4H4IA

Oye1-w116v complexed with the dismutation product of (s)-carvone
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLVVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X-ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4h4iA00
5CG7A 1OG0A 1UUMA 2RDTA 2NXIA 3F1QA 5AHEA 5H2ZA 3NPUA 4HNVA 3TMLA 5DELA 2NUXA 3P80A 1KFEA 1DOSA 2GQAA 2R94A 1SFLA 2TPSA 3G0UA 3RNDA 5E93A 2C16A 2AQWA 2VFFA 3OVRA 1H63A 5HINA 3G0SA 2ATSA 3GLCA 4I7UA 3TCEA 3LCWA 4KFNA 1NVMA 5D30A 1F76A 3THQA 3N73A 1VQTA 2QDGA 4HIBA 2Z6IA 4MY9A 3LHTA 1ZJIA 4RK8A 2VXNA 3JRKA 4X3ZA 3C2OA 3B03A 5G1YA 1ZFJA 4AAJA 2YR1A 4ICNA 5CZ0A 4KFOA 1VYRA 4FEZA 1T96A 2NZLA 5I3KA 4ADUA 1VYPX 2C1HA 2QCHA 3M16A 4N6FA 3G1HA 1KTNA 4K39A 1FBAA 3W7RA 2C14A 3M47A 5EYWA 1B9BA 1VC4A 1GOXA 1HO1A 2Y63A 3GVGA 1CW2A 5G2WA 3ANYA 2KZHA 4FIRA 4JYDA 3GXPA 4MZ1A 1QPOA 4OE7A 1LROA 3QW4B 2TRSA 2ISSA 4N4PA 4JTIA 2BZNA 4OT7A 3R8RA 3P67A 1IF2A 3HQ1A 4XWUA 4J9JA 3NQDA 4PEKA 1OHLA 3O6CA 1TTIA 1TQJA 3DU0A 2G97A 1FWSA 3S8HA 1OYBA 4JD4A 3W1QA 3P84A 1L6WA 5HWJA 3W1LA 4JS3A 3NPXA 4BWLA 1JRCA 1ZAJA 4QITA 3CTLA 1VYSX 4ZQPA 3W1MA 3N14A 3FJ6A 4UIOA 5C55A 2CLEA 3L65A 4PA8A 1PS9A 3DGRA 5FESA 3NYZA 1IXQA 1NF0A 1CI1A 1GG0A 1KA9F 1LBFA 1TMHA 3PS7A 3S5YA 1SUXA 3PSVA 1L9WA 4D2JA 2JGYA 4JTJA 3O1NA 4DXVA 3W7QA 1ZAHA 3NZ1A 4IPIA 3CIXA 4P2VA 1G4PA 1JUEA 3R12A 1YPFA 1HO4A 4EWND 1W5OA 3G8EA 5DCEA 3DBPA 3EX3A 3VKJA 3UXAA 1H1ZA 1GTEA 4LVAA 1H5YA 4UTWC 2FDSA 1RD5A 1JCNA 3EWWA 4UTJA 5AC8A 3B4UA 1EIXA 3W1XA 4RCXA 1HUVA 3HF3A 3IGUA 3CHVA 2NX3A 2OCZA 3R5EA 3MBDA 2OMAA 1KM4A 3TK7A 3HIJA 3TW7A 1GQNA 4AVFA 1AL7A 3PBWA 4Y90A 1I2PA 1FWTA 3W83A 2V5BA 4GUJA 4N9BA 5DCBA 1M6JA 1AK5A 1SO3A 4O10A 3FS2A 3IGXA 3NQ8A 4M5PA 2VKZG 2W0UA 2C13A 2YXGA 2HTMA 3SIZA 4JX4A 2OX1A 3BW3A 4QNWA 5E1QA 1LTDA 2G5WA 2V2DA 3I7SA 1OF8A 2P0OA 2LLEA 3G3DA 2OZ0A 4O17A 4GE8A 1SZGA 2PRHA 2X1TA 5AHIA 1QPQA 1T8XA 4GRSA 2VOMA 1IIGA 5BMXA 3WK2A 4MJMA 5G4WA 3P5ZA 3KXQA 3TU9A 4RXFA 1SO5A 1P4CA 3DZ1A 3QRHA 3NL2A 4O28A 3W71A 3SGUA 1A5BA 1EWDA 5KSWA 4UUIA 2QAFA 3TNOA 1VH7A 3B0VC 3TKFA 3F4NA 3A21A 4FNPA 1W8SA 2ZRYA 3L68A 3U8GA 3H55A 2DZPA 4RLIA 1Z42A 2VENA 2GQ9A 1KM2A 4KWWA 3BARA 3NL3A 3L2IA 1FQ0A 1GVRA 1ZHAA 4IMGA 2JBMA 1FWWA 1XXXA 2NV1A 1LOLA 1LORA 3P8JA 4GUIA 1FCVA 2PCQA 3PUDA 4MFDA 1QO5A 3W9ZA 5TQLA 2WSQA 1O4UA 5CGQA 3STFA 2E5CA 3LERA 3M1ZA 3N3MA 3DFTA 5A8GA 3W7PA 4K6AA 2QUTA 5LHEA 3LOTA 4WOZA 1R47A 5D05A 4BF9A 3AO0A 4CNPA 1QPRA 1VS1A 2ZZ2A 1OFPA 2NXGA 5I3IA 3TC7A 2X1UA 3W72A 1QFEA 4GXMA 4WXYA 3P74A 2OJPA 1H7RA 1GVOA 3RK8A 4R33A 4HPXA 2ZTKA 2XFWA 1M5WA 3VCRA 3CM4A 4R7JA 4QJ1A 1SZNA 3QJAA 3LV5A 3W7DA 4O4WA 2O7QA 1K3UA 2DZUA 4C1LA 2GOUA 4UXDA 5IBXA 3EEGA 5D03A 3TX9A 3GDLA 4QQ3A 5D2XA 2H8ZA 4AH7A 3W86A 4KWVA 1XDLA 3I7QA 2QUVA 3P60A 4E2DA 5F2GA 1BTMA 2E6AA 2H8XA 5U4NA 2V5LA 2NUYA 2PRLA 1G7VA 2HS8A 4UMCA 1RR2A 5HNRA 2CFFA 3QF0A 5LGZA 4WXZA 2DU2A 4O0KA 2CLMA 4Z1BA 4DO6A 2CWNA 4K8HA 1PHQA 5J5RA 2YFOA 4JEQA 3G1DA 3GXTA 4K7VA 1ICQA 3G1YA 3S1XA 1O95A 5BOOA 4JTFA 1TRIA 5LNWA 4FXSA 3FYOA 1F2JA 4FO4A 1G69A 2ALDA 1XBVA 4IX0A 5AC6A 2FFCA 3RLUA 2G95A 1JR1A 4ZQCA 3E49A 3MI6A 1W56A 3LHVA 4Y8FA 3A9IA 3TQ0A 3UYCA 3FKRA 3L66A 3TJLA 3HGRA 2E5BA 3B0PA 3S1UA 1FXPA 4Y9AA 3W70A 4DEFA 2ZRWA 1YDNA 3NQ2A 1YXYA 4OWGA 4O1BA 5U7SA 1H7OA 4JDBA 1T0OA 3NQFA 2E77A 4WQ6A 2R8WA 3A5VA 1ICSA 1KFCA 3T7VA 3PY2A 5AYYA 1VHCA 1LBLA 2WPBA 4LTSA 2VFDA 2FPYA 3PUOA 2ZA3A 2W6RA 1DORA 2QJGA 1KM0A 3W84A 1W3NA 4N6EA 1SR9A 1VHNA 3YPIA 3E96A 1IIHA 1H7XA 1RV8A 1UCWA 4LVFA 5HWNA 3KVJA 4LVDA 1SW0A 2BX7A 3LBMA 4K37A 1XCFA 4OHQA 2J6XA 2DJLA 3QH2A 1B57A 2QCNA 2VELA 4M6VA 3LM7A 2A7RA 5CKSA 3MWAA 3OVPA 5CZSA 4Q33A 1YXDA 3STGA 4HNTA 1P5BA 2X16A 3LCGA 4ML9A 2RH9A 1ME7A 3LTYA 1K03A 4RZ5A 1KM3A 2Y88A 2C0AA 1OVDA 3OIXA 3WJWA 4XKYB 1X1OA 4GUHA 4TR9A 1JUKA 2GVGA 4LC8A 4NVTA 5DY3A 1OX5A 1J2WA 1Q6LA 4ONVA 1BWKA 4A22A 4O19A 2YW4A 4XBSA 5K4ZA 2ZRZA 5EY5A 4OGZA 3TC6A 5AC7A 3HG2A 3GYEA 5FF4A 3W7HA 4TIMA 5C54A 2E68A 5EMUA 2J9ZA 4FNSA 3GIYA 2Q3OA 5KITA 1GVFA 4ORMA 1AG1O 2BWGA 5AN7A 3NOEA 3C8FA 3C4UA 3LRLA 4NX0A 3W2LA 3LX9A 1JQXA 1W37A 4GUGA 3NQAA 1H62A 1ZNNA 1FXQA 4ZQNA 1YDVA 3KAOA 4IX2A 3PAJA 1YTDA 3MUXA 3IVSA 4MZYA 1LRTA 3A5FA 1LP6A 3P5YA 1C8VA 2V8ZA 3CC1A 1QDSA 3BW2A 1HFBA 5G4EA 3BLIA 2P1FA 4S2BA 4M6QA 1FCBA 3QC3A 4W9TA 1JCMP 1ALDA 2FB3A 3NEVA 3B8DA 5D2WA 1TREA 3WK0A 3TV8A 2YCEA 1EB3A 3IEBA 2CZ5A 3BGGA 3H53A 4UTLA 2NX1A 1FX6A 1OFOA 2PURA 5I3HA 5C6MA 5H91A 3UD6A 1ADOA 3QMSA 4NU7A 2UV8G 2ZRXA 1H7NA 1YTKA 1KM6A 3KRUA 4UCGA 5C5YA 1OYAA 3M6YA 1JCLA 4RR4A 1WAUA 1TTPA 1OFEA 1JULA 4JTGA 2E5DA 5EA9A 4A29A 5K9XA 2Q3RA 3LDVA 4NNAA 3NNTA 2A85A 4X22A 2EKCA 5AHNA 1Q6RA 3TROA 2RFGA 4X9SA 4O4VA 5F2MA 3TFCA 4O52A 1H61A 1L2UA 2C6QA 4CCDA 1RVGA 4AWTA 4LW7A 4GNJA 1A5CA 1VRDA 4WY0F 2VFGA 2ZZ1A 3FOKA 3VFLA 3SW6A 1TJPA 3A22A 4MPQA 4DO4A 2A7NA 4U4MA 1FY6A 4DPQA 2JKEA 2QCGA 2GPTA 1I2QA 3DI0A 5I3GA 3HG3A 1UUOA 4QSHA 2Y6ZA 3GAYA 1PVNA 1WV2A 2PC4A 1JCJA 3LCXA 4O16A 2E6YA 5D32A 3EWYA 3FJLA 4NZFA 3W2JA 2QEZA 1TTJA 3TAOA 4HNNA 1B4EA 2VEMA 