 1TPFA 2NV1A 2OCZA 4AAJA 3C56A 1VCGA 3TW6A 1B57A 2ZRWA 4UXDA 2ZZ2A 2XN2A 1GEQA 5CG7A 2YGYA 1Y0EA 4JR5A 4O1DA 4HNUA 4RR4A 4U28A 4ZZ9A 2OT1A 3PY2A 2A7NA 1H50A 3BLFA 3DFOA 2DJLA 3DAQA 4WZHA 4YCOA 2OMAA 4PTNA 4YL2A 1B9BA 3C2OA 4HNTA 1Q6RA 5I3IA 3IIXA 3W1TA 1DORA 2W6RA 3MYOA 2X1TA 3BW3A 3U8GA 3C2RA 4AMAA 3M47A 4RJEA 1NSJA 1KM2A 2NX3A 2V81A 3NM3A 4O10A 3G1FA 1LCOA 5K9XA 4UNLA 3LLFA 5D04C 1KV5A 2ZZ1A 3G1VA 1S3HA 3C2EA 4ALDA 4UFLA 5K9DA 1KM3A 3O8AA 1AL8A 3C0JA 5LGZA 2ISWA 1DJNA 4GXMA 4O1AA 1G7VA 3TJLA 1FCUA 5TIMA 7TIMA 3QFEA 5K7JA 1S5TA 1O5XA 2A21A 3MO7A 3LCIA 4NUWA 1WXJA 1VQTA 4MOZA 5K9CA 1LTDA 3H53A 1O60A 3W7DA 3NXFA 5TQLA 1I2RA 3GAKA 3GAYA 2H8ZA 1T8XA 2R14A 3IRDA 4N4PA 4K7VA 3EX6A 2O7QA 4DF2A 1BEUA 3P74A 1XBZA 1S5WA 3GLCA 2QUTA 2A5HA 3DFSA 2B7QA 4RZ4A 5CPNA 2V2HA 4ORIA 4C1LA 2VFGA 3ZWTA 4FNTA 4D2JA 3K30A 4MYXA 1KLZA 2BTMA 1F7BA 1ZY9A 3QMSA 2NUWA 3NQGA 1OX4A 3PUDA 5AHLA 4TMCA 1LBFA 3KVKA 5D2VA 5HJLA 2F84A 4O8RA 3MHGA 5HQEA 3RF9A 5F2MA 3AO0A 3LCFA 1J4EA 3N9RA 3HGRA 5C55A 2YCEA 2C6QA 1P5BA 4OQVA 3NQVA 3YPIA 4N9CA 5D03A 4GWEA 4WY0F 2CU0A 3SIZA 1BKSA 1TCDA 5CKSA 1W3TA 2VXNA 4TIMA 3I6RA 2FPYA 5D2XA 4NQ1A 5K2ZA 3S1WA 2BZNA 3W7QA 1KTCA 4HT3A 5BNKA 2YDAA 2EPHA 3PULA 3UWQA 2QCDB 4XKYA 4IWWA 1QO5A 1TSIA 3EEGA 1LM1A 2E6FA 3CPRA 1EP2A 4MJZA 3TR2A 1K8ZA 4M5PA 2X30A 5I3KA 2X2GA 4NU7A 1I2QA 4JDBA 1JR1A 5AC6A 1TV5A 3UXAA 4LTSA 4OWGA 1XI3A 4ONVA 2V5LA 3PBWA 1G4TA 3I7QA 1VHCA 3ABSA 3WJYA 2PRHA 1YDVA 3S1XA 5CPMA 3WJZA 5LNWA 3NL5A 2GUUA 3O6YX 3E9AA 2J6XA 1TV7A 5DXXA 3P81A 4HHPA 4UTLA 1OF8A 2B0MA 1PS9A 3SECA 1ICPA 4UTIA 4EF9A 2QCHA 3QQ0A 1FCVA 3IIVA 3W1MA 1S5VA 3UPBA 3W71A 1KFBA 2C13A 3W1XA 5HNRA 4O16A 1R46A 4JEQA 3OHIA 3FJ6A 3W7GA 3M6YA 5L9FA 5G5IA 4A2RA 1LBMA 3WFAA 1UJPA 1UBSA 4LOCA 3TC6A 4HSOA 3GZ3A 3W88A 5D33A 2ATSA 1HUVA 4MYAA 1TB3A 3KFTA 4XTDA 1M7PA 3W7LA 3GXNA 1LYXA 4IXHA 1VJIA 3EX3A 1LRNA 1RZMA 3M16A 3UY7A 3DFPA 3N14A 2LLEA 2ZRUA 3TCEA 1SZNA 3HGJA 3ABRA 5I3HA 2PC4A 1XBYA 4A22A 4YXGA 4CNOA 1RVGA 4ZQMA 2HSAA 2A85A 4Y96A 5E0KA 2GVLA 3W23A 3UD6A 4O14A 2VEIA 1OYCA 5AYZA 3OEXA 2Z6JA 4NNAA 2NZLA 3CQ0A 3ELFA 5IM51 4LWWA 4H4IA 4LC6A 4Z1BA 4EVZA 2AGKA 4BF9A 4DPQA 2BLEA 4O19A 4NNBA 1RR2A 1H7XA 3DZ1A 3TSBA 1NF0A 3KHJA 3A5VA 1T0OA 1F6PA 3QPYA 4PA8A 1EUAA 1TV8A 4WD0A 1DV7A 3OA3A 1JJKA 4H3DA 3EX1A 2YYTA 3IVTA 5CSSA 4QITA 4TR9A 2Y89A 3HMJG 4I7VA 3EXTA 4JYEA 2FFCA 5EMUA 1OFBA 2XN0A 2WO5A 3NPVA 4A3UA 3GR7A 5HWMA 2PCQA 3CM4A 4FIQA 1JCYA 4UR7A 4A21A 3QC3A 4M6VA 3L66A 1ME7A 3FKRA 1DHPA 3I65A 3Q58A 5LSMA 3GKFA 4HNVA 8TIMA 3E96A 3NVTA 4CNPA 2C1HA 5KMYA 4UTTC 3LRMA 3EXSA 3G1SA 4FX7A 4WQ6A 3TQKA 3NQDA 4W9TA 4DBDA 2OJPA 1QCWA 3M5VA 4QISA 3O06A 1YPFA 3G0UA 1WOBA 2CLEA 3SJ3A 4AXKA 3OIXA 5DCEA 1TTIA 3BO9A 3FKKA 3NPXA 1GWJA 4UTTA 1XM3A 2YPIA 1X8FA 1RPXA 2E1DA 1SZEA 1XDMA 1JCMP 2YFNA 5CZSA 1WYIA 3QPZA 5F4WA 2CLOA 2GJLA 1H7PA 2BSLA 2E6AA 1EIXA 5FEXA 5LNSA 2JKAA 1XCFA 3FA5A 4HIBA 4UTHA 3KRSA 3TIMA 3N73A 4RCXA 4XBSA 3IGSA 3HG2A 3SGUA 5L6UA 3LB0A 4HN4A 3TFCA 1K8YA 4HKPA 2DZXA 1AW5A 4AVFA 4AH7A 1T96A 1OFDA 5LNRA 5CZJA 2ZZ7A 1KW1A 4A29A 2DZWA 3V75A 3LTPA 3D0CA 4MY1A 3W7KA 3HBLA 3P82A 2QUVA 4NJKA 5FF0A 3PR2A 2DZVA 3NQ6A 3W7RA 3GK0A 3G1YA 1LRTA 2GJNA 4GUGA 4XUGA 3UNDA 4LC8A 4JTIA 4CNNA 1QPNA 1JRCA 5HINA 3BG3A 3W74A 4S2BA 4C1KA 2ABAA 2BX7A 1TTQA 2NLIA 2QCFA 1TPDA 3S5ZA 1I2NA 5G1YA 1MSSA 1KM5A 2ZTJA 2J88A 3N9SA 2ZDRA 2FLIA 2NXIA 2P0OA 4CCCA 4PCFA 3DI0A 3OG3A 1FX6A 2WKJA 1H7RA 4JTGA 1W5NA 4LS0A 2QAFA 1CW2A 3EWYA 4NJIA 1VR6A 4FNPA 1JUBA 3EWBX 3RMJA 2C14A 2Z6IA 3DENA 3PUOA 5AB3A 1VH7A 1GVRA
chains in the Genus database with same CATH superfamily
