4H59A

Crystal structure of iron uptake abc transporter substrate-binding protein piaa from streptococcus pneumoniae canada mdr_19a bound to bis-tris propane
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
306
structure length
306
Chain Sequence
APDKIVLDHAFGQTILDKKPERVATIAWGNHDVALALGIVPVGFSKANYGVSADKGVLPWTEEKIKELNGKANLFDDLDGLNFEAISNSKPDVILAGYSGITKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDSKALGMEKEGDELIKNTEARISKELEKHPEIKGKIKGKKVLFTMINAADTSKFWIYTSKDPRANYLTDLGLVFPESLKEFESEDSFAKEISAEEANKINDADVIITYGDDKTLEALQKDPLLGKINAIKNGAVAVIPDNTPLAASCTPTPLSINYTIEEYLNLLGNACKNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of iron uptake ABC transporter substrate-binding protein PiaA from Streptococcus pneumoniae Canada MDR_19A bound to Bis-tris propane
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Iron-compound ABC transporter, iron compound-binding protein
total genus 99
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4h59A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4h59A02
2XDQB 5I4KA 4HN9A 4MX8A 5M34A 1TOAA 2PRSA 2R7AA 5CX1B 2XV1A 3AEUA 3TNYA 2X4LA 1M1NB 3AERB 3AESB 2WI8A 4G07A 4UTOA 4WNAA 1MIOB 1M34A 1QH8A 1QH1A 4OVKA 3ZKAA 2XUZA 3PSHA 4CL2A 1M1YA 3R5TA 2PS0A 4ND8A 3MWFA 2ETVA 1PSZA 4FKMA 4LJSA 2R79A 5KHLB 1XVLA 1N2ZA 1KARA 2AFHB 5CX1A 1K75A 2MINB 1EFDN 5KOJB 3K1AA 2XH8A 1FP4A 2O1EA 3PDIA 4WZBA 4FILA 4INOA 4WESB 1G21B 2OV1A 5GGYA 2M6KA 1K2VN 1K0FA 3R5SA 4M7OA 4MO9A 2PS3A 1K7SN 1MIOA 1QH8B 2XQVA 3LI2A 4N01A 5JG7A 4H0FA 1M1YB 2RG7A 3LHSA 5JPDA 3BE5A 5KOHA 1G20B 3EIXA 5M3BA 2Q8QA 2WHYA 3ZK7A 1PQ4A 3AEUB 3AEKB 4NNPA 5BVGA 3AEQA 3K1AB 4K3VA 4XPIA 1N4DA 2OGWA 1KAHA 2YNMD 3U7QB 5BVHB 4WZAA 3PDIB 2AFIB 4IRMA 5HX7A 1M1NA 2Q8PA 4WN9B 3AETB 4OXRA 4LS3A 2OV3A 4UTPA 3GI1A 3PSAA 3MINB 3AEQB 4TKUA 3AEKA 3ZK8A 1N2CA 1QGUA 2M6LA 5FLYA 4WZAB 4FNAA 2QI9F 3HJTA 4HMQA 4UDNA 4ND8B 5AFSA 5KOJA 1ESZA 1N4AA 4TKVB 3AETA 2XY4A 5HDQA 3AERA 3AESA 4WNAB 2AFIA 4XPIB 4FI3F 3CX3A 4WZBB 3TEFA 4GICA 5KOHB 2OSVA 2PS9A 3NU1A 4B8YA 1FP4B 3MWGA 5JOQA 3MINA 5M2QA 1M34B 4UDOA 4INPA 3EIWA 1KAEA 2YNMC 3TLKA 3MFQA 4TKUB 5B58T 5M29A 5BVHA 4HMOA 4WN9A 5CR9A 1G20A 4WESA 4OXQA 3ZTTA 4MLZA 5JJ5A 1H1LB 1N2CB 2XDQA 3G9QA 4PAGA 5BVGB 3HH8A 4G09A 3ZK9A 1H1LA 1G21A 2MINA 1QH1B 4NNOA 1L5HA 3UJPA 3U7QA 4TKVA 3BE6A 4PM4A 2AFHA 5GGXA 1QGUB 3MD9A 4H59A 4HMPA 4BBPA 4DBLE 2PHZA 3HXPA 1L5HB 4MDYA
chains in the Genus database with same CATH superfamily
4C3ZA 2GVDC 2JW5A 3TBHA 2JVKA 4C4XA 5CU7A 3AU9A 3DTTA 1K7FB 4LXXA 4FCTA 3HKBA 4JXJA 1ZK2A 1UC9A 3IVRA 3BN3A 2SBTA 3DBVO 1QO9A 3NWPA 2Q3JA 1ZA2A 5GOZA 2Q62A 1TA4A 1Z0UA 3FNBA 4PR3A 4X3PA 2EDAA 1OXBB 1X86B 1AURA 3MWFA 4IS2A 4YQFA 5DSTA 1U2PA 1TW2A 4LDQA 2IHJA 5MGNA 2XUGA 4DCGA 1ADFA 5DP1A 1ML3A 2WKSA 1A9TA 2PO7A 2WZQA 3WDKA 1KP9A 4CUZA 1NVUQ 4KITB 4LPKA 3FCSB 3N1UA 3AOGA 4U2FA 3CZPA 4KKXB 4XJVA 1LVGA 3B1JA 3FRHA 3KKQA 1MA3A 3AWIA 4L7VA 2RHTA 2WF9A 3EZ7A 4QGHA 4IYRA 2ZJ6A 4UUPA 5DBGA 3H9BA 5AIAA 5DNDA 4GGPA 1NVAA 4DQDA 1G1MA 2CLFB 1SBHA 4PTYA 5JANA 3LBIA 4GMFA 4KIFA 4Q21A 4H3HB 3AIIA 2HV8A 5J4KA 1SZDA 4KOAA 3T7DA 2O0JA 4FMBB 3MJEA 2AN1A 2D00A 1H9AA 1QG0A 2HF7A 3DMTA 3MJCA 1PWYE 5IAJA 2W42A 1Z28A 1RJ9B 3MTAA 3BGSA 3MEQA 3KO8A 3OT4A 1VB5A 4PLTA 4FX5A 1WKBA 4OYRA 4QYTA 4MLPA 4TWJA 5TJ9A 4XGKA 4P3YA 2G80A 2YN0A 4JDUA 1PNVA 4JJKA 2IXFA 4PE5B 4HK4A 1CKEA 1II9A 3MINB 3D4LA 2IQ5A 2N42A 1MTZA 1DAIA 4W5WA 1JEYA 4DABA 3UY4A 2J9ZB 4OSEA 2JATA 2N0SA 1YFJA 1DT3A 3FD8A 4LOJA 3ICQB 1UM9B 5JADA 3ZDRA 5EZYA 1V39A 2H2DA 2VK2A 3A3YA 3Q3IA 3W8FA 1DWPA 3FTFA 2QRZA 2GDJA 1UBLS 5KOJA 2LW7A 5EXDA 4C22A 1PNTA 3AETA 3CRW1 3QPUA 4JC5A 2A6PA 1AKYA 2QV0A 3KBBA 4LJLA 5CH3A 3ADBA 1Z56C 3EPLA 2WINI 3UG6A 3CVWA 1YXMA 4F4HA 3DBLB 4XIYA 4B35A 4Q4JB 2P0EA 1LX6A 4FS3A 3UAZA 5AP9A 4JENA 3B2NA 1ZEJA 3JQ8B 2FPRA 3VPAA 2WNHA 1YV9A 1D07A 1K6JA 2ZB7A 4ZHQF 3KT8A 3TD2A 2PBFA 1IL0A 2PIDA 3HKEB 1N6NA 4PYLA 3UH0A 4CMIA 3T3OA 2DTEA 1T36A 2PUGA 3QTBA 4AZ3A 3L46A 1SOUA 3PUZA 4FONA 1XAHA 4BUCA 4D3XA 2TSYB 2WF5A 3R6WA 2SKCA 2W6QA 5FI3A 1MHPA 5JECA 5BN1A 3JZMA 1I6MA 4R9RA 1JXOA 1L4BA 3HCWA 3WRYA 5JAHA 2O8EB 5FNVB 5MN5A 2CJYA 3N0TA 4Y2JA 1P0FA 1Q22A 1T8RA 5IVIA 4PYJA 3CWCA 4JA2A 1BMQA 3K2IA 3TD6A 1F14A 1UMCA 2ACVA 2GTHA 2PHZA 3HY3A 4DBLE 2JAXA 2E4VA 2ZJ0A 3LT4A 4E6PA 3D2LA 4O3MA 4O2AA 2WLSA 1KVTA 2F9MA 5SZIA 2F3QA 3OUUA 4R1LA 4DL9A 1PK7A 4OI0A 4ZTZB 1MEEA 4JLOA 2OMKA 4R84A 2C3PA 2WU0A 3E6AA 2QS9A 2MR5A 2BLLA 1DKUA 1ODCA 3HADA 4TYWA 2ASEA 2BP7A 3GN1A 5DBHX 4J6FA 1BO6A 3A7EA 3NVKI 3DEIA 1C3OB 3IBYA 3QKRB 3L6CA 3ANLA 4CW7A 5K8CA 4Y9TA 2W11A 3IV9A 4F9EA 3OIYA 3OM0A 2P1ZA 4BV8A 5JQGA 3CZRA 2DFVA 3D4BA 3ONNA 3I30X 4JBXA 1TM7E 4QQKA 4I6EA 2JGDA 3KLOA 1NG1A 4N8DA 4AZSA 3PDIA 4G6ZA 4CCAA 2XGSA 2VQEB 2H11A 2Y77A 4OV6B 1NNSA 2J6BA 1DEHA 2QRNA 4R0NA 1LPNA 2W8BB 2Y3IA 3P8ZA 2ZUWA 1MIOA 3FUXA 4AKTA 1C4OA 1D9XA 2IP1A 4L51A 4QULA 1I9GA 1AZLA 4OYHA 2IYWA 3I6ZA 3X1WA 3GZNB 5HW0A 1MQAA 2ORVA 2PUWA 4FW8A 4L57A 3ZCXA 3I6MA 1NY6A 3AEQA 4K3VA 1KGSA 4G63A 4HSEA 3DULA 4P82A 4X1YB 4JUDX 3DV2A 3OM8A 3FHTA 2IYVA 2IH2A 3I4FA 4E88A 1Y3DE 2APJA 1LPOA 2DOKA 4FD3A 