2Z6JA 2V9DA 3QPZA 4UFMA 5G2HA 4Y96A 2ZZ3A 1OK6A 4TMBA 2Z2UA 1RQBA 3RFAA 4UR7A 1P0NA 4JYEA 4PODA 4PH6A 4IOTA 3RMJA 2X1RA 4S1FA 4UR8A 5J5DA 1JCYA 3ABOA 4ZZ9A 1TQXA 3SECA 3DHDA 4TU1A 1QR7A 2J9XA 3N9RA 3S9YA 4YCPA 1QOQA 4PL1A 3ATYA 3L5LA 3N34A 3NM1A 2QCFA 3WK3A 2ZRUA 5KZEA 2AAMA 3EX2A 1BKSA 5DCDA 1RQEA 1XL9A 3FYPA 5KTLA 5F4XA 4N4QA 3MYOA 5TBOA 4HN4A 4MIMA 5CZJA 5GVJA 5AHLA 1SZFA 5DLCA 1S3HA 1W3TA 3TAKA 3FEMA 4LOCA 5AYZA 4Z0JA 4NXKA 1AW5A 1TPH1 3CLMA 2XN1A 2CZEA 4IMFA 1TPDA 3Q2DA 4CCEA 5LNSA 2C18A 1G6CA 2QCDB 3ATZA 3BGJA 5D04C 3TXZA 3VE7A 2CLLA 1ICPA 3I65A 3W23A 1ZCOA 5DXYA 4U28A 2YFNA 4CNOA 4JTKA 3NQEA 4MOZA 4NNCA 3IRDA 5CSSA 1VPXA 3DENA 3HGSA 1W3IA 3N9SA 2J88A 3KVMA 4XQ6A 1NFBA 3HBLA 3QPYA 4HPJA 4PCFA 5CPLA 3NG3A 1G4EA 2EF9A 1IGSA 3LCIA 4GFSA 4BWLC 1G4SA 1UJPA 4UFKA 1I2OA 5DY2A 1SW3A 3C2VA 1QWGA 1E51A 4UTKA 2YYTA 4YWIA 5KZDA 4JN6A 3RLVA 3EX4A 1PL9A 3GDRA 3P62A 4AXKA 1EP3A 1TPUA 4JR5A 1DBTA 5BW6A 2V0TA 3LHYA 5LZLA 3BG5A 1KTBA 1F74A 2Q8ZA 4O0ZA 5D2YA 1XUZA 4JYFA 3R2GA 3W2NA 3BG3A 2Y7FA 1W1ZA 4N9EA 5CPNA 4EF9A 4ZMGA 1KBIA 3PM6A 1FCQA 2HMCA 1MSSA 2QKFA 3BVJA 4UTTA 3VNDA 2FTPA 4RZ6A 1DJNA 4NQ1A 4TX9A 1OK4A 2TSYA 1TPFA 3C6CA 2I14A 1U5JA 2Y70A 3KVLA 4Z1DA 3OEXA 4UNLA 3KHJA 3RF9A 1FWRA 4MLRA 2TYSA 4XKYA 2HS6A 5D2VA 3G3MA 3W74A 3SI9A 2EGZA 8TIMA 3HGOA 1VLIA 1TO3A 3L0NA 3PSWA 4WJEA 3W7IA 4NT0A 1MEIA 3LHWA 1BEUA 2CLOA 3TSBA 5C2XA 1X1ZA 3HPXA 3WFAA 1SFJA 2E1DA 3HO8A 3UNDA 4ADSA 3TMQA 1KBJA 2WO5A 3HPZA 3NPVA 3ABRA 3PBVA 2Y7GA 3TA6A 3BLEA 4FX7A 4FF7A 4GC4A 3LCLA 3KX6A 3NQMA 1VCFA 1AW1A 2OT0A 1Q6QA 4JXCA 4Z1CA 4HSNA 4R53A 5LNUA 1WYIA 5D2TA 4WZHA 1K7EA 4IMDA 1CX9A 1VGAA 3UWQA 2QJIA 4EF8A 5EL1A 5CSRA 2PRMA 2BLEA 4NUWA 3C52A 3TH6A 4O11A 3CWOX 2WSRA 2Y7DA 3LXCA 1F7BA 4MLJA 3TDFA 3MP4A 3GX9A 4ORIA 3Q37A 4M7TA 5SWUA 3FFSA 4Y6GA 1QNVA 3UWYA 3UXDA 4CQAA 1RZMA 2BTMA 1LM1A 1SO4A 3MYPA 3NAVA 3ZR4A 1SSGA 3HPSA 1Z41A 4QNEA 2ZZ5A 4NXSA 3BO9A 4JTTA 4UMBA 1R2TA 3G18A 3HG5A 1C9DA 1H1YA 3HMJG 5HR7A 2A6LA 4E38A 3TW6A 3QW3A 2ZRVA 1LZOA 1MEWA 5AHFA 1KFBA 3G1XA 3WJYA 3O8AA 2WNZA 4I9AA 4LS2A 5IBXC 4AHOA 1QO2A 4JY8A 3M5XA 3W73A 2DORA 5K9DA 3G24A 3OHIA 3Q58A 4LNYA 4O13A 3S5NA 4EIVA 1G7UA 3UWVA 3LCFA 1GPWA 1WBJA 4M6PA 1YLVA 4O1AA 5L9FA 3EWXA 3N2MA 1OF6A 1UB3A 3G0XA 2RDUA 3CB8A 4XTDA 3G1FA 6TIMA 2NV2A 1H50A 3NL5A 4TMCA 7TIMA 1TV7A 4AHQA 2O7SA 3NQ7A 1S5VA 2JGQA 1WQ5A 4IQLA 5F2IA 1H7PA 5F2LA 3C2RA 5K9CA 2FIQA 3B05A 1PCWA 3GKFA 3W7NA 1W54A 5HULA 3T40A 4N02A 1QCWA 5CPOA 1JRBA 1YPIA 2GVLA 3W2MA 4JGDA 1DVJA 3M44A 4NJIA 2B7OA 3VI2A 3I7RA 2J9YA 1K7FA 3NM3A 4LVGA 3VE9A 2Y89A 1TPC1 3O63A 4I7VA 4HT3A 5DBUA 2GVJA 3L21A 1O5XA 4ZVJA 4FXRA 1TPVA 2NX9A 1F6PA 1FDJA 2YX0A 4FNUA 2EPHA 4AF0B 1NAL1 3M9YA 1TB3A 5D02A 1KFKA 1WDWA 3MO7A 3A24A 4FHAA 4GBUA 4MJZA 5I3FA 3MHGA 3BPWA 2VEIA 2WOQA 1LYXA 4A21A 2YZRA 2Y61A 4FX6M 1K02A 3PC0A 4UTHA 1IXPA 1EP1A 3IIZA 3DXIA 2GUUA 5E0KA 3IIXA 2ATMA 1OFQA 1TPB1 4UFLA 3W85A 5L6UA 1VLWA 4Q4KA 1O60A 3SJ3A 2QCDA 3ZWSA 3S0CA 1GWJA 3MHFA 3M41A 2WV8A 3PB2A 2R14A 4YLWA 2CZDA 1A53A 3M7WA 3IVUA 3NO5A 4OV9A 5F4WA 4LU0A 3W7LA 1EEPA 1LBMA 2TMDA 1XC4A 3QZEA 4MYAA 4OV4A 4H4IA 3C2FA 1I45A 1H7WA 3ABSA 3O16A 2Y7EA 4DF2A 5EPDA 3THAA 3BW4A 1FUYA 3WK1A 2DP3A 2JKPA 3EWUA 3V1PA 1KM1A 1GVQA 3C2EA 5K4XA 3LBCA 3LI1A 4YMZA 1VJIA 3KVKA 1W5NA 2ZA2A 4DQWA 1D9EA 1PV8A 2ZCGA 4ADTA 4RXGA 1KFJA 3Q94A 3ABQA 3USBA 1FWNA 2ZQ0A 3G1AA 1V7YA 5KINA 4MY8A 5DXXA 1A50A 3M5ZA 1DHPA 3FLUA 1KFLA 4POCA 2DZTA 1EX5A 4CQ9A 4LY8A 3CWNA 4MZ8A 2A0NA 2FPVA 5EKYA 2WNQA 2GQ8A 3GDKA 1RQHA 4NNBA 3DFPA 1VZWA 2XN2A 1HG3A 4BI7A 5D09A 5FF3A 2V30A 4NJHA 3L67A 2NUWA 4O14A 1P0KA 3NR0A 4PC8A 1YDOA 1KV8A 2A2IA 4TO8A 2ZBTA 5G5IA 3TQVA 5FF7A 3EXTA 3EXSA 2GJNA 3UZ5A 2QR6A 3EWZA 4JDYA 1TCDA 4A2RA 2ABBA 2WQPA 2ZFAA 1S5TA 1OX4B 3NQ6A 2E6DA 3LTPA 2E6FA 3EWBX 4JICA 3SZ8A 2I1OA 1EWEA 3O6YX 3L0GA 2VC6A 2YW3A 5FEPA 5MHBA 3GR7A 2Y85A 1OJXA 3LXBA 1SU5A 1W5PA 4IUOA 3M5VA 5I3JA 1YTEA 4YL2A 3SR7A 3NQVA 1H60A 1VR6A 1F5ZA 3LLFA 2A1YA 2C3ZA 4RV8A 2AGKA 4CLMA 4PFMA 1PHWA 3CT7A 1N7KA 5D33A 4RX0A 4AB4A 4JX6A 5K2ZA 3QQ0A 1X8FA 1LOQA 3DKJA 2A21A 3ELFA 4CNNA 1I8JA 2NXHA 3CPRA 2ZZ6A 4DO5A 4I7WA 5AYXA 4LRTA 5HR6A 4K38A 2J27A 4WY0B 3LHUA 3BK0A 1C29A 2C19A 3GDMA 3W07A 3MJYA 4JTUA 4BFAA 3W75A 2X30A 4IMEA 3W7KA 2QDHA 2WNNA 4WOQA 3C56A 1TIMA 1WBHA 2ZZ7A 4LWWA 3HGJA 1U83A 4LUIA 1G4TA 3TE9A 3HB9A 1IXOA 4UMAA 1TPEA 3LB0A 3W7GA 2F84A 3S1WA 4JTLA 3M5YA 2V2HA 3UZJA 3NA8A 3DKLA 5AOUA 4O1CA 2V81A 1RPXA 1TSIA 1NEYA 1XBZA 1R30A 3RU6A 3LI0A 4RJEA 1J4EA 4JNMA 1LOSA 1H51A 1ME9A 2ZDRA 2JKAA 1Q6OA 4XZ9A 4B5NA 2FPTA 2GJLA 1ZALA 1Q3NA 3DFSA 3P8IA 5D37A 3LCHA 3JR2A 2PE4A 2Z1BA 3U6WA 5DBTA 2WJZA 5HUPA 1KLYA 1M7PA 1GZGA 1LLZA 1UASA 2ISWA 3QQ1A 3D0CA 4BK9A 4ZL1A 3SY5A 3T4CA 3R89A 2P10A 3L5MA 1NSJA 1F05A 1JQVA 3F03K 3W1PA 3P82A 3T78A 4AHPA 3GXNA 1VCGA 1KLZA 5K7JA 4O1DA 1B4KA 2WKJA 5IM51 3PG9A 2X2GA 1EA0A 1EUAA 4DPPA 3QEZA 3LTSA 4NJKA 1BWLA 4G1KA 1R46A 5KMYA 3PBUA 3EB2A 3E12A 3MP5A 3IGSA 5AHMA 1OFAA 3G1VA 3ZWTA 4HKPA 4A3UA 2Q8LA 2B7QA 3PVFA 4UC5A 