1B5TA 4GNJA 5I3JA 4W8BA 4GLEA 1L6YA 3VIMA 4V33A 4CVWA 3D46A 3NZRA 3VKJA 3ZR4A 5E0CA 3ATZA 1RP9A 1M01A 5CPSA 3WLIA 2WPBA 4I5XA 2X7VA 4H7VA 1X38A 2CLHA 1WKYA 1ZBCA 3BSMA 5CQ1A 4LANA 2G41A 1HKKA 1QK2A 2VC6A 1JZ2A 2CBUA 1M5WA 4DZ5A 4NZJA 3EB3A 1XXXA 4Y9NA 3R11A 4Y90A 1TPUA 1DIEA 3D3AA 3DBNA 4QCEA 4R85A 2UWFA 3GW3A 4FXJA 3C4UA 1E6NA 3IUIA 4PUUA 1TRDA 1ONXA 2ESCA 1V51A 1POJA 1L8PA 5JUVA 1O6IA 1PL9A 5HWJA 1BVNP 2R94A 4Q33A 3QYSA 5A94A 1H0IA 4RUBA 4ZTXA 3VNKA 5FAGA 1UJQA 1FP9A 1P7TB 1ZFJA 1KD0A 4AF0B 1UWRA 2EEXA 3W07A 4Z2IA 3W4RA 1V5XA 1GONA 1BXBA 1ZHAA 1DEDA 4GINA 2OOGA 1C3FA 3BG9A 5AY7A 1CI1A 2PTXA 1AZ1A 3TZNA 2JK2A 4RV8A 1RA5A 1WDWA 4N9BA 3I7RA 4WSKA 4KWUA 2XFFA 3CB8A 4I9TA 1KA9F 1C93A 3W7EA 2OGYA 3N17A 1FRBA 1VEPA 3K4DA 3F4DA 2B7OA 2XIQA 3IVUA 7REQA 3N12A 1XGEA 4B5WA 2F9RA 2Z1KA 4MNKA 4MUPA 3T8QA 5I24A 4C6LA 4FNUA 7TAAA 4BWLC 1UD4A 3CBWA 1A4MA 1PJ9A 2WZMA 2C1IA 2PDKA 4LF2A 2I9UA 3AYSA 4B2DD 3A24A 3NDYA 3FYYA 4NY2A 3V0TA 5HR7A 3NWRA 2PGRA 2PDHA 4FI4A 1MRQA 1MW0A 2V38A 4ECLA 3ABXA 5CPLA 1E70M 2F7FA 2ZUVA 3CQKA 1R38A 4ZSTA 3TJIA 2TPSA 2RDUA 4DX3A 1KCZA 3BCFA 1HJSA 1SU5A 1WB0A 3STCA 4J3TA 4FB7A 5KITA 3DHFA 3ECQA 3CO4A 3FSUA 2VX5A 1YW1A 4U4MA 4YN5A 3P60A 5FIPA 2HE8A 3QKZA 2WQDA 1RV8A 3H12A 3UQNA 5TAOA 2FTPA 3UYCA 1HO4A 2CKRA 3GR4A 3W2UA 3WBWA 1XRSA 1ZNNA 4PMDA 2HROA 4WX2A 3BMWA 3G1XA 3QMRA 1KGUA 2PMQA 1D7KA 2DEPA 4JHZA 2VENA 2VDGA 3H22A 4KEUA 5HNUA 4O57A 2Z2UA 2GVYA 1EJ7L 4UB9A 1I0BA 1I8JA 3G8RA 4DO5A 4AX7A 2A4AA 4W84A 2JGQA 4GVGA 4IPNB 1F3TA 4PL2A 1OGGA 3W1AA 2NUXA 4UMBA 3U2OA 4ZOBA 5HAOA 4OE7A 2GGIA 1MUMA 3CUIA 1A5BA 5G2IA 4ENLA 5GJPA 1DQXA 3FVMA 4JHMA 1QK0A 2GZXA 1DKWA 4PBFA 2P53A 1A5LC 2TODA 1DIKA 1YTDA 4NSBA 3W1LA 2NW0A 2I56A 4GQQA 3R6IA 4LAUA 4NAFA 3ZFHA 2I7GA 4MB3A 3V18A 2DVUA 2RDWA 3LCXA 4RXFA 1V6WA 3A5FA 3ITVA 4C6CA 3WLPA 1EJSC 4UQCA 3RO6A 3SY8A 3SUSA 4WSJA 3WG6A 1HO1A 4QE4A 5LIUX 2PWUA 1JAEA 1OY0A 4ATWA 3K1DA 2WHLA 2OODA 1ZGDA 3P14A 3PPCA 1DJWA 3SCPA 2C1GA 1MNSA 1OG0A 4IX0A 4Q3MA 3TNBA 1F6KA 4AF0A 3VDAA 4E8DA 4LX4A 3CLWA 4EP8C 3KP0A 4PFHA 1Q2SA 1EC9A 4DJEC 1GOXA 2GK1B 2OOFA 1XL9A 4JTDA 3MDUA 3W7MA 2QCEA 3VOIA 2WWDA 3FCPA 4M6PA 4GH3A 1IXNA 1W1A1 1YX1A 3A4AA 6CGTA 3ONCA 1UOKA 3WBXA 3AJXA 3HJEA 3LGGA 4AZIA 3EDJA 4URIA 2H6RA 4JIEA 3W75A 3B06A 4R9OA 1H1YA 1RALA 3WLRA 4EXAA 3LV6A 3T1GA 1UWQA 1UMLA 3UCCA 1A50A 2Y7GA 1LZOA 2G3NA 1CEOA 3RPMA 3R5EA 4PMVA 3C8NA 3R12A 5FESA 1JZ6A 4F2UA 3NA8A 1W54A 3P8IA 3EBVA 1GQNA 3N3MA 4G9PA 2EKGA 4UOQA 1VLWA 1CXKA 1SUXA 2O7SA 4PUNA 5BRPA 2PGWA 3GTXA 3B04A 4LAKA 5A6SA 1WDQA 1UC4A 1XYFA 4C6PA 4PE8A 1T40A 2NQLA 3T55A 1F61A 4KWVA 4KT2A 5LZLA 1Z7AA 4MB1A 2WSKA 2JEPA 3EYPA 2CWXA 1A4LA 2XUCA 3ALGA 3MP5A 3K8LA 3GXTA 1BWKA 1JUKA 1AH3A 2XFWA 3M0ZA 5CBIA 1VBUA 1G1YA 2J7GA 1E9LA 1CPUA 3LXCA 3WEZA 1ZBVA 5EBUA 4LGXA 1P7TA 4TX8A 3MUCA 1BXCA 2YCLA 3S9ZA 2TAAA 4QG9A 4O15A 3SUTA 3TEVA 1NU5A 5F4SA 3CV7A 4XIMA 4C65A 1TA3B 2D3NA 3VYLA 4CLMA 3S0CA 1KKOA 3AZTA 1UHVA 1OX4B 1PZ1A 2VCBA 2DORA 3URAA 3UXKA 4ATLA 3M0XA 4RDVA 4OTKA 3O63A 1XV8A 3B0PA 3MWCA 1MVYA 4X61A 1FWRA 4Z0SA 1U33A 2VTFA 1WO2A 1YNYA 4HTYA 1VPXA 4MFEA 3QPEA 4B5TA 1BYBA 1E0TA 1P6CA 2FPTA 3DOPA 1DWAM 1C8VA 1Q7ZA 1VC4A 1S38A 4IXXA 5EA9A 1XH1A 1ONRA 4HSNA 1H1ZA 3DHUA 1DQUA 3H2MA 3WQVA 2VWSA 2OQLA 3B9DA 3GU9A 3FK4A 3LXAA 4O4WA 2E3ZA 1YNPA 1RJRA 4DF0A 2ON3A 1IXQA 4KETA 4ICNA 3SN0A 2G97A 4GYPA 4TX9A 3ARWA 2J7DA 1FWNA 1CXIA 3GNPA 3TC3A 4PMQA 2VZOA 4E2BA 3W7IA 3WLKX 4GNVA 4QTGA 1R3SA 2RKXA 3RGTA 2IKIA 3JRKA 2A7PA 4WVXA 5D09A 4BF5A 2EBNA 2NQZA 3LNMA 3IUHA 5ABFA 3USBA 1KFWA 3ARXA 4JTEA 3EDEA 3S3GA 2NT0A 1O1HA 3PJWA 4AYSA 4XD4A 3LV5A 1J5SA 3H2OA 1EZWA 1WKFA 3LQLA 4S3KA 3ZS4A 5AN7A 3IAPA 3GFYA 4W8LA 3DHDA 1IR1A 1OD0A 2E6DA 5DT5A 1MI3A 9XIAA 3GNRA 5F1UA 3PZ9A 2F8QA 3PAJA 3W6LA 3AXXA 3H6OA 4GI4A 1GVIA 4GJ1A 4R53A 3THCA 2CXGA 5FCZA 1JNEA 4R7JA 1G67A 2YKKA 1GOMA 3TR9A 1I4NA 2OKOA 8RUCA 2FDSA 4L64A 4IGSA 1AQFA 1S46A 