4HFJA 2E4YA 1QS0B 2C4UA 1N2GA 3U56A 2ZR7A 1O87A 2TMDA 3TIVA 6CHYA 1QU3A 3I53A 5IBRA 3FUUA 4X6YA 5JDIC 2F90A 1HR0B 1K98A 4HEQA 1PEYA 2WHXA 5H02A 1E9VA 3Q3GE 2BF4A 3BB1A 4B44A 2H2FA 1VGVA 1WMFA 1B3RA 1C9EA 2P69A 1SVNA 4XX0A 3ZS8A 5TVKA 2FMUA 1KI8A 1UT6A 4DDVA 3NX4A 2V7VA 3DLBA 2HD4A 4WT7A 1PJLA 4LOAA 4CKXA 2GERA 1QG4A 2GPWA 3D4NA 4RU1A 3A36A 4HHEA 4KK3A 3VDQA 4DJAA 2DJIA 4HPJB 3RGGA 5IJXA 2DH5A 2CV0A 4JODA 4RW0A 1T0JB 3TLKA 1GRNA 1XTPA 4NBKA 1JIQA 5M29A 3VR3D 3T7EA 4JS0A 3PCTA 4GL4A 1T0IA 3K30A 3THXB 1R27A 1KQNA 1NLMA 1QH0A 1YDGA 4HDMA 4PG6A 5LA6A 1US8B 4WESA 4B3XA 5J4HA 1LRLA 2PT5A 4H7JA 1FS6A 2Q6OA 2QLLA 3ENVA 3M0EA 2GYYA 3VI4B 1IQ0A 4PZCA 3UKOA 4FC7A 4ZJUA 2WF7A 3HP4A 3OJFA 4D57A 5DV9A 5LOVA 5JNWA 5TGTA 1LKZA 3BWVA 1YIOA 4AKSA 1J00A 1N34B 5JCXA 4FHCA 1LDEA 4LSMA 4X44A 1R88A 1ZI8A 3VR4A 1LDMA 2EQBA 4TN5A 2BHTA 3VI3B 4ZDKA 1XCMA 2ATCA 3AVQA 1OBFO 4H1HA 5DBIA 2R44A 4I4IA 2P9ZA 3DW3X 3EASA 3HRIA 3SKXA 3CZ9A 2QL6A 4Z3DA 4Q1CA 1OI7A 4DV3B 1JG7A 3HYCA 2DSTA 4Q4JA 1SKBA 1JF8A 3PJRA 4O4JB 3TZLA 3QK7A 1GKLA 2IZOA 4N49A 2HWKA 4OHPA 3WGOA 2QUKA 4LSWA 4K3UA 2V4MA 1N3LA 1UKAA 2R6JA 4EECA 4EO7A 4PRLA 1ZVJA 4AULA 4CEHB 4TS4A 1J06A 4EMUA 5DB4A 1GPAA 4AZ0A 5A3VA 1W0CA 3UAVA 1JR3A 1KQFA 5FI0B 1KKLA 2GZAA 4M1TA 2BTEA 1ZFNA 4U0JA 1VG0B 3RC1A 2GZDA 2PZJA 5GY7A 4JX8A 4TLCA 3DDCA 3LX4A 4J75A 4RCVA 1XYGA 3V1YA 4D82A 5L8VA 1AZTA 2GCOA 4QJIA 1VHTA 2IEDA 4CDRA 1EX6A 3H86A 4PYMA 5L4LA 1L5VA 4MS1A 4BEWA 5JXHA 2FR1A 2AKAB 4BX3A 1RRMA 1QOQB 1NQVA 3T1TA 1NW5A 4C89A 2XKBA 3VTFA 5GVSA 3WRWA 3E1SA 2QZJA 2PGJA 1YS4A 4WOJA 3SM3A 4IIFA 4N48A 3L6DA 1WTAA 3FFWA 3M6MD 3PFWO 3QFRA 3KVOA 4KVAA 4XOIA 4F12A 5EP1A 2C8JA 1D6NA 2X15A 3GMTA 2I29A 3PCRB 1JIVA 4WVLA 2G76A 1IH8A 4PZDA 2JCGA 5FR1A 1WOYA 5DOVA 3TIIA 1XMPA 1PWEA 5IG2A 1Y42X 3GJ5A 2J0EA 3V46A 3DOOA 3KR1A 3SQOA 1SVUA 1UBRS 1WHSB 4OXXA 3DE3X 1OFIA 3H5IA 4MW0A 1RRKA 1N57A 1ZL2A 2IYPA 3ETJA 3KKEA 3KS9A 2XAUA 3ELWA 4O0LA 4F7WA 2C4WA 2NMVA 3FOWA 1A2BA 1T4DA 4YP1A 3NNDA 2QSZA 1ZLXA 1E3EA 4QA9A 1I7DA 2FZKA 2GJ9A 1SN7A 1PD0A 1QS0A 1BDMA 4E30A 3HCBA 1OJLA 3KOUA 3GXBA 2J6HA 1TIBA 1H94A 3FYDA 4D8YA 3R76A 1CDZA 1CQXA 2O3SA 2OSVA 2ZBDA 3KSUA 1HMYA 2RAPA 4OHOA 5J3JA 2XUPA 3GNTA 4E14A 3EPJA 2FSSA 3OZAA 4WK0B 2IZZA 3VAAA 3A9CA 4KRXA 4W5HA 2O7QA 1QK5A 1PR2A 4UPVA 3TR5A 2FTKE 4KFSA 2NT3A 2D4HA 2V7XA 3QLTA 2ZB8A 3EOZA 2WYUA 2Y1GA 3CJTA 4Q1VA 5HTKA 3KKMA 5KPJA 4KDEA 2G0TA 2PQ2A 3HO1A 5BYKA 4FFBA 2VG8A 3R8CA 1IYZA 4PZ0A 5JEDA 4DMRA 1W5SA 2NU9B 2J9YB 3SHQA 3TGWA 5PNTA 1QYDA 4QWMA 4BGEA 5JY1A 5JSZA 1JR3D 2FSIA 4OKSA 4PTLA 5IDYA 4AK9A 3VC3A 5LIRA 3OT5A 4E21A 1B8OA 1MAAA 4QDUA 4IXNA 1V5WA 1F7VA 4CNQA 5EWJA 1GPMA 4PM4A 4TV8B 1UJ6A 2BMJA 1XP5A 1K8QA 4JC0A 1WG8A 1VZ3A 4DLRA 621PA 4LY3A 1T5LA 3WE7A 1P6QA 2BIFA 5C81A 1JEAA 2GNOA 3AJ8A 5A2GA 3BMQA 3VM6A 4XGIA 2DF8A 4HZUB 4YDHB 3MUNA 5CW2A 2JA1A 2QGNA 4JOCA 4P83A 2ID9A 1RQ7A 2J3LA 3AERB 3L8GA 5FCDA 1TYZA 1I01A 3Q7EA 2CV2A 2WDPA 3QI2A 3AR7A 3SBDA 5BN5A 1QGAA 3RFVA 5FJJA 1ZJ6A 1KU0A 3O1IC 1RTKA 3KX2A 3EVCA 3FTQA 1TKCA 1T26A 4UFOA 5EP2A 4WK4B 3C3YA 3CNOA 4ZV4A 4FOOA 2FPSA 3OF3A 5DT2A 2HBYA 4BNXA 2XOKA 4CT5A 2QD1A 4R4JA 2A1IA 2ECQA 3WLFA 4ER0A 4MKFA 1BEZA 1X7XB 2I2XB 1WBJB 3ZW7A 1Y9EA 1T43A 5I51A 3HJBA 1CB7A 1W36C 3U9TA 1MQ9A 4EA8A 3VBCA 2PX6A 1VPDA 5TMBA 3ZWWA 2C1EA 3ETCA 2PR7A 1LK0A 4RE6A 5EWJB 2ZT7A 3TOSA 4KHPB 1C9JA 1ZOOA 1W1IA 2UZ0A 4UHCA 1SG0A 2HJWA 2VXOA 3FVVA 3NDPA 5EQFA 3RU3A 3R74A 4KE7A 5AI4A 2VUUA 1R5BA 2YHIB 2IH5A 1GGNA 4BEJA 3NDRA 4Y9SA 2YY7A 4WZAE 2C3MA 5HE8A 1N1EA 2BAGA 2X3FA 2VJCA 3LGXA 4UU7A 4ZMRA 2ZR8A 3ZWDA 1ZISA 3KWLA 4KQIA 4LDRA 5L7YA 4KDCA 2EX0A 2VPTA 3QF4B 5C1OA 2IIPA 1HTWA 4QHTA 5E6SB 4KSBA 5EL0A 1EYZA 5JS7A 2C5AA 3V48A 2ZZKA 3LL4A 2ZUFA 2NV2B 4DEYA 4MGZR 2YWGA 5ALWA 2OD2A 5HR5A 4DQLA 5JVDF 1V26A 3UT0A 1MMFB 2OCKA 4CLDA 4ZDJA 4AZVA 2XCUA 2AZXA 1D8TA 2VP4A 3N74A 1DO8A 3NCHA 4HADA 1BMFD 1K4YA 1PJ2A 1CB0A 3KL4A 5EJMA 3P9YA 3TRIA 4BMXA 1RABA 4B3GA 4INAA 2O0KA 3EXHA 4UVIA 3SZLA 1Y37A 3QX8A 4JVSB 3CINA 2G71A 3ITKA 1OHHA 4BIMA 4ZA2A 2WAOA 1BD4A 1YB2A 5DZSA 3VKGA 4WZBB 2E6UX 3S2GA 4BGDA 4EDHA 3AL3A 3AVPA 1QTIA 4YHHB 1IXKA 3C6ZA 5DYWA 5G53C 1MGOA 1ZKDA 2J9FA 1GTVA 1E8DA 2EJWA 3ZCTA 2XWJI 3QVLA 5BSVA 3QX7A 2DG2A 3I1JA 3VFDA 4DJJA 4NBVA 4PONA 3L43A 2C94A 3LLSA 4UFNA 2ZYSA 1BE0A 4YLGA 2BMAA 2W6IA 3KRTA 4X6UA 3ZLTA 3MWYW 4N76A 1V25A 3SLRA 5LA6F 4HH1A 3RVMA 3S1AB 3L3BA 5EWLB 4QJ5A 1ZHFA 5HOEA 3OZIA 2Z4TA 3HU3A 3RK0A 2J6IA 3ANXA 3QE3A 3CUUA 4JLMA 3CKKA 2Q1XA 5LQDA 3TVTA 3VU3A 1ISGA 1UFRA 3HDYA 4NJEA 5HGJA 1JNYA 5HDBB 4BGUA 4AKEA 5K20A 5JCZA 1Q3TA 1TZCA 4CEJB 1I14A 1E3SA 2DH6A 4UM9B 1DBVO 1GNSA 1QPZA 1GL3A 2H4HA 5I47A 2H9AA 2E4AA 4MX8A 4BAZA 2O8BB 4JP1A 4FFRA 1TOAA 2JA2A 1C4KA 1H2YA 5LB2A 4J43A 1VPVA 4ERXA 2R6AA 3NG1A 2WAMA 2VF5X 4MIKA 4GQIA 4PWYA 5FOXA 4GMGA 4UUMA 3CM0A 4DADA 3U44B 2J3QA 2OZLB 3ZBTA 2YH2A 1PVDA 2YYSA 4WJKB 3MILA 5TR9A 3RH0A 2FJUA 3G7SA 4RQUA 4CQLB 4R3WA 3EF3A 5AM2A 1GILA 1P39A 3RGWS 4MQ4A 1PJZA 3QTTA 4FXPA 4RVGA 1G2OA 1P4JA 3C74A 4MW5A 1ODSA 1SCQA 2WTMA 5AESA 5EJFA 1AU9A 4RPLA 3AI7A 3KTOA 3NANA 4RO0A 2C8LA 2NSHA 1Q7EA 3B7PA 2GEVA 