4YXGA 2YDAA 2Z0IA 1W5QA 1X6UA 4L4LA 1B3OA 3ZFHA 3WJZA 3DFOA 4AF0A 3QFEA 3OA3A 1XFBA 3E02A 4UTWA 3UWZA 1N8FA 3GNNA 2B0MA 1YXCA 3ZS4A 4CCCA 5D38A 3UQNA 3LGEA 3MI2A 4O8RA 2H3DA 5K3VA 5HUOA 1MZHA 3LV6A 2QCMA 1DL3A 4EOUA 3IIPA 5G2IA 1WXJA 1JJKA 1HL2A 5CZTA 3U2OA 1OFBA 4MFEA 4MKNA 4H6KA 4MY1A 2VFHA 1PIIA 2RHGA 3C0JA 1ZENA 3IVTA 3P81A 4OQVA 4AMAA 4UTTC 3NXFA 1XM3A 1SPQA 1W0MA 4UTIA 5AFDA 5FF2A 1I2NA 3DHFA 3GKAA 3O07A 5G1TA 2CW6A 1MO0A 3BG9A 3S6DA 4O18A 3PULA 1GYNA 4JIQA 1MXSA 4N9CA 2VEKA 1THFD 3W7EA 3NVTA 3SSJA 3DFQA 5FEXA 1NF7A 2CLIA 4LS0A 1LDCA 2QCLA 1KTCA 1FDYA 2VFIA 2BXVA 1PCKA 4XUGA 3UWUA 1LCOA 2ZZ4A 4E2BA 3QSTA 3NL6A 3O15A 3KFTA 3TR2A 5FEZA 1DJQA 4RKAA 2H3BA 4K36A 3PBYA 3CEPA 4AWSA 4HSOA 1SZEA 2DZXA 4R34A 3NZRA 4FNRA 4IMCA 5KZMA 1T99A 4LUJA 3S1VA 4MUZA 1O5KA 1GYLA 4LVBA 2DZVA 4FIQA 4X2RA 4IXXA 3OG3A 1LRQA 3AJXA 3OVQA 1TV8A 2CZFA 1FDZA 2YGYA 3T44A 1DQWA 3FA5A 3DFNA 3HOJA 1P1XA 2EAWA 3GR8A 3MP3A 3IIOA 4LV9A 4K8EA 4OBTA 1EPXA 3B06A 3KOFA 4O50A 1WA3A 3CU2A 3V75A 5EBUA 3G1SA 3O6DA 4BI5A 1WOAA 2ZA1A 3IV3A 2VFEA 2NWSA 3OBKA 3R13A 2B4GA 2FLIA 3HJZA 4ZQRA 2D73A 2DJXA 4MYXA 4IGHA 3P7YA 4NZJA 1TYGA 4E0CA 1TRDA 1LRNA 1OX4A 4Z0SA 1UBSA 3FIGA 1I2RA 4IXHA 4M7SA 5HMSA 4H3DA 3NDOA 5A5WA 3JS3A 4CQ8A 4QM1A 1K7XA 3GAKA 4BI6A 1AW2A 3MMTA 5DN1A 1GVSA 3BLFA 3A23A 3PR2A 3W87A 3W1RA 3W7OA 3EKLA 4UFJA 3LRMA 1QOPA 4YCOA 3E9AA 1EUNA 1HTIA 3QM3A 2DZSA 3O06A 1SO6A 3W76A 1A5SA 1TJRA 1X7FA 3LHZA 4LC6A 4WD0A 1ML1A 3S5ZA 5T26A 3L5AA 5BNKA 3NGJA 4LT9A 2FJKA 4UTMA 3W7MA 2R91A 3W88A 4NJJA 4QISA 4WY0A 5F4SA 2G96A 3GDTA 3WJSA 5LKYA 3EX6A 4K7YA 5HQEA 4QIUA 4ZQMA 2YSWA 4NX5A 1SW7A 4O57A 1VCVA 3S5OA 2YPIA 4OU1A 1SQ7A 4DF1A 1GT8A 1XUUA 3TSDA 3MHUA 1Z44A 2X1SA 1ZAIA 2QAPA 3PB0A 1KW1A 4DBDA 2BSLA 2XN0A 1TV5A 2F7FA 4JY9A 3TXVA 3QYQA 3K30A 3UWWA 3G8RA 2H90A 3N19B 3UPBA 2NWRA 4KKXA 1XDMA 3TUUA 1N55A 3NQCA 1F73A 4GJ1A 3STCA 5LNVA 1YYAA 4FNTA 5HJLA 5ABTA 5FEWA 4O53A 2YYUA 4KFPA 2DZWA 4QAIA 4DBEA 1MEHA 3M0ZA 3UY8A 3T55A 2H6RA 4DELA 3STEA 1YADA 4AEOA 4Z1AA 2Y62A 4O54A 1L6SA 2E09A 3W1AA 2FB2A 4NJGA 3W1NA 2A6NA 2QJHA 1GJPA 3F4WA 3W6YA 3MI3A 1FCUA 2V82A 3S42A 4WX2A 5LHFA 4Q32A 3B04A 5BMWA 1XBYA 1ONRA 3QSRA 1D3HA 2IQTA 3LRKA 4MVAA 2ISVA 2NLIA 3W1UA 1Q45A 3WJXA 3DH7A 4JIPA 3I6RA 1SSDA 3EX1A 5BRBA 3C3NA 4LRSA 3PF3A 3KRSA 2FQIA 3W22A 3FKKA 1W5MA 3MW7A 3UY7A 2JK2A 3QMRA 4PL2A 1TPWA 4JTHA 4N9DA 5LNRA 4L4MA 1O94A 4Z08A 2QUUA 5F1UA 2CLKA 3W7CA 1WOBA 5HWMA 1XKYA 1GG1A 3NPWA 4JTSA 5FI8A 1L6YA 4EVZA 4ZQOA 1WX0A 3L0KA 2QF7A 5FF0A 1DQXA 1OABA 1PE1A 3NQGA 1GTHA 1V5XA 3QMTA 4FNQA 4GWEA 3SGZA 3UPWA 1AL8A 4WUIA 1Z48A 4A2SA 4JX5A 2QCCA 3EKZA 3TJXA 3INPA 3PG8A 1XBXA 3W2UA 2RDWA 1M7OA 3CEUA 4JTEA 1ZY9A 2B7NA 1OFRA 4UFHA 5CPMA 2CLHA 1K8YA 4IPJA 2A7PA 4XTIA 1Y0EA 2EHHA 3N2XA 1I4NA 4DF0A 3GZ3A 3HG4A 1OX6A 1G67A 1GEQA 2CLFA 1W31A 3LXAA 4O15A 2QCEA 3W2KA 4UTUA 3W7JA 3W1TA 2ZTJA 4C1KA 5AB3A 4AWUA 4FB7A 1KV5A 5TIMA 3GNDA 4O12A 2B7PA 4GUFA 1F6KA 4PTNA 3I68A 1DKWA 3P61A 3MBFA 3DI1A 2OT1A 1JVNA 1QMLA 3E0IA 4BR1A 2A4AA 4HNUA 3CQ0A 4N2YA 2A5HA 1AMKA 2ZYFA 3TIMA 3W3OA 2RKXA 3O05A 4UNKA 1R2RA 3G22A 1DV7A 2V2CA 1JCXA 2J24A 1QAPA 3B0UX 3GK0A 4S2CA 1R2SA 5F1VA 2ABAA 3L9CA 2I9EA 3GB6A 1OFDA 3LLDA 4RZ4A 5LSMA 3PWAA 4UFIA 3SFKA 1LLWA 4IWWA 1JUBA 1QPNA 3EXRA 1OYCA 1IXNA 1K8ZA 3IIVA 4XBKA 3C61A 3TSMA 2HSAA 1K8XA 4LV4A 4M19A 4FX8A 5LGXA 3BV4A 3M43A 4IJBA 3TQKA 3CIWA 1ME8A 4ALDA 1J5TA 3PUEA 2C15A 1EP2A 2CU0A 1S5WA 3TFXA 1XI3A 3KRZA 2VEPA 1KM5A 6ALDA 4HHPA 2W79A 1TTQA 1A5AA 1D3GA 2WSYA 3DAQA 3H54A 4LS1A 4P61A
chains in the Genus database with same CATH superfamily
5CG7A 2PDQA 1U5HA 3B8WA 4KEUA 1M9HA 4RPPA 1VFOA 3VOCA 2GDQA 4INFA 4HNVA 4HPHA 1CLXA 2E4TA 4D8ZA 1DOSA 2R94A 3A4XA 1WCGA 1IWPA 3QV8A 1S2AA 1XLJA 1ZB5A 2F61A 4D6GA 3H12A 1H5VA 1DIDA 2PP1A 3GLCA 1OC5A 3S3GA 3SIMA 3TJ4A 3F5JA 4GY7A 4KFNA 2EPLX 1NVMA 5EFFA 1E6QM 3ITCA 2X42A 4KGJA 3H4WA 3AS3A 3THQA 4LUTA 1EGZA 3NOYA 2NQ5A 1VQTA 2QDGA 4IFOA 4MM1A 3WDRA 3OODA 3AU2A 1T96A 4ADUA 2BASA 5H8UA 2VI0A 3M16A 3BAWA 3GFZA 1KTNA 4K39A 3OPSA 3W7RA 1B9BA 3LPPA 1GOXA 4R7WA 2XFRA 4QJ4B 1CW2A 1CXIA 3A3XA 3MZNA 4FIRA 4A6GA 5A2BA 3GM8A 4OE7A 4QLLA 1V03A 2YCLB 1Y5XA 2HRWA 3IJ8A 3ZSSA 2ZUWA 3R8RA 1BGAA 3QHMA 1C9WA 4PRRA 5C2GA 3W1QA 5JUVA 2YDQA 3P84A 5HWJA 4H01A 4QITA 5A6SA 3CTLA 1VYSX 3W1MA 4ATDA 4RZBA 2RUSA 4PEEA 3L65A 3KOYA 2ALRA 1PS9A 2J8GA 5HMEA 2NQLA 1LWJA 1NF0A 1CI1A 2O55A 3UA4A 4YHGA 3PSVA 4JTJA 3VIFA 4IPIA 2W67A 1G4PA 1ZBCA 4ZO9A 1HO4A 5I00A 1HNYA 1W5OA 3G8EA 1AQ0A 5DCEA 3E2RA 1H1ZA 4X2PA 1XD0A 2FDSA 9CGTA 3SAZA 6ENLA 1UWSA 2CKSA 3B4UA 3MCOA 4RNHA 4GI6A 4GK8A 3IGUA 1JPMA 2XVNA 2NX3A 5EMMA 2OMAA 1KM4A 3HIJA 4P8XA 5A2AA 1I2PA 4GY1A 2V5BA 4GUJA 4U33A 3L2MA 4O10A 4XZWA 2YCKX 4B4FA 4HVXA 2ZKMX 2XH0A 2C13A 4RE2A 4JX4A 3VX0A 4W7WA 2OX1A 4EAYA 3RO8A 8XIAA 5E1QA 2G5WA 2V2DA 3I7SA 1OF8A 2P0OA 3VC6A 2LLEA 3G3DA 5CLWA 1YBQB 2O56A 5H8MA 2D2OA 1SZGA 2J75A 4QG8A 2BOEX 2PRHA 6REQA 5AHIA 4GRSA 1VAHA 1IIGA 3CH0A 3V5CA 1XV8A 1XLLA 4RXFA 2GUYA 3TYZA 1EC7A 3U5UA 3EOUA 4IP7A 