4H5FA

Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l-arginine, form 1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
240
Chain Sequence
QSAVEAIKQKGKLVVATSPDYAPFEFQSLVDGKNQVVGADIDMAQAIADELGVKLEILSMSFDNVLTSLQTGKADLAVAGISATDERKEVFDFSIPYYENKISFLVHKADVEKYKDLTSLESANIAAQKGTVPESMVKEQLPKAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKNAGLAVATVSLKMKDGDANAVALRKNSDDLKEVVDKVIQKLKDEGTYQSYLEKAASLTEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine, form 1
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Amino acid ABC superfamily ATP binding cassette transporter,
total genus 79
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h5fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h5fA02
1JVYA 4QSCA 1AOVA 2REGA 2WKYA 4R6KA 1SQYA 4E0XA 5HM4B 3UORA 3B6QA 1QULA 3UA8A 5B70A 2O1MA 3K1NA 3PD8A 4GWOA 2ONRA 2QS2A 3PMXA 4G68A 3WAFA 4LUBA 1H44A 2X7QA 2FYIA 1JW4A 1SI0A 2GRVA 3C35A 3GBAA 4QF9A 2DVZA 2R71A 4H5GA 4F1UA 1NKXA 1SW1A 3GXAA 3OD7A 1OVTA 2I49A 5KZTA 4H67A 4LONB 3LBSA 1GGGA 3RUMA 1MDP1 2VD3A 4XKQA 2I58A 3E3KA 4AQ4A 5AA1A 3IOVA 1B5IA 1MRPA 5H8NA 2NWJA 1TFDA 2UVHA 3K6WA 1NNFA 2W7YA 3G7WA 1HSLA 4HW8A 1FCKA 2XXPA 1MPBA 1Y4CA 2REJA 3PGFA 4KI0E 3TQLA 4U4XA 3PU5A 4MH5A 2ALUA 5L9MA 5CMCA 1OIBA 3VVFA 2AL4A 2NUVA 3L6HA 4F22A 5CI5A 3T93B 1TT1A 2X26A 3G3FA 4G8HA 1FTKA 1B0LA 4F18A 1OVBA 2D21A 1LBBA 2HCAA 3BBRA 5FHMA 3PUZE 1B7HA 3BFUA 3CR9A 4GXAA 4WEPA 4GF8A 1USYE 2HZLA 4M1VA 4Q5TA 1A8EA 5CMMA 1B9JA 2B65A 2FNCA 3ILTB 4DXUA 5JK4A 2YJPA 5CMBA 3T66A 2AYSA 2R6GE 3CFXA 4DCYA 3KJTA 2GH9A 3N6UA 2V3UA 3H4ZA 4KQPA 1MM7A 3FV2A 3TTMA 1L5TA 1MQIA 1B32A 1PBQA 3FJMA 4ND9A 5DT6A 3RLFE 3VDFA 2F6GA 4ZECA 3PUXE 2VOZA 5DEXA 2QS4A 1D9YA 3I3VA 4QFLA 2GFEA 3K00A 4JSOA 4N07A 5DVJA 4ELRA 4OEVA 3TCGA 5DYHA 4OFJA 4OYVA 1BIYA 1NL5A 3F11A 2HZKA 3H6WA 3MPLA 4PFUA 3TELA 4EDPA 3S9LC 1M5EA 3C33A 3MC2A 3KSXA 1OLCA 2Y7RA 1AMFA 1B0HA 3EHSA 3G3JA 2F35A 3OO8A 3PPNA 3MP8A 1NNKA 3K1PA 5I2NA 5IAIA 2H98A 1DTZA 4LP2B 5M2VA 3H06B 5H8FB 5ICQA 5DTBA 5ELVA 2V25A 4OHNA 2DWJA 2V3QA 4R6YA 5I2KB 2VHAA 1FQAA 3O6IA 4R72A 4RJZA 1OQHA 3U92A 3C32A 3SEWA 4F39A 2F36A 3IB2A 1B46A 2I4CA 1Y3QA 2X7PA 3DELB 3FXUA 3KZGA 3N6TA 1US4A 3O97A 2H9BA 3G3KA 3R7XA 3RN8A 5AA3A 4EF2A 2HXWA 3TDJA 3T9UA 4ZE9A 3S4UA 2RC9A 1UTHB 1LAFE 1N7WA 3ONMA 4NE4A 2PMSA 5TU0A 1LAGE 2A5SA 2ZYNA 4OMBA 2XXYA 3SETA 3OEMA 4U1OA 4ECFA 4IY5A 5H8FA 3O2AA 2UVJA 4JSDA 2CMOA 1XS5A 3W15C 3VXCA 2XXUA 4YKJA 1B7UA 1WODA 2XXVA 1XC1A 1RYOA 1B6HA 3EHUA 3DP4A 4LA9A 3QUFA 2Z22A 2ONSA 4R6HA 3ODBA 3FGSA 3RPWA 4MLQA 1UTHA 3B7DA 2F8DA 4ZEFA 4BDRA 1H43A 4ZEKA 1O64A 5FTHA 3S9NC 2ZYOA 2O7IA 1KWHA 3KN8A 4GL0A 3K02A 1N3XA 4NF6B 4YB7A 3V8XB 3V5AA 1IUDA 4YMAA 4EXLA 5FHOA 3QYTA 1YAEA 4EXKA 1FQDA 3IR1A 2F34A 3FUZA 3VLWA 2RC8A 3HHGA 3OENA 4OZ9A 1YCJA 4H8JA 2F7AA 1ZIUA 4KFQA 3VVDA 1A40A 1B3GA 1OMPA 4EF1A 3IJOB 4XTCQ 3C4MA 2Q8JA 2DP8A 2O69A 1WVJA 2LAOA 4OEUA 4P0GA 3TKDA 5AA2D 1MH4A 5TP9A 1ZBMA 4YICA 1SW2A 5I58A 2DE2A 3UK4A 1SI1A 1B3FA 4WKMA 1AIVA 2NXOA 3SKPA 4F2OA 4EQ9A 5AA4B 1PEBA 3B6TA 2Q89A 4RNSA 5CMKA 1CB6A 1Z7NE 1S7YA 2Q2AA 1Y4TA 1B2HA 2P1SA 2Z23A 3I5OA 3K0VA 3KFMA 3O28A 1MQJA 3R26A 4PE5B 4G8MA 2DSFA 2HAVA 4FEBA 3KJ7A 3OSRA 3EPEA 3FXQA 3H03A 3DP8A 4QRZA 3A09A 4RK9A 4MFIA 2XX9A 3KOTA 3RGYA 4DLDA 1MPCA 4GQOA 1A55A 1LFGA 1DOTA 1P1QA 2QSXA 3PMVA 1B4ZA 1QUIA 1XOCA 3PV0E 1TXFA 4NWCA 1O63A 1Q35A 1Y3NA 3Q29A 4YU0A 3QXMA 5K2XA 3LSFB 5HBCA 1MXZA 4U4SA 3RQTA 4C1TA 3O6GA 4ESWA 3IK6B 1HSJA 1QKAA 2Q9TA 2DWAA 2QJEA 2UYEA 3MVZA 3KBRA 4IO5A 1EH3A 3IAZA 2XD2A 3O9PA 4G68B 4DZ1A 3MVYA 4QFKA 4R73A 3SEVA 2Y7WA 3IL1B 3N26A 