4HEA1 1OC2A 1I4EB 1KEVA 3F5DA 4CN9A 4TZ0A 1O03A 4D8VA 1YE3A 2J9GA 4QOEA 1W44A 4HUJA 2VPXA 2BUBA 3MMXA 4HNHA 1SUCA 2QR5A 3NUQA 3JWPA 1WWKA 2ORWA 3R5SA 3SYTA 3HY6A 1M7BA 4D3YA 1GZUA 5HUHA 4GECA 2O3UA 3VSDA 4C4TA 4TVBA 5KJ6A 3A4LA 4TV8F 3HE3A 5KYWB 4ZQIA 5T6BA 4HVTA 3NHSA 4ESVA 4F06A 4X7RA 3H8WA 4NNPA 4W9MC 1TYDE 4WXRA 1J0AA 1E79A 1HTTA 2SNIE 1HEIA 3WL6A 1NLYA 2E6KA 3EGCA 4BPRA 2RHLA 5CJJA 4NKRA 4P7FA 5DWVA 1YRLA 3EUFA 3DKVA 3G5AA 3ZCPA 4BVFA 2HLPA 4PHGA 4X61A 5FL3A 4BX2A 3F6SA 5F1KA 1LWOA 5LP6C 3V4FA 3GPLA 1C8KA 4K2AA 3AL0C 2C5LA 4JH0A 1RWOA 3OAAA 2QLTA 4Z0TA 3FUCA 1BCRB 1STOA 1XQXA 2LCIA 3I73A 3JAKB 3MRVA 5AUOB 2PFSA 1JWLA 1E6EA 1EIZA 3V1KA 2BFDB 4A8PA 4ALJA 3WV5A 2G8NA 4LVNA 1HUQA 2XMZA 3HVIA 3OO0A 1XA3A 3EF1A 4HRVA 5FWXA 1ORHA 2DPYA 2YRXA 4A16A 2CCKA 3O2JA 4FSHA 3SG0A 1JDPA 3ILVA 3G02A 4HOYA 3EY4A 2BR4A 3DOHA 4RSRA 3E58A 4HH3C 3PQ6A 1VHQA 1XEXA 2CNLA 3SZRA 1D0VA 5AUNB 3RHFA 3TLCA 3G2JA 4C01A 2NU7B 9ABPA 3DAFA 3DO8A 4M0KA 1N5KA 4RKQA 4TZKA 5BVHA 4LHSA 3LXXA 3MYYA 3R3XA 3MLBA 1WKVA 1NNEA 2IYUA 5ALZA 2XUKA 4WN3A 5KDDA 3F8SA 3H0CA 3V4SA 1N1GA 1E1QD 3ZHVA 3FJ1A 3JQBC 3HSKA 3V7YA 4E4YA 2W93A 1TVEA 1UXOA 2ZOSA 3GFPA 4OAPA 2QT1A 2H1LA 1A7UA 3QTLA 1G21A 4EB8A 4LV5B 3CVUA 2J87A 3KQLA 3ZV4A 1L7PA 4LW8A 1RYEA 4ISBA 2RIPA 2XTJA 1RT9A 1SELA 4B32A 4XX1A 1T8YA 3FKSD 1N5IA 1IRIA 2B8NA 2PRSA 5CNKA 2BT4A 3GZ4A 2JFFA 3C6KA 3K5IA 5LNK6 1A72A 3ET5A 1ZSVA 3KT6A 1YA4A 4J1SA 3SC2A 3Q7IA 2XZPA 3JQFC 3U7IA 2YS6A 5ICMA 5GZ1A 2J5KA 1IN8A 4MROA 5AXCA 4EP1A 3DF7A 5GM2A 4EEZA 4HWSA 5CLLA 1N2ZA 1X80B 3JQAB 1PS9A 2RK6A 1Z13A 1KZGB 3A2MA 1DTEA 5E3JA 4BMDA 4DG9A 2O8FB 4EBBA 4JT8A 1RNLA 3P2YA 2RKWA 3ACBA 4FEEA 2R751 2EJVA 3L01A 5BN3A 3BE8A 3A8TA 1VDZA 3TSOA 4BLVA 1XKTA 3MD0A 3ZPXA 1SXIA 2PWAA 4DBZA 3QOWA 4YJ2A 3ZHSA 3GDHA 3ZU6A 2G83A 2WJYA 3AR8A 1Z15A 1CUEA 3GCXA 4F04A 4YAIA 3H42B 3EZYA 4TSFA 4NCBA 1M6VB 1NPTO 3CSDA 3GYBA 4GWGA 4ZVLA 4EZIA 4AI6A 5LQUA 2QTGA 3PX7A 2Q8QA 4HAWA 4R1MA 3UA3A 1USWA 1ONOA 1RKVA 4BFTA 1CY1A 2H1FA 3OEED 4HLCA 4B4UA 4BFUA 2FMTA 2GRUA 3K1AB 3HU2A 3K20A 3ZJYA 1LSSA 1OBCA 1YRQA 5JROA 3ZGZA 3H4MA 1X19A 4HLDA 4HN4B 4G5GA 2XODA 3H13A 2GHTA 2I6XA 4Q03A 4BGVA 1ZH8A 1YS7A 1RQXA 4JMPA 2Z5GA 2I8AA 4K8OA 5EKSA 4DDMA 1GGVA 4U7DA 2PIAA 4ZTUB 1U0OC 3A32A 4AFNA 1VLMA 2QUBA 4I1UA 4JQOA 3TLBA 4K6MA 3R3SA 4TN1A 2AVNA 1GUDA 4JASB 5EEHA 2FJPA 5I9MA 3L04A 1FDSA 1MP0A 3L41A 2YJGA 4PC1A 1P7YA 2VPWA 3P0HA 3FKQA 4ON9A 4UQOA 2VTEA 1YR9A 3WKDA 4TS9A 1P7CA 1V35A 1P44A 5HIMA 3RI3A 1TPYA 5L3SB 2AFIA 1J42A 3OF5A 1PL0A 2BFMA 4B6PA 3E5MA 1UDWA 1HXHA 4UQLA 3NASA 4PZ9A 2Q0QA 3BD8A 2PANA 2GZSA 4P4GA 4KXUA 2H06A 3OZXA 1L8LA 2VL7A 3DHVA 4HDKB 3T1QA 1GG9A 3PITA 1DX9A 2G9ZA 4H6XA 2IUUA 2BGTA 5KWIA 3PTLA 3BORA 2GEDA 2PEZA 3DZDA 1KORA 3IE2A 1G6Q1 3D5QA 1G63A 4KFTA 2XZOA 3OJLA 4ID9A 4RH3A 5A4MS 1KJYA 1XLWA 3TDKA 1RWQA 2DFNA 1MXHA 2VXYA 3KAKA 3P32A 1LDNA 1E7RA 4OXQA 4ZOAA 3T5AA 1HI9A 3FRJA 1P0CA 2JLZA 1H1LB 5E9JA 2F48A 1I2CA 3R7FA 3ZH9B 4BRSA 3C7DB 2VDQB 1D04A 1MEJA 1N2HA 1OI3A 1OYOA 1C50A 2O2SA 3GUCA 4FQ7A 1ULHA 3TRFA 3BL6A 4I1IA 2QSUA 3HWWA 1QH1B 1VSUA 2AWNA 4HXGA 1FFYA 2R48A 2NSLA 1FDRA 3V6LA 3GJXC 1I8TA 4GYWA 4KTVE 3QE2A 5BSMA 3G2IA 2NU8B 1ZK1A 4HEJA 2SICE 3V4ZA 2Z9CA 5F21A 3TTWA 3ZWYA 3RSGA 1NHGA 3O8RA 2XV1A 1E61A 2OLEA 2I54A 5FTJA 5HIKA 1Z2EA 3UMVA 2XYQA 4YFYA 4DANA 1UBJS 2GAJA 1GUAA 1BX1A 5BOSB 3PVCA 1MB3A 1U3DA 3PT5A 3PQ7A 3KP1A 4GM4A 4Z6KA 1EFPA 2AXNA 4FGJA 1OX4A 4G1VA 4NPHA 3VTKA 3TW6A 3VZQA 3R3ZA 1FW6A 3LYHA 3LMKA 5DTEA 5EWMA 4O4IA 1JSZA 3JQGA 2AN4A 1GLNA 2JGDB 4N4AA 2PMBA 4QQNA 5HJ2A 3VDNB 3R2JA 4ARZA 5FXMA 3MLEA 4B3BA 2WD7A 3ZDYB 3RABA 2WHQA 4C4PA 4CQMD 1CJBA 2ECPA 3Q98A 2BGMA 4QDXA 1RAHA 4WDQA 1YHYA 4OXIA 4XYMA 3CO0S 4C29A 3GLSA 3HP7A 4DXHA 4BKQA 4FFLA 5KOHA 1SXPA 1YL6A 2I1WA 2VPQA 4C0AC 4E15A 1B8NA 4J2TA 1NJ8A 4YAEA 1MZPA 1OB2A 1NW3A 1C9KA 3N86A 5KAMA 1QANA 1Z5UA 2X4GA 4XVCA 1H8ED 4FR0A 2ZUTA 3GLHA 1NMZA 2ZJ4A 3GJTA 2OBYA 4XYBA 2AK2A 3BXEA 1WXWA 3VHRA 3OVMA 1DAHA 1C14A 1EE1A 1PJ3A 4R8MA 1QRRA 1W0JA 1JMKC 4QYMA 3HBJA 5AJTA 3AUSA 3C8ZA 1ZG3A 4WOPA 4CCYA 3VDXA 3UHAA 1U7OA 2ZIGA 5THXA 4ZOLF 4X90A 4YJ3F 3O83A 1QPGA 2J9RA 2CUNA 1WCIA 4G5QA 4F84A 4LNUB 5L45A 4CLOA 3LRTA 4MIYA 2DR3A 1E79D 2BJVA 3A4MA 4GSYA 3MWJA 4K5QA 3VKWA 2OBBA 3GIDA 5T5QA 2IK8A 1M66A 2SCUA 4N5DA 2NO4A 1KPIA 2Q9BA 3BIFA 4MGYR 1SCNE 3N8NA 3P4XA 4O2LA 4EEXA 5CA1B 1VL0A 1WLSA 2FK8A 4GICA 5LKAA 2BKLA 1CVIA 2CVFA 2VA8A 3UICA 2ZYIA 3AI2A 2WTNA 4GOXA 4LK3A 1CNFA 1GZDA 4GI2A 1IB6A 4GLLA 3CTMA 4UARA 3HSSA 1WPRA 2PA0A 4NZNA 1MT3A 3I09A 1GSOA 1I10A 1G5FA 2ILVA 3C3AA 1UIRA 3ROEA 1Y5IA 5AHKA 3I45A 3X1MA 2C9CA 3FHJA 3INNA 3BXZA 4RVNA 4ZT5A 2YJ4A 4MQ5A 3PP8A 1KMHB 5AW5A 3RB8A 3T0FA 1U3VA 1FSSA 2JB9A 4ND5A 4NJMB 2YC4C 4TMWA 4BZWA 3FROA 1N2CB 5JS1A 1KRHA 1AKEA 1DKOA 2PA3A 2VHQA 2ZT8A 3ND9A 3TW0A 3UB3A 4B84A 2GNAA 4D80A 1BOFA 1ODIA 5H70A 1SKQA 1PO7A 1L5HA 4DV0B 5GPBA 3VHQA 1TTQB 3KJIA 3JALB 1WNTA 2W2QA 2R7KA 4PW0A 3V7UA 4H16A 3VNQA 5KHLB 3BSSA 3QEKA 5CD9A 1TAUA 4PVCA 1QVRA 2HA2A 2W58A 3M8KA 3RUAA 2QVXX 2E89A 2FZWA 4R16A 3ZG6A 4MZXA 2VHXA 1TF5A 4IMJB 4W6QA 1VL5A 1S7GA 2ZAMA 3N0RA 1UXJA 