4ZSUA 3V1HA 2EPNA 1KGXA 5REQA 1EWDA 3PUGA 2FHBA 3APYA 1VH7A 4JZ5A 5A6LA 5A94A 4EX4A 4A8IA 4FNPA 3WF2A 1D7KA 1UWRA 3GHSA 1Q2RA 4GG9A 4RLIA 1Z6KA 2VENA 1KM2A 4KWWA 4UBPC 4XAGA 3KLLA 3NO3A 3SRKA 1U5VA 2WHLA 1A5NC 2YCJA 4MPKA 3EB4A 1LLOA 4MFDA 4JN7A 3N4EA 3L4UA 4B3ZA 5CGQA 3EB3A 2EG7A 4RNJA 2WJEA 2WMHA 3DFTA 3N3MA 3HFTA 1EDQA 4K6AA 4OZOA 3F2BA 2E1WA 4BF9A 2ZZ2A 5BXTA 1OFPA 4WSKA 3LS9A 3W72A 1D8WA 1OCQA 2ZX5A 2OJPA 1EGMA 4GI8A 4R33A 3UVIA 3PPHA 2BOGX 4QJ1A 3WLMA 4O4WA 5I07A 3FGCB 1K3UA 4B9YA 5IBXA 3KBJA 2AOSA 1MNZA 5MKGA 4KWVA 1OIMA 1BPLB 2XHYA 5CQ1A 1V4YA 2VDIA 2F8QA 2QUVA 4E2DA 2Z25A 2C7FA 5U4NA 1G7VA 2HS8A 3WCZA 4KIRA 3KOWA 1FH8A 1DWIM 3FN9A 5LGZA 5JIWA 2DU2A 4LAZA 4O0KA 4Z1BA 3WLKX 1H0IA 5CXPA 3GHTA 1WDQA 1ICQA 1AQHA 3THDA 5BOOA 5LNWA 2PBOA 2AQVA 1VB9A 3H7UA 4AMCA 2A3BA 1G69A 2ALDA 4BJHA 1JR1A 3MI6A 2BGSA 3TJLA 4Q8WA 2PDGA 2JEPA 3CZEA 4XISA 1ZS2A 3W81A 1FXPA 4AD3A 3R79A 3VM5A 1YDNA 1KWGA 4ROQA 4O1BA 2BBFA 1BF2A 3ZR6A 3AU6A 4UQEA 2E77A 4WQ6A 1KFCA 3T7VA 2Q01A 3PY2A 1P48A 2WPBA 3TTSA 2VFDA 4ERIA 2FPYA 2ZA3A 4D6IA 1KM0A 1MW1A 1W3NA 4N6EA 2WNWA 3E96A 1EHAA 1A0EA 1RV8A 1XICA 2E8ZA 1UQYA 4QRNA 4U3AA 5HXMA 4K37A 4HHHA 4XG1A 1H0GA 1BYBA 2VELA 3E1F1 4GKLA 4PUNA 5CKSA 5I77A 4X63A 3BLKA 3MWAA 3U3HA 4HNTA 4LSBA 1LQAA 1DWJM 4RZ5A 2Y88A 1T40A 5I5RA 4QCEA 2XWEA 3WJWA 1DWHM 1J2WA 1O66A 1BWKA 2VJXA 4A22A 4HU4A 2QW5A 2YW4A 1DQUA 5AC7A 4TIMA 4DJFA 5EMUA 3CPGA 5KITA 1NFGA 1B31A 1UA3A 3TTOA 3ZT6A 3LRLA 2V5JA 3ES8A 1XRVA 3BZJA 3WIJA 1QNPA 1Q13A 2A3EA 2VTFA 1ZNNA 5FJUA 4ZQNA 3OP2A 1RVKA 3MUXA 1Y5WA 5GPRA 3MKVA 3P5YA 3CC1A 4Q4MA 3BW2A 2XM2A 6XIAA 4KEVA 1IQ8A 2FB3A 3NEVA 3WK0A 1TREA 3K8MA 1EB3A 4AIEA 3MUAA 1YE4A 3H53A 5ECUA 3L4XA 3M0LA 4NU7A 2C79A 2JFEX 2ZRXA 3SUUA 4UTFA 3KCLA 4AZ6A 5C5YA 4DZAA 1JCLA 4F79A 3OZOA 5CBBA 4RDVA 1F4HA 1TTPA 9XIMA 1OCJA 1UWUA 5K9XA 3GU1A 3NNTA 1C93A 1IZKA 2A85A 3UU0A 3VGFA 2V3GA 1QK0A 3TROA 3SB0A 2EEXA 2FZBA 3VK5A 3ARVA 2C6QA 3LM3A 4GNJA 1V3MA 1VRDA 4WY0F 4NZ4A 3A4WA 2VFGA 2ZZ1A 2GJXB 3VFLA 4GXWA 1FY6A 4XSLA 1IEWA 3QTPA 1EBGA 2P76A 2Y6ZA 1QRQA 2PC4A 3RUBL 3CZKA 3NDYA 5LIKX 3GBEA 1V02E 1WKDA 3L4ZA 5M2FX 3BSGA 3TAOA 4HNNA 4D6FA 3F2DA 1B4EA 4NG3A 2XUCA 3UXIA 2R82A 4H7VA 4KEZA 5CPQA 4GYPA 2ZZ3A 1IZCA 4WVXA 4TMBA 2Z2UA 2GJPA 3RFAA 4UR7A 4PODA 1U33A 1OT2A 3CK5A 1SJBA 2X1RA 2HXTA 4UR8A 2DSWA 1KFWA 3PJUA 1EYEA 3ZJKA 4ZZ9A 2POTA 1TQXA 2J9XA 2QIIA 4KRUA 4R3UA 3S9YA 4YCPA 3PZGA 1KR0A 3CHFA 3N34A 1JF5A 1VP5A 3B0XA 4DAIA 2AAMA 1BKSA 4PMYA 5DCDA 3FYPA 2GFTA 2PDCA 5CZJA 1XH1A 5GVJA 4J40A 1R3YA 1S3HA 4XD3A 3FEMA 4Z0JA 4TUFA 1TPH1 3CLMA 4HCHA 2CZEA 3Q2DA 1R3TA 3BGJA 5FJOA 5H6HA 2D69A 2CLLA 1ICPA 3W26A 2DY3A 1ZCOA 3MVTA 4MWAB 1VFLA 4U28A 1V02A 3NQEA 4G5DA 1UH3A 4GZEA 3MV11 3N9SA 3H24A 3KVMA 1L8NA 4XQ6A 1YW1A 4L9YA 4I5UA 3QPYA 1CECA 4RDWA 2GL5A 4H8UA 2VNCA 3SGGA 1GVEA 2J7FA 2INZA 1IGSA 1WUFA 4C6IA 4M24A 4KRZA 1BRLA 5BOFA 1SW3A 3V5OA 4P7LA 3P3BA 2R24A 3AYSA 3JVAA 3QOKA 4UTKA 2PB1A 4NILA 4WJ8A 3QV7A 4LUSA 4GZJA 4F0RA 1POKA 2POZA 1E0XA 5LZLA 4QS5A 3M07A 3VNYA 2PP0A 3BG5A 1KTBA 1VPYA 2DZBA 5D2YA 3GIPA 3SJNA 3W2NA 4JKKA 3ARZA 5CPNA 1M53A 2EQDA 1TWDA 1FCQA 4B5WA 3BOXA 3BVJA 3LY0A 1ZCCA 2FTPA 4BEUA 4JFTA 3QGAC 4TX9A 1OK4A 1LWIA 1TPFA 3RX3A 4YPJA 3V0SA 4JQ3A 5TNVA 4Z1DA 5J04A 4H9TA 2DVTA 1FH7A 8RUCA 4HCDA 3IJ6A 3H2CA 1FWRA 4MLRA 3SI9A 8TIMA 1VF8A 1CGXA 5JBDA 1TO3A 3L0NA 3S2JA 4U31A 3GVRA 1X38A 3W7IA 1MEIA 2D3NA 1OM0A 1YQ2A 5C2XA 3WFAA 1OB0A 3E5PA 1HVQA 3CPUA 3HO8A 3PJTA 4ZOCA 1SJAA 3BURA 4IIGA 2NSXA 2WO5A 3K13A 2PDMA 1J10A 3AHXA 4GC4A 3NQMA 3AS2A 1AW1A 4JXCA 4PN2A 1E6PA 1CTNA 4HSNA 3VXGA 5A8QA 4WZHA 1K7EA 4IMDA 4HPGA 3PTQA 4EF8A 5C0QA 3MY9A 1MFUA 5EL1A 4GMEA 2BLEA 3C52A 4JHZA 3UGRA 1OZMA 3T1GA 3CWOX 2WSRA 4PCPA 3KRBA 3MP4A 1L0PA 3Q37A 4HMDA 4M7TA 1EL3A 4HTYA 1LUCB 5EBAA 3FSTA 4AZ7A 1SO4A 3V0TA 8A3HA 5FOOA 2PF8A 1Z41A 4NZ5A 2D0GA 4EPKA 3O6AA 2EBNA 3GS6A 2F6XA 4UMBA 1OGBA 2IPJA 1UD6A 4YN5A 1R2TA 2NT1A 3I4EA 3RDKA 3HMJG 1QI0A 4JKMA 4HNLA 4W4QA 5B7YA 3ICJA 3PANA 3WH5A 2ZRVA 3UG3A 1Y7VA 1LZOA 3GNRA 5AHFA 2XSAA 2DW7A 3O8AA 2WNZA 4I9AA 2HEJA 2WZHA 2F6KA 2CIPA 1I60A 2DORA 5K9DA 3G24A 4HU0A 3Q58A 4LNYA 1WKFA 3S5NA 1RJPA 1G7UA 1CGTA 3UWVA 1GPWA 2FMOA 3RYSA 3JW7A 5DT7A 1CZ1A 4GYJA 2C91A 1TV7A 1US2A 4W8BA 1BSIA 2JGQA 1DIOA 5F2IA 4A4AA 3TJIA 4KMQA 1EF3A 4MF4A 5K9CA 1PCWA 2WHMA 3QKEA 5GQBA 4G7EB 5I79A 3W2MA 4F0HA 1DVJA 3M44A 4ZXOA 4EK7A 4W7VA 3VI2A 4S39A 3I7RA 2VR2A 2FGLA 1K7FA 2GWGA 2V67A 4HMNA 2CETA 2PZNA 1R3WA 2AL2A 2NX9A 3VD9A 2YX0A 1ZL1A 3M9YA 1WDWA 3REQB 4LBUA 3L2LA 3BAYA 4L1GA 4FX6M 2R1PA 1ZUAX 3UZZA 5A69A 4C7DA 2FKPA 5L6UA 1VLWA 2QCDA 2WW5A 4FR1A 3UESA 4HPNA 1C7SA 1XLCA 2R14A 3N4AA 4GNVA 4LAMA 1P7TA 3I3EA 2TMDA 1LBMA 3SQSA 2CCRA 1XIHA 1EA9C 3C2FA 4GZIA 1V0MA 4GO9A 2VQUA 1E1FA 1X39A 3ABSA 2PD5A 3ISIX 4WKFA 5JU6A 1OT1A 2JKPA 3Q45A 3C2EA 5AVNA 3SBFA 3WLPA 1PIGA 2EG8A 1DE6A 3A9BA 1KXQA 1OWQA 1EJTC 3UETA 3E2VA 1KFJA 2OQYA 2VX6A 2CESA 4M82A 3G1AA 3W27A 1V7YA 1W2PA 1EJRC 1XYZA 2VGGA 5I7GA 2WVUA 1KFLA 1UKQA 3NSMA 1PPIA 3FJNA 