1QVSA 4IO4A 1YTVA 3B6WA 4FAJA 2DOJA 4OFLA 3PUWE 3FIRA 2XHDA 3AXFA 3HV1A 4PETA 2DS9A 3OOAA 4KYEA 2QMWA 1A99A 3TAJA 2DE3A 2HFBA 3VVEA 1ZKBA 3MVXA 4FEDA 4JXIA 3U1OA 2XXRA 4TQUQ 4H0WA 3LSLA 3G3GA 4Q30B 4YKIA 3LUYA 3EQ1A 4RPOA 3CSGA 3VV5A 3ZSFA 3P7IA 1NFTA 4JWOA 1IEJA 2O68A 3LSWA 3S2VA 1VFDA 3CVGA 1SBPA 1ZJLA 1UTBB 1IXIA 2NOOA 2P0SA 2RKMA 2Y84A 4G77A 3OMBA 4F3PA 4ESXA 4TLLB 3UP9A 3G3HA 4RA1A 1IXHA 1N04A 1R1NA 4NTLA 1B1HA 4IO7A 4F3BA 4RPNA 3N5LA 2ZXTA 4LVQA 4BDQA 1SVXB 1AH5A 4H6DA 4DE8A 4JDFA 3DLNA 4GXSB 4IO2A 2OCUA 2XXWA 5AE4A 1B4HA 1LGBC 1DSNA 3W9VA 2V3TA 3V89B 4O3BA 1D9VA 5EHMA 3O6HA 3K4UA 2D3IA 1JEUA 3KOSA 3QSLA 3WAEA 4R2FA 2RF1A 4I8CA 1MY1A 4NF6A 1MM6A 1ATGA 3Q27A 5L9SA 2M8CA 1FTLA 4KPTA 3USDA 2G93A 5KCJB 3H3GA 3HCQA 1R9LA 4POXA 1B3EA 3ZS6A 4Z7EA 5I2NB 2XXXA 5KDTA 4AB5A 1SD3A 5A5XA 4F2QA 3CG3A 4GIZA 1GV8A 4P11A 1R9QA 2OLBA 3FATA 4FATA 3TEPA 3U93A 4U1ZA 2F6PA 4RY1A 4RXLA 4FIMA 3MVWA 4UA8A 3FV1A 2VP1A 2G29A 4YB5A 1PC3A 4G2ZA 1B51A 5CM6A 5I59A 1J1NA 2PT1A 2XXHA 1MQDA 1Y1MA 1P1OA 3ZKLA 3L6GA 2OK2A 4YAHX 2OWSA 1US5A 3QAXA 5KDTB 4H5FA 2AIXA 1I6BA 3KN7A 4GLIA 5A5XB 4XXUA 1QW0A 5IKBA 1USYH 5I56B 1MS7A 1Q1KA 3MJNA 1XHYA 4JWYA 2Z8FA 5J1DA 1DTGA 4OQOA 3T22A 3OO7A 4GFRA 1H3DA 2ZNSA 1T0KA 1MY3A 2CZLA 1ZU0A 3D4CA 3EF7A 5DVFA 1ZTYA 4O3CA 5FTIA 4NF5B 4ZE8A 3S9EA 3H6VA 3PMWA 3C36A 4OWDA 3DM0A 1IITA 2Z8DA 3RT6B 5H8HB 3T96B 3SEXA 5F7VA 4IGRA 1M5FA 3SESA 1LFIA 3TTNA 4MLVA 4ZZEA 4N6PA 3RY3A 1N7XA 3OO6A 2OJTA 4H1XA 1EZPA 1FQBA 2H99A 1SYHA 2Z8EA 1JW5A 3A3CA 5FHNA 3UN6A 3IJXB 2ZMBA 1FQEA 2R9JA 5LOMA 4C1UA 4KYSA 4RYAA 1CE2A 4QHQA 1B3HA 2Q2CA 5I57A 4UACA 2VGQA 4GRKA 4TOZA 1FQCA 3LR1A 5KCJA 2DWHA 3EN3A 3FASA 5AA4A 1F9BA 3VE1B 1XVXA 2ONKE 3FJ7A 3MZ9A 4AB6A 3FVKA 5HPQA 1URSA 1M5CA 4KCDA 1P99A 2AL5A 1URGA 1PDAA 3PPRA 1GVCA 2UXAA 4R2BA 1QJMA 1A54A 2XX8A 3MZBA 4IY6A 3VFJA 4DXBA 2PYYA 3RTWB 5CC2A 5I59B 5I57B 4YB6A 1Z7ME 1B5HA 1UTBA 4LQ5A 3U8QA 1EZOA 3KEIA 2DYXA 5H8SA 3MBPA 1ELJA 2H4IA 3H7MA 1P1WA 2XXTA 4PP0A 4GVOA 2PVUA 4JWXA 4OERA 1B1XA 2QMXA 3H6TA 1B05A 1MXXA 3JZJA 4QSDA 1OQGA 4M4GA 1SW4A 1VR5A 4GOTA 1B7ZA 1NNTA 2F5XA 1GR2A 5JTYB 2ZYMA 3LC8A 4R9GA 1UQWA 3TZAA 3Q26A 4ELQA 4N13A 4QSEA 2HQ0A 5K2YA 3PD9A 2NVUB 2OBGA 2DQVA 4R75A 5I2KA 1MQHA 3K6VA 1WDNA 4ONYA 4OFOA 2P2AA 4X1DA 2PT2A 4TLMB 5JEIA 3IB1A 3I6VA 4HCYA 3TTLA 3OSQA 2I0BA 1PBPA 2RCAA 1FTJA 4KR5A 1TWYA 1JVXA 3T9HB 5JTYA 3PPQA 3CG1A 2F97A 3FXRA 4YKKA 4F3SA 4ZS9A 3O29A 3FVNA 3KSJA 1LB8A 1FTMA 3CFLA 1OLAA 3OEKA 4NF4A 4I1DA 4ZDMA 3SEYA 3MUQA 4U21A 4NF8A 3FZVA 3PPOA 1LAHE 4KCCA 1N84A 3IX1A 3THIA 4F29A 3PUYE 3MWBA 4DDDA 4H8IA 4YMBA 5CBSA 1LFHA 4P0IA 4EUOA 3OXNA 3UGWA 2DVCA 5AA2B 3U94A 5ITOA 1IZ1A 4BDLA 3RTFB 1MY2A 4K3FA 2E0SA 5L8DA 5L9OA 1FW0A 2I6EA 2ZYKA 5EHSA 2A5TA 2QPQA 3TCFA 4FJPA 1NH8A 3KG2A 4F1YA 1JQFA 5B7DA 2IEEA 2QS1A 3MP1A 4FORA 5ICTA 3V83A 4R9FA 4HCWA 3OO9A 5ISUA 2Y7IA 3JYRA 3LSXA 1AL3A 2OZZA 4PFTA 3IB0A 1EU8A 3TPAA 3D4GA 1XVYA 2XXQA 1NH7A 4BDMA 4DXCA 1N76A 3MPKA 1IXCA 1MXWA 2UVGA 3RNNA 2I4BA 3M3FA 2A5TB 1MH3A 1RYXA 4NMYA 1N0TA 4BDNA 4EQ7A 3CIJA 1MDQA 1ZLQA 4Q0CA 3C31A 3C9HA 2HAUA 4I62A 3OELA 4OESA 3SEUA 1EZ9A 1POY1 1ZMGA 4RK2A 3M3LA 4POWA 3IOWA 4XKNA 1I6QA 4PQJA 4R74A 3VXBA 1MQGA 2THIA 3QIMA 5BUUA 4PFWA 3HPIA 1SW5A 3A3UA 3BKIB 4QFOA 2H25A 5DEXB 4YZZA 3SERA 1B58A 4U2RA 5F1QA 4F3GA 1P1UA 1UIVA 2HEUA 2O84X 1MG1A 4ZEIA 2Y7PA 2F7BA 2O1LA 4MF3A 3IO6A 3Q28A 4G4PA 1IXGA 4NF5A 4ZEBA 3IORA 3K1MA 3E13X 3K6XA 3MZ1A 1JEVA 4JB7A 4GL8A 5H8HA 3HN0A 3QUJA 3BFTA 3FVOA 4XKPA 1M5DA 4HTGA 3DP6A 4X48A 5H8QA 1GTKA 5EYFA 1TFAA 1Y20A 1MPDA 1O7TA 1MY0A 4NWDA 5I58B 3PUVE 2XD3A 2BJJX 3MAMA 