4NBLA 4R7TA 1T6BY 2RBGA 5HF9A 1XRQA 2HRBA 3RT9A 4C7KA 4W9NC 3DC7A 1U3GA 1WE2A 1OW3B 3D2CA 4ZO8A 3WZMA 4P86A 1NVBA 1XKQA 4ZU1X 2C1ZA 1QB7A 4RJJA 2HF2A 2TRSB 2PVPA 3TMKA 2YFQA 3HB1A 5BT8A 2NVOA 4DA9A 1P2SA 1PEDA 2FRDC 3I9MA 2VYVD 4ME6A 1LLCA 1XF9A 2UDPA 4YJ3B 1EHCA 1Z0DA 2JHFA 3FDJA 5IJ0B 4MQBA 2Q5LA 1DCTA 4YIKA 3Q0TA 1LS1A 4YECA 1YTUA 4F46A 4UEQA 5KKNB 2H07A 4PX9A 3PNBA 4TYNA 2A94A 2MJLA 5FO0A 1JALA 2A7QA 2ZVQX 4MPJA 2B35A 4PZLA 2M6KA 2A84A 4X94A 2JJ2A 3JRWA 4FBGA 4V0NA 3GNSA 3BDIA 1RWXA 2X2EA 4FCCA 1JAZA 1M1YB 2GA9A 3U0BA 2EBUA 3PA8A 1UAYA 3BSYA 4KX5A 5ENVA 5FL7D 4FYXA 3ULKA 1ZMBA 1PHPA 1PNQA 3JYNA 4KUEA 1PYDA 4EB0A 3B6ZA 3KT3A 2WM8A 4I4TF 1PJQA 4JX9A 3CW8X 3I42A 4LOIA 3FJOA 5ADUS 2AMJA 5JSHA 3GLGE 5AVXA 2PXHA 5LQKA 1B42A 3GQBA 5KNCH 3FAKA 2GYUA 5L53A 2PPVA 3KUKA 1FVXA 2BDTA 3BWMA 1I80A 2PMCA 4TMVA 3KJZA 3Q0EA 1XU7A 4R8VA 3RC7A 3R40A 1XZPA 1N8NA 1URPA 2BONA 4GMHA 5L3QB 4G0VA 2Z08A 2V3VA 4GZ3A 5J9FA 5IVHA 3UUEA 5J5AA 1F2UB 2IHZA 2PYZA 4N3BA 4AJNA 2FWPA 2ZE5A 1Q1NA 4P54A 3L0ZA 4P35A 1EWTA 3AJDA 1UFQA 4UJ3A 4KLZA 1RKXA 5J4VA 4KXQA 4JP5A 3CYFA 4OD0A 4UBNA 5E1DA 2O0LA 2VPIA 5T8KA 1KAQA 1UZAA 4US1R 3TE6A 5KU7A 1ZH0A 3GLIA 1W48A 1ENZA 3CX8A 5D7NA 5HDQA 4EO4A 3NOVA 3R5FA 4F9TA 1NE2A 1ZM2A 3TQQA 3WNZA 1RPJA 5JXGA 1U8CB 3CKLA 3CQ9A 3DAOA 3TQOA 1S3IA 4D3SA 1HSOA 1HYHA 1Q0HA 4IMRA 2YIDA 4WERA 5K0EA 5KWJA 4W6ZA 4PS0A 4KPFC 3WGQA 2FNAA 5I7WA 1YVUA 4HSGA 1KO4A 5C32A 2PH5A 1A71A 2ZJ7A 1WO8A 2IU0A 1OFUA 4N8EA 1E89A 2I22A 2Y92A 3ZKWA 2DUMA 2J41A 5FA6A 5MFZA 1RVDA 5FWNA 1R4NA 3IO5A 1EXVA 4FOLA 1UF9A 3IHKA 2Z30A 3OLVA 1XQWA 1K3FA 4MLZA 3SMQA 4XUCA 2QAIA 3ZBQA 2OVBA 4UCWA 1XLVA 2PUAA 1Z37A 3EVGA 3OOWA 5KNBD 5I01A 1C7ZA 1C9YA 1A5AB 4RTMA 2OKCA 1U1GA 2QUHA 3ANNA 3TKYA 5CLFA 1JIIA 5ALQA 5EHXA 2DHEA 4BFCA 3ZY5A 2RHRA 4ERNA 4WJLA 5HZKA 1IIRA 1UKVY 3JVVA 4TUYB 5DLDA 3LM8A 2OO5C 3NCTA 4K1XA 3LQ1A 3TOXA 4Q3CA 3S8YA 4OYYA 1L5NA 5KQPA 5I4KA 3K5WA 2PRKA 3W3ZB 1KJNA 5ELMA 2VN8A 4IXTA 1DJPA 3R8XA 2W22A 5CFOA 3E7PA 1G8FA 2OHGA 3SDZA 3BD6A 5DM0A 1S02A 3G2KA 1FTSA 2OCGA 1HL3A 1TCAA 2OMEA 2WU3A 3LP8A 5CCBA 4RZUA 2ZJ8A 1IBRA 1ZVMA 3D3JA 4S3MA 1CUVA 2AR7A 1CY2A 2AUNA 2N9UA 3D8RA 3O8DA 4G89A 4RLFA 3CH4B 4NAVA 2F3PA 3BKWA 1VOTA 1T5TA 4YNBA 5ITZB 5KI6A 1EFKA 2HMYB 2X77A 3CIFA 3PRHA 3ELDA 1A69A 4O4HF 4C0SA 1CY7A 3AGQA 4RGVA 1IN4A 4F60A 2PGLA 1YR8A 4IHJF 4Y2XA 4ZVQA 5AM3A 1FE8A 3A0UA 2YWCA 4H7FA 4OA8A 2A7XA 3PEUA 4IIYA 1HYQA 1P1KA 1UBSB 4LYDA 1T29A 1OKKD 4I99A 4X64B 4CM6A 5A2QA 2P30A 1TT5A 1P3Y1 1WQ3A 1J22A 4Q12A 3W7VA 3BWXA 3FPCA 1GAQA 2WHEA 4M89A 1G20B 1I6LA 2RHCA 3ZY6A 5HJEA 4N5LA 2HC9A 1FUUA 3ESAA 3MTBA 1NBME 4TXLA 2XTAA 3HBNA 1CX9B 1PG0A 3G59A 3C15C 3AONB 5JNRA 4EHNA 5CHEA 5ULLA 3D0OA 4QGGA 4KQKA 4QO8A 2Q3CA 3PFGA 2NN3C 3DTVB 3USZA 2P9HA 1KAHA 1TIKA 4KNYA 3AFIA 3IMEA 2FCRA 3N6RA 1W9HA 3LLCA 1VHWA 4M0MA 2H3EA 2NZ8A 2BGLA 4DCOA 4KLNA 4KVFA 5G3ZA 5B1DA 3ZHTA 1P0QA 4HD8A 2FAXA 3SZ3A 4YJ3A 2ZSUA 4JP2A 5MGBA 4F6RA 3SQWA 5IT4A 2QIPA 3I1YA 1ZRHA 1A9RA 1YQ9A 2HK9A 2I55A 2LKCA 4UBOA 1W19A 2WYOA 2FPUA 1UANA 4LC1A 1N0IA 4M1EA 4EJ2A 5HGXA 1Y8RB 5CT5A 4ROTA 3WYAA 1BMTA 5AVQA 3V00A 1T4MA 2PD6A 3HB0A 4KXNA 5C8YF 2P6MA 3JZAA 1XQYA 3U4HA 1ORRA 3BTUA 1CJSA 2DP4E 2EZUA 5LBIA 3L6UA 3BXHA 3CR7A 3OE7D 5CURA 2BUAA 3PE3A 5CPBA 4ZT3A 4E07A 4EY6A 4L5BA 3GAMA 1JDUA 1Q11A 2HH9A 3DWGA 3UF0A 3CPEA 5DMXA 4BDTA 1VL1A 4LFBB 2Z56A 1QP4A 4HXFB 4UHFA 2O4UX 3JZFA 3PDJA 4F9FA 4XJXA 4FMPA 4PN7A 2Y67A 5DSZA 5KO2A 3EXIA 2GD0A 4YV1A 1E9AA 3IA7A 4X85A 1O95C 3CLUD 2FMXA 4BMVA 2OGSA 4LXGA 4WRRA 2O8DB 1HG1A 3FB1A 2PLFA 1MTOA 1P4AA 3QU4A 4WLNA 3NTXA 5HMLA 2NPFA 2L19A 1XJ5A 2G6TA 1P7ZA 2P41A 3ZHZA 5EQDA 1RKUA 2EF1A 2C4KA 4OKNA 1UKCA 3SPXA 4BB5A 1YJ5A 1U6JA 1QR6A 3EN0A 4CVNA 4DR6B 1DKLA 2C4HA 2WAYA 1NTRA 1SK8A 1NBOA 1ZIPA 3DOIA 5DCUA 1XTSA 1I0LA 7AT1A 2BE9A 2NU6B 4IDFA 1NRIA 4LY6A 3THOA 1NYQA 2Q1YA 1AE1A 1VKNA 3DDSA 5FB3A 5TPWA 3ZE9A 4OATA 4RWZA 3VSEA 3R5JA 1FSGA 4ARUA 5JD6A 5GIPE 3E81A 4R7ZA 1FDIA 5BORA 3LKBA 2D54A 4O2BB 4PZUA 4K0RA 4BV2A 3A26A 1DP4A 4LHZA 1AD2A 4FWIB 1Q74A 1TZBA 2MU1A 2YJ3A 5KQGA 3FMGA 4RLQA 2FCAA 1GADO 1ZM4A 3BWBA 4RANA 1RZRA 2DFLA 5LNK1 5HIAA 1JKFA 2C78A 3QELB 5KHAA 3U5ZB 2B21A 4EENA 2DHDA 3IAS1 2NPIA 3MIZA 1CQWA 1V11A 4OQXA 5EE5B 3VAYA 3HFRA 4PPNA 4AQYB 3R7WB 4QFCA 2D4AA 3THRA 5B2FA 2PLWA 4HJXA 3AVUA 2GWHA 3FE2A 1MDFA 4INOA 4ZO9A 5DW3A 1KAOA 1KC1A 4EX7A 4K9DA 1PJBA 1XD2A 2J5QA 1ZUD1 2QX9A 3KQQA 3P19A 3KZMA 1HNNA 1ECGA 1ZX1A 5BOSA 2P4QA 3EXG1 4TKMA 5CXXA 4KGDA 5G1PA 1HLGA 4OOEA 5BYAA 4KREA 2V8OA 1UP7A 3LH5A 5EHGA 1BU8A 3VKHA 3X1DA 3ZWBA 3QA3E 4TS3A 1CRQA 1C9DB 1OZAA 1OHHD 2O2EA 4U00A 4X91A 2FZVA 4EUFA 2R62A 1F0NA 4O63O 4J7CA 2QVLA 4KXWA 4JLNA 2GXAA 2J07A 2VH1A 1SCUA 3JQQA 2QTZA 3X0DA 1DBIA 4PC3A 1USUA 2XQFA 1KSHA 2EP5A 2GARA 2YASA 5DHFA 5E6UA 5HTOA 2WIGA 3STHA 1YQXA 4HG2A 4DR5B 4A3SA 2QN1A 3S1LA 1PVVA 3FR7A 5K3OA 2Q1SA 4UDNA 1VE3A 1XCGB 3R0IA 3V8VA 3PRYA 4BJHB 3OT1A 3OJOA 4DYVA 4XASA 2IIQA 1VLZA 3UXYA 4P4SA 1TAGA 3I2YX 1TUBB 1YL5A 3PU6A 3G89A 4KXYA 2C58A 3A1VA 3NHUA 2Q4EA 1O9HA 2J08A 1YKGA 4JKIA 1Z4KA 3BMCA 3KKLA 3DWEX 2X2FA 4HAOA 4E1AA 2WFAA 3ELUA 4NJOA 