3DUGA 3ANVA 2FPVA 4NNBA 3V3WA 4WHBA 5D09A 1EJWC 3I6EA 3TZFA 4CQCA 4NJHA 3L67A 2NUWA 4WF7A 1XIEA 3CUXA 5C9XA 3WEZA 3NR0A 3DESA 1KV8A 4GI4A 1E73M 3WMLA 4RV3A 4TO8A 3CUJA 2WHJA 1GCYA 1H3GA 1DE5A 2HQAA 1UROA 3EXSA 5I02A 4MNKA 2VZOA 5JH1A 3IACA 4L9XA 2WQPA 1S5TA 1XLHA 2VWTA 4XKMA 5F7UA 4D1IA 2JEQA 1TZ7A 3SZ8A 3ITYA 1XKJA 1EWEA 3O6YX 3VNZA 4AD1A 3QC0A 5MHBA 3S47A 1R7AA 2G4FA 2Y85A 1RBLA 3H7RA 1SU5A 1YTEA 2DSKA 2XGIA 1H60A 1F5ZA 2XM1A 4CKQA 2A1YA 4RV8A 4C7GA 4ZA0A 4C6CA 1VRXA 4RX0A 4AB4A 5JQ9A 4JX6A 5K2ZA 2Z26A 3ELFA 3IGHX 5BYWA 1WZLA 3S5SA 5DRCA 2WBGA 1AD1A 1E70M 1W1VA 3HURA 1GZ1A 1TVLA 3A13A 4WY0B 2P3ZA 1S2VA 1C29A 3MT1A 2PA6A 4P8WA 4BFAA 3W75A 3GXFA 5LIYX 5A6KA 1JFXA 4ZB2A 1FOBA 4BCEA 3B0YA 2J8FA 2QDHA 1TIMA 1KRCC 3CZ8A 4CD5A 4CQBA 3GU9A 1NWUA 1W9BM 2ZXAA 1JF6A 5FAJA 3LK6A 1JNEA 1U83A 1B3XA 1XG4A 2BB0A 3SFWA 4JFUA 1IXOA 1XLDA 4Q8UA 4JBRA 5B7ZA 2YDRA 3M5YA 4Q4PA 5AOUA 4I8DA 4YTRA 1F07A 3RU6A 4Q8VA 1LJYA 3MANA 5GJNA 2IXVA 2CNCA 1ME9A 2ZDRA 4YVPA 4KEMA 2E8YA 1UQZA 1RJQA 2F2KA 2HPIA 2Z28A 3P8IA 3JUGA 3JR2A 2PE4A 2PGFA 1KLYA 3TW9A 1M7PA 4N42A 1LLZA 1UBPC 2ISWA 4WCJA 5TAOA 3R89A 3F4VA 1AQFA 1Q8AA 3EKGA 1GKRA 2OLSA 4C6QA 2HE8A 3WLOA 3F03K 4FAMA 4QG9A 1TJ2A 3W1PA 1DJIA 4L6DA 1XLFA 2BP1A 2PDWA 4H9UA 3T78A 5A6BD 4CD7A 4V28A 4HK5A 4J3TA 4AUBA 4JN8A 2CKRA 1B4KA 1UC4A 4DPPA 5HNNA 3RG6A 3DERA 5EMJA 4NJKA 3MU7A 3WD0A 2PUZA 1W9UA 1R46A 5KMYA 2A3LA 3E12A 3MP5A 3PZVA 1OFAA 3CBWA 2QF8A 4GGHA 4HKPA 3CAQA 3W02A 2Z0IA 2WCAA 4WKAA 4PBEA 5HK4A 3WY1A 3ZFHA 3DFOA 1P6BA 4AF0A 5A6BA 5CGTA 3SCPA 1P0BA 2GVYA 1W32A 3GNNA 2B0MA 2WZMA 3AC0A 3ZS4A 4CCCA 3W28A 2PWFA 3GDBA 3MI2A 3N04A 2H3DA 4JPGA 4I9JA 5HUOA 1ITUA 1PZ0A 4EOUA 4GIEA 3U2OA 3GNPA 5ENLA 5BU9A 4JCMA 3C0JA 1ZENA 3IVTA 4AMAA 4IG2A 4UTTC 3NXFA 1ZJBA 1PB0A 1XM3A 4WRHA 4CU8A 5AFDA 2ZVIA 1GVYA 1I2NA 4LJ3A 4QXIA 4DBUA 1R5YA 2CW6A 3GC4A 3BG9A 3LU2A 4YS1A 3S6DA 3PK7A 4F8XA 3WUGA 1Q6DA 2EJAA 4PCSA 4N9CA 4M81A 1THFD 1UPPA 1H11A 2IPWA 3TWBA 5FEXA 3ZVIA 1WZKA 4LS0A 4HA0A 1KTCA 1VEOA 1FDYA 2VFIA 2AGTA 3UF9A 1PCKA 1JZ5A 1ZQ5A 1U22A 1UZ4A 4TQTA 3FK4A 3WQPA 2NT0A 2H3BA 4K36A 1FH9A 4H6QA 4HSOA 4KGLA 4MUZA 5CJMA 5E0CA 4LVBA 4FF5A 4FIQA 4IXXA 3PJWA 3EOSA 3AJXA 3GG8A 5BOEA 3VKDA 2P8CA 4J3UA 2ZWZA 4ZTYA 3NQBA 1XYAA 2EAWA 3GR8A 3PFMA 1GVIA 1NOFA 3B06A 1EZ2A 3KOFA 1JIBA 3CU2A 4HOZA 1Q7ZA 2DSVA 3O6DA 3CV1A 3IV3A 4Y9OA 3R13A 2FLIA 1YE6A 1XLKA 3EOLA 4WDWA 4HSHA 4KWSA 3VZXA 3URBA 4Q4RA 4AX6A 1VIZA 3VOGA 3D6NA 3R25A 3EPMA 1D8CA 5E09A 2XFYA 4LY4A 5DN1A 1E1CA 1KRBC 1NP0A 3PR2A 2VDGA 2ZC8A 3DFHA 3SEPA 3IRSA 1XSKA 4H41A 3W1RA 3D47A 1J2BA 3CL6A 3LEPA 2FZ8A 1HTIA 1SO6A 1B90A 1TJRA 4WD0A 1BYCA 1FWJC 2XGBA 4UTMA 2J8TA 3UCQA 4QISA 1E4IA 1S3TC 5F4SA 1A4LA 1E6XM 1DHKA 3WENA 2G96A 2WSKA 3GDTA 4K7YA 3PZOA 3DYMA 4QIUA 4ZQMA 1ONWA 1SW7A 3VIPA 3GG7A 2QVNA 3PB0A 1G94A 3ZLFA 2I16A 1TV5A 2F7FA 4JY9A 3TXVA 3TTQA 4QJ5B 1HJQA 1SGJA 3N19B 1XIMA 1F3TA 3I3BA 3EA1A 2WHKA 3STCA 5LNVA 4EAMA 1GOMA 2O9RA 4NP7A 4ZO6A 2XH4A 4EPEC 4UZSA 2H6RA 3MKKA 4EP8C 3STEA 4J3SA 4C5ZA 1YADA 4C90A 2Y62A 4Y2WA 2E09A 3CS2A 3TR9A 1JFHA 2A6NA 2QJHA 3W6YA 1XIGA 4DN1A 2XVKA 2INFA 5BMWA 1ONRA 1D3HA 3H21A 1AJ0A 3LRKA 4Y9NA 4HN8A 4MVAA 4BQ4A 3VKKA 3W1UA 1JPIA 3I6RA 4MDPA 1QHZA 3EOOA 3ZSTA 4QSFA 5BRBA 4LRSA 2FQIA 4HJFA 1OZQA 1W5MA 4PTXA 1CENA 1C8QA 4JTHA 1SVDA 3FDGA 4N9DA 4L4MA 1CGYA 3BC9A 1Q7QA 3D5HA 2WC4A 1H2JA 2UY5A 5A95A 1DXEA 1JZ4A 2BHZA 6REQB 3APGA 3G6LA 1VEMA 3BCDA 5FI8A 5LA1A 3L0KA 2ON3A 3HA1A 5CBIA 2J62A 2O4QA 2G50A 3UPWA 1AL8A 4C6PA 1Z48A 3AWOA 2QCCA 5REQB 1XBXA 2RDWA 1M7OA 4DZIA 2VGIA 3MC5A 1MVYA 1ZY9A 2B7NA 2W3ZA 4UFHA 1KQZA 1K8YA 2A7PA 1A0DA 3HG4A 4IMAA 1OX6A 1E40A 2YA2A 3LXAA 3K1GA 3VNJA 7REQA 4H8NA 4F0SA 1G1YA 3W2KA 4NAEA 1Q4WA 2DDXA 2PTDA 1RSCA 5AB3A 4IL2A 3CQHA 4AWUA 4XD4A 3OYXA 3SCTA 4O12A 2B7PA 1F6KA 2PGRA 3ARRA 3P61A 1DKWA 2J78A 2UY2A 3DI1A 2D0HA 2DT1A 3M4HA 4HGXA 1MUMA 1DJZA 1GZJA 3RJYA 4PCTA 3C86A 2VR5A 2WKGA 3CO4A 2VQTA 4B2DD 1AMYA 1NFPA 1IWAA 1TJ1A 4YIWA 3B0UX 4S2CA 3L9CA 4GVHA 2PSNA 3GB6A 4HQVA 1YNQA 3VGHA 1OFDA 3R0DA 4E6MA 2REQA 2WMKA 3GSMA 3PWAA 2I5IA 1QPNA 3CMJA 3U5YA 1K8ZA 2BS9A 4XBKA 3TSMA 5MKGB 2A79A 5LGXA 1OADA 4IJBA 2PWUA 3WNPA 1FKXA 4B2DA 2C1GA 3A4AA 4ALDA 2BGNE 1X6NA 1V6UA 2CBJA 3VAVA 1KM5A 1KCKA 1JD9A 4FLRA 3R43A 3OLIA 4PB5A 5BXPA 1OG0A 1UUMA 1MDRA 2FH8A 2FZMA 2XIMA 1VFSA 5AHEA 3NPUA 4YNGA 2OSWA 3W53A 5DELA 3P80A 2GQAA 2B81A 4XB3A 1SFLA 2TPSA 2ZXDA 3G0UA 5CEWA 3EMZA 3OVRA 3B8UA 2ACQA 4WR3A 5HINA 3G0SA 2Z29A 1EGVA 1DTNA 3B9EA 4YJ5A 3TCEA 3VMNA 3LCWA 2VD8A 3GZAA 5D30A 4F0MA 1F76A 1HGWA 3CGTA 3N73A 1RP9A 2PDXA 3OGRA 4AEEA 4OTKA 3KDNA 4X3ZA 1H4PA 1ZFJA 2OB3A 3BTNA 1VYRA 4S3EA 2OYKA 4JIHA 3WBYA 4JKLA 3LPGA 3G1HA 1U1HA 3QBUA 3KBVA 4BEQA 5EYWA 2ISDA 1VC4A 2WBKA 1HO1A 1GEHA 2WVVA 2GK1A 5HANA 5C7VA 4JYDA 3VIKA 1PKYA 2QMKA 1QPOA 1QVBA 1LROA 3QW4B 2ISSA 1JDFA 4JTIA 5CBJA 5LIWX 4J9JA 4PEKA 1GK8A 1XFCA 1CEOA 1OHLA 2YA1A 1FWSA 1RAKA 3S8HA 4GD0A 4JS3A 1LL4A 1S2TA 1JRCA 1IEIA 3BANA 2VT0A 3N14A 4C6LA 5C55A 1MW0A 2CLEA 1Q66A 1DJWA 3WEMA 