2DWIA 3IOTA 4G8NA 4DCXA 2DE4A 3HHFA 5CRYA 2O7UA 1B40A 1JETA 2I3VA 3TTKA 1Y9UA 2V84A 3TQWA 2QS3A 3T9XB 3ECRA 4IO3A 1B5JA 1POTA 1Y1ZA 2QRYA 2XXIA 4ELOA 1Y3PA 4LZ8A 3TMGA 5ITPA 4IO6A 3KGCA 2IA4A 1BKAA 1LAXA 2I48A 3CI8A 5H8NB 1B3LA 1H76A 3C34A 3E4RA 4ELPA 1I6AA 1A8FA 2H5YA 5H8QB 4ZEDA 3GLBA 4O3AA 4F19A 4U22A 5CBRA 3VLUA 3K01A 2D5WA 4OETA 4XIGQ 2Q88A 1QUJA 1N3WA 3TODA 2I3WA 4Q8RA 5I84A 3MP6A 1FTOA 5TPAA 2E1SA 3CFZA 2XX7A 4C0RA 2F78A 4H65A 4LZ5A 1XT8A 1BLFA 3O66A 4GD5A 1LB9A 5BWJA 3IO4A 4X9TA 2F7CA 2O6AA 4NEDA 1VFEA 4OTEA 3QK6A 3MW0A 2RC7A 2Y7KA 3M8UA 4KHZE 1DMBA 4THIA 4F31B 1QKBA 3K6UA 3U72A 3T9VA 5TPAB 4XKRA 1BP5A 1JNFA 2B3BA 2ZNUA 1MXUA 1DPEA 1II5A 2ESNA 3E9XA 1NMUA 2FA7A 1LSTA 2OWTA 2VD2A 3FVGA 3PPPA 2UYFA 4L17A 4U23A 3TFLA 2DXYA 4WEDA 2V93A 4X1BA 1D3KA 3M3KA 1BTJA 1PB7A 1B52A 1IIWA 4JBZA 2B3FA 4G68C 3HO7A 1MXVA 2PBWA 1MXYA 2YPNA 1P1NA 4LZ7A 3TYHA 3H6UA 1DPPA 2DXRA 3R6UA 3K2DA 3MQ9A 3HSTA 4FECA 3FD3A 4ISUA 4E0WA 2O51A 4IB2A 3TCHA 3CRBA 4FE8A 1RKMA 3KN3A 4OXVA 5DVIA 2GHAA 4HS7A 1HSEA 4WXJA 3VLVA 2GHBA 4LQ2A 2KLFA 2I0CA 1M5BA 1LCTA 2PX1A 4QFPA 1IQ7A 2YLNA 3Q25A 1VSOA 4BLAA 4EQBA 4F1VA 4KD5A 1H45A 1SYIA 5I56A 1NNPA 3IOUA 4ZZAA 1LLSA 5TP9B 3W9WA 3ZKKA 4BDOA 1A7LA 3CSBA 1LCFA 3EHTA 3TUSA 3RT8A 1VE4A 3FJGA 3UIFA 4YKPA 1FQFA 4LATA 3SDFA 4OVJA 2RCBA 5AA2A 1S50A 1URDA 4Z0IA 2UVIA 1I69A 1LBCA 4IGTA 3GBBA 4I9DA 2ABHA 4KYDA 1MY4A 3N94A 1R6ZA 3ILUB 2RINA 3JV9A 1PB8A 1SDXA 2ANJA 1UIUA 1S9TA 1PB9A 4NF4B 1YPNA 3TTRA 1JW1A 4OENA 4NF8B 2ZNTA 4MBPA 2QL3A 3GZGA 4PFYA 4DIGA 3G3IA 3S9MC 1D4NA 4QFNA 1QUKA 1ANFA
chains in the Genus database with same CATH superfamily
1JVYA 4E0XA 3UORA 2ONRA 3PMXA 2X7QA 2FYIA 1JW4A 1SI0A 3C35A 5BWJA 5FBPA 2R71A 1OVTA 4LONB 4FBPA 1MDP1 2VD3A 4XKQA 4AQ4A 1B5IA 5H8NA 3K6WA 1FBHA 1Y4CA 2REJA 3TQLA 2ALUA 5L9MA 2NUVA 4F22A 5CI5A 1TT1A 1FTKA 1B0LA 2D21A 2HCAA 1LBBA 3BIGA 3LV0A 1DBZA 5FHMA 4WEPA 1KZ8A 2FNCA 2B65A 2R6GE 2CZKA 4KQPA 1PBQA 5DT6A 5DEXA 1D9YA 2GFEA 3K00A 3TELA 1NL5A 2HZKA 1DK4A 3H6WA 3C33A 3KSXA 3G3JA 4O8MA 3OO8A 5I3SA 1NNKA 5IAIA 5M2VA 3H06B 5ICQA 5DTBA 3O6IA 4R72A 1OQHA 1NUXA 1Y3QA 3DELB 3KZGA 1US4A 3R7XA 3TDJA 5ET7A 3T9UA 1UTHB 4NE4A 1LAGE 2A5SA 4ECFA 1KA0A 4U1OA 3O2AA 4N8YA 3VXCA 3DP4A 4GX6A 2Z22A 2ONSA 4R6HA 3RPWA 2F8DA 5FTHA 2O7IA 2QVUA 4YMAA 2RC8A 1YCJA 1ZIUA 4KFQA 2DP8A 2LAOA 1MH4A 4P1LA 4MIJA 4WKMA 2L5VA 1AIVA 2QFLA 2Q2AA 3I5OA 1MQJA 4G8MA 2FVZA 4QRZA 4P56A 3EPEA 3FXQA 3OSRA 3RGYA 4MFIA 1A55A 1LFGA 2QSXA 1B4ZA 1QUIA 1Y3NA 3Q29A 3QXMA 5HBCA 4ESWA 2VPOA 4IO5A 3MVZA 2Y5KA 3IAZA 2P3NA 2XD2A 4HE1A 4R73A 3FIRA 4PETA 3ROJA 2DS9A 4JXIA 3U1OA 4H0WA 3G3GA 3LUZA 3CSGA 3LSWA 1SBPA 1ZJLA 1K9YA 1NUZA 4RA1A 4NTLA 5EQ8A 2ZXTA 4LVQA 1AH5A 4H6DA 4DE8A 4GXSB 1B4HA 3QSLA 3WAEA 1ATGA 2M8CA 5KCJB 2F3DA 1INPA 1CNQA 5KDTA 1B3EA 3ZS6A 3B8BA 5A5XA 4F2QA 5EQ9A 1R9QA 3FATA 3U93A 4RY1A 4FIMA 4G2ZA 1B51A 1J1NA 3T1BA 2OWSA 1US5A 3QAXA 2AIXA 4XXUA 4JWYA 3MJNA 4PAKA 1DTGA 4XF5A 1T0KA 1MY3A 2XA5A 1VDWA 1ZTYA 3DM0A 2Z8DA 5IZ3A 1M5FA 3TTNA 4MLVA 1FBGA 1FQBA 3A3CA 5LOMA 1B3HA 2HPGA 4UACA 2VGQA 4GRKA 4TOZA 5DW8A 3FASA 1F9BA 1LBZA 2ONKE 4KCDA 3VFJA 5CC2A 4IY6A 5EYGA 1UTBA 5LTCA 3KEIA 1ELJA 2H4IA 4PP0A 5ESYA 4QBAA 4OERA 2HHMA 1VR5A 1XI6A 2CZHA 1UQWA 4ELQA 3SZPA 2NVUB 5K2YA 2OBGA 4R75A 3K6VA 1WDNA 3BIHA 4OFOA 2PT2A 3OSQA 1PBPA 3FBPA 3CG1A 3OEKA 1OLAA 4I1DA 3SEYA 4HXVA 4MJOA 1IMFA 4F29A 4HE2A 5AA2B 4MNCA 2DVCA 2WBDA 5L9OA 1G0HA 2HXRA 2V4CA 4FJPA 2QS1A 5T3JA 3JYRA 3LSXA 4ESXA 2ZZVA 4N91A 3D4GA 3MPKA 3RNNA 2A5TB 4EQ7A 3CIJA 2Q74A 4Q0CA 1FPJA 4I62A 4P47A 4RK2A 3VXBA 3IOWA 4PQJA 4R74A 3NOHA 3QIMA 3A3UA 2H25A 