2FUG6 1N6OA 4JJ8A 4CNBA 1W1WA 5A3JA 1GL9B 3UMFA 1KQ3A 3MJVA 4IZ6A 1JSXA 4B7XA 1Q21A 1E3IA 3SGLA 4CTMA 3ZVMA 1M1XB 3F6PA 3M6UA 4S1NA 2VYCA 3AW9A 1KWKA 1SUSA 1Y3FE 2H17A 3GN2A 2JCXA 4AXXA 1NF2A 3A9SA 3LY8A 1V9CA 5EIFA 4E7PA 1L5LA 2FJ0A 1JBEA 3G7UA 3NM4A 3STXA 2WPNA 4X6LA 1MC8A 4RHEA 5EXXA 4YRRA 3IUSA 3B82A 2JLVA 4MJXA 3TJZA 4Q3BA 3VR5A 1QQTA 3AR2A 2GJ8A 2G9VA 4FD2A 1EFPB 4N12A 4XR4A 4DAEA 5DP2A 3N8IA 3OMLA 3CN9A 2HJRA 1IZ9A 1V7CA 4RVFA 1EFTA 3W8DA 4AZ3B 4D46A 2IX3A 2ZXUA 2HJ9A 4ZQFA 2WIBA 5TF0A 1ZMXA 4C08A 3PUIA 1PF7E 5K6AA 1J33A 1G291 1YS6A 3GLVA 3HFGA 2I4OA 5TY0A 4M22A 1N2XA 4EY8A 2E5WA 4Q0MA 4EPTA 1XLTA 3GD5A 3KOMA 2ADFA 3WXBA 1U5CA 1VECA 3NIFB 1R6VA 1RJDA 5KKAA 3R9IA 3LUPA 3VJLA 7REQA 3HRHA 3VR1A 5COBA 2AH5A 1UJBA 2YYYA 5ERGB 3F47A 1J4AA 3BIOA 1KEWA 4XYLA 4EVSA 1I5OA 5E2IA 3ONFA 5TDHA 5AXAA 4YJ2B 4DIOA 1CDOA 3VISA 4IBOA 3FIJA 3IRUA 2AX4A 5BSUA 1L7BA 2O2JA 3FHCB 1IDN1 4EUNA 1P4SA 4DGSA 3ILHA 5CFZA 2H7CA 4DHWA 3QXJA 4IHJA 3TFQA 4EG0A 3IFSA 4JZYA 3ASZA 4MRVA 3WKBA 2A1UA 2O48X 4G4SO 3JQAA 3N9IA 3PUWA 4R98A 5D1HA 5JQGF 1AQUA 2JKZA 5E38A 1DJOA 2ZDGA 4UFPA 4Z5XA 5B7PA 4Z86A 2JGIA 4PGHA 1CZHA 1DHTA 3GB9A 5FUVA 5AOCA 3MW8A 2NU7A 4MAAA 2QG4A 3GFVA 1RM4A 1XCOA 3A4VA 3VMMA 2RI1A 3ZXIA 3LKZA 4B6FA 4FYYA 3QKUA 3IXQA 3QPDA 2XQKA 3QUSA 1OIVA 4H6VA 4I1OA 4OSOA 2N1BA 2NZJA 4WKPA 5SYNA 4OI1A 1PD1A 1WSDA 5H5JA 3I6YA 4R2HA 2FP4B 4HN2A 1TAQA 2YNMD 3NBMA 3KT0A 5THKA 3RAEC 1YNOA 4Y3UA 4M3NA 4GFDA 3GJQA 3H75A 5AKLA 1QNFA 3GP8A 1I13A 3F0TA 1OKKA 2PLRA 3WHLA 1K7YA 1TJNA 2PFGA 3LX6A 1ZN9A 2ZJZA 4P3OA 3WNBA 3W6NA 4P2GA 2PSHA 3I4LA 1NUSA 4CIWA 3CLSD 4FFPA 4U6NA 1ZJZA 5DSXA 1MH1A 2J09A 5TX7A 3S5UA 3LTNC 4BOYA 2EHDA 3CLSC 3FVWA 1FJHA 2HGSA 1UXIA 4J49A 2XCTB 1EK1A 3QVGB 1HOXA 2EVWX 2JGMA 1Z6QA 5TV2A 1ECCA 1XZAA 4DT1B 2B83A 2QROA 4FI3F 3ER6A 2PKCA 5TGZA 1L7EA 1YRBA 5KVAA 4U39A 4CLXA 2YHUA 1YH3A 2X76A 5KVCA 4RABA 1JT9A 2ZRMA 5B6JA 3LUFA 3VJRA 2H48A 4L08A 3GA7A 3O4HA 1W6RA 3DS8A 1ILWA 1AO0A 1AGXA 3W1WA 2HPVA 2O8CA 1T3HA 2YZMA 1TUBA 1E2NA 2QLBA 3KM0A 4O5AA 5I7AA 1QLJA 4DPMA 4R51A 1ID8A 4G1MB 2FZLA 2ZRBA 2B2CA 1PZNA 2VOEA 1YO6A 2CB9A 1TRKA 1U0JA 5GONF 5IDXA 3CRRA 1UBKS 3FKSA 3KB6A 4TROA 5K0CA 4F3RA 4AYTA 1IOVA 3OE7A 3PXEA 2QQ5A 3GRKA 1GPLA 2BTQA 1ZJJA 5M04A 2C4TA 3OTGA 1SCUB 4YJFA 2X9LA 3EPPA 1B0UA 2CXUA 2HLNA 5JMPA 3HDGA 1UT5A 3HV2A 1R9JA 2IHTA 2Y1CA 3MWEB 4X1OA 5JRJA 1QM5A 2C9DA 4DLBA 1G7SA 3LBYA 2ODNA 3U13A 1B0PA 3DMFA 4EOGA 1MX3A 4ZVUA 3W5VA 2ZZMA 5DXJA 4KDRA 4ZAZA 5KKCA 2A59A 2V45A 2GKOA 1YA8A 4D9CA 4MYRA 3JVEA 2YHAA 5BUQA 3ICPA 3MB5A 5HZHA 1E98A 4RM2A 4NONA 1AGNA 4DILA 2OG2A 4HNQA 10MHA 1CP2A 4EY3A 4CL2A 3THWA 1F8GA 3K5HA 5G40A 2I9KA 1SVLA 1QIEA 2PS0A 4ZODA 1YULA 4LF6B 4DLAA 2C3OA 1ZZGA 2HNBA 4JJ7A 1QKIA 4IIJB 4FXOA 4UAUA 3W2EA 5ELXA 4GMKA 5GM1A 3U7EB 1GTRA 4NE2A 1W94A 1DJLA 1XTBA 3F8WA 2RAFA 1V47A 2DHQA 1X1AA 1GDTA 4XD7A 1ONBA 3R5XA 2Y4NA 3W05A 5EJEA 2Q3HA 4AIIA 1Z0SA 3D3NA 5KYVA 1BFUA 4MGIR 5CIYA 5ER6A 3QJ5A 1N2JA 5BV1A 5H59A 1KYIA 4QVGA 5JYEA 5T8KC 3E9RA 3I61A 2WMNB 1G64A 1NXXA 2D0PB 2XTNA 4ENTA 1NIJA 4YV0A 2HZ7A 1I7SB 1TEXA 1SHKA 5A7FA 5ICSA 2A78A 5CD1A 1YJCA 2J3KA 4FYWA 4WOKA 1WNFA 1G3UA 4EB3A 3H83A 3T7SA 1EVIA 1M2OA 2J7KA 1I6WA 2OK8A 2XCLA 3M9WA 5DX1A 4D8XA 1YU9A 1ZN8A 2I4IA 1TJ5A 3NHJA 3ICVA 4ZCLA 5HSGA 1OH6A 1OX5A 2NYRA 1NT4A 3JAKA 4RHFA 4EF4A 4BJ5A 3ZHRA 1GNVA 4TYMA 1WR8A 4GR5A 1AB5A 2LNDA 5FRDA 1NR7A 5C34B 2Q6LA 1FC0A 2HEIA 3EQZA 4D4HA 3ERCA 2HIMA 2UUPA 1M3SA 4O8ZA 5J5CA 3OQIB 3QUCA 2PQ0A 2VBIA 5BP7A 3JPYA 4GM0A 1H2BA 2C7BA 1WA5A 1ULSA 5JAZA 4JQCA 3EOBI 1NP6A 3JW8A 1PWHA 5AI6A 4INZA 3B9BA 3HA2A 2RGNA 3V3TA 2PGIA 4O02B 5DCYA 4BMNA 3LUHA 3AB7A 5H82A 2YJNA 4BZPA 4ND1A 1GUFA 2RHBA 3GPDG 3EDRA 2WKRA 3AHHA 4M76B 1LLDA 3G8BA 2WWIA 2FZ5A 2LRHA 4REQB 1T91A 3ZV3A 3OWHA 5EERA 5I4IA 3CVJA 4I66A 2D1RA 2E4WA 2OTCA 4K7JA 4PU0A 1C2TA 4BJ1A 3DFUA 1H4TA 1K0UA 2DAPA 3OOHA 4BVLA 3NYQA 2H63A 3DDOA 3IQDB 1GCOA 1M1UA 2K6GA 4KPGA 3PKJA 4KAFA 4YK7A 1XZFA 2YBDA 5EUCA 3HJRA 1Y8RA 2GILA 4IOMA 4IDBA 1A2KC 4LXHA 2ZTVA 1Z4IA 2OILA 4G25A 1HV8A 2BFBB 1R10A 4O4JA 4O4LB 4V2UA 4RS3A 4Z4CA 2W48A 2QTWB 4W7HA 5JH7B 4R8SA 3ZTTA 1Y4AE 1Q0SA 2DQ4A 4QASA 1D09A 2DBQA 2B4KA 2KE5A 2MSKA 3GLTA 3STYA 2HLDD 2RGCA 5CGQB 3REGA 3GPIA 3N53A 2B6HA 4Y2QA 4AKHA 4BTLA 1UBHS 2WABA 2ZETA 3U44A 1X1DA 1QV7A 2A1TR 3NRBA 2AI3A 3T5MA 1J25A 4DUPA 4IVNA 1X70A 3ICWA 4PLVA 1FVHA 3UCFA 1M1YE 3A58B 5J40A 1V43A 3N2GA 4IIJA 1CNMA 4CLOB 3JYHA 5EGSA 1NASA 1Z34A 3LPDA 4IVQA 1K7XB 5BN3B 2QTNA 3M1YA 4HGYA 3EG9B 4YA6A 3LLUA 4DIBA 4OHBA 3KG2A 1FLNA 1FB5A 2XKAA 5IM5A 2BF7A 1TT5B 3ZIUA 5KWEA 1IHXA 2AIRA 2LDXA 1N77A 3ZE8A 4MI1A 3GEBA 5JLJA 4JBYA 1CQIA 5AM5A 2RGUA 2D7CA 1ZQ1A 3PGKA 4J1NA 3MZ0A 2QK4A 2GQ0A 3C4QA 4RVOA 3DEKA 4ML3A 2DXIA 1ZIDA 2GHIA 2W2TA 2V97A 3FTCA 3KXIA 4MHTA 5MHTA 2QRJA 2WF8A 1W25A 4RFVA 2WWXA 4ZAGA 3IGFA 2XJ4A 2ODTX 4B45A 1RLJA 3L84A 2HWUA 3KIPA 4FYKA 1OWPA 2QXUA 2G63A 4XQEA 2RHWA 3A9WA 1KI2A 1R6BX 1Y1PA 1X1BA 4P7KA 4YCMA 3L7DA 1EBUA 1SUDA 2X0IA 1RJFA 4R2MA 3H0KA 1RCUA 3LDHA 5DWDA 2H1CA 1RXIA 2HY7A 5M3BA 3ZIDA 2GO7A 4EG1A 1AJEA 4E3ZA 1R5OA 4RY8A 3U09A 3PQ3A 2HADA 3QXSA 