4MM1A 1PHQA 2X1SA 3CHFA 5H2ZA 2ATMA 1XRTA 1QHZA 1CXFA 3DXIA 3BW4A 3OQEA 3F4VA 5D9OA 2E28A 2WVVA 1F73A 2VP8A 3F03K 4R33A 3VOJA 3E0FA 3RCNA 1L8NA 1TELA 2PZNA 4HGXA 1WKEA 2WSQA 3AIEA 5FF2A 4UOZA 4HK5A 1GJWA 3QQ1A 4NJGA 4JY9A 1CZ1A 3S1UA 2CERA 3G3DA 1H62A 4UFMA 3EOEA 1XBXA 4KW2A 2J24A 3U2ZA 4I8YA 3EEZA 1OGBA 2WZIA 4GXWA 5FEZA 3NR0A 4L1XA 3DYPA 3MBDA 3O07A 4ZE4A 1Y5VA 2VURA 4PB5A 4F0HA 3O15A 1WOAA 2QV4A 4XKYB 3RU6A 1BRLA 3PG9A 4Q8VA 1EP3A 4FXFA 4GVIA 1N8WA 4DUOA 1J11A 1SO4A 1Q2RA 4PGLA 2QJGA 7A3HA 5A8MA 4FOUA 1GG1A 1NWSA 3T40A 3C0QA 2BY0A 3VNYA 2AAAA 2HXTA 4AIOA 1F8IA 2P5NA 1WV2A 2ZWZA 4KERA 1EJXC 5IBXC 4ZQCA 3WDQA 4MY9A 3KTSA 3VCNA 2AQWA 5G1MA 3WD0A 4NASA 1OM0A 2DZBA 3N15A 4LQ1A 2WK2A 1EH9A 3SGGA 2QCCA 1GUVA 1JYWA 1W0MA 3IRSA 8CGTA 4EAYA 1JPHA 1AL7A 3D6NA 3NL6A 3N19B 4IG2A 4TV5A 3LCWA 4GE8A 1V0KA 1VBRA 3BGJA 1UKTA 1ZCOA 4JTAA 3VIKA 3V7PA 1W1TA 3VUSA 5K4ZA 2FZMA 2AOSA 1N55A 3KVMA 3WLOA 1MDRA 3WQCA 1KGXA 2E8YA 4ZEPA 4O0QA 3PM6A 3PSWA 4AEEA 3C6CA 4RDWA 5D4YA 4GZJA 1QW8A 1E15A 2Q8ZA 2AMGA 1OSEA 4FR1A 4FIRA 3M5XA 2NQ5A 3NURA 2EKCA 2WBKA 2ZYFA 5I02A 1Z3NA 4H7CA 4JOMA 2UY3A 4HK7A 2H3DA 4QXIA 5G2HA 5CG0A 4PBEA 2PDMA 4ZFMA 2Q3OA 3FAXA 3R4IA 2E9BA 3ME3A 1Q7MA 1G69A 3L23A 3AYVA 5D02A 3NYZA 5DRCA 3TYBA 1FWCC 3THQA 1EJVC 3LY0A 3UCQA 4B5NA 3RM9A 3Q94A 3S83A 1I45A 5C9ZA 5KINA 2PLJA 2AKZA 4G7EB 3WMSA 2EGZA 4D1IA 3GTFA 3WLNA 2QJHA 2OSXA 5C5YA 2E5BA 5I77A 2IXUA 3A4JA 3MDWA 1X1OA 5DLCA 1TJRA 1HJWA 3L4TA 1PV8A 4JGDA 1W2VA 1MW3A 4AZCB 1J5TA 4UTJA 2VVNA 4I9AA 1R47A 3S1GA 3AALA 4BY3A 1PYMA 4NX5A 3KOZA 1FUYA 1VHNA 4WY0A 3TLQA 2Y6ZA 1M3UA 3CZLA 3A23A 2HVOA 1XLLA 4LVAA 1JCLA 1L2QA 3G5EA 3KVLA 1U83A 4JCLA 1ITXA 4QG8A 3ITTA 5EKYA 2QVNA 4LS2A 1TQXA 3R1ZA 1VENA 1YADA 3C52A 1BVZA 1FDJA 1WDPA 4CQDA 1XYCA 1TQJA 1HP4A 5CBJA 1V3IA 2E77A 1QNRA 2Y7EA 4IMCA 2V5BA 1EFZA 5ECUA 1XX1A 3HB9A 1PE1A 3ZVHB 3NQ8A 4ZO7A 1HL2A 3RLVA 1W56A 1VFUA 2OLHA 4RW5A 1G6CA 3UWZA 5AHIA 1WUFA 2WLZA 4Q4OA 2ZKMX 4ZO6A 4KRUA 3N2TA 4IPJA 6REQB 2VR5A 3ENLA 4NAFB 1TJ1A 3W2NA 5DF0A 5E6ZA 1E6XM 5C0QA 1FQ0A 1XCXA 4LVGA 3VIHA 4KFNA 4AQLA 1GVOA 4AWSA 1FTXA 1XKJA 3ANYA 3F4WA 4DWSC 2YXOA 1KCXA 4H7ZA 4A8LA 4UC5A 3KVJA 5F2GA 1FDYA 4QROA 4M56A 3KCJA 2BB0A 5E5CA 1P4CA 4MUZA 1BQCA 4FNRA 5FJIA 3UWUA 4CEUC 1TREA 1VFSA 3MP3A 3ARQA 2J77A 4ADTA 1RQEA 1J12A 3PC0A 4TMBA 1SW0A 2E5DA 4QJ1A 5BXSA 2FJKA 1GW1A 4LYPA 3N4FA 4LAMA 2L5HA 2YLLA 4OV4A 1JGMA 2HNHA 4LPCA 5CC5A 2BY2A 2V5KA 2UZ9A 4HHLA 1C91A 3CK5A 4E8GA 1XICA 1TPH1 3AJ7A 1UD6A 1HGYA 4LUTA 3TQVA 1XFCA 4XISA 3G6LA 3VIIA 2YLAA 1A80A 1LWHA 3PJXA 2ACRA 2F38A 1XG3A 1DXIA 1HJVA 5BRBA 3UZWA 3GDMA 1DOSA 1W31A 1I0DA 2ACSA 1XDLA 3H7UA 5DT7A 1SZRA 3MSYA 2VGIA 3TXZA 3ZOAA 3G1DA 3HA1A 4WK9A 4DWSD 3BH4A 3UXIA 4E8CA 2VOTA 4QAWA 3T6CA 3P5ZA 3U5UA 4M3PA 4DJFD 4LAOA 3IVSA 3LPGA 1KV8A 2JIEA 2F2HA 3E2VA 4CQ9A 2BY1A 1G0CA 2VRJA 3U2EA 1RSCA 3VOCA 4BFAA 1BYDA 4FP1A 2A7RA 2W9MA 1N7KA 2YCIX 2QAPA 5FA5A 4GI8A 1QBAA 4FOJA 4E38A 1SQ7A 4S3GA 4IM4A 3VM5A 4POCA 2YL8A 1OJXA 4N02A 4LUTB 2ZCGA 4AWEA 2NT1A 2A3CA 4PUDA 1DXFA 4R34A 1ZU8A 4O17A 1TFVA 2GSJA 1MXDA 1SPQA 3V35A 4Y9AA 1QOPA 1TKKA 3U3HA 4HPJA 1DQWA 4DIAA 2FZBA 4S3DA 1SYTA 3NGJA 1DJHA 2V5JA 3GXFA 1RP8A 2YIHA 1R86A 2DZUA 4H83A 1QPRA 4HPGA 1DE6A 4MFDA 3QR3A 3IJLA 4AZ5A 4RE2A 1QT1A 1H5VA 2FYMA 2Y85A 3MCMA 1W5PA 1F07A 2DJXA 2RJHA 2GVJA 4YWIA 2VR2A 4JEJA 1WQ5A 1K9EA 4JKMA 3QW3A 3RN6A 3L5MA 4KWOA 1PKNA 4KEMA 4MDOA 1BQGA 4LVDA 4OIFA 5BZAA 3KCOA 2I5GA 5CC7A 3TYCA 1GW9A 3F1QA 4L6DA 1GVFA 4NT0A 2F2KA 3JZUA 1OFPA 3W22A 4CEXC 1QAPA 2CZDA 3EWZA 2EG8A 4ROPA 1XLHA 4C90A 3BICA 4AIEA 1MQRA 3WBAA 2OX4A 2IKHA 1MXGA 5C54A 1H63A 2EJ1A 1DPMA 1HKWA 4HN8A 5GJMA 2WMFA 2QCDA 1EGZA 2P50A 5DFAA 1QFEA 3PWAA 4LU0A 3D3FA 2HCVA 4IQJA 1V6XA 3XISA 4H6QA 2BP1A 3P67A 3M44A 