2FHYA 4GX3A 4F3GA 2F7BA 2O1LA 3IO6A 4NF5A 3IORA 3K1MA 4PBQA 3MZ1A 2BJIA 4JB7A 5H8HA 3QUJA 4X48A 1TFAA 1MPDA 4NWDA 2BJJX 2DE4A 3HHFA 5CRYA 2O7UA 1B40A 1JETA 1Y9UA 3KC1A 4ELOA 2XXIA 4LZ8A 2IA4A 3CI8A 1B3LA 2H5YA 4AS4A 4O3AA 4F19A 4OVPA 3VLUA 4I3EA 4IR8A 1FTOA 2F78A 3O66A 1LB9A 3QK6A 2Y7KA 1QKBA 2ZZXA 1JNFA 2MKZA 4OVQA 1IIWA 4JBZA 2B3FA 4LZ7A 1P1NA 1DPPA 4FECA 4ISUA 1RKMA 1HSEA 4BDOA 3W9WA 3EHTA 3TUSA 1VE4A 5I7IA 1FQFA 2RCBA 1URDA 1LBCA 3GBBA 2ABHA 1R6ZA 1YXIA 2RINA 2XXKA 3JV9A 1UIUA 1S9TA 1PB9A 3TTRA 1YPNA 1JW1A 4DIGA 2WX9A 3TTLA 1AOVA 2REGA 5HM4B 3B6QA 1QULA 2B4MA 3UA8A 2O1MA 3K1NA 4G68A 3WAFA 1H44A 4H5GA 4F1UA 1SW1A 4PTKA 4I3YA 4H67A 1GGGA 4GX4A 1NNFA 3G7WA 1RDZA 1HSLA 3VVFA 3L6HA 4F18A 5H8NB 3BBRA 1B7HA 3BFUA 4GF8A 5CMMA 5JK4A 3ILTB 2AYSA 2V3UA 4ZECA 4ND9A 3VDFA 3PUXE 1FBPA 2QS4A 4NG7A 4JSOA 4N07A 4OVTA 5DVJA 4ELRA 4OFJA 1BIYA 4PFUA 2Y7RA 1AMFA 2F35A 3K1PA 2H98A 1DTZA 4LP2B 5ELVA 2XWIA 2V3QA 2VHAA 4RJZA 3U92A 4F39A 3SEWA 3N6TA 2H9BA 3G3KA 5AA3A 4EF2A 2HXWA 5TU0A 4EF1A 5H8FA 4IY5A 2UVJA 1XS5A 3RPLA 4GBVA 2XXUA 1RYOA 4P8BA 1B6HA 3EHUA 1UTHA 3B7DA 4BDRA 4NX1A 4GL0A 3K02A 4NF6B 3V8XB 3V5AA 4EXLA 4EXKA 3IR1A 3FUZA 3VLWA 3HHGA 4OZ9A 3VVDA 3IJOB 2Q8JA 5AA2D 1WVJA 3TKDA 4P0GA 4PDHA 5I58A 2DE2A 1SI1A 3SKPA 1PEBA 3B6TA 1FJ9A 5CMKA 2P1SA 1B2HA 2Z23A 4PGPA 3KFMA 4MEVA 2HAVA 5H8QA 3H03A 4DLDA 4NWCA 1O63A 4PFBA 4U4SA 4C1TA 3O6GA 1QKAA 2QJEA 4G68B 4DZ1A 3SEVA 1YTVA 3A29A 3AXFA 3HV1A 3OOAA 1A99A 2DE3A 2HFBA 3VVEA 4FEDA 1KA1A 4Q30B 3EQ1A 1NFTA 1IEJA 1VFDA 2Y84A 2NOOA 4F3PA 4TLLB 3RPLB 4JDFA 2B4LA 1D9QA 2XXWA 1LGBC 1DSNA 2DDKA 3V89B 4O3BA 5EHMA 5I5PA 3K4UA 2D3IA 3KOSA 4N4UA 2RF1A 4I8CA 4GWSA 1MM6A 1FBDA 3Q27A 5L9SA 2G93A 2KQZA 1NV2A 1R9LA 5I2NB 2XXXA 2FIXA 4P11A 2OLBA 3TEPA 4U1ZA 4RXLA 1LBXA 4PE3A 4UA8A 1PC3A 1LEVA 4H46A 2XXHA 4NGUA 4GLIA 1K9ZA 5I56B 1Q1KA 1XHYA 2Z8FA 1NV6A 4GFRA 2CZLA 5EYHA 3C36A 5F7VA 1LFIA 4ZZEA 3OO6A 5FHNA 3UN6A 2KR0A 4C1UA 1CE2A 1DCUA 3HFUA 3FJ7A 3MZ9A 1URSA 1P99A 3PPRA 1GVCA 1PDAA 2XX8A 4DXBA 2PYYA 3RTWB 4NHBA 1EZOA 1P1WA 3H6TA 1B05A 1MXXA 4QSDA 1OQGA 1NNTA 1GR2A 3LC8A 3TZAA 1BK4A 4N13A 2DQVA 1MQHA 3I6VA 1FTJA 4ZS9A 3KSJA 4DI3D 3CFLA 4NF4A 4U21A 1LAHE 4YMBA 1N84A 1LFHA 3PUYE 3MWBA 4EUOA 1FPIA 3U94A 1IZ1A 1MY2A 4K3FA 2E0SA 1Q9DA 1NH8A 5ICTA 4R9FA 4DXCA 3IB0A 1IXCA 1MXWA 2UVGA 1IMAA 1MH3A 2OX3A 1N0TA 4BDNA 5LDZA 1ZLQA 3C31A 4OESA 3OELA 1NV5A 4XKNA 1I6QA 3KC0A 1MQGA 2THIA 1YZ0A 4PFWA 1SW5A 3CHGA 5DEXB 4N6KA 3SERA 1B58A 4U2RA 5F1QA 1P1UA 2Y7PA 5ET8A 1IMEA 1IXGA 3K6XA 4GL8A 3HN0A 3FVOA 1GTKA 5I58B 1O7TA 3IOTA 3T9XB 4I40A 5ITPA 1Y1ZA 3KGCA 4ELPA 1I6AA 1A8FA 4ZEDA 3GLBA 4HE0A 4XIGQ 1QUJA 2I3WA 5I84A 4H65A 3IO4A 1VFEA 4OTEA 2RC7A 4KHZE 3M8UA 4THIA 5F24A 4F31B 4GWYA 1AWBA 1BP5A 2ZNUA 1MXUA 1II5A 3E9XA 1NMUA 3PPPA 2OWTA 4U23A 2DXYA 4X1BA 1D3KA 3HO7A 4GWZA 3TYHA 3R6UA 2DXRA 4E0WA 2O51A 4IB2A 3CRBA 4FE8A 2XWKA 2GHBA 1M5BA 4N81A 1NNPA 3ZKKA 3RT8A 3FJGA 3UIFA 4YKPA 2WBBA 4Z0IA 2UVIA 4KYDA 4IGTA 3N94A 4MHFA 1NV4A 4OENA 2ZNTA 3GZGA 3FXBA 5IZ1A 4QXDA 4R6KA 2WKYA 5B70A 2QS2A 1FTAA 2GRVA 2VPNA 4QF9A 4MAGA 2DVZA 1NKXA 3OD7A 5KZTA 1NI9A 1QGXA 2FBPA 3E3KA 3IOVA 4X8RA 2OWZA 3B50A 2NWJA 1TFDA 2UVHA 4UABA 2W7YA 4JVIA 2XXPA 4U4XA 3PU5A 1OIBA 2AL4A 4G8HA 3G3FA 1OVBA 4PAFA 3CR9A 1USYE 1NUWA 4Q5TA 1FPKA 4GWWA 1B9JA 3T66A 3CFXA 3KJTA 2GH9A 3N6UA 3H4ZA 1MM7A 1L5TA 3FJMA 3RLFE 3I3VA 4KXPA 4OEVA 3F11A 1M5EA 3MC2A 3PPNA 3EHSA 4PFRA 5I2NA 1FPGA 5H8FB 4R6YA 1FQAA 2P3VA 4XFEA 4X04A 3O97A 3S4UA 2RC9A 3ONMA 2PMSA 4JVCA 2ZYNA 2XXYA 4JSDA 3W15C 3PTYA 2XXVA 1XC1A 2Y5LA 4LA9A 3FGSA 4MLQA 4ZEFA 4DXUA 3KN8A 1N3XA 1IUDA 1FPDA 