3RE1A 2C2XA 4PPGA 3DOUA 4BZQA 1J6UA 2IQIA 3LPLA 4BNDA 4N3AA 1U9JA 2H16A 2PQMA 4WOCA 1FMTA 4MMZB 1N0UA 2IXEA 4AZTA 4R54A 1C7QA 3OLZA 4HNGA 1XD8A 3H65A 3IDSA 1JR6A 2HJGA 5FTWA 2MHCA 1Q6YA 1DJNA 2X9QA 3EWSA 4URYR 3V2UA 1PUXA 3GP5A 2QZPA 5IN5A 4B47A 4PSDA 1A27A 1QYVA 4RIEA 3BRWD 2DY0A 2FN9A 2QTBA 4LTMA 3UQYS 1KI4A 4XB6B 3DL0A 3PA6A 3E7FA 3DAHA 5CVDA 4DZTA 1MB2A 3PUJA 3L1VA 3PQCA 2F8MA 1VTKA 3CR3C 3D6AA 1NONA 3UW1A 3AVXA 5C52B 1YB6A 2UVPB 3AY0A 3IPLA 4G65A 1X7YA 5KZMB 4Z3KA 1KBZA 3F7MA 4M1KA 5FL7A 1C8LA 4PF1A 2VT6A 4B2PA 2REBA 1RDFA 2R7NA 5EMKA 5CB6A 1YC2A 2FP4A 2GM9A 3QKSA 1D2MA 4GX1A 5AKIA 5IJZA 1KBOA 1FTQA 3PGXA 3IE1A 3KXPA 3HCFA 2UVQA 2B1IA 4PTZA 4RUKA 1H05A 3VTAA 4F21A 3EIWA 4ZAYA 3ZLJA 3E5HA 2EFHB 1ICEA 1RS0A 3KPWA 3PT9A 5A05A 5CW1A 3EA4A 4JJEA 2FVYA 4G0ZA 4M0EA 3LRPA 1FBNA 5TB5A 3SHWA 1DCMA 1BEEA 1M75A 3OLXA 2X6RA 1EX1A 3DZGA 4N03A 4PRKA 4BKPA 3CBQA 4P0PB 1XAJA 1CERA 2Q0XA 4DW8A 5H3LA 2IEZA 3MA0A 5BMVB 3DEFA 2R0QC 5E6RA 1FFAA 1FMLA 4I9FA 2CSXA 3EA5A 2B1GA 5JJIA 1KI1A 3KTFA 3VXKA 5C3MA 5BVGB 4N6NA 3AINA 2BV3A 2EEZA 5HF6A 2JANA 3RIGA 5J23A 1GLGA 3CVOA 2AW5A 2BDEA 3G8DA 1P2BA 2WVGA 1E63A 3AKYA 3M81A 3MQ2A 4FE3A 3M6FA 2PUHA 4X84A 3AM3A 3MC1A 3TLXA 2A4KA 2NOAA 3E8MA 4G5FA 3V3KA 3DQQA 1OXMA 4U8HA 4M1YA 2ISSD 4D7AA 4MMYB 3G8AA 1G8MA 3DZCA 1K7EB 2DWCA 3KDSE 2AQIA 4L4XA 3ETNA 4PC6A 1XNHA 1XZKA 1JR4A 3MELA 1RM0A 2CJWB 3RSCA 5JBIA 2WWFA 3AZQA 1Q0RA 4QFDA 5DYNA 1WHTB 4BVKA 3UEOA 2OCPA 2QG6A 2JI7A 3PQDA 3SFTA 2WKPA 4WLFA 1H8EA 2ZTSA 4XA8A 5AM4A 3UWOA 2YXNA 1N8KA 1H4QA 4K9SA 1PJ8A 2ZTMA 2ZT6A 3A7DA 4TL9A 4Z8YA 1JJBA 3OEHA 3PRJA 4CN8A 2YFYA 5JH7F 1E3MA 1P5ZB 3DZHA 4WESB 3NH6A 1TXGA 5A9TA 1YU6A 3TR0A 2C9YA 3ILXA 3KTDA 4TLBA 3JQRA 3N8DA 4D9IA 5TS2A 1C30A 1O94C 3G9XA 3V4VB 1UZLA 4YB8A 4AS3A 3LHIA 3LV8A 1X2BA 4E5SA 5M5BA 1E9DA 2ZAYA 2G9QA 4P0QB 3A14A 3PXGA 2LR0A 3PIRA 3ZHBA 1DOZA 1USGA 1EFRD 4JEIA 4AXBA 1VKOA 4IIGA 5AHOA 2WA1A 4UVDA 2GEKA 2CKDA 1M5UA 4E0BA 4DCUA 1FP6A 3QVWA 5H80A 3EQ9A 1QAMA 4D92A 3HTXA 5CGZA 1LVHA 4G5SA 1EK5A 2CFRA 3RIEA 3LLVA 3MTDA 1WUJS 4TKUA 1USVA 5JLAA 4BQEA 4QTUB 1Z63A 2CNWA 4NECA 1VP9A 5TVGA 2H1VA 2ZPUA 1RCFA 3ZNPA 1EQ2A 4FBMA 1ZOIA 5EZQA 1PQYA 2QGFA 4B6OA 4IOJA 1M6NA 1ZY2A 2UUBB 5TNXA 3K71B 4KI7A 3NKVA 4WAUA 1KDZA 1YBVA 2J0UB 3LL7A 1EUQA 1X87A 1TCBA 2ZVPX 4TT3A 1X1SA 3BBPA 3LQQA 4LEIA 2B1QA 4GDFA 3G0CA 2ZYRA 5I9LA 4G0OA 1MOQA 1RSZA 4FKZA 4HDQB 1TZMA 5F4BA 4LDJA 4DARA 5EUQB 5A06A 3HKDB 1M34B 2O7NA 3A4TA 4YRIA 1BVRA 1SKAA 3ZNNA 3I8SA 3OP4A 4DCSA 3MFQA 3HJFA 1Z9BA 3O9VA 3TG8A 4IEIA 5F98A 3INYA 2H5EA 1CF2O 3CCCA 4G5OA 4AQ7A 1KS2A 2FUG1 1YHZA 4LV8B 2A30A 4YRCA 5P8WA 1KZ9A 4DV7B 2ZSEA 3EIFA 2XLCA 3GLFB 1MQSA 2GHRA 1Y7TA 3DT6A 4XVQA 4WXEA 3PC8A 1QK4A 1VCOA 4RXTA 3DGEC 3AM4A 5IT5A 4TYYA 1KAMA 4LFAB 3ZX4A 4YMWA 5KEIA 3QLVC 1JA0A 1JWBB 2VWHA 1HWYA 5BWLA 1L4LA 3JVDA 2XCQA 1JX6A 4QHSA 5EMMA 4B71A 1Y6ZA 3WMRA 3G2QA 2GO1A 2HJSA 3K6RA 2FLVA 4M1SA 4PLCA 1C3OA 2HDWA 1WXDA 1ODLA 2LVBA 1BW9A 1U90A 1FDVA 2BEWA 2H4JA 1WB4A 3HVUA 4NNJA 4WCFC 3RAFC 5KX5A 1QZTA 1WXIA 2WTXA 4BRUA 2XXAB 4CODB 4H60A 4PNEA 3DDZX 4RGYA 2CVHA 4UU0A 2V65A 1DKNA 3O6VA 4HB2A 5BNWA 1YT5A 1M34A 3ROKA 4BE7B 1XTRA 3DHEA 1DUIA 3HACA 2YV2A 2JAQA 1J0XO 5HCIA 2NU6A 4UM8B 3SR0A 5JTTA 2CNDA 1QGDA 3MTGA 1RRCA 4O0MA 3B89A 2W2NA 1OT5A 2COUA 5GOTA 2PS1A 2ZSKA 2D3TA 3MTEA 1BA2A 4LTNA 5FUWA 1GGEA 3DMYA 3DUWA 1GCAA 1S7CA 2EBHX 3O9MA 3ESCA 9MHTA 1GTMA 4PYIA 1Q0ZA 3IT1A 4H1UA 5H3HA 3SX4A 3PHHA 3SYRA 1BEUB 4OOFA 1OREA 2PY6A 4B40A 1ZSYA 4N0PA 1U7ZA 2Z58A 3RVQA 5BQ3A 1Z6TA 2QAJA 3OJXA 3U26A 1ZD2P 1Y3IA 1YR3A 5DM60 5CLIA 4TMXA 1IFXA 3NPMA 2BJWA 2JKYA 2QZ4A 5JG7A 4IUYA 4DUZB 3NNNA 1M9NA 3NAQA 1YVDA 3BQ9A 1UBGA 2DVMA 2OGTA 3OOSA 5AI8A 3A3PA 4D9MA 2H4XA 4M0LA 1HDOA 3O3MB 1W4BA 2E85A 4M0CA 4DJDC 3ZXXA 3AEXA 1X77A 1Y34E 4L5IA 4NH0A 4KE6A 2XIQA 1M6WA 4YRLA 2PJUA 1T1EA 1CTQA 2PZLA 4RSHA 5F7OA 4XVUA 4EKGA 4CXMA 4HH0A 3FWYA 1VLQA 3ZCRA 1XMXA 3FTDA 3AETB 4KUHA 4K2HA 1ZD1A 1WY7A 5D3MA 2PGNA 2B9VA 7ABPA 4QQFA 1ZU5A 3ICOA 5E9QA 5A5FA 1YB7A 1CEYA 2OYCA 1SB9A 1EBBA 4M8KA 1KFKB 3HVRA 1A8PA 1B8UA 1M1ZA 1V6AA 1JBKA 4TWRA 4MGKR 3Q9LA 1T9GR 2I4TA 3BZUA 1AA6A 1KPGA 1SKYE 2YL2A 1HDIA 3I5AA 2AC7A 4ISCA 3OY2A 2VHZA 3MJFA 1QG2A 1AMUA 5DHPA 1MJHA 2JK0A 3FYUA 2ZP1A 4IXMA 3DXXA 4ZOQI 2AHOA 1AXRA 3CZCA 1SC9A 1YIAA 2F00A 2ZVJA 4H1WA 1O8CA 3EGXA 4AU1A 2FZEA 1FP4B 3WO0A 1I2AA 1Q3HA 2D1SA 2R7MA 1SPXA 3BRWA 2QMUA 4E5MA 4QM7A 1Q92A 2PCLA 2YV1A 2CDRA 2PWYA 4MYCA 3DKPA 1D6SA 1RJEA 5DEIA 4GRAA 1JL3A 3B1FA 4NYIR 4XRRA 4PN3A 5HYVA 3E23A 1IB0A 3NM5A 3QKIA 1GPUA 4ZVSA 2PMFA 1PWXA 3SY8A 3TLGA 1I3LA 4NVRA 1GTZA 2YWFA 4LGYA 1A50B 5JWRA 6REQA 3QEOA 1N3BA 4WXPA 5LR6A 3GJ4A 1Z5GA 1VKJA 1Z73A 2HYDA 2HRCA 2ZIVB 2NXEA 4MKZA 1KP2A 1JA9A 3R3YA 1NX6A 5ALSA 2AD5A 3URMA 4BFLA 4U7PB 4CM4A 2UYOA 4FYPA 3UC5A 5F2KA 1G60A 4WKGA 1F3LA 1VP3A 4ARCA 3A1DA 4RVDA 3DDUA 4WY5A 3NBQA 2BMFA 3ZBPA 1ISRA 3CPJB 3S2SA 3D8TA 2WUDA 2OXEA 4JXZA 4IO0A 3L7OA 1U9ZA 1UJ5A 1Z6GA 2IU6A 2X0KA 4FMDF 1XXHB 2XR1A 3AP1A 1E6WA 3L7BA 3ND6A 2J85A 4HEHA 4BO0A 4JV5B 2ERYA 3PNPA 4BLUA 4Z53A 1DKPA 4Q3KA 3UVEA 5JVDB 4CU2A 2IDKA 4IF6A 3B6JA 