1OABA 5A1AA 4L56A 1B54A 3GBEA 1HJUA 1XIMA 1GZ1A 4FXSA 3KS6A 3LRLA 1LF1A 1AZ2A 1UUMA 4MMWA 4EPBC 4L65A 4HMCA 4UUIA 1TJ0A 4LV4A 1TTPA 2H8XA 4NG3A 5HMFA 1VB9A 1Z48A 1SO3A 1NWUA 3AUJA 3EDKA 3OLEA 5HUOA 1XFBA 3TFXA 1GNXA 3UWVA 4PUEA 2J78A 3SUWA 3K5XA 2IUZA 2J7HA 5A6KA 2YGYA 2IPFA 4RR4A 4U28A 4J7RA 1H50A 2CEQA 1KR0A 3MC5A 2WM1A 3ARUA 1PWMA 4OOZA 2W6RA 2NVDA 1EHNA 3IJ9A 4MWAB 5CGMA 4A6GA 1NSJA 4NAEA 2NX3A 4O10A 4PTDA 4HPHA 4PUKA 4PYSA 3FGCB 4UNLA 4L9ZA 3SQLA 3KE0A 3R0UA 4GBDA 2ZZ1A 1S3HA 2X41A 3C2EA 1J79A 2GJXA 3KOXA 4W85A 1WZKA 4XSLA 1AL8A 1B0IA 3H24A 4PTWA 5JBFA 1DJNA 5FJTA 4F48A 4DJEA 5TIMA 4AZ6A 5H1WA 3CUJA 3QFEA 1S5TA 3WEOA 1JZ4A 4IICA 3H53A 2V3FA 4BHYA 3GAYA 2D22A 2V3GA 1R3YA 1T8XA 2XVKA 2PSNA 4K7VA 3EX6A 2O7QA 1E6PA 3VKBA 3WNLA 4YTUA 5FJUA 4B16A 2YOCA 5IDZA 2VDIA 3H2EA 2VFGA 2HNEA 3R25A 4FNTA 1UD2A 1UP0A 2XFRA 3I6EA 1KLZA 2BTMA 4IP7A 1LBFA 3GC4A 5M1TA 3PAOA 5D2VA 5HJLA 2J8FA 4AZBA 2PDYA 2DT2A 3BQ5A 4HA3A 5BU6A 1VEMA 5H8MA 2C6QA 1P5BA 3P6LA 4OQVA 2CPUA 3O3RA 3WSUA 2QDEA 1BKSA 1TCDA 3R43A 3ICJA 1G5AA 4M1RA 2PDIA 3S6TA 1W3TA 5I09A 4KEVA 3SUVA 2J7FA 4HP5A 3AS2A 5DX7A 2Z24A 1M65A 4OBRA 3W7QA 3TQPA 3LYEA 4HT3A 1FWBC 5AYBA 3RCMA 1JAKA 1V6UA 1TSIA 3EEGA 3B3DA 1LM1A 2MNRA 5I3KA 3LQGA 1A3XA 1I2QA 4GC3A 4AD2A 4E4FA 2BG5A 4V2XA 2PP1A 4MNLA 3PBWA 1G4TA 4WJ8A 3CMGA 3AMDA 3ABSA 2GGEA 3S1XA 5CPMA 1S2VA 2HVNA 6ENLA 3WIJA 3O6YX 5KZ6A 3KWXA 1OF8A 2B0MA 1PS9A 3RCYA 3SECA 4ZODA 3ZZ1A 3W71A 3AIBA 1KFBA 4HYRA 4JFVA 1E6QM 3WFZA 4IIEA 1BTCA 4KCVA 4LOCA 3W88A 2VCCA 2ATSA 2G3IA 1TB3A 1VJZA 4GZ7A 3GXNA 4IXHA 4WIWA 1IQ8A 4PUMA 3UZYA 4NHVA 3ARPA 3M16A 3UY7A 2O55A 1SZNA 3UJRA 2O0TA 2IMRA 3RXZA 4YXGA 1RVGA 2X1IA 2HSAA 2A85A 4L80A 2ACUA 3U2CA 1I6NA 1UZHA 3MY9A 3ALFA 1W9DM 3GWQA 2WXDM 1YE6A 3GUWA 4H4IA 4CN1A 3UJEA 2BLEA 3BAXA 4AZHA 4NNBA 1C90A 3O0KA 2DT3A 2OWXA 2ZOXA 3OGRA 4H9TA 1M7JA 3ZVHA 5DMLA 3II1A 1TV8A 2IPJA 1DV7A 1EYEA 4H3DA 3ZT5A 2YYTA 4PCNA 1K6AA 4N7QA 3WMLA 2R1PA 3NJ3A 1CENA 1MWOA 3HMJG 1DWGM 2FZ8A 2ZICA 4HJWA 1BKHA 4R9XA 3BMVA 1H0GA 3K4WA 3CM4A 3QC3A 3UPMA 1RK6A 4I9MA 1KXTA 1DXEA 2OZTA 1A3HA 1JPMA 2C1HA 5KMYA 1TMLA 3MS8A 4ZOAA 3BOXA 2ZXBA 4J40A 3NQDA 4IISA 2OJPA 3UJSA 3AAMA 4H8NA 1U5HA 3VX1A 4J3XA 4D9PA 3OIXA 3WH5A 5DCEA 1XM3A 2YPIA 7XIMA 2X8RA 2ZUNA 2E1DA 4IG2B 1P6BA 4P7NA 2ZUUA 1WYIA 2WC7A 3RR4A 2CLOA 3GNOA 2GJLA 2E6AA 1EIXA 3N1AA 2JKAA 2HK0A 2Z1SA 1W1B1 3FA5A 4PB3A 3TIMA 3DX5A 1HIZA 3LB0A 2VWTA 1EBGA 2E0PA 4JL1A 4UTFA 1HL8A 4R5EA 2DZXA 4AH7A 1TE1A 2YA2A 5LNRA 2CHRA 5HJYA 2WANA 4DY1A 2DZWA 3K13A 1V3KA 3P82A 3NQ6A 1Z69A 2X0HA 3B8SA 5FAJA 1W1IE 4REQA 3VCCA 2GUYA 4LC8A 1X7IA 3WUBA 1JRCA 1OIFA 2ABAA 2BX7A 3GHRA 2QCFA 3AIVA 1S2CA 5M2FX 1IWPA 1MSSA 2ZTJA 4HMDA 3N9SA 4X0NA 2FLIA 2NXIA 2OXNA 2EPMX 3VD5A 1H7RA 4DUXA 2JIWA 1LWJA 1JUBA 4FNPA 3QOMA 3EWBX 2CZVA 2QS8A 2C14A 4H8UA 1J96A 2OYLA 1O68A 1UC5A 1GVRA 4EWND 3KBVA 3M46A 4I6VA 1OCJA 1T8QA 2WLYA 3R8GA 1JZ3A 4JX4A 3CYJA 3B9OA 5FACA 4LV9A 4BI5A 2Y62A 3QV6A 4HD5A 1UZDA 3MI6A 1KR1A 3PWGA 3TP4A 2BHUA 4NYUA 1OFRA 4B2DA 4UTKA 1TUFA 2J13A 5AECA 1XLMA 1AW2A 4IHCA 3REQB 4FX8A 2NQ9A 3MKVA 3WEMA 1DTUA 3MQTA 5A95A 5H8PA 5FI8A 4M0XA 3OA5A 1J0YA 3PZIA 4PMUA 1D2KA 4AUBA 1C8XA 2OO0A 1H11A 4FF5A 3EZ4A 1HKVA 2HPMA 1B9ZA 1K8XA 1R2RA 4CKQA 2DUZA 1M9HA 1TMHA 2A3LA 3IPWA 5KTLA 4Q8QA 3TE9A 4KBXA 4E6MA 1D3CA 4Y8FA 4Q6XA 3UETA 3L2IA 4H9ZA 3TNOA 3W73A 4JCMA 3INPA 3WD3A 3MUIA 3EKLA 1PIGA 1JD9A 4P7OA 1AK5A 2PGFA 5D30A 2PDXA 5H91A 3EPMA 2CNCA 1J01A 4WXYA 3NTYA 3G3MA 4TXEA 3PNZA 1BAGA 1KB3A 3S1VA 2NX9A 1K02A 3PJUA 3UA3A 3QZEA 2YZRA 5T9BG 1LDCA 1PKMA 1V3MA 4Y6GA 3O6CA 2PRMA 1GPWA 4R27A 3I3BA 1ZJBA 2CFFA 2W79A 3GRIA 2CHOA 3IAQA 4MF4A 1BPLB 3WBYA 3QMTA 3LPPA 3MMTA 4E3VA 3W38A 2GPTA 4DBWA 1IZKA 1R30A 3VD7A 3CWOX 1FWIC 3BTNA 4OT7A 1HKJA 