1KA9F 3PS7A 3ABXA 4J35A 4WK9A 3RGTA 1W3HA 2GDVA 4HA3A 3NZ1A 4P2VA 3CIXA 1JUEA 3R12A 5A8OA 4GNKB 3NUKA 2Q71A 1XLGA 1GTEA 4IGSA 1H5YA 2ZUVA 4UTWC 1RD5A 1Q2SA 1JCNA 4UTJA 4NZ1A 4CGTA 4RCXA 1MUCA 3O9NA 4A3RA 1UP0A 1GOQA 2HDJA 1HUVA 3ITLA 2OCZA 3JZEA 2QVHA 2R9RA 4PMQA 3R5EA 3MBDA 3T6CA 3TK7A 3TW7A 1GQNA 4AVFA 1VFTA 1B3WA 4Z2KA 4N9BA 1AK5A 1SO3A 3IGXA 3NQ8A 4L56A 2JQXA 3UG8A 2YXGA 3RRAA 4IQEA 5FSEC 2QGHA 3D46A 4UB9A 5AYBA 3HPFA 4M51A 2O4MA 3DYOA 4Q6JA 5IFPA 4ZO7A 2NV9A 1FHVA 1MXDA 2VOMA 3WK2A 3AXHA 2D0FA 4KIEA 4ERAA 1NWSA 2FGZA 3QRHA 4E8CA 3GVQA 3MJMA 3NL2A 1JYXA 4O28A 1KGUA 5JMUA 5CJNA 1GOIA 4ERGA 2QAFA 4J27A 3TNOA 4L4OA 4HNCA 1PXGA 3F4NA 3TKFA 1TZZA 3A21A 3K5XA 1W8SA 3RCYA 2ZRYA 3L68A 3U8GA 4QAWA 1Z42A 4U5KA 2GQ9A 3ONCA 3BARA 1ZHAA 4Q3MA 4IMGA 2JBMA 4BHYA 2NV1A 1LORA 1WKYA 1KWKA 1L6FA 2PCQA 3PUDA 3WUBA 3HQNA 5TQLA 3FA4A 4W7UA 1LT7A 1QW8A 2E5CA 1FP9A 3MZ2A 4A3HA 2BXYA 5AYIA 2PU1A 3W7PA 2V68A 2W61A 2MANA 1R47A 5D05A 2V3EA 4GA8A 3AO0A 1VS1A 1J0ZA 3TC7A 1QFEA 3DC8A 1JEZA 3P74A 4XAZA 3EOEA 5M1TA 4HPXA 3VCRA 3DIPA 1IT8A 3CM4A 4R7JA 1SZNA 3QJAA 3THCA 3RX4A 3UA3A 2O7QA 3PZTA 4LFYA 5FD0A 2DZUA 2GOUA 4M80A 3EEGA 5D03A 2CBIA 3GFXA 2H8ZA 4PSRA 1I1XA 3W86A 3K1DA 3OLGA 1G0CA 3NURA 1UPMB 4BA0A 2E6AA 4UMCA 5HNRA 2CFFA 3QF0A 1RD6A 4WXZA 3GU2A 1Z69A 4PRWA 3QGVA 2QPSA 5J5RA 3R1ZA 4AY7A 1TUXA 1B3ZA 2YFOA 2YDSA 3DC0A 2CLPA 5E70A 2ZXQA 3G1DA 4MWAE 4CEXC 3U4FA 1MMFA 3S1XA 1TRIA 2OVLA 5D4YA 3FYOA 4CN4A 4FO4A 3OZPA 4H8VA 5M5DA 1NELA 4ZQCA 3E49A 1UOKA 3A9IA 2WMFA 1BRLB 4JQ2A 3UYCA 4F2BA 3QPEA 4GQQA 2E5BA 3B0PA 3S1UA 3VIMA 1EH9A 4Y9AA 3UT0A 3UJFA 4LUSB 1YXYA 2PWVA 1B2YA 1E0UA 4OWGA 1B3YA 2PDUA 2PLKA 4GZ7A 3AHYA 4JNZA 5U7SA 2PGWA 3G5EA 3S2LA 1ICSA 5AYYA 4EPBC 2FHCA 1UD3A 1DWFM 1M1BA 1PUDA 2W6RA 2QJGA 1W3KA 4ZFCA 3OQ8A 1VHNA 3YPIA 5BRPA 1EYWA 1H7XA 1UCWA 4LVFA 4LVDA 2PWGA 2BX7A 2IQ0A 1XCFA 1BLIA 2DJLA 1B57A 1O6IA 2OTDA 4M3PA 1HJWA 4IJCA 3OVPA 3O2LA 1L6GA 4Q33A 3SUVA 3STGA 1IEXA 2X16A 4ML9A 5I2UA 1X1NA 2RH9A 1K03A 3LLXA 4MTVA 4MDOA 1MQQA 3OIXA 4XAPA 3T8QA 3NIYA 1S5MA 1X96A 4HYWA 5M03A 4RW3A 2P5NA 3QR3A 3VKBA 3LPOA 5J8LA 3URNA 1PKLA 1X98A 2WCSA 1UKTA 3FJ4A 5FF4A 4Q8NA 3B9NA 2E68A 5E9AA 3GIYA 2Q3OA 3B97A 2GOKA 1GVFA 4ORMA 4Q4QA 3L4VA 1Y65A 3EDJA 1QASA 4HP5A 3ZMRA 3GTNA 1R86A 3LX9A 1NOUA 4C6EA 2G3JA 3VILA 1W37A 1GW1A 3NQAA 4IX2A 1T41A 1TCMA 3IVSA 4B5SA 4CN6A 1C8VA 5HQLA 1QBAA 5CJ5A 4S23A 1HFBA 3WFLA 1CXFA 1FCBA 3GTXA 4W9TA 4FMVA 2IS7A 2X7VA 3TV8A 3GG0A 3ZT7A 1OFOA 5PTDA 2V63A 3UD6A 3QMSA 1XGZA 1KM6A 4FPSA 4WKHA 1TFVA 3AOFA 4PTDA 2E5DA 3MMDA 1YNPA 3EDEA 4A29A 2Q3RA 3LDVA 1HN1A 1VJSA 5AHNA 5C71A 4X9SA 4G6CA 1V3KA 3U4AA 3PAOA 3XISA 4IP4A 4CCDA 1RVGA 3ID7A 1LF1A 3WQCA 2XIQA 1UR9A 3NZPA 3SW6A 4KS0A 3A22A 4MPQA 4DO4A 1HX0A 4QDPA 4Q8QA 4E5TA 4KCUA 4QSHA 4Z2GA 2OZTA 1PVNA 4PMNA 3H2AA 4AZBA 1LL6A 4S3GA 5FL1A 5I24A 1ADDA 3KTSA 2VUNA 3E2SA 3W2JA 1VBRA 4ECLA 3GVWA 1K4GA 3ITOA 4XIMA 3L4YA 6TAAA 2XVPA 4AIBA 3S2CA 3KZSA 3A12A 2V9DA 4TTUA 5G2HA 1ISXA 4Y96A 2QV5A 4DWSD 4L6HA 1OK6A 1RQBA 4HD5A 5FAGA 4PH6A 2DW6A 3RMJA 2GSEA 1BHGA 2ISFA 3PTDA 2X0HA 1VFHA 1JCTA 2E0PA 4R5EA 4TVDA 8XIMA 1QR7A 1PWLA 2AL2B 2NQZA 1VD6A 3WH9A 3N13A 1S1RA 1T6MA 4DX3A 2QCFA 3EX2A 1LL7A 4AYSA 1RQEA 1XL9A 5KTLA 1CNVA 1QU4A 1VBJA 3IK4A 3RR1A 4MIMA 3BAIA 1HF6A 5AHLA 4I6KA 1SZFA 5DLCA 4EE9A 4LOCA 1AW5A 4IMFA 1TPDA 1G6CA 2QCDB 2E9BA 2ACUA 3L4WA 5DXYA 1J0YA 2YFNA 3VIIA 3ALGA 3BLLA 4JTKA 4G7FA 4CVUA 4MOZA 4NNCA 3MCMA 1P7TB 1VPXA 3ERPA 2EPOA 3DENA 1J8VA 4A8LA 3LZ3A 3WFZA 1R3SA 2PDIA 4PFHA 3TVAA 2E25A 3HBLA 3BLPX 1E56A 3R11A 2XH7A 1QTWA 3IJLA 3UJRA 3LD5A 3COTA 2GZXA 3BOFA 4UFKA 2Q6ZA 5KEZA 3C2VA 3OYZA 1KCXA 4LXFA 3RLVA 3EX4A 3OZYA 4QR6A 1A3WA 1O1ZA 3U2ZA 4AXKA 4JR5A 1OG6A 4HOWA 2V0TA 3LHYA 2WSPA 2WJDA 2Q8ZA 4O0ZA 3PTKA 3BG3A 4IM4A 2Y7FA 4N9EA 4EF9A 4ZODA 3JU2A 4OUIA 3BUVA 1ESWA 4DJDC 1P0EA 3KTXA 2HMCA 2PTZA 4KW2A 4UTTA 1XYMA 4RZ6A 2TODA 1DJNA 4NQ1A 4DHGA 3C6CA 3MDUA 2Y70A 1KGWA 1L2QA 4BY3A 2W62A 2VUYA 3TLLA 3KHJA 3RF9A 1CYGA 2YOCA 3G3MA 3W74A 3W0KA 4FLSA 3H23A 3GTIA 4GX8A 1LQ0A 3TLQA 2ZX6A 1YIXA 3R4IA 4NT0A 3AZRA 4M1RA 3E2QA 1BEUA 2CLOA 3GY1A 1X1ZA 1US0A 4LGXA 4Y9MA 1O5QA 1JDEA 2E1DA 1LT8A 3HPZA 3B9DA 3BLEA 5H1WA 3LYEA 2VWSA 3LCLA 1UR0A 3FXGA 1Q6QA 3CAWA 5I6SA 4QS6A 5LNUA 1WYIA 3ARTA 1VGAA 2RJGA 3IV8A 5A6AA 4XO7A 4LANA 3TCSA 3EPNA 2PRMA 1TELA 5AECA 3VYLA 4O11A 2IKHA 4J3XA 2Y7DA 3LXCA 2OG9A 4I3GA 4W85A 3BJFA 5SWUA 2PDFA 1FWEC 1XRSA 3RN6A 1WKEA 3UXDA 2WYSA 4WGHA 3NDZA 3RCNA 3MYPA 3KP1A 4GQ0A 2XINA 3TYUA 1RCQA 3NAVA 3ZR4A 1ENUA 1SSGA 3R7MA 3ZQ9A 4QNEA 4AW7A 4EXBA 2OQLA 1BFNA 3BO9A 3I4KA 4GQGA 4JTTA 4L61A 3G18A 3LQGA 4C6NA 3FVDA 4QBXA 4E38A 3AUJA 4Q22A 1BVNP 1HVXA 3TW6A 1MEWA 4AISA 2WZEA 2C71A 4W89A 3WH6A 3P0XA 4LS2A 4AHOA 4JY8A 1U2YA 4IF2A 3CQKA 4DM2A 4MJ2A 2YB4A 5FSDC 4O13A 1T8QA 3IJDA 4R9OA 3PWGA 4IIFA 1WBJA 4M6PA 1GJUA 3T0CA 5L9FA 4B5XA 1AH3A 2NV2A 1X97A 1H50A 7TIMA 3Q67A 5DO8A 4AHQA 1DWGM 4Z2IA 1WQ5A 1EJVC 1GUVA 5F2LA 5BXSA 3W7NA 4K1WA 1EJXC 4FALA 3BCFA 3T40A 1JRBA 1YPIA 2GVLA 2I17A 