5G4KA 3RJZA 1F06A 4A2PA 2GN0A 4TKLA 3VR2D 3RFTA 3DGFC 4Z9FA 3WG9A 3DPUA 1D2CA 1X7DA 1ZUNB 4YV7A 1XSEA 2GN9A 5E4JA 3CW2A 5A04A 5KMGA 4FGUA 3PYXA 4MRNA 3ZWXA 2A5DA 4MYTA 3S2ZA 5FTLA 1D8AA 2NSJA 3Q10A 1VRCA 3HPRA 4O1IA 1VC2A 2WG2A 4UEOA 3SS9X 2PZMA 2WJAA 1PCXA 3IB3A 3EZLA 2R8YA 3GX1A 2BL4A 4MO9A 2RHGB 3DXZA 1WP9A 3MWDA 3NIWA 2EW8A 2V7EA 4LECA 2YXEA 4BATA 4KR3A 3D6MA 2GEJA 1OWMA 2VDWB 5F2NA 1YWGO 4RKWA 1TF2A 1SHTX 3FYUC 3WLTA 3OX1A 8OHMA 2Z09A 3LDUA 3F67A 2FN4A 2ZI4A 2ASVA 4RF5A 2KQUA 2XMCA 4HFNA 5CITA 4RIIA 3IQIX 4ZQBA 4NCIA 4HLNA 3KJEA 1R7RA 4IILA 3X1KA 3K4QA 3RAJA 3MS2A 1NUAA 3N6XA 3OM1A 4B2IA 4UTPA 1VZ2A 3UJ7A 2ZB3A 4PIVA 2IPAB 4BNIA 1VMEA 3HP1A 4RDIA 1HRKA 1YC5A 3PCXA 3FYUB 3B9QA 2J4FA 5HUJA 4URFA 1RP7A 3RSQA 3JV7A 4I46A 4J7UA 3B36A 1CUJA 2D2IA 4PYOA 3TSZA 5LYJA 3WTCA 3JAWB 2AC2A 1T4BA 3QW4B 3SDSA 4CMKA 4EITA 3OTOB 4TZTA 2B7CA 3OFJA 4NEQA 5FUMA 2IS1A 4C30A 5LLTA 3O0TA 4IR7A 1HTBA 1Z0AA 2AX3A 2DPLA 3N2YA 4DNQA 4AY5A 1ECBA 4RZXA 4FOPA 1U0SY 2FSGA 1K4KA 1ZD9A 4C5CA 1WMDA 4NCHA 1DWUA 3B3AA 4P5EA 3T3HA 2HHAA 2YNMC 2ZIXA 1ISPA 2UVPA 2XE7A 4UEWA 3U4AA 3FVRA 3KVYA 5CCEA 2Q28A 4RK5A 1UT8A 3K5PA 4PCAA 4DTIA 1IUNA 3T1OA 1HEUA 3WQRA 3EC1A 1MRNA 3QBJA 4HWTA 3RD5A 3CLTC 4H4EA 4TL8A 2RMKA 4LXIA 5F76A 2EKPA 5BNFA 1E5QA 1ZCZA 4QGSA 3ZDDA 4MWDA 4GPAA 4QDJA 4Z2AA 3EVDA 1M2GA 4KR0A 1J0BA 1KTVA 3M34A 1I94B 2PN1A 1RADA 1TEVA 1RYYA 1FFCA 2FHPA 4BWYA 1JHPA 1LVUA 1B14A 2V7WA 4GI5A 4HAYA 2C54A 3HN7A 3IAM1 5KYUA 5U4QA 3ZHUA 5GADl 1HEYA 2QDKA 3OM9A 2FMIA 3RSFA 4W7SA 4E7OA 1QF7A 3R7WA 1TT7A 2BGJA 2R87A 4FMCF 4NS4A 3X1JA 1O96A 2QA5A 3PDUA 1DPFA 1R0ZA 4KG7A 2P6OA 1J0DA 3SX0A 1U6KA 3UGJA 4RULA 2HMTA 1ESDA 2BM8A 2XUZA 3WBBA 1IOLA 1J2UA 3H8SA 4BNWA 3GLIE 1J23A 3RVJA 1VHJA 1QFZA 1JR2A 3ZJ4A 4LRSB 4QDTA 3E2MA 1II0A 3TB4A 2H2WA 4A7PA 1LV8A 1BDIA 1E1CA 4GX0A 4JHLA 2ZRLA 4YTEA 2H57A 3FR8A 5EXEA 1QBKC 4LE2A 4DWOA 3OCVA 4NMWA 2GAAA 4M9RA 4QLAA 4DMLA 4R1TA 1ML4A 4IDQA 4WDRA 1FLDA 1QE5A 3IP5A 8LDHA 3C3WA 2AR9A 5CA1F 1YQUA 4MI9A 2GFQA 2P2ZA 1SUEA 3HCCA 2W2OA 5SICE 4XRGA 3EC7A 5B7GA 1UBMS 1K0FA 2GM5A 5IDQA 4V3BA 4UUQA 4XARA 3S3TA 4AO6A 3W5CA 1KZHA 4KL8S 3UK1A 4AMZA 2NV6A 5DM4A 1BS9A 4EKEA 1CYDA 1O5OA 2JHPA 1UJ2A 2MYNA 4TTRA 1H9CA 4Q3OA 4S0XA 4C0KA 2A5YB 4P2BA 3AU8A 3NVMB 4JC8A 3B1YA 3D8UA 4RJKA 3LPMA 4ZOLB 1KL7A 3B5IA 3L79A 3A70A 1CD5A 3LBFA 1Z39A 4GLJA 4GBJA 4BRWA 4NJEB 3I6IA 3BWDD 2O3RA 3U19A 2EP8A 3ONDA 3DPIA 4LBVA 3GVIA 3KQWA 3WP0A 1EUCA 1AGYA 5CVJA 3N87A 5ALXA 4EATA 4U5QA 5I9SA 5SYAA 4CG1A 4TMKA 1M54A 4LSZA 1EXMA 3EXEB 5TQJA 4ETMA 1U8YA 3EQ2A 2CD7A 2G1UA 3G0IA 1ZNQO 3GVHA 5HRUA 5KTMA 3EYWA 1DE0A 3C8DA 1GAXA 1E2PA 6LDHA 4N5NA 3PZRA 5K2MA 1NVGA 1J9ZA 1UKBA 1TE2A 4RV9A 4LXUA 3A37A 5DM1A 1J9GA 2ODPA 2ZVDA 2UV8A 1E6KA 3F97A 2Y2UA 4QUJA 3O1JC 3J81k 4Y6PA 1O54A 2HMAA 2H1WA 1UL1X 1V6CA 2HN9A 1M2WA 1SC1A 3Q15C 1J07A 1XAIA 4RQTA 4D4KA 5LM3A 2C5EA 1I1HA 3ODPA 3RODA 4DYDA 3FWNA 1ST3A 3E3OA 5LQCA 1Q1ZA 4K9KA 3L0IB 3MINA 4GOND 5LC1A 3ZZTA 1AKTA 1IEXA 3DBHB 3IEPA 1Q1QA 4ETNA 5BXQC 1DTSA 4BB6A 1XJQA 2DPMA 3NGMA 5L4SA 4TV9F 2FN7A 4KUGA 1P5HA 4QOIA 3S2UA 4BO2A 4DQXA 1HURA 2BJHA 5IABA 2R9VA 3CRQA 2UZ4A 3G9ZA 1DDOA 3WKAA 1JJVA 4C7BA 1W8IA 1I4TD 1SZPA 5C5EA 1W0KA 3S27A 3RRNA 1BGWA 2AG6A 1T9AA 2YVAA 1O96B 2YWBA 3DOEA 3O21A 4FYVA 1S3GA 2HGZA 821PA 2O3QA 3GGSA 3P9XA 1SRRA 3N7TA 4II2A 4RSMA 3UMJA 1P3JA 4WY8A 5LZ9A 1V3QE 3W5AA 3AKZA 5KAPA 3QFTA 3EF0A 5CA0A 2R8PA 3PR3A 1AN0A 1Q20A 1DBQA 4TTJA 5JZVA 4Y2GA 1NVVQ 1G8GA 2LCQA 1VSBA 5EMJA 2H7YA 3RU9A 4JROA 1EAMA 5DASA 2H00A 1NW6A 1JKJB 2Q4RA 3AEUA 5BYBA 1PK8A 3SS8A 3PC6A 1PFKA 1SHLA 2XDWA 1WPXA 1PL7A 1BE8A 4TXHA 2WWTA 1UJCA 1RTTA 3BTSA 2JIDA 5AYVA 2C9ZA 4LZZA 1IVNA 2GPYA 3L1IA 3NOOA 2DQZA 4QC2A 4WJZA 4YJHA 4G4JA 2C7PA 4KQ2A 1MLDA 2HK7A 4M9SA 3W9YA 4NFSA 2J8ZA 4HZIA 5JD5A 4LA4A 1IBMB 3K6JA 1EGQA 4OPMA 1ZGGA 2YYZA 4BUJA 2CSUA 2PM8A 3W3AD 3G13A 2GFIA 2O5RA 4B2YA 2Y9MB 4IPTA 4O4JF 3WMFA 2BFFA 4IQGA 3E0QA 4Q3DA 2B2NA 1VL8A 3GGPA 2QX6A 1L4NA 4HDOB 4WZZA 3GEGA 1PS8A 3K09A 1NVDA 4RWEA 3IERA 4EY4A 1JFLA 2AQKA 2HRDA 4BKUA 3G3EA 2HM7A 4A6DA 5KU1A 4RQAA 2VHTA 1FDOA 1RHJA 2BE7A 1ZCFA 4FYIA 4EJSC 3VR6H 4HGZA 4JZKA 4OI2A 5JSQA 4EIWA 5HOQA 4FDTA 5IYZB 5ICFA 3IVXA 3N28A 5CT4A 3ZY3A 4B3TB 3EB9A 1GFSA 3UXMA 2BGKA 1RW4A 4IJQA 4RD1A 5EAIA 1IHOA 5KPDA 1TVKB 1J8YF 1T5BA 4QRHA 1PNOA 5D84A 3USES 2PX3A 3O0DA 1LDYA 4C78A 2G36A 1WCWA 1Z06A 2R6R1 2ZCVA 2Y1WA 4Y7CA 4AMVA 1F12A 1G42A 4GUAA 2BYTA 4L5AA 1RZ3A 4PG8A 1QVAA 1JFFA 1S3FA 2E18A 2I6GA 2I2FA 3UQZA 4URXR 1TFRA 1G8YA 1RYZA 2EFJA 1G98A 3F1LA 2XMQA 4WI1A 2XMGA 1E9FA 1XWFA 3HBAA 5BR4A 4IHAA 4WH0A 1PG2A 2OD9A 1VL2A 1KEPA 3OCYA 3UJAA 3ZQJA 2RD2A 1E5LA 3R1IA 4FLMA 1MX9A 4JVOA 3S2IA 4UM5A 3UXHA 4QJBA 1XEWX 3HDQA 3PEWA 1AC5A 3Q7TA 4MXDA 4B6GA 1Y7IA 4XIFA 2Y93A 4AYXA 1GQ2A 4FOTA 2CYCA 3VA7A 3HBLA 2ZCJA 1FPMA 4ER6A 1NZFA 2A14A 2GUGA 3CKYA 3K1ZA 1J1UA 2D3WA 1P19A 1QWSA 1ZNXA 3D9QX 2HU8A 1TU4A 3DDWA 4MPDA 1Y48E 1OA0A 2VJKA 4U9HS 1ZC4A 3W79A 1MB0A 2BMEA 3T6KA 2QQGA 2C04A 2F1IA 4INPA 4KC0A 3R9XB 4Q7LA 1CE8A 1AKQA 3CNLA 2W6MA 2FMHA 1WUIS 2JGRA 2RK3A 5CDUA 1XQ1A 2EKQA 3M7IA 1USIA 4RZ3A 2FFJA 1DU4A 