1YAEA 2PFZA 2F34A 2JJKA 2F7AA 1B3GA 3C4MA 4OEUA 4OVRA 4YICA 1SW2A 1B3FA 1CB6A 1S7YA 3K0VA 4PE5B 3R26A 4DI4B 4FEBA 3KJ7A 3DP8A 4RK9A 3KOTA 1MPCA 4GQOA 1P1QA 1DOTA 1XOCA 1TXFA 4YU0A 5K2XA 1HSJA 2UYEA 4P3LA 1EH3A 4QFKA 3N26A 2QMWA 3MVXA 4YKIA 2XXRA 4RPOA 3ZSFA 3P7IA 4JWOA 2O68A 3CVGA 2P0SA 2RKMA 4PF6A 3OMBA 1IXHA 1N04A 1B1HA 4BDQA 4PCDA 5EQAA 3DLNA 5AE4A 1D9VA 3O6HA 1JEUA 3E79A 1FTLA 4KPTA 1NV0A 2R8TA 3HCQA 4AB5A 1SD3A 4GIZA 1GV8A 4FATA 2F6PA 4YB5A 5I59A 3FV1A 2G29A 2PT1A 1P1OA 3L6GA 1I6BA 5IKBA 1QW0A 4OQOA 3EF7A 2PCRA 4O3CA 3S9EA 4OWDA 1IITA 3SEXA 4IGRA 3RY3A 2OJTA 1EZPA 2H99A 1SYHA 4PAIA 1FQEA 2Q2CA 1FQCA 5KCJA 5AA4A 4OVSA 4AB6A 5HPQA 1M5CA 2UXAA 4R2BA 5I57B 5I59B 1Z7ME 2DYXA 1FPLA 2XXTA 2PVUA 1B1XA 3JZJA 4M4GA 1SW4A 4R9GA 3Q26A 3RYDA 3ISPA 5I2KA 2P2AA 2I0BA 2RCAA 4KR5A 3T9HB 1TWYA 5JTYA 3PPQA 2F97A 3FXRA 4F3SA 1FTMA 4ZDMA 3MUQA 4NF8A 4O94A 4DDDA 4P0IA 3OXNA 5L8DA 5EHSA 1FW0A 3TCFA 1JQFA 5B7DA 3MP1A 4NN3A 4HCWA 3KBZA 3TPAA 1LBVA 1XVYA 2XXQA 1NH7A 3MSTA 4BDMA 1N76A 3M3FA 1MDQA 1JP4A 3C9HA 2HAUA 3SEUA 1POY1 3M3LA 4N8GA 5BUUA 3HPIA 4QFOA 1UIVA 4ZEIA 1MG1A 4PF8A 3E13X 2WEFA 1JEVA 3BFTA 4XKPA 1M5DA 1FBEA 2CZIA 1MY0A 3PUVE 2DWIA 4DCXA 2I3VA 3TTKA 2V84A 4H45A 1EYJA 3ECRA 4IO3A 1B5JA 2QRYA 1Y3PA 4IO6A 2I48A 1H76A 3E4RA 5ET5A 1RDXA 5CBRA 3K01A 2D5WA 2WYKA 4OETA 2Q8MA 3TODA 4Q8RA 3MP6A 5ET6A 5TPAA 2XX7A 4LZ5A 4LN5A 1XT8A 1BLFA 2O6AA 4NEDA 3MW0A 4XKRA 4OANA 1DPEA 2FA7A 1LSTA 2VD2A 4L17A 2UYFA 2V93A 1MXVA 2PBWA 1MXYA 2YPNA 5A5LA 3K2DA 3KN3A 4HS7A 2ZZWA 4LQ2A 2PX1A 2YLNA 3Q25A 4NAPA 4BLAA 4EQBA 4KD5A 5I56A 4ZZAA 4G61A 1LLSA 5TP9B 3CSBA 4LATA 3ILUB 4NF8B 3IFAA 2QL3A 3E78A 1EYKA 3S9MC 1D4NA 1QUKA 4QSCA 1SQYA 3GYYA 3PD8A 4GWOA 4LUBA 1IMDA 1FPEA 1NV7A 3GBAA 3GXAA 2I49A 1FPFA 3LBSA 3RUMA 2I58A 5AA1A 1MRPA 4HW8A 1FCKA 1MPBA 3PGFA 4KI0E 4MH5A 4MNPA 4N6DA 5CMCA 3T93B 2X26A 3PUZE 4GXAA 2HZLA 4M1VA 4MNIA 1A8EA 4N17A 2YJPA 5CMBA 4DCYA 3FV2A 3TTMA 1MQIA 1B32A 5IZZA 4NQ8A 2F6GA 2VOZA 4QFLA 3TCGA 5DYHA 4OYVA 3MPLA 4PC9A 4EDPA 3S9LC 1OLCA 1B0HA 3MP8A 2V25A 4OHNA 2DWJA 5I2KB 3C32A 2F36A 3IB2A 1B46A 2I4CA 2X7PA 3FXUA 2F3BA 3RN8A 4XEQA 4ZE9A 1LAFE 1N7WA 4OMBA 3SETA 3OEMA 2CMOA 4YKJA 1B7UA 1WODA 3T0JA 3QUFA 3ODBA 1NUYA 1H43A 4ZEKA 1O64A 3S9NC 2ZYOA 1KWHA 4YB7A 5FHOA 3QYTA 1FQDA 3OENA 4H8JA 1A40A 1OMPA 4XTCQ 2O69A 5TP9A 1ZBMA 3UK4A 2NXOA 4F2OA 4EQ9A 5AA4B 2Q89A 4RNSA 1Z7NE 2XWOA 1Y4TA 3O28A 2DSFA 2GQ1A 3A09A 2XX9A 1FPBA 3PMVA 3PV0E 1Q35A 3RQTA 3LSFB 1MXZA 3IK6B 2Q9TA 2DWAA 3KBRA 3O9PA 3MVYA 2Y7WA 3IL1B 1QVSA 4IO4A 3B6WA 4FAJA 2DOJA 4OFLA 3PUWE 5CM6A 2XHDA 1YYZA 4KYEA 3TAJA 1ZKBA 4TQUQ 3LSLA 3VV5A 3LUYA 2CEYA 3S2VA 1UTBB 1IXIA 4G77A 4PGNA 2XWVA 3UP9A 3G3HA 1R1NA 4IO7A 4F3BA 4RPNA 4NF0A 3N5LA 1SVXB 4IO2A 2OCUA 1RDYA 3W9VA 2V3TA 1IMCA 4R2FA 4NF6A 1MY1A 1IMBA 3USDA 3H3GA 4Z7EA 4POXA 3CG3A 2FIEA 2WYPA 3MVWA 2VP1A 3U65A 1MQDA 1Y1MA 3ZKLA 5EQ7A 4YAHX 2OK2A 5KDTB 4H5FA 3KN7A 5A5XB 1USYH 1MS7A 5J1DA 3T22A 3OO7A 1H3DA 3D4CA 1ZU0A 5DVFA 5FTIA 4NF5B 4ZE8A 5IM2A 3H6VA 3PMWA 3RT6B 1G0IA 3T96B 5H8HB 3SESA 1LBWA 1EYIA 4N6PA 4P1EA 1N7XA 4H1XA 2Z8EA 3D1RA 1JW5A 3IJXB 2ZMBA 2R9JA 4GWXA 4KYSA 4RYAA 5IZ3B 4QHQA 5I57A 3LR1A 2CEXA 2DWHA 3EN3A 3VE1B 1XVXA 3FVKA 2AL5A 1URGA 1QJMA 1A54A 3MZBA 4YB6A 4LQ5A 1B5HA 3U8QA 3EKIA 5H8SA 3MBPA 3H7MA 4GVOA 4JWXA 2QMXA 4GOTA 1FBFA 1B7ZA 3MYUA 2F5XA 5JTYB 2ZYMA 4QSEA 2HQ0A 3PD9A 4ONYA 4X1DA 4TLMB 5JEIA 3IB1A 4HCYA 1JVXA 4YKKA 3O29A 3FVNA 4AS5A 1FSAA 1LB8A 4P9KA 3FZVA 3PPOA 4KCCA 3IX1A 5CBSA 3THIA 4O7MA 1SPIA 4H8IA 3UGWA 5ITOA 4BDLA 3RTFB 2I6EA 2ZYKA 2A5TA 2QPQA 4MX6A 4F1YA 3KG2A 5J16A 3V83A 2IEEA 4FORA 3OO9A 