2XH2A 4ES4A 1A5OC 2G3FA 2FH6A 4GVIA 3VE9A 2NQ9A 1TPC1 1JG9A 3O63A 4I7VA 2GVJA 1O5XA 3CZJA 3W00A 1TPVA 1C92A 1F6PA 1W9DM 2HBXA 3AYRA 4FNUA 4HZMA 4AF0B 4XIAA 1MI3A 3UXLA 4QROA 3UZYA 1KFKA 1O12A 1F6YA 2PPGA 5I3FA 3HQPA 1M41A 2WOQA 1LYXA 4UTHA 4HK6A 4R85A 5IRPA 2GUUA 1EJ7L 3M46A 2W63A 3AMDA 4UFLA 3W85A 3AS1A 3LG3A 4FXJA 3SJ3A 3SRFA 1V6XA 3ZWSA 3GNXA 4IG2B 3MHFA 3VNKA 5HAOA 3ARWA 3H8AA 4C91A 2CZDA 1HP4A 3IVUA 1MRQA 4OV9A 5F4WA 1CWYA 1XC4A 1B1YA 3QZEA 2BNJA 3OBAA 3TC3A 5D8ZA 4H4IA 5FIPA 1UG6A 1I45A 3O16A 5AY7A 4J2MA 1WB0A 1JNDA 3WK1A 4ZO8A 1SFSA 5K4XA 3LBCA 2WK2A 3LI1A 3SM0A 3AXXA 3W24A 3KVKA 1RHCA 4W86A 3N15A 2WC3A 4DQWA 4ADTA 3PZNA 4RXGA 4AVNA 2IXUA 1SMDA 1FWNA 1RK5A 1AUSL 4LCQA 4XAYA 2XIIA 4ZE5A 2BY2A 4IFKA 5DXXA 1NQ6A 1E1EA 3BZGA 1DHPA 2Y5JA 4WDTA 4POCA 2DZTA 4LY8A 3GC2A 1TWWA 3GW0A 4MZ8A 4A35A 2D1ZA 2A0NA 3CUZA 4MB4A 3N2BA 4L9ZA 1VZWA 2EG6A 2XN2A 4BI7A 5AZ0A 3N6HA 3MUY1 2VO5A 3ARXA 4ZBCA 1K6WA 2ANUA 1AFSA 1E9YB 2A2IA 2ZBTA 5G5IA 5FF7A 1WAWA 4W5UA 2GJNA 2ZUSA 3DOPA 4FLQA 1JD7A 2QR6A 1H41A 4JDYA 4ZB0A 2DIKA 1F3WA 5GNXA 2E6FA 3EWBX 1FWBC 4JICA 4D8AA 4K8GA 3L0GA 3CLWA 4OIFA 5CCZA 3GR7A 3QZAA 3TYEA 3LXBA 1E1CB 2ZIDA 1W5PA 4O1EA 3GHUA 2XVLA 2E9LA 4IUOA 1AH4A 1VR6A 4MKSA 5A8MA 2AGKA 4FXFA 3T0BA 4DY1A 3WD4A 3GTHA 1XSIA 3CT7A 1M7JA 2CBVA 3GXMA 1X8FA 3DKJA 2A21A 3AXIA 4CNNA 2NXHA 2ZZ6A 3AIEA 3I6TA 1GQKA 3E3HA 4LQ1A 2W27A 3BK0A 2C19A 4V1YA 3GDMA 1EPVA 3FV9A 1P43A 3BMXA 3CAKA 5A2CA 1QBBA 3LENA 1UC5A 3C56A 3UR2A 1WBHA 1GQLA 3UEQA 4AIOA 1VEPA 3TTYA 3FSUA 2DQWA 3LMZA 2GLKA 4IP5A 4H9MA 3CH9A 1UA7A 5HMFA 3NFUA 4LUIA 1FHUA 2GDUA 4X0NA 4IIEA 3AIWA 3HB9A 4LNCA 1E43A 1TMLA 2V2HA 3UZJA 3CUFA 4O1CA 1RPXA 4B5UA 1XBZA 2YA0A 4OJYA 3LI0A 1AZ1A 3CV6A 4JNMA 1LOSA 3KCOA 2YL6A 1V6YA 1ZALA 1Q3NA 3DFSA 3LCHA 4AXNA 2KAUC 4YTSA 3WNNA 3U6WA 5XINA 5HUPA 3ARSA 4AWEA 5HPCA 4HZ7A 5BRQA 3SY5A 4AC7C 1E0WA 2PAJA 3L5MA 3R0UA 4LEQA 3Q4DA 1IEVA 1NSJA 1P6WA 3APTA 6PTDA 3WEOA 1PZ3A 3P82A 4ZSTA 2D24A 4AHPA 1KLZA 3PPFA 3AISA 1KBKA 2NVDA 4O1DA 3SRDA 3JZUA 5IM51 3PG9A 1EA0A 3G6MA 3QEZA 3LTSA 2AQOA 6XIMA 1Q8JA 1GOWA 3NZGA 3E0FA 2QYGA 3PBUA 3IGSA 5AHMA 1EO7A 1RCXB 4AYGA 3AIUA 3DG6A 2C8NA 2AKZA 4RL3A 1AODA 1FWAC 2WANA 2YDAA 4Q4SA 3BWWA 3U57A 4L4LA 3BQ5A 4YTQA 3WJZA 3UJ2A 3NZQA 3V4BA 3HM7A 2FFIA 3T81A 1MFVA 4UTWA 1N8FA 1YXCA 3M0VA 4PMJA 5D38A 5K3VA 3IIPA 3WLRA 7REQB 3CTTA 4MFEA 4MY1A 1XCXA 2VFHA 1K4HA 3WL1A 4NAEB 1EQCA 4OQVA 1ZU8A 4MNJA 3AIBA 3GH7A 4XAFA 2OWWA 1KR1A 2NQJA 4UTIA 1BG4A 5FF2A 5G1TA 1MO0A 4JHMA 4O18A 2UY3A 1MXSA 1TV3A 1U30A 3QN3A 3W7EA 4KCTA 3NVTA 3DFQA 1JYNA 1NF7A 2CLIA 1J9YA 1LDCA 1A5MC 5A1AA 1MQPA 1WNOA 4XUGA 3UWUA 1LCOA 1KNWA 1KXVA 3H4GA 3V0UA 2CBUA 3VZZA 3O15A 1GQJA 2REQB 3TR2A 2QUMA 5C7HA 1IGWA 3EMQA 4W88A 1BGGA 3T0DA 1SZEA 4R34A 4FNRA 1QK2A 1T99A 4LUJA 4V2XA 1O5KA 1V79A 4ILSA 5EGRA 3ZYZA 5DMNA 5HPOA 3F5LA 4CCZA 1NJJA 1LRQA 1TV8A 2CZFA 4L6OA 1GHRA 1FDZA 3WELA 4GABA 1W3JA 1QNOA 1DQWA 3FA5A 4JTQA 1QI5A 1XRTA 1EPXA 1UD5A 1VBGA 2PDPA 1WA3A 3MUCA 2X7WA 4BKNA 2QJJA 3DHUA 1MW3A 1WOAA 2ZA1A 3NYDA 2HZGA 2VFEA 3TN3A 2GGEA 4YHEA 3HJZA 1TUFA 1OBAA 3O3RA 3RCMA 3ZZ1A 4NZJA 3WQDA 1LRNA 6CGTA 4C6BA 4E3TA 4Z0SA 3H7VA 4WDXA 1I2RA 5I09A 1KCZA 5HMSA 4H3DA 3NDOA 5A5WA 3POHA 3JS3A 1CT5A 4CQ8A 2JIWA 4F4RA 4O1FA 2I57A 4KQNA 4PTMA 1F3XA 3BLFA 1HKKA 1UR2A 2CHOA 3W87A 3CIVA 4LAOA 3EKLA 4UFJA 3VDCA 3E9AA 3QM3A 3TWAA 1FFQA 1HZYA 2AMGA 2J66A 2WVVB 2GK1B 3L5AA 3NGJA 1FRBA 4LT9A 2R91A 2JE8A 3CJPA 1IR2A 4F3HA 5LKYA 4M56A 2AL1A 2XIOA 4HYRA 3SDOA 2HJPA 2YSWA 3UVAA 4NX5A 1VCVA 1EF2A 1HP5A 4LEFA 1XUUA 1GGOA 1LG2A 1Z44A 4XSMA 1ZAIA 1IT7A 1DP0A 2QAPA 3L23A 4LBRA 2BSLA 2XN0A 2PP3A 4GVGA 4HMCA 3S46A 3WUEA 3G8RA 2C0HA 2GQ3A 1A0CA 4KKXA 4DO7A 4ZB5A 1N55A 1W9XA 3NQCA 2A3CA 3LGDA 1K1DA 1ADSA 1YYAA 1H49A 1TWIA 4O53A 1UIPA 4KFPA 1XQLA 3WZ0E 4DBEA 1MEHA 3IK2A 4RUBA 3MSYA 4Z1AA 1BKHA 3W1AA 3W1NA 3RXZA 1MZRA 3SCVA 2VCAA 3B04A 1XBYA 3PZ9A 3CMGA 2IQTA 4H8HA 1O68A 4EXAA 2ISVA 1C90A 4BF5A 1Q45A 2I56A 2JF7A 3WJXA 4GI9A 2E7FA 1V08A 4GQRA 2YL9A 3PF3A 3ZXWA 3HMCA 3W22A 1E3XA 1EFZA 2JK2A 3WNKA 1TPWA 2FTYA 4LB3A 2FZ9A 2VZTA 3PNUA 1O94A 3CL8A 4JQAA 2CWXA 4NZCA 4Z08A 3E0VA 4Z2LA 2ZUUA 1XKYA 1BXBA 3S9ZA 1WX0A 2OQHA 3ZLGA 2EPKX 5FF0A 3H2NA 5JXQA 1PE1A 1GTHA 1V5XA 3QMTA 4GWEA 3SGZA 4WUIA 4JX5A 3INPA 1NH6A 5D8WA 5I0DA 2VCBA 4UQDA 2ZUTA 1YKWA 1OFRA 4I8YA 5CPMA 1IT0A 2VRJA 4IPJA 4DF0A 1I4NA 5A6JA 3P0WA 1GEQA 3C0QA 2CLFA 1W31A 3MS8A 4J7RA 2QCEA 4L1XA 4JIRA 3WQ6A 4UTUA 5DF0A 4XO6A 2FJUB 1PKNA 3ABZA 3GNDA 3I68A 1KO0A 4LALA 2OT1A 1JVNA 4BR1A 1W91A 4IUGA 2A4AA 3AIQA 4N2YA 2A5HA 1AMKA 4QP0A 4ASTA 3W3OA 3IUHA 2RKXA 4UNKA 5BCAA 2OR2A 2J24A 1GOOA 4ICMA 4HCLA 3NTYA 4X60A 2EJ1A 3B8IA 4AY1A 4X0VA 4RE3A 3UP8A 4EPDC 5A3HA 4YTTA 4RZ4A 1ONXA 4UFIA 3SFKA 3SN4A 1LLWA 1JUBA 4WIWA 3OLDA 1OYCA 1BVWA 3C61A 2HSAA 1KRMA 3CQIA 1K8XA 4OECA 3IUDA 4FX8A 3WNMA 3GFYA 4XD5A 3EA2A 3TQKA 3FNDA 3CIWA 1ME8A 3T2PA 1J5TA 3WQFA 3CHEA 3MTWA 1JL8A 4K2SA 3TFXA 3KRZA 2VEPA 1NDYA 4HHPA 1ISWA 1SZRA 1D3GA 1ZRQA 2PDYA 2WSYA 3RLGA 2PDJA 3DAQA 