3KBMA 2ZBTA 4L5ZA 4MKNA 3F2DA 4OVXA 3KOWA 5F2IA 3W24A 5G4EA 4M8UA 4KFOA 3NOEA 4REQB 1E4LA 3IGUA 4WR3A 1A5CA 4BF7A 1X6UA 1YDNA 4PRTA 1TIMA 1YKWA 4XWUA 4KIRA 3OVQA 2VD9A 2Y5EA 1ISVA 1T6MA 1LL7A 3GR8A 1UUOA 2IQDA 1UZ4A 1VFLA 4HU0A 4MWAC 3NQAA 1EL3A 5A8QA 1B2YA 3N2MA 1TA3A 2YW3A 1W3JA 4G7EA 1LLZA 1G7UA 1Q6EA 1BF2A 3AHYA 3R10A 2I17A 3SJNA 4V28A 1DTNA 3CAWA 4NAEB 1KCKA 5D2WA 3UWYA 3M0KA 2IQ0A 4B5VA 2PD5A 1XC6A 1NAL1 2ZRXA 1PCKA 2GWNA 2QF7A 2WCAA 4F0MA 3J7HA 1R7AA 1CWYA 2G3MA 3DGRA 4Z1DA 3MMDA 5CPOA 1M7XA 3TZFA 1KCLA 4IPIA 3RUBL 1E0WA 3HQOA 1FXQA 1TZZA 3T2OA 3NQBA 3SFWA 5MF5A 1J0ZA 2ZWYA 3DDMA 3WDIA 3U7VA 4GO8A 3QFWA 1X7FA 1QHPA 2PAJA 3ITYA 1ICQA 1OG6A 3UG8A 1FH9A 4ORMA 3HPXA 2WYSA 4LUJA 3UR5A 4NVTA 5MHBA 4QRNA 4IQDA 4ADUA 3ITOA 4E2DA 1J6OA 1MW1A 2EO7A 2PF8A 4XIAA 4J28A 2A6NA 3KL5A 1US2A 3JW7A 4CCEA 1IGSA 2FH8A 4HCLA 3BC9A 3LZ3A 3LS9A 3F4CA 3VVGA 4UFKA 4FLOA 1XQKA 3CIWA 3PVFA 3QGAC 1W5MA 2CWNA 4UQAA 5TNVA 1R2SA 5DO8A 3WCZA 2BODX 3BMXA 3DFNA 3TU9A 1OWQA 2VGGA 2O9OA 3S2NA 2FQIA 5D8WA 2EG7A 2VRKA 4AEFA 2CLPA 4IMAA 2DQXA 2J6VA 1EEXA 1WX0A 1WAUA 2Y70A 4JIIX 3MU7A 1EWEA 2E8ZA 5I78A 1PHWA 3VGGA 4GZEA 4JIPA 3KUMA 4PTMA 3UNTA 1V7AA 1WDSA 3OPSA 1G9HA 4UOJA 4H41A 2FHCA 3HOJA 3A21A 4GVFA 2PDWA 3FEMA 4ZQPA 2ASHA 3RRXA 3MANA 3L7RA 5LIXX 3LM3A 2VX6A 1LOQA 3VZYA 3K8MA 1P0DA 4DELA 4WUIA 3E2QA 4O50A 1K9FA 1UYQA 4TTGA 1W8SA 5FJRA 3EKZA 2A2IA 2C19A 4K8EA 3COTA 1S5NA 1C29A 5M3WA 2GL5A 2ZA1A 3SR7A 2CCRA 3U5YA 1J18A 3M5ZA 4QX4A 3C0SA 1NWRA 2WZTA 4KWSA 2XSXA 4HOWA 3V1PA 3VNZA 1Q7QA 1E6RA 1E4MM 3M0JA 3W85A 1RQHA 4A3QA 5AFDA 5JH2A 3EWDA 3EXRA 3WDHA 2VEFA 3N3TA 3DN5A 3ERPA 1V02E 2Y5JA 3NPUA 1FWWA 1NIUA 4GUHA 3DHPA 4AC1X 1O95A 2V8ZA 2CLKA 4EXBA 4JTKA 3FFSA 4JTSA 3DG7A 5I3GA 3TMQA 1W9UA 2W0UA 5LXEA 4E3TA 2C0AA 4YVVA 1A5KC 3OYXA 1ZP4A 3TYAA 3QV9A 4LVBA 4FNSA 1ENUA 5E93A 4JTLA 4H9UA 1AJ2A 3TSMA 5I07A 3HQNA 4MPQA 3EMCA 2WPGA 3VGFA 4Z1AA 2CZ5A 3GIPA 1JI2A 1W9BM 2PZ0A 2VZTA 3QHOA 1O5KA 4RLIA 2GWGA 1FWJC 2V69A 4JS3A 2HDJA 3M0IA 2GUBA 2PBGA 5DN1A 4B15A 3SBFA 3QYQA 4GPNA 4B5UA 3SFKA 3RK8A 2REQB 2BDQA 1RCQA 2R1KA 1HN1A 1REQB 3AXHA 1BWVA 4GABA 4KS0A 4GI9A 4K38A 1ADOA 4M6UA 4RW3A 1PB0A 3WNOA 1UWUA 1IR2A 3KAOA 4IQLA 3FJ4A 2XINA 1DE5A 3NO5A 2X05A 1EUNA 5GPRA 3PG8A 4XBJA 3BSGA 1O7AA 2YW4A 3NZGA 3CLMA 3IIZA 4GD0A 2QCLA 3CAVA 4K1WA 1XG4A 4N6FA 4AZCA 2NXHA 3PUGA 5DBUA 1K8CA 1UP2A 1E0VA 2QXWA 1OGSA 3TCSA 2QJIA 4DF1A 5DXYA 4NILA 1IIGA 4S39A 5LIKX 4LBRA 2OWCA 3SY1A 1Q45A 3R7MA 2JFEX 1MO0A 1KQYA 1V03A 1I2OA 2E40A 1ZAHA 1A47A 1CDGA 3ZR6A 3CIVA 4MKSA 2O56A 3E6EA 1O5RA 1JQVA 3OLDA 3PFRA 3PZVA 1A5UA 1W8GA 3HN3A 2YXGA 4EX4A 4IUOA 1ZTVA 4UCFA 1WA3A 5EU9A 3G77A 4TVCA 2GOKA 3LBMA 2QCGA 1LP6A 3FA3A 2CESA 3F5LA 1XLEA 5CSRA 4JQ4A 4YTTA 1W1VA 3H26A 3G1RA 3W1UA 1NQKA 1D8CA 4CQAA 2XZ7A 4D6GA 2YB4A 1ELSA 3NO3A 3NYDA 2XYLA 3W2LA 1V3HA 3WYZA 2AQOA 4YHEA 3KCLA 5E1QA 3VFLA 2PDUA 2ZDSA 1OYAA 1R8LA 2PURA 4XZWA 3KOYA 3SY5A 4I9JA 1MEHA 1PZ2A 3VA8A 4WXZA 3OZYA 7PTDA 2WVTA 4AD5A 4IFKA 4RKAA 1IT8A 5A3HA 4PFMA 1BWLA 3L9CA 3TTEA 3PZQA 4OU1A 1OZMA 4WHBA 2YL5A 4F0RA 2POZA 4S1FA 2BWGA 5JBDA 2VOMA 1GKRA 3CTTA 3PTDA 5T9CE 3LLDA 2W66A 4QGCA 1PCWA 3O9NA 2OVLA 5G4WA 1QWKA 3G1AA 3EX4A 3PBVA 3NQMA 2IXVA 4OHQA 1ODUA 1J8VA 2WCSA 2DDXA 1G4EA 4G6CA 3NVDA 3GBDA 2GOUA 5A8GA 3F4NA 4LW7A 4DNHA 3TJ4A 4DBUA 1DP0A 1V02A 4QE5A 5AZ1A 1TJPA 1Z41A 2ZA2A 3CZJA 1TZ7A 4GA8A 3AHZA 1RAKA 2JGYA 1KTNA 2CBVA 4GUIA 3DCPA 1JPIA 3BLEA 3DH7A 1NF7A 3MV11 5FL1A 5FF3A 4IIBA 1NH6A 3V36A 4LUSB 1ICSA 3MI3A 5DRIA 3SN4A 3E5PA 4GOAA 5ABFB 4H9MA 4P8XA 3WNMA 2O9RA 4DZIA 3B0YA 4H2HA 1IT7A 1OVDA 4RNFA 1CBGA 4Q8NA 1GJPA 5KZMA 3OOQA 3VIOA 1R9ZA 3LI0A 4E0CA 5BXTA 4DO7A 4Y7EA 4PCPA 4CNUA 3CMFA 1M1BA 6XIAA 3BGGA 1UKSA 4F9DA 2A0NA 4IIHA 4D71A 4J3WA 3UWWA 1UOZA 