5ISUA 2Y7IA 4PFTA 1AL3A 2OZZA 1EU8A 2I4BA 4JVDA 1RYXA 1FRPA 4NMYA 1EZ9A 1ZMGA 4POWA 3BKIB 4PDDA 4YZZA 1LBYA 2HEUA 2O84X 4GWUA 4MF3A 3Q28A 4G4PA 4ZEBA 4HTGA 3DP6A 5EYFA 1Y20A 4GBWA 1NV1A 2XD3A 3MAMA 1FJ6A 4G8NA 1FBCA 3TQWA 2QS3A 1POTA 2QVRA 3TMGA 4OA4A 1BKAA 1LAXA 3C34A 5H8QB 4U22A 2Q88A 1N3WA 2E1SA 3CFZA 4C0RA 1NV3A 4GD5A 4X9TA 2F7CA 4O7IA 1DMBA 2VT5A 3K6UA 4PBHA 3U72A 3T9VA 5TPAB 2B3BA 2ESNA 2PFYA 3FVGA 3TFLA 4WEDA 3M3KA 1BTJA 1PB7A 1B52A 4G68C 5IGAA 3H6UA 3MQ9A 3HSTA 3FD3A 4MMPA 3TCHA 4OXVA 5DVIA 2GHAA 2QVVA 4WXJA 3VLVA 3IFCA 2KLFA 2I0CA 1LCTA 4QFPA 1IQ7A 1VSOA 4F1VA 1H45A 1SYIA 3QMFA 3IOUA 1A7LA 1LCFA 4MCOA 4N15A 3SDFA 4OVJA 5AA2A 1S50A 1I69A 4I9DA 1MY4A 4PFIA 1PB8A 1SDXA 2ANJA 4NF4B 4MBPA 4PFYA 3G3IA 4QFNA 2ZNSA 1ANFA
chains in the Genus database with same CATH topology
1JVYA 4QSCA 1AOVA 2REGA 2WKYA 4R6KA 1SQYA 4E0XA 5HM4B 3UORA 3B6QA 1QULA 3UA8A 5B70A 2O1MA 3K1NA 3PD8A 4GWOA 2ONRA 2QS2A 3PMXA 4G68A 3WAFA 4LUBA 1H44A 2X7QA 2FYIA 1JW4A 1SI0A 2GRVA 3C35A 3GBAA 4QF9A 2DVZA 2R71A 4H5GA 4F1UA 1NKXA 1SW1A 3GXAA 3OD7A 1OVTA 2I49A 5KZTA 4H67A 4LONB 3LBSA 1GGGA 3RUMA 1MDP1 2VD3A 4XKQA 2I58A 3E3KA 4AQ4A 5AA1A 3IOVA 1B5IA 1MRPA 5H8NA 2NWJA 1TFDA 2UVHA 3K6WA 1NNFA 2W7YA 3G7WA 1HSLA 4HW8A 1FCKA 2XXPA 1MPBA 1Y4CA 2REJA 3PGFA 4KI0E 3TQLA 4U4XA 3PU5A 4MH5A 2ALUA 5L9MA 5CMCA 1OIBA 3VVFA 2AL4A 2NUVA 3L6HA 4F22A 5CI5A 3T93B 1TT1A 2X26A 3G3FA 4G8HA 1FTKA 1B0LA 4F18A 1OVBA 2D21A 1LBBA 2HCAA 3BBRA 5FHMA 3PUZE 1B7HA 3BFUA 3CR9A 4GXAA 4WEPA 4GF8A 1USYE 2HZLA 4M1VA 4Q5TA 1A8EA 5CMMA 1B9JA 2B65A 2FNCA 3ILTB 4DXUA 5JK4A 2YJPA 5CMBA 3T66A 2AYSA 2R6GE 3CFXA 4DCYA 3KJTA 2GH9A 3N6UA 2V3UA 3H4ZA 4KQPA 1MM7A 3FV2A 3TTMA 1L5TA 1MQIA 1B32A 1PBQA 3FJMA 4ND9A 5DT6A 3RLFE 3VDFA 2F6GA 4ZECA 3PUXE 2VOZA 5DEXA 2QS4A 1D9YA 3I3VA 4QFLA 2GFEA 3K00A 4JSOA 4N07A 5DVJA 4ELRA 4OEVA 3TCGA 5DYHA 4OFJA 4OYVA 1BIYA 1NL5A 3F11A 2HZKA 3H6WA 3MPLA 4PFUA 3TELA 4EDPA 3S9LC 1M5EA 3C33A 3MC2A 3KSXA 1OLCA 2Y7RA 1AMFA 1B0HA 3EHSA 3G3JA 2F35A 3OO8A 3PPNA 3MP8A 1NNKA 3K1PA 5I2NA 5IAIA 2H98A 1DTZA 4LP2B 5M2VA 3H06B 5H8FB 5ICQA 5DTBA 5ELVA 2V25A 4OHNA 2DWJA 2V3QA 4R6YA 5I2KB 2VHAA 1FQAA 3O6IA 4R72A 4RJZA 1OQHA 3U92A 3C32A 3SEWA 4F39A 2F36A 3IB2A 1B46A 2I4CA 1Y3QA 2X7PA 3DELB 3FXUA 3KZGA 3N6TA 1US4A 3O97A 2H9BA 3G3KA 3R7XA 3RN8A 5AA3A 4EF2A 2HXWA 3TDJA 3T9UA 4ZE9A 3S4UA 2RC9A 1UTHB 1LAFE 1N7WA 3ONMA 4NE4A 2PMSA 5TU0A 1LAGE 2A5SA 2ZYNA 4OMBA 2XXYA 3SETA 3OEMA 4U1OA 4ECFA 4IY5A 5H8FA 3O2AA 2UVJA 4JSDA 2CMOA 1XS5A 3W15C 3VXCA 2XXUA 4YKJA 1B7UA 1WODA 2XXVA 1XC1A 1RYOA 1B6HA 3EHUA 3DP4A 4LA9A 3QUFA 2Z22A 2ONSA 4R6HA 3ODBA 3FGSA 3RPWA 4MLQA 1UTHA 3B7DA 2F8DA 4ZEFA 4BDRA 1H43A 4ZEKA 1O64A 5FTHA 3S9NC 2ZYOA 2O7IA 1KWHA 3KN8A 4GL0A 3K02A 1N3XA 4NF6B 4YB7A 3V8XB 3V5AA 1IUDA 4YMAA 4EXLA 5FHOA 3QYTA 1YAEA 4EXKA 1FQDA 3IR1A 2F34A 3FUZA 3VLWA 2RC8A 3HHGA 3OENA 4OZ9A 1YCJA 4H8JA 2F7AA 1ZIUA 4KFQA 3VVDA 1A40A 1B3GA 1OMPA 4EF1A 3IJOB 4XTCQ 3C4MA 2Q8JA 2DP8A 2O69A 1WVJA 2LAOA 4OEUA 4P0GA 3TKDA 5AA2D 1MH4A 5TP9A 1ZBMA 4YICA 1SW2A 5I58A 2DE2A 3UK4A 1SI1A 1B3FA 4WKMA 1AIVA 2NXOA 3SKPA 4F2OA 4EQ9A 5AA4B 1PEBA 3B6TA 2Q89A 4RNSA 5CMKA 1CB6A 1Z7NE 1S7YA 2Q2AA 1Y4TA 1B2HA 2P1SA 2Z23A 3I5OA 3K0VA 3KFMA 3O28A 1MQJA 3R26A 4PE5B 4G8MA 2DSFA 2HAVA 4FEBA 3KJ7A 3OSRA 3EPEA 3FXQA 3H03A 3DP8A 4QRZA 3A09A 4RK9A 4MFIA 2XX9A 3KOTA 3RGYA 4DLDA 1MPCA 4GQOA 1A55A 1LFGA 1DOTA 1P1QA 2QSXA 3PMVA 1B4ZA 1QUIA 1XOCA 3PV0E 1TXFA 4NWCA 1O63A 1Q35A 1Y3NA 3Q29A 4YU0A 3QXMA 5K2XA 3LSFB 5HBCA 1MXZA 4U4SA 3RQTA 4C1TA 3O6GA 4ESWA 3IK6B 1HSJA 1QKAA 2Q9TA 2DWAA 2QJEA 2UYEA 3MVZA 3KBRA 4IO5A 1EH3A 