2XPKA 3H54A 4P61A 1OGSA 2VGBA 2NXIA 3F1QA 4PUKA 1JZ8A 5H2ZA 2PBGA 3ZVHA 4IISA 1XRFA 2NUXA 1E9LA 2PDHA 1KFEA 3RNDA 4U2YA 5E93A 4BF7A 2C16A 2AQWA 1H63A 1OGGA 3HV9A 4I7UA 3TOPA 4NYYA 2E40A 3WX7A 1V3HA 2QDDA 2NLYA 4ZE4A 1PYFA 1TWZA 3CYVA 1R3VA 2EKGA 3PJXA 2YL8A 4HIBA 2ESCA 4QQUA 4S3FA 3LHTA 1ZJIA 2E67A 2VXNA 3C2OA 1KB3A 3B03A 5G1YA 5CZ0A 4KFOA 4AD0A 5I3KA 3AMKA 1NIUA 3F2CA 4GH3A 2C1HA 3VU2A 4N6FA 4A8NA 5RUBA 1C8YA 2OKTA 3M47A 2R1LA 2YXXA 4NAFA 2Y63A 2WQDA 3EPOA 4JTRA 3B4YA 3MMWA 3CXOA 4K68A 1U1JA 2FMNA 1B30A 3GXPA 5BXRA 5CC3A 4N4PA 2BZNA 4OT7A 3P67A 3OTRA 3HQ1A 4XWUA 3NQDA 3GXIA 5T8GA 1BG9A 3ENLA 1TTIA 1TQJA 1XLIA 2VM8A 3L4TA 4G7EA 3W1LA 3NPXA 5C2CA 3VOJA 4DJDD 3AIRA 3AYVA 1P0DA 4AZIA 4PA8A 2CHRA 5IXEA 1VFFA 3NYZA 1R3QA 2YZ5A 1LBFA 3S5YA 4G9PA 3MUIA 1SUXA 1Z32X 1L9WA 4D2JA 2JGYA 4DXVA 1PDZA 1E6NA 3W7QA 1ZAHA 4HYVA 1YPFA 5CSYA 3DBPA 2WCGA 3FYYA 2Z1WA 4LVAA 2XVGA 2P88A 4DJDA 3POCA 3EWWA 5AC8A 1EIXA 3VINA 3EDDA 3KS6A 3PNZA 3RPTA 3HF3A 3CHVA 2RAGA 2ZVRA 1J0IA 1OY0A 3UXKA 4H9XA 3PBGA 3PBMA 1CDGA 3MSGA 1PTAA 1GPFA 3W83A 4RE4A 3DDMA 1EBHA 5DCBA 5G4HC 3FS2A 3KBSA 3W6LA 4DJEC 4M5PA 3RR4A 1UKOA 4JEJA 2HTMA 3SIZA 1C8XA 3BW3A 4URIA 4W84A 1LTDA 4PUDA 2YCIX 4IJRA 4HK7A 1V3JA 4O17A 1OINA 1UHVA 4GE8A 5HNUA 4R9XA 3HN3A 3ARUA 2X1TA 3WBEA 3OBEA 2D23A 5BMXA 1IE7C 4DBWA 1NWTA 5G4WA 3P5ZA 3KXQA 3TU9A 3DZ1A 1PJ9A 5KSWA 5EFDA 4UUIA 1V3LA 3UJSA 1IWBA 3H55A 3OB8A 2DZPA 2Y4SA 3DGBA 1NM9A 3C0SA 3DCPA 3XINA 3NL3A 3L2IA 1FQ0A 1HQTA 3E6EA 5CC6A 1XXXA 4IGNA 7A3HA 4N7QA 4GUIA 1FCVA 1J0JA 2QMJA 3PZIA 2QHAA 1QO5A 2G3MA 3W9ZA 3GC5A 1A47A 2WSQA 1DWAM 2V38A 3UPMA 3STFA 1H09A 3M1ZA 3VIJA 2QUTA 3LNMA 2PCEA 2YL5A 3LOTA 4WOZA 5C8BB 3VFCA 2PEVA 2NXGA 3O7UA 5I3IA 4WXYA 3DN5A 3FY1A 1H7RA 1GVOA 1QJWA 5LA2A 3RK8A 4DNHA 1M5WA 2DSZA 1SJCA 3SURA 5CC7A 1FWIC 1Y8BA 4UXDA 5A6TC 3GDLA 3VD3A 1GOKA 4QQ3A 3T42A 1RALA 3RHGA 3T09A 1XDLA 3P60A 5KZ6A 2WVTA 5F2GA 2GSJA 1BTMA 2H8XA 2VGFA 4H7CA 2V5LA 2NUYA 2PRLA 5FJIA 2VX7A 3OU8A 2CLMA 3H4XA 4K8HA 1BQCA 4JEQA 7XIMA 3HV8A 1O7AA 1ZTVA 3GXTA 2OGYA 4A3YA 2BVTA 1DIEA 4JTFA 4GCXA 4MKVA 1V8EA 3EWCA 3I3DA 4RE0A 1A5UA 5AC6A 3RLUA 1W56A 1UJQA 3LHVA 4Y8FA 3TQ0A 4ZEPA 3FKRA 3L66A 1FVPA 3FA3A 3QV9A 1OD8A 4GYFA 1WDSA 4JOMA 3W70A 4DEFA 2ZRWA 3NQ2A 4C60A 3WBXA 1XLEA 1T0OA 1ZJHA 3KL3A 3MA8A 3RRXA 3ZJ6A 2R8WA 3A5VA 2Y8VA 2OEJA 1VHCA 3LA4A 1LBLA 4LTSA 3A3HA 1DORA 4E4PA 3F5KA 3WLIA 1SR9A 1UR1A 2J79A 3PTMA 4B9ZA 4QLJA 1YPXA 1ITQA 1J5SA 5HWNA 1SW0A 1XPYA 3LBMA 1I0BA 4OHQA 1QATA 2QCNA 8CGTA 3KEHA 4JTAA 3LM7A 5CZSA 1W9VA 4PSPA 5ABHA 1EC9A 3LCGA 5LIXX 1ME7A 2HISA 1SYTA 1S38A 2R1MA 2C0AA 3BLDA 1NOWA 1OVDA 2BDQA 1X1OA 1JUKA 2W4XA 2GVGA 4LC8A 4NVTA 5DY3A 3WQVA 4ONVA 3BAKA 3D3AA 3V18A 3GHRA 2VC9A 4XBSA 4FI4A 1REQA 4OGZA 5EY5A 3HG2A 4US6A 1CGWA 4W8AA 4F48A 5C54A 4FNSA 1M65A 4WSHA 1AG1O 4WLCA 5AN7A 5I3DA 3NOEA 3C8FA 3C4UA 4HHLA 4IPPA 3BMVA 1F9CA 3S2MA 5HATA 3AHZA 4AX7A 1PYMA 4LF1A 4GUGA 1AVAA 1FXQA 1UKPA 2OYLA 3DG7A 3VKCA 1YTDA 1LRTA 3A5FA 1LP6A 4B90A 2V8ZA 3VM7A 3VDHA 1EX1A 5G4EA 3O0KA 3BLIA 2P1FA 4PMXA 4S2BA 4M6QA 3QC3A 1IZJA 1ALDA 4PBFA 3B8DA 2YCEA 3EYPA 3IJIA 5CLTA 2CZ5A 2NX1A 1FX6A 1V0LA 2PURA 5I3HA 5C6MA 2H9AA 5AVHA 4C6FA 2UV8G 3MB9A 1HKVA 2OWXA 1YTKA 3KRUA 1GW9A 4UCGA 3K46A 4DUOA 3HFYA 1WAUA 3FW6A 3WBAA 2WWDA 4JTGA 4NHVA 1G9HA 1W9PA 4RPQA 5EA9A 1IV8A 4NNAA 1W1YA 2FYMA 3FX4A 2EKCA 1JGIA 1Q6RA 5DEZA 2RFGA 2VVNA 5DANA 4O4VA 5F2MA 3TFCA 3OA5A 2O9OA 4S38A 3WQ4A 1L2UA 1GKPA 1OIFA 2PDKA 2VC5A 1K9EA 5M3WA 3FOKA 4H19A 4E4UA 4MNLA 5EB8A 2OLAA 2A7NA 1E71M 3KOZA 4Y8EA 3CUGA 1VJZA 1I2QA 4JNYA 5I3GA 1UUOA 2NQHA 3LCXA 3VDBA 4O16A 4LYRA 2OKOA 2E6YA 5D32A 3EWYA 3HJEA 3KWSA 3W82A 1PX8A 4NZFA 2QEZA 2W9MA 1TTJA 4PRTA 3LZ5A 3AAMA 4L65A 3QPZA 1RCOB 3FHAA 2ACRA 1P0NA 3GRIA 3WN6A 4IOTA 2VD9A 4P7QA 3TZNA 4CQDA 5J5DA 1S1PA 1POJA 4TU1A 4PBGA 1XIDA 1QOQA 2VVSA 4PL1A 3ATYA 3L5LA 3NM1A 5KZEA 2WPGA 2GUBA 4H9ZA 2SFPA 4D6CA 1J6OA 5DT5A 5F4XA 3MYOA 4NRRA 5TBOA 1UWQA 1PZ1A 1FHDA 3GH4A 1M3UA 1W3TA 1RP8A 4DWSC 2XN1A 3CZLA 4CCEA 2C18A 3AFBA 3ATZA 3VE7A 2RGLA 4CNOA 3TYDA 2VURA 2HNHA 5CSUA 3BJSA 3HGSA 4GIYA 1W3IA 2J88A 2AKMA 2Z7KA 1Q6GA 4QE4A 3H6OA 3H2EA 2EF9A 3LCIA 4BWLC 1G4SA 1UJPA 1B5TA 1W8GA 1QWGA 1E51A 3B8TA 1QHOA 1WE5A 4YWIA 4A8RA 1J96A 1DXIA 5KZDA 4JN6A 3LQLA 1J01A 1PL9A 1WXYA 2PF0A 4LBSA 2BHYA 3GDRA 3H2OA 1EP3A 1TPUA 2ZXBA 5BW6A 4GIAA 3LSCA 3P6LA 4IFKB 2XG9A 4JYFA 2OX4A 1JZ6A 3IJ7A 3BH4A 2DUAA 4ZMGA 3HPAA 5JH2A 4DZ5A 4D72A 3GIQA 4H9VA 2DPEA 1MSSA 4K3ZA 3ZT5A 2QKFA 1UIOA 2Z24A 4IQJA 3QGKC 3QOMA 4OKDA 1R9ZA 3FDKA 1QI2A 3V35A 2D2GA 3ME3A 2I14A 1U5JA 3GVVA 1KC7A 1W1IE 3F4DA 1Q63A 4NASA 3WYZA 1Q7MA 1EDGA 4XKYA 3NXLA 1WZAA 5ABEA 1TV2A 4Q8OA 3TEVA 1VLIA 2DVXA 1HJUA 4OFCA 1RBOB 3TSBA 1QHPA 3HPXA 2PLCA 2OO6A 4PCNA 2QDEA 3ZJ7A 3EWDA 3TMQA 3NPVA 1UD8A 2Y7GA 4HU3A 4B5VA 5E0FA 3WDPP 1B3VA 1VCFA 4Z1CA 4HNOA 4R53A 1NU5A 3AZSA 1PTDA 1CX9A 3UWEA 3UWQA 4MNMA 3M0KA 1JYWA 3SCQA 3FVMA 2CERA 2IUZA 2X41A 1MW2A 4D1JA 4CD4A 4MLJA 3TDFA 3GX9A 2NVCA 1QNSA 1DPMA 3FFSA 1ISZA 1QNVA 4IPLA 4ML4A