3W00A 3PTQA 1W5QA 3AHTA 3VXGA 1EF3A 1OK6A 2DT1A 1LOLA 1A5NC 5A6TC 1JQXA 1XGDA 4C5YA 4EPKA 3CV1A 5DCDA 1F8MA 1VBHA 1E40A 3BLPX 1AJZA 1GEHA 1CYGA 4W88A 1EXPA 1CLKA 2OPJA 3CL7A 3PTMA 2V9DA 1RY0A 3PTKA 2J9XA 3TYUA 3R8RA 2INZA 5C9UA 3AROA 1YXDA 4R7WA 4UR8A 1B90A 4GYJA 3ZIZA 1F74A 3AMLA 1KBJA 2X0YA 3CO8A 3A9IA 3BOLA 2C7FA 1EDTA 1MRAA 4O1EA 1AA1B 3N2CA 1DJQA 4GFSA 4GMEA 4J3ZA 4XTIA 4C1NB 1HW6A 4ILSA 4HMNA 2ZTKA 3H2AA 4QDPA 2AQVA 1QVBA 4F0LA 5BU9A 4J2PA 2A6LA 3UG5A 1HVXA 5BMWA 1LROA 5AOUA 1SFJA 3LLXA 1H5YA 4KEZA 2P0IA 3AICA 3M41A 3N2BA 1DVJA 1BRLB 1TJ2A 3GG1A 1GJUA 1Z6KA 4DVOA 2QKFA 3P2VA 3NL3A 3T81A 4HSHA 4ROQA 4WCJA 2VGFA 4J35A 4RNJA 1XIFA 4QJ5B 2BVTA 5HQMA 2E7FA 3S5NA 5DY3A 4ZCWA 3IANA 4IGHA 2Q8XA 4Q4KA 4F40A 4CCDA 5I23A 1QPOA 2D2JA 2VC9A 2BY3A 3B8VA 4UR9A 1CB7B 4XZNX 1RCXB 2QEZA 3E49A 4WOZA 1OX6A 1B4KA 1J2WA 4TTUA 2FHFA 4C6DA 3NNTA 1ZENA 2AAMA 2INEA 1YDOA 3U57A 1EXBA 5EMMA 1XIJA 1BSIA 4QG6A 1ZAIA 1OK4A 1XLJA 4PUWA 3CC1A 1V3LA 4Q8UA 5J8LA 1N82A 3S9YA 1YTEA 2PU0A 3T0CA 4DUWA 2PGEA 1FHUA 2JKEA 4AD4A 3STGA 3FVDA 4ACZB 5HK4A 4B3KA 4GYFA 3OGSA 3N6JA 1V0MA 3P61A 4R88A 1UASA 3DECA 2PC8A 4Q6JA 1E3ZA 3VUPA 1JXJA 3WN6A 4O8AA 1E43A 4ERAA 5BOEA 3VC6A 1Q8JA 4JTUA 2VR4A 5DEZA 4H1ZA 4UMCA 2WZHA 1G4PA 4B9ZA 1U5JA 4XBKA 1NEYA 3FHAA 2PEVA 3BAJA 2BBFA 4HNOA 2OZ0A 3W7HA 4JTFA 4UTMA 2D20A 2YYUA 1FHLA 2ISVA 4DYEA 4CD5A 1XLAA 4B5XA 1QNQA 3HF3A 3UU0A 4I7WA 1Y65A 3AUOA 2ZUWA 1TR9A 2NQJA 5E0FA 3MZ2A 2HMCA 4NZCA 3W7PA 4D6CA 3WMBA 5A6LA 1KQZA 4KCTA 5FF4A 1SO5A 4W87A 1UPPA 2RHGA 4FO4A 1SVDA 4L4MA 3SQSA 4ACZA 1BG4A 3ONBA 2RJGA 1XKYA 4LCSA 4MB4A 4MZ1A 4ZQRA 1XIGA 2Y63A 2D2HA 2Z7KA 5C6MA 3NSMA 3QY7A 5DBTA 3VAVA 2WC4A 5CXPA 2FFIA 1XINA 2NX1A 2OO6A 4INFA 3L4UA 3MV01 5REQA 3GM8A 2HPIA 4IZGA 1A0CA 1AD1A 1Z32X 4GVHA 2EQDA 5XIAA 3ISIX 3L0KA 1TYGA 1EKOA 3UGVA 4PL1A 2VYOA 4K68A 4BI7A 1Z42A 3SI9A 4PMNA 1XUUA 1F05A 1ZP3A 2E5CA 3L4ZA 4XQ6A 4F8XA 3MVTA 3B0VC 1LUCB 1YLVA 4UTUA 4P61A 2GGJA 4UNKA 1JDDA 3VE9A 4KGLA 4BEQA 3GVQA 3RFAA 2DW7A 2A1YA 4U3AA 4LRSA 4CUCA 3AWOA 3GC2A 1XHGA 4IJRA 3KOFA 3MHFA 2VX7A 1W6TA 3ZM8A 4C7GA 3QC0A 4A8NA 4Z0JA 3GVGA 1RD5A 3SADA 4UCGA 3VOGA 3HGSA 3GVRA 1GT8A 2O9TA 4N9DA 2WW5A 5D37A 1W37A 2OT0A 3WLLA 4IP5A 1H3GA 3I4EA 4X2PA 3KTCA 4Q7IA 1C9DA 8A3HA 3TC7A 4AU0A 3NZPA 4AWTA 4LT9A 1XH2A 5EMYA 4UQ9A 1ITQA 2Z2AA 4OUEA 1RHCA 2V68A 2WV8A 4H8HA 3ZJKA 1UG6A 3KX6A 4IGMA 3DI1A 1UQZA 4M80A 4FA3A 5M5DA 3JZEA 5BW6A 2V67A 4JHOA 5I06A 1BXNA 3VGHA 1YMYA 4Z2KA 3CUGA 4Y9MA 3W7OA 1E5JA 3TONA 1KLYA 3MW7A 2PTZA 3BZJA 5BYWA 3G2GA 3L68A 4NX0A 3FOKA 4A3RA 3S42A 3WUFA 2HZGA 2WMJA 3WQGA 2PDNA 5T91A 4KKXA 3URNA 4F2BA 1EQPA 2GQ3A 1F3EA 3IGXA 3A3WA 5AKQA 3HPAA 1W3NA 5CH9A 4KESA 4ZR8A 4DYJA 1IXPA 2PCEA 1J0KA 4A4AA 3H7RA 3B0UX 3MPGA 3OG2A 1HP5A 2R24A 3PHAA 3ES7A 4K37A 1ZB5A 5B7ZA 5CC3A 3N04A 3O16A 4ASTA 1PBGA 1POKA 3GHTA 2OB3A 2J9YA 5D2YA 4IX2A 5A6BA 4CQCA 4XV0A 4IQEA 1L6FA 4UFIA 2CHNA 4JFTA 4B3ZA 1TIWA 4YCPA 3G18A 4JTHA 3RLUA 4L4PA 2XVGA 2YDRA 1OFOA 1H2JA 3H8AA 4KRZA 1B1YA 3HG4A 4PSPA 4PZVA 2DUAA 2X7WA 1KM0A 1LBLA 1GHSA 1DJYA 1GOQA 2B7NA 1YTKA 2XFYA 1VRDA 2NQHA 2QDHA 4ZTYA 2RH9A 3I68A 5AHMA 3MHUA 1MW2A 2PS2A 3B8IA 3E74A 3ORWA 3S2JA 1BG9A 4IP4A 1RUSA 1JZ7A 3FY1A 2X1UA 3T07A 4E2VA 3IJ6A 2QW5A 4CNTA 1AFSA 1KFCA 4XK2A 3CWNA 3GB6A 3ZSSA 2R8WA 3T09A 3GXPA 1GYMA 4ZENA 1TO3A 1Q6QA 4YLWA 1XSKA 3WFLA 3RHGA 1TPFA 3PNUA 2OCZA 3C56A 3TW6A 2ZRWA 4X60A 5CG7A 1GQIA 4HZ7A 4JR5A 2XIMA 3ES8A 4FOKA 4XO7A 3UZZA 3LNPA 1JZ8A 3DFOA 4HZ6A 1ZZMA 2OMAA 4YL2A 1AVAA 1AH0A 2BGQA 3C2OA 1PWLA 4HNTA 1WPCA 1UD5A 5I3IA 1DORA 4J3VA 1QI0A 3MYOA 2X1TA 5D8ZA 1KWGA 3M47A 1VD6A 4RJEA 3ZLFA 3SQMA 5K9XA 3G1FA 1X96A 3R0DA 3LLFA 1Q63A 4H9VA 4U2ZA 3CYVA 4I5RA 3ZJ8A 4EAMA 1GHRA 1KM3A 1G7VA 1FCUA 3HFYA 3GE7A 2OU4A 2G50A 2A21A 