3IAZA 2XD2A 3O9PA 4G68B 4DZ1A 3MVYA 4QFKA 4R73A 3SEVA 2Y7WA 3IL1B 3N26A 1QVSA 4IO4A 1YTVA 3B6WA 4FAJA 2DOJA 4OFLA 3PUWE 3FIRA 2XHDA 3AXFA 3HV1A 4PETA 2DS9A 3OOAA 4KYEA 2QMWA 1A99A 3TAJA 2DE3A 2HFBA 3VVEA 1ZKBA 3MVXA 4FEDA 4JXIA 3U1OA 2XXRA 4TQUQ 4H0WA 3LSLA 3G3GA 4Q30B 4YKIA 3LUYA 3EQ1A 4RPOA 3CSGA 3VV5A 3ZSFA 3P7IA 1NFTA 4JWOA 1IEJA 2O68A 3LSWA 3S2VA 1VFDA 3CVGA 1SBPA 1ZJLA 1UTBB 1IXIA 2NOOA 2P0SA 2RKMA 2Y84A 4G77A 3OMBA 4F3PA 4ESXA 4TLLB 3UP9A 3G3HA 4RA1A 1IXHA 1N04A 1R1NA 4NTLA 1B1HA 4IO7A 4F3BA 4RPNA 3N5LA 2ZXTA 4LVQA 4BDQA 1SVXB 1AH5A 4H6DA 4DE8A 4JDFA 3DLNA 4GXSB 4IO2A 2OCUA 2XXWA 5AE4A 1B4HA 1LGBC 1DSNA 3W9VA 2V3TA 3V89B 4O3BA 1D9VA 5EHMA 3O6HA 3K4UA 2D3IA 1JEUA 3KOSA 3QSLA 3WAEA 4R2FA 2RF1A 4I8CA 1MY1A 4NF6A 1MM6A 1ATGA 3Q27A 5L9SA 2M8CA 1FTLA 4KPTA 3USDA 2G93A 5KCJB 3H3GA 3HCQA 1R9LA 4POXA 1B3EA 3ZS6A 4Z7EA 5I2NB 2XXXA 5KDTA 4AB5A 1SD3A 5A5XA 4F2QA 3CG3A 4GIZA 1GV8A 4P11A 1R9QA 2OLBA 3FATA 4FATA 3TEPA 3U93A 4U1ZA 2F6PA 4RY1A 4RXLA 4FIMA 3MVWA 4UA8A 3FV1A 2VP1A 2G29A 4YB5A 1PC3A 4G2ZA 1B51A 5CM6A 5I59A 1J1NA 2PT1A 2XXHA 1MQDA 1Y1MA 1P1OA 3ZKLA 3L6GA 2OK2A 4YAHX 2OWSA 1US5A 3QAXA 5KDTB 4H5FA 2AIXA 1I6BA 3KN7A 4GLIA 5A5XB 4XXUA 1QW0A 5IKBA 1USYH 5I56B 1MS7A 1Q1KA 3MJNA 1XHYA 4JWYA 2Z8FA 5J1DA 1DTGA 4OQOA 3T22A 3OO7A 4GFRA 1H3DA 2ZNSA 1T0KA 1MY3A 2CZLA 1ZU0A 3D4CA 3EF7A 5DVFA 1ZTYA 4O3CA 5FTIA 4NF5B 4ZE8A 3S9EA 3H6VA 3PMWA 3C36A 4OWDA 3DM0A 1IITA 2Z8DA 3RT6B 5H8HB 3T96B 3SEXA 5F7VA 4IGRA 1M5FA 3SESA 1LFIA 3TTNA 4MLVA 4ZZEA 4N6PA 3RY3A 1N7XA 3OO6A 2OJTA 4H1XA 1EZPA 1FQBA 2H99A 1SYHA 2Z8EA 1JW5A 3A3CA 5FHNA 3UN6A 3IJXB 2ZMBA 1FQEA 2R9JA 5LOMA 4C1UA 4KYSA 4RYAA 1CE2A 4QHQA 1B3HA 2Q2CA 5I57A 4UACA 2VGQA 4GRKA 4TOZA 1FQCA 3LR1A 5KCJA 2DWHA 3EN3A 3FASA 5AA4A 1F9BA 3VE1B 1XVXA 2ONKE 3FJ7A 3MZ9A 4AB6A 3FVKA 5HPQA 1URSA 1M5CA 4KCDA 1P99A 2AL5A 1URGA 1PDAA 3PPRA 1GVCA 2UXAA 4R2BA 1QJMA 1A54A 2XX8A 3MZBA 4IY6A 3VFJA 4DXBA 2PYYA 3RTWB 5CC2A 5I59B 5I57B 4YB6A 1Z7ME 1B5HA 1UTBA 4LQ5A 3U8QA 1EZOA 3KEIA 2DYXA 5H8SA 3MBPA 1ELJA 2H4IA 3H7MA 1P1WA 2XXTA 4PP0A 4GVOA 2PVUA 4JWXA 4OERA 1B1XA 2QMXA 3H6TA 1B05A 1MXXA 3JZJA 4QSDA 1OQGA 4M4GA 1SW4A 1VR5A 4GOTA 1B7ZA 1NNTA 2F5XA 1GR2A 5JTYB 2ZYMA 3LC8A 4R9GA 1UQWA 3TZAA 3Q26A 4ELQA 4N13A 4QSEA 2HQ0A 5K2YA 3PD9A 2NVUB 2OBGA 2DQVA 4R75A 5I2KA 1MQHA 3K6VA 1WDNA 4ONYA 4OFOA 2P2AA 4X1DA 2PT2A 4TLMB 5JEIA 3IB1A 3I6VA 4HCYA 3TTLA 3OSQA 2I0BA 1PBPA 2RCAA 1FTJA 4KR5A 1TWYA 1JVXA 3T9HB 5JTYA 3PPQA 3CG1A 2F97A 3FXRA 4YKKA 4F3SA 4ZS9A 3O29A 3FVNA 3KSJA 1LB8A 1FTMA 3CFLA 1OLAA 3OEKA 4NF4A 4I1DA 4ZDMA 3SEYA 3MUQA 4U21A 4NF8A 3FZVA 3PPOA 1LAHE 4KCCA 1N84A 3IX1A 3THIA 4F29A 3PUYE 3MWBA 4DDDA 4H8IA 4YMBA 5CBSA 1LFHA 4P0IA 4EUOA 3OXNA 3UGWA 2DVCA 5AA2B 3U94A 5ITOA 1IZ1A 4BDLA 3RTFB 1MY2A 4K3FA 2E0SA 5L8DA 5L9OA 1FW0A 2I6EA 2ZYKA 5EHSA 2A5TA 2QPQA 3TCFA 4FJPA 1NH8A 3KG2A 4F1YA 1JQFA 5B7DA 2IEEA 2QS1A 3MP1A 4FORA 5ICTA 3V83A 4R9FA 4HCWA 3OO9A 5ISUA 2Y7IA 3JYRA 3LSXA 1AL3A 2OZZA 4PFTA 3IB0A 1EU8A 3TPAA 3D4GA 1XVYA 2XXQA 1NH7A 4BDMA 4DXCA 1N76A 3MPKA 1IXCA 1MXWA 2UVGA 3RNNA 2I4BA 3M3FA 2A5TB 1MH3A 1RYXA 4NMYA 1N0TA 4BDNA 4EQ7A 3CIJA 1MDQA 1ZLQA 4Q0CA 3C31A 3C9HA 2HAUA 4I62A 3OELA 4OESA 3SEUA 1EZ9A 1POY1 1ZMGA 4RK2A 3M3LA 4POWA 3IOWA 4XKNA 1I6QA 4PQJA 4R74A 3VXBA 1MQGA 2THIA 3QIMA 5BUUA 4PFWA 3HPIA 1SW5A 3A3UA 3BKIB 4QFOA 2H25A 5DEXB 4YZZA 3SERA 1B58A 4U2RA 5F1QA 4F3GA 1P1UA 1UIVA 2HEUA 2O84X 1MG1A 4ZEIA 2Y7PA 2F7BA 2O1LA 4MF3A 3IO6A 3Q28A 4G4PA 1IXGA 4NF5A 4ZEBA 3IORA 3K1MA 3E13X 3K6XA 3MZ1A 1JEVA 4JB7A 4GL8A 5H8HA 3HN0A 3QUJA 3BFTA 3FVOA 4XKPA 1M5DA 4HTGA 3DP6A 4X48A 5H8QA 1GTKA 