3FNGA 3TQSA 5JRZA 1FVFA 3ZCSA 4KYUA 3O4JA 2HRQA 3DLCA 4LCJA 2C5BA 3OIVA 1LEHA 1M74A 1LRKA 3H5VA 3VOAA 4MTCA 4MW2A 1R3DA 4DCPA 3GLKA 1YFKA 4M8LA 3U1TA 3GH3A 4AROA 1CJVC 1V3VA 4GE3A 3TRJA 1JV2B 1J9EA 5FPSA 5IASA 3L0CA 5CEFA 2V9CA 1PSDA 5BUSA 1XMOB 4EAQA 3JARB 1RXVA 4BKRA 2VQFB 3SKYA 1MGPA 1NMYA 4DR4B 1L5HB 4LK2A 1L4GA 2R1ZA 2WNSA 1CJCA 2XE6A 2YWHA 4DAOA 4EHAA 1JB9A 3J7TA 4D96A 4YHBA 4IH9A 3PLNA 3IUBA 1RLIA 4J0EA 4BVJA 3AESB 2UUCB 1JU3A 1HNWB 4NK4A 3KEMA 2B1JA 1NKSA 4F4IA 3BIJA 3PQEA 3OQHA 1UJMA 1E7QA 2JK1A 1MD9A 5FADA 2O57A 1J0CA 1IXYA 1PUIA 1QMPA 2YFKA 3KUUA 4ZGWA 4RVCA 2VDWA 1UMBA 4ND3A 4QXRA 2CZQA 2GPNA 1V1JA 1GZ6A 1ATZA 3B8HA 2WZCA 4K1LA 1ZIOA 3ZQ4A 1IN5A 1FX0A 1FP4A 1WMSA 4JUIA 3ZY4A 4YMLA 4E5YA 1SPBS 1PFQA 1BU5A 3CX7A 4JDPA 4XKJA 4AYWA 3IBCA 2FG5A 4F2HA 2ZRQA 4V0LA 1W87A 4KLRA 4OO3A 1KBQA 1ZCBA 3C7TA 1XLUA 3BXFA 3DLPX 3AC0A 1XTKA 2AWOA 3F8TA 3H5NA 4UW9A 3AZOA 3NH9A 1MAVA 5AXDA 4A8JC 3I72A 4L16A 5G4KB 3SIXA 4UNQA 3TMAA 2ZSHA 1M6VA 3IBFA 5JVDA 1AK9A 1C29B 1V1MA 1DAOA 1KY5A 1KF0A 1W30A 1PJSA 1CUXA 1ZONA 2NZYA 4MS4A 4TMTA 4YQZA 3NP9A 2G25A 5LDHA 4DR7B 3DYBA 3D3EA 1T2AA 3ASUA 1K06A 3NYIA 4LTDA 4IUBS 2A4MA 3WV4A 1SD1A 3KXDA 4MPTA 5A1JA 5JMTA 2X9VA 1M5TA 2Q8PA 2OGZA 3FFAA 1GQOA 2D1QA 1KH2A 2W7TA 1QGZA 1U2ZA 3B6IA 3NEJA 2VHCA 3OP1A 3SQMA 8ABPA 1Z3IX 2VNJA 4ONEA 2VTDA 5ARCA 1MEOA 3TKLA 1Y9AA 2I7VA 2YJZA 3PR2B 4Q24A 1LSOA 2QU8A 1IN7A 2JFGA 2Q9AA 3PYMA 3MS4A 2Z83A 1E9BA 2H5IA 2QX7A 4RY2A 3H5RA 2RH8A 3F98A 2FQYA 5AW0A 3KKZA 4YT5A 2D62A 4I5EA 2IXAA 5KQRA 1RIFA 4RJLA 5ADVA 1Y1QA 3IUMA 5CT6A 3V4RA 4WZBE 1NU6A 3AF3A 4LRTB 4K6KA 2KBFA 5IVPA 2JFUA 4HWKA 3MWEA 1PDOA 1UOOA 4KK4A 5KVSA 3FGOA 4H3SA 2BEUB 2WD7B 4Y6SA 3UK2A 4DVJA 2DBRA 3DAYA 3O4VA 4TPKA 1IBSA 4B7UA 1OAOC 2NZWA 3A6KA 3GR6A 4QXOA 3G49A 5FBZA 5CDYA 3W2IA 4FT4A 5KBYA 2X1MA 3QBDA 3T3EA 4KIGA 3OZFA 4X20A 1XD2B 5AQEA 1J09A 2CLKB 2Q7OE 4J94A 3U48A 3PRKE 3W9UA 3HJGA 2JBAB 3CLVA 1PZXA 3Q12A 1M72A 4ILKA 3WY9A 1EDEA 3AKCA 4ZEOA 4D4LA 4AJEA 2CL5A 3GGGA 3DMHA 1GNRA 4JB0A 1JG6A 2XNHA 4P0TA 4MS4B 3TNFA 5KX5B 3QELA 4AJOA 1GG8A 3L93A 1V9SA 3QYAA 1QLHA 4NZZA 4XEHA 1PP4A 3QH4A 2CBZA 2GZHA 4MK4A 3PC2A 5KYXA 1J2TA 3PVZA 1M2EA 1FS5A 2VAPA 3G85A 5CDSA 1UINA 1B2RA 4L7QA 2XNJA 5B3AA 5FX2A 4CJXA 1U2DC 3DH0A 1I4DD 1G1AA 3KV1A 2JD1A 3L8DA 4D9JA 4JB8A 2CWWA 1JYFA 2G1JA 3A4IA 1P31A 1EINA 1Z17A 4Z49A 1FX0B 3OOEA 2DFTA 5AH0A 4MWGA 1HE5A 3JAWA 3VNBA 3H1PA 2CXXA 1OAAA 3CN7A 3I58A 3I8OA 1W4AA 1LNSA 3KJQA 3WP1B 4UXHA 2YZ7A 2LE0A 3F71A 2QENA 2DFKB 2H2HA 2P9TA 2VUTA 1GRRA 4YCDA 4XGRA 4BP8A 2YIMA 4S05A 3TIGA 1SIOA 1FL9A 2YDXA 3CV3A 1ZL0A 3GJRA 4WW0A 4WL0A 2OV8A 1DXHA 3WL3A 4YT4A 2GT1A 1ADYA 2V4UA 3KR0A 4KQJA 5FBHA 3VOTA 3U40A 2NZUG 1YHNA 1B74A 4Q18A 1ULTA 3MCUA 4X1KB 2GCIA 1YB5A 4C0BA 4BAGA 4XZ3A 1Z8HA 1ZOLA 2Q07A 1QHEA 3TTTA 2E55A 3BTOA 1PX2A 1FOEB 5SV2A 3O4RA 4RS4A 2NG1A 3TVYA 4CE6A 1T9ZA 1FTGA 2QAGB 2J9FB 2IU3A 2QRLA 3BFXA 3SXUA 2VK8A 2B8JA 1SH7A 4RMJA 5EHIA 2V3CC 4GC5A 3WAKA 1M33A 4H1VA 3IEUA 5HP4A 3ZDCA 1CRZA 3BICA 3N07A 2ZE8A 3WLJA 2VDRB 4FCWA 3BD9A 4NBUA 3ZLBA 5CB4F 1BKYA 3UAWA 5IXYA 3DOCA 2XRMA 4FHEA 5EPOA 1RXYA 5TQ2B 1FUYB 4PR0A 4KX3A 2OV3A 2NZ2A 3DYIA 4QUHA 3RIMA 1VGQA 2J3IA 2BEJA 4HQLA 5EEGA 3SLGA 1H6DA 3TTVA 1HX7A 2CEAA 1U4OA 3M2PA 4L4ZA 2BVNA 3M1AA 2IXBA 5ES4B 3DVRX 4L8GA 3ORQA 1T36B 2JJYA 1JE1A 1UZMA 1E7SA 2WYIA 1FDUA 2JHAA 2DZDA 1C5KA 3FOEC 4LRUA 3R9WA 3NC0C 3PNMA 3G23A 4KFRA 3FGPA 2WU8A 2WWYA 2IEBA 4AD8A 1NZDA 1V2HE 1KOLA 4MLDA 4FK8A 1ADJA 5IFLA 4BNMA 1GYQA 4LZJA 1JHMA 4GL2A 4RTNA 2O8BA 1C1DA 1FPQA 3CNHA 1YRHA 3BC1A 4S1PA 1QF9A 3TAHA 1C2YA 3VO8A 2R6HA 5IZ4A 4J3JA 4ZI7B 3AFNA 4F5EA 2F8SA 4BQNA 3BRCA 2QUAA 3EEYA 1XYVA 3Q7QA 4QOJA 4UE3S 1G5IA 2HWWA 4IWNA 4C6TA 5K6TA 2JFHA 1SBZA 2P2LA 4DG5A 8AT1A 2PRJA 3NJ4A 1JU4A 1P8AA 5AICA 4H6PA 1KTIA 2HIGA 3UUFA 1MR3F 3QJGA 4M6WA 4X7MA 2ZKIA 4L5CA 3NT4A 4ZDWA 3SJBA 4B0PA 3U16A 1EHYA 4G1BA 2P4HX 2AG1A 4GO1A 4ZOEA 3F9CA 4K6OA 1MXFA 4FNMA 3ZGXA 2VF7A 1EK0A 3L05A 1KDRA 4WACA 4LF5B 4X6XA 2BSAA 1DQNA 3JQ9C 5DH9A 1X3SA 3RRZA 2H7VA 1O9BA 1HLDA 1TUIA 5B1IA 3EOAI 3WIOA 1P60A 2CHVA 3IPRA 2ZK7A 2C4VA 2BMVA 3C3XA 5ERXA 5BMOA 5CPFA 2DR0A 3DMDA 4GBED 4G26A 3AHFA 4PYQA 1L7XA 4I14A 2NXWA 3KL2A 4TX1A 1KQPA 4KIWA 3VR6D 1SQ6A 3I2KA 4UTRA 4JP8A 3IAM6 2RC5A 1H5NA 1UPFA 2V7QD 1PR3A 3WL7A 2A67A 2R96A 5IEJA 3CVVA 1N5RA 3MF4A 1EVYA 4WNCA 2AE2A 1O0BA 1VCIA 3UK7A 5BQXA 3TK1A 1S2IA 4E03A 4HP8A 4LMRA 2CC2A 3UANA 4CIBA 3CUSA 2FU5C 1TJ3A 3RC2A 4RORA 4XQCA 1KXZA 1KZ1A 1KZ6A 4IIXA 1P7WA 3BFPA 1YCDA 3IX7A 1AOXA 5IAKA 4CMGA 1YDWA 5KTRA 4XUDA 4DC0A 4D6PA 2C99A 1HBJA 4ZT6A 2QKYA 2CMFA 2JIRA 4DTCA 4ZHQA 1UPUA 3WL8A 1AKVA 1B41A 4C1NA 3M3PA 4J2OA 1F3OA 3WHPA 2OQIA 2RBKA 4UM9D 4YT8A 1AMNA 2WD9A 4RDXA 4U7FA 1X80A 1J5PA 1P74A 1YMUA 3ZU3A 1IJKA 3CF4A 4BMOB 2A3NA 1YZQA 2HJHA 4PSKA 3AQ4A 5MN6A 2ZQZA 3NHWA 4ZAWA 2JIZA 4K6FA 1V96A 4Z7OB 2R8XA 4KWEA 4ZT4A 5I3ZA 4DCNA 1A76A 4LXQA 4AB1A 1ZNWA 4I36A 2PPLA 5BVHB 2Y0EA 2HWYA 4BX9A 3BYZA 1VFPA 5C18A 3NYWA 4PYRA 1MABA 4NU6A 4NH4A 4RM3A 1G9TA 3DTVD 3M9XA 3FOFC 2CLDX 4QUBA 2RAVA 3AUJB 4G0YA 4WSOA 3TZQA 4C7JA 4LQ4A 2IYAA 2M6LA 4CU5A 2VT3A