3LENA 3MJMA 2DUXA 1RBAA 4E4PA 5K9CA 1O60A 3ZLGA 3LUTA 3AHXA 1I2RA 5M17A 4OKDA 4HJFA 3U48A 4C6MA 3ARTA 2ZXDA 1TVNA 4M81A 1B3ZA 2A5HA 1KNWA 2B7QA 3DFYA 4ORIA 4J3SA 3LSCA 3PJTA 2GDUA 4GJJA 4K8GA 1V4YA 1DIOA 3SB0A 3ZWTA 4BJHA 4D2JA 3M6DA 4MYXA 3GG0A 1F7BA 1IT0A 3NQGA 1OX4A 1H4PA 1W2PA 2E67A 2F84A 4O8RA 2PPGA 3KZSA 3WQFA 4RDYA 5F2MA 3AO0A 1I9CB 5I00A 2KAUC 3HGRA 1DJXA 3VNJA 2YCEA 2JE8A 3QHNA 1E1CA 4WY0F 1XP3A 1UUQA 4TOQA 3CUZA 1NOWA 4LY4A 5CKSA 2VXNA 4TIMA 1PDYA 4HK6A 4F79A 5K2ZA 1BSLA 3S1WA 4RPQA 2ISFA 2E1WA 2YDAA 4LALA 1EDQA 4BKNA 3WKZA 1MYRA 2QCDB 1EOMA 1QO5A 5BROA 3WMCA 3I3DA 2E6FA 4P8VA 1EP2A 4UQEA 3TR2A 1HVQA 1MDLA 2X30A 3QZAA 3MZNA 4FR6A 4YTSA 3APGA 1JR1A 1ISXA 4HBKA 2REQA 4OWGA 2INFA 2YL9A 4ONVA 3AU6A 5HMEA 2J7EA 2Y8KA 1VHCA 2Q09A 3EGJA 2PRHA 3AC0A 3MUY1 3WH7A 3AS3A 3NL5A 3KBWA 2GUUA 3E9AA 4WKFA 1RD6A 1TV7A 4HHPA 4UTLA 4XAPA 5EFDA 3UG4A 1VBJA 4GYPC 1ICPA 1Y7VA 1VPYA 4EF9A 1DHKA 3IIVA 1UWIA 4TUFA 2C13A 2ONEA 3W1XA 3FJ6A 3S2CA 3M6YA 3PZNA 5L9FA 4QSFA 3BV7A 1PYFA 3TC6A 3WF0A 4HSOA 3GZ3A 2QMKA 3VDGA 3A4XA 1SJAA 2Q6ZA 4Z1YA 3SAZA 1ADDA 2YA1A 4ZB0A 2O9PA 3EB4A 5HJXA 4V15A 3ARYA 2AGTA 2VZVA 1LRNA 1CCWB 5B80A 4RPPA 3TOYA 3VKCA 2CETA 3A64A 5CCZA 4J1OA 3GYCA 4ZB2A 1XBYA 3P3BA 1E1EA 4L1GA 2FGLA 3BLLA 4Y96A 4O14A 2VEIA 1OYCA 3AS1A 3OEXA 1ZBWA 1E9IA 7REQB 1US3A 3CQ0A 3ELFA 4GY7A 4F3HA 5IM51 4LC6A 3DERA 4Z1BA 1JD7A 4DJDA 1SM9A 1YBQB 5ENLA 3DZ1A 3RM8A 1JF6A 4L4OA 3B4YA 1EUAA 2H9AB 3MSRA 3ANVA 3POCA 3LK6A 3EX1A 3CZEA 2J7BA 3IVTA 4QITA 4P7RA 4TR9A 1T41A 1TV2A 1S5MA 4JYEA 4DLMA 1OFBA 2XN0A 3HV8A 3GR7A 4ZO8A 4PRWA 3IS4A 3NO1A 1JCYA 1R6WA 4RL3A 3SCRA 5CJMA 3WNKA 3RO8A 1ME7A 2Z26A 3OGVA 3FKRA 4C5ZA 5LSMA 3ZYZA 3GKFA 2QNEA 3E96A 3NVTA 3SEPA 3EXSA 4WQ6A 4FX7A 1HQTA 2J7CA 1Q6CA 3OQ8A 2XTKA 4JTCA 1QCWA 3GUGA 2OSWA 3O06A 3G0UA 3BDKA 3SJ3A 2HV5A 1Z89A 4DM2A 1TTIA 4UTTA 2DZAA 1RPXA 2ACQA 5IDIA 5CZSA 3AMGA 4ICCX 1NDWA 3IACA 3K4AA 1CGYA 4EK7A 2DIJA 1SR0A 4DXKA 1YPXA 3TN6A 1H09A 1WKDA 3IGSA 3HG2A 5HPCA 4XAGA 4HN4A 3FA4A 3TFCA 3NEHA 4GGBA 5E9AA 4Z2JA 2V3EA 4XUYA 2QMJA 3U0HA 5F7UA 4AVFA 5CZJA 2ZZ7A 1JI1A 3BGAA 3O2LA 3W7KA 4NJKA 4QEHA 3GTIA 2OGJA 3SRDA 3PR2A 2DZVA 1Q6GA 1LRTA 2XIIA 3CHDA 4LSBA 3W82A 1K70A 1KRMA 3EA3A 4KF1A 4JTRA 1XD1A 4JTIA 4CNNA 4S2BA 4CU7A 4PRRA 2NLIA 2EPNA 1Q85A 4DUVA 3S5ZA 1I2NA 2HISA 2J88A 3WNNA 2D2OA 3AIQA 1ONWA 4NZ3A 4YNGA 4PCFA 3OG3A 1FX6A 2WKJA 3CJPA 4N0RA 4LS0A 4NJIA 2F6KA 4WGHA 4MNMA 3DENA 5IHSA 1VH7A 4PMXA 3FW6A 3LHTA 3NQCA 2X1RA 3GKAA 3LERA 1XWYA 4Q22A 1WUEA 2XVPA 4BWLA 4G7FA 3PS7A 4HZMA 4JKKA 4U5IA 4QIUA 2CYGA 4AZ7A 2DSUA 3E0VA 3USZA 4B91A 2D2GA 5HBFA 2BNJA 5JU6A 1GQLA 1SJCA 2BHYA 5XINA 1MXSA 1VFHA 2ZX9A 1K1DA 4O11A 1L9WA 4LAZA 2FZ9A 1Q4WA 1BVWA 4C6KA 1QDSA 3GDRA 3RG6A 2W3ZA 3ZSTA 1WZMA 1C9WA 4X22A 3WL0A 3THDA 2UY2A 4BQ3A 5C2GA 4YHGA 3PFMA 3WK0A 4Q8PA 1IXOA 1PO9A 3EX2A 1T99A 4DPPA 3VI2A 2Q8LA 4NL1A 4X9SA 1VFFA 1A5SA 2DSKA 4UZSA 1H7OA 1GZJA 2XM1A 5A6BD 5CGTA 2DZSA 3QHMA 4C91A 2UBPC 4QQ3A 1VEOA 4JIQA 1M7OA 4YMZA 5AHEA 2F6UA 3LEPA 3E2SA 4ML9A 2OR2A 3GG8A 3VNIA 1E71M 3EOOA 4D8LA 3DEQA 3GH5A 2G8ZA 1XUZA 1RLDA 4DXXA 2GQ8A 3SW6A 1HFBA 2QYGA 5KZEA 1XIBA 4TV6A 1LL4A 4NJJA 5I5RA 2OLSA 4LUYA 3OB8A 2QHAA 1JCTA 4NI3A 3W7NA 4O53A 1ISWA 5KETA 4UMAA 3EMZA 1HX0A 3QF0A 4IIGA 3NXLA 4C6FA 2FDMA 3LOTA 1UBPC 3C8FA 1PTDA 3M0LA 2ODOA 2V30A 1ZL1A 1UB3A 3NFUA 4J5NA 2J4GA 2PDPA 3NQFA 4WY0B 3N4EA 3OBAA 3BLOA 1OC5A 1F4AA 3W84A 1GG0A 1UWTA 1NFPA 1RJPA 2W63A 3CQHA 4V1XA 3GSMA 4XO6A 3R0KA 2VCAA 2Z1BA 3TN4A 1M53A 3WK3A 1US0A 4JICA 3CTLA 1EP1A 5GNZA 1LT7A 1SZFA 2X40A 3FAWA 1U5VA 5E9XA 2X42A 4FXRA 4JX6A 5EL1A 4GIRA 3ZT7A 1TPEA 4O12A 4ZXOA 1YRRA 2NWRA 4W5ZA 4C1NA 1VJSA 1KTBA 4O28A 2OTDA 1QW7A 5BWFA 5U7SA 4M7TA 1JPKA 1GVSA 3VOHA 3S2MA 2FHBA 1FFRA 5EB8A 1VFOA 4XZIA 1ME9A 5C9RA 3VKKA 3GU1A 3AZRA 3BE7A 4C7DA 3W7CA 1S2TA 5BMXA 1ZCCA 4W7UA 3CAKA 4LXFA 3S6DA 2QUUA 4K1GA 1QJWA 3E0WA 8XIAA 1EDGA 3KS5A 4GQGA 1FY6A 1I60A 2ZC1A 1FP8A 4NXSA 4W8AA 2EF9A 4DWDA 1HT6A 2TRSA 4DM1A 4ZQNA 1WBHA 2XZ9A 3UR2A 2POTA 4EXQA 3UVIA 3UBPC 4JNYA 2RDTA 4Z2LA 1R7OA 1VYSX 2GDQA 3FJNA 2UV8G 4CCZA 4GO9A 3W1QA 3TX9A 4FLSA 5LKYA 3G24A 1THFD 4GQ0A 4XAFA 3P0WA 3WUEA 4Q8TA 1W3KA 1G94A 3RITA 1G01A 1G4SA 2VJXA 3SN1A 3NQEA 7ODCA 1O5QA 2ALDA 1PTGA 2IPWA 4EE9A 2VZSA 4HYWA 4RNHA 4NZFA 3DFHA 3TXVA 3V5OA 3P7YA 4QFUA 1HL9A 1QI2A 3NGFA 4FMVA 5DANA 1OFAA 3GQYA 5CZKA 2OEJA 4LUSA 4B3LA 1MEWA 4DRSA 1NQ6A 3TTYA 1V93A 3RJXA 1SR9A 3AFBA 3LI1A 4N6EA 2WSYA 4ZE5A 4TU1A 3JS3A 2Q3RA 1Q6DA 2PWDA 1H41A 2DVXA 2FGBA 4HNLA 3WJXA 4RX0A 1JVNA 2HVMA 5I0DA 3CH9A 2H3BA 3L67A 3T7VA 1HJXA 2C15A 1KXVA 2A3AA 4YJ5A 2C16A 1GOOA 3OO2A 1E51A 1ADSA 3DU0A 5F4XA 5HMDA 3IIOA 4MVAA 1EA0A 4UQBA 1JGIA 1EZ2A 2YBVA 2ZX7A 1UR9A 2R1NA 3NDOA 3QM3A 5I79A 1TPVA 1PVNA 4X0VA 1DL3A 3KDNA 1R5YA 3DKLA 3V1HA 4WDWA 4K8HA 3WY1A 4N9EA 3TJXA 1X6LA 4DZHA 4NNCA 4GHRA 4EPDC 3LZ5A 2OSYA 1F5ZA 4PODA 3UYIA 3VIPA 4WDTA 4ZB5A 3SCOA 3LBOA 3OZPA 3VIJA 1M04A 1Q66A 1NELA 4A8IA 3LBCA 1KFEA 3KLLA 1Q6LA 1KM4A 1E3XA 4LYRA 4D8ZA 2X09A 4IMFA 3E0IA 1PKLA 2WNQA 2WMGA 2Q01A 3R13A 1QNPA 5FJJA 5AYIA 4ZMGA 3W27A 4BI6A 3M4HA 3MJYA 3T9PA 3KRBA 4MWAE 1K7FA 5C9WA 4HNNA 3UZ5A 3VABA 5AC7A 2QJNA 2CW6A 4ZSUA 1RBOB 2GGHA 3TROA 1UKOA 3GDLA 1IE7C 2ABBA 4E5TA 2V82A 5FJPA 1RLCL 3GTHA 4GKTA 2P76A 3HJZA 2RAGA 3WK2A 3PBYA 4GI6A 1TWIA 1Z44A 3PZUA 2MUCA 3LTYA 4IMGA 2QUMA 4DAIA 1YPIA 4F9JA 2PA6A 1GVQA 3U7BA 1EX5A 1EOKA 3VE7A 3WF3A 2C3ZA 4FALA 3P5YA 4HCDA 1AUSL 2VEKA 2O4QA 2JBMA 1KM6A 2WVSA 2Y0FA 1KBBA 1JCXA 3I3EA 3FV9A 3LU2A 3S8HA 1CX9A 4LH8A 2GJPA 1B3YA 3B9AA 1WDRA 1XYLA 1UR4A 5LNVA 3PZMA 3ITGA 3S4TA 2YA0A 3HIJA 5HR6A 1ZLPA 4U2YA 3JU2A 5A2CA 3G0XA 2FPVA 4WRHA 4XD6A 1A0DA 2XDFA 3W25A 3PWIA 3CUHA 3W1PA 1J6PA 3GH7A 1CXHA 3TYZA 4M7SA 3MUZ1 3WLJA 1QMLA 5B7YA 3MB9A 2XIBA 4KQNA 5GJNA 2X2YA 3L5AA 4FNQA 3RNDA 4GIAA 1V79A 4HCHA 5JQ9A 1U1UA 3WDRA 2PWFA 2Z00A 3Q2DA 1HF6A 4DYKA 4HU4A 3L65A 2QIIA 3IGHX 4O1CA 3W86A 1A5AA 3BXWA 3OTRA 1KXHA 2PWEA 4QHRA 5JMUA 3WJWA 1NVMA 1OADA 2RDXA 4PC8A 4GUFA 3B8UA 4AFYA 3BOFA 1QOQA 1LG2A 2QT3A 3TDFA 3B0XA 2CZFA 2DU2A 4O1BA 3BPWA 1N8IA 3VDBA 2J9ZA 3HV9A 1TWDA 1Z9AA 4P5UA 5EPDA 3IJ8A 3RR1A 2XIJA 2VEMA 4D6HA 4K36A 3CEUA 1CECA 4NP7A 1W9PA 1R3QA 2VFIA 1KBLA 5J5DA 3TK7A 4F2TA 1YE4A 3CU2A 5M03A 3JR2A 4X9YA 1OCNA 2QPSA 1H7WA 3DC8A 4J9JA 2OZ3A 3P0XA 2PUZA 4AB4A 4IL0A 3E0LA 4K3ZA 2ZVRA 4MZ8A 3QZ6A 3WNPA 2CLLA 4IGNA 4NKCA 1HTIA 4XB3A 3H70A 3S5YA 5C8BB 3UEQA 4FPSA 2G95A 3M5YA 2VO5A 1FXPA 1VFMA 3PZOA 1CGUA 1XYAA 3R2GA 4QP0A 3SCUA 5HMSA 2WVVB 1C8QA 1H61A 3FXYA 4XZLX 4H9YA 3C2VA 1UD8A 3ZJ6A 3N4AA 4LEFA 3BAWA 5BOOA 1A5OC 4UBPC 3C86A 3GS6A 3WDJA 1GTHA 2OEKA 1FA2A 2RGMA 3VZXA 3LHVA 1TV4A 4H00A 4Q32A 5T26A 1P0KA 1WNOA 3M43A 1UKPA 3M7WA 2VD8A 1VBGA 2VVSA 3NEVA 1UROA 2PF0A 4GNKB 5A69A 1UPMB 3AOFA 1XGZA 3OLIA 1U2YA 2D0GA 4Y9PA 3PB0A 2PLCA 4BCEA 5AHFA 4FLRA 5LYRA 3GDTA 1HKIA 4RE3A 3WH8A 1QPQA 1A3WA 2HE5A 3JVAA 4O0ZA 5DY2A 1RY8A 3H2FA 5J04A 1BYCA 2NUYA 4L1WA 3IIPA 2DIEA 3AQUA 4MJ4A 1QASA 1LORA 3WK1A 2EXOA 2RGLA 2J8TA 4YYCA 3ITLA 1GYLA 3KZPA 4O18A 2VQTA 4E4UA 5ABEA 3LHZA 2HXUA 3TYDA 3GH4A 2WSPA 3TN3A 5I2UA 1D3HA 5CZ0A 3E1F1 4MB5A 1EWDA 2Z28A 3MO4A 2A79A 3OIHA 4CD8A 2FTYA 2ZC8A 2YBTA 2NWSA 1UIPA 3WQEA 1QO2A 1P1XA 3BANA 3DGBA 2XU2A 3W72A 2WWCA 3NSXA 1KFLA 1SGJA 2I16A 1WDDA 3AYRA 4C6EA 4MKVA 1UH3A 2J27A 1XQLA 1X1ZA 1OEPA 1YXYA 2OZ8A 3OVPA 4IL2A 3L0GA 1WBJA 4LUIA 1FCBA 1TE6A 4ZOCA 2DV0A 1GVYA 4QE1A 4QS5A 1QPKA 4DI9A 2Y4SA 1ML1A 1DJZA 1ZQ5A 4W4QA 1DJIA 3MI2A 1H49A 3EWCA 3L12A 1OFEA 5IOBA 3G1HA 2HWGA 2X0SA 3SCVA 3A12A 4AHOA 3G8EA