5EYFA 1TFAA 1Y20A 1MPDA 1O7TA 1MY0A 4NWDA 5I58B 3PUVE 2XD3A 2BJJX 3MAMA 2DWIA 3IOTA 4G8NA 4DCXA 2DE4A 3HHFA 5CRYA 2O7UA 1B40A 1JETA 2I3VA 3TTKA 1Y9UA 2V84A 3TQWA 2QS3A 3T9XB 3ECRA 4IO3A 1B5JA 1POTA 1Y1ZA 2QRYA 2XXIA 4ELOA 1Y3PA 4LZ8A 3TMGA 5ITPA 4IO6A 3KGCA 2IA4A 1BKAA 1LAXA 2I48A 3CI8A 5H8NB 1B3LA 1H76A 3C34A 3E4RA 4ELPA 1I6AA 1A8FA 2H5YA 5H8QB 4ZEDA 3GLBA 4O3AA 4F19A 4U22A 5CBRA 3VLUA 3K01A 2D5WA 4OETA 4XIGQ 2Q88A 1QUJA 1N3WA 3TODA 2I3WA 4Q8RA 5I84A 3MP6A 1FTOA 5TPAA 2E1SA 3CFZA 2XX7A 4C0RA 2F78A 4H65A 4LZ5A 1XT8A 1BLFA 3O66A 4GD5A 1LB9A 5BWJA 3IO4A 4X9TA 2F7CA 2O6AA 4NEDA 1VFEA 4OTEA 3QK6A 3MW0A 2RC7A 2Y7KA 3M8UA 4KHZE 1DMBA 4THIA 4F31B 1QKBA 3K6UA 3U72A 3T9VA 5TPAB 4XKRA 1BP5A 1JNFA 2B3BA 2ZNUA 1MXUA 1DPEA 1II5A 2ESNA 3E9XA 1NMUA 2FA7A 1LSTA 2OWTA 2VD2A 3FVGA 3PPPA 2UYFA 4L17A 4U23A 3TFLA 2DXYA 4WEDA 2V93A 4X1BA 1D3KA 3M3KA 1BTJA 1PB7A 1B52A 1IIWA 4JBZA 2B3FA 4G68C 3HO7A 1MXVA 2PBWA 1MXYA 2YPNA 1P1NA 4LZ7A 3TYHA 3H6UA 1DPPA 2DXRA 3R6UA 3K2DA 3MQ9A 3HSTA 4FECA 3FD3A 4ISUA 4E0WA 2O51A 4IB2A 3TCHA 3CRBA 4FE8A 1RKMA 3KN3A 4OXVA 5DVIA 2GHAA 4HS7A 1HSEA 4WXJA 3VLVA 2GHBA 4LQ2A 2KLFA 2I0CA 1M5BA 1LCTA 2PX1A 4QFPA 1IQ7A 2YLNA 3Q25A 1VSOA 4BLAA 4EQBA 4F1VA 4KD5A 1H45A 1SYIA 5I56A 1NNPA 3IOUA 4ZZAA 1LLSA 5TP9B 3W9WA 3ZKKA 4BDOA 1A7LA 3CSBA 1LCFA 3EHTA 3TUSA 3RT8A 1VE4A 3FJGA 3UIFA 4YKPA 1FQFA 4LATA 3SDFA 4OVJA 2RCBA 5AA2A 1S50A 1URDA 4Z0IA 2UVIA 1I69A 1LBCA 4IGTA 3GBBA 4I9DA 2ABHA 4KYDA 1MY4A 3N94A 1R6ZA 3ILUB 2RINA 3JV9A 1PB8A 1SDXA 2ANJA 1UIUA 1S9TA 1PB9A 4NF4B 1YPNA 3TTRA 1JW1A 4OENA 4NF8B 2ZNTA 4MBPA 2QL3A 3GZGA 4PFYA 4DIGA 3G3IA 3S9MC 1D4NA 4QFNA 1QUKA 1ANFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVY A;  4QSC A;  1AOV A;  2REG A;  2WKY A;  4R6K A;  1SQY A;  4E0X A;  5HM4 B;  3UOR A;  3B6Q A;  1QUL A;  3UA8 A;  5B70 A;  2O1M A;  3K1N A;  3PD8 A;  4GWO A;  2ONR A;  2QS2 A;  3PMX A;  4G68 A;  3WAF A;  4LUB A;  1H44 A;  2X7Q A;  2FYI A;  1JW4 A;  1SI0 A;  2GRV A;  3C35 A;  3GBA A;  4QF9 A;  2DVZ A;  2R71 A;  4H5G A;  4F1U A;  1NKX A;  1SW1 A;  3GXA A;  3OD7 A;  1OVT A;  2I49 A;  5KZT A;  4H67 A;  4LON B;  3LBS A;  1GGG A;  3RUM A;  1MDP 1;  2VD3 A;  4XKQ A;  2I58 A;  3E3K A;  4AQ4 A;  5AA1 A;  3IOV A;  1B5I A;  1MRP A;  5H8N A;  2NWJ A;  1TFD A;  2UVH A;  3K6W A;  1NNF A;  2W7Y A;  3G7W A;  1HSL A;  4HW8 A;  1FCK A;  2XXP A;  1MPB A;  1Y4C A;  2REJ A;  3PGF A;  4KI0 E;  3TQL A;  4U4X A;  3PU5 A;  4MH5 A;  2ALU A;  5L9M A;  5CMC A;  1OIB A;  3VVF A;  2AL4 A;  2NUV A;  3L6H A;  4F22 A;  5CI5 A;  3T93 B;  1TT1 A;  2X26 A;  3G3F A;  4G8H A;  1FTK A;  1B0L A;  4F18 A;  1OVB A;  2D21 A;  1LBB A;  2HCA A;  3BBR A;  5FHM A;  3PUZ E;  1B7H A;  3BFU A;  3CR9 A;  4GXA A;  4WEP A;  4GF8 A;  1USY E;  2HZL A;  4M1V A;  4Q5T A;  1A8E A;  5CMM A;  1B9J A;  2B65 A;  2FNC A;  3ILT B;  4DXU A;  5JK4 A;  2YJP A;  5CMB A;  3T66 A;  2AYS A;  2R6G E;  3CFX A;  4DCY A;  3KJT A;  2GH9 A;  3N6U A;  2V3U A;  3H4Z A;  4KQP A;  1MM7 A;  3FV2 A;  3TTM A;  1L5T A;  1MQI A;  1B32 A;  1PBQ A;  3FJM A;  4ND9 A;  5DT6 A;  3RLF E;  3VDF A;  2F6G A;  4ZEC A;  3PUX E;  2VOZ A;  5DEX A;  2QS4 A;  1D9Y A;  3I3V A;  4QFL A;  2GFE A;  3K00 A;  4JSO A;  4N07 A;  5DVJ A;  4ELR A;  4OEV A;  3TCG A;  5DYH A;  4OFJ A;  4OYV A;  1BIY A;  1NL5 A;  3F11 A;  2HZK A;  3H6W A;  3MPL A;  4PFU A;  3TEL A;  4EDP A;  3S9L C;  1M5E A;  3C33 A;  3MC2 A;  3KSX A;  1OLC A;  2Y7R A;  1AMF A;  1B0H A;  3EHS A;  3G3J A;  2F35 A;  3OO8 A;  3PPN A;  3MP8 A;  1NNK A;  3K1P A;  5I2N A;  5IAI A;  2H98 A;  1DTZ A;  4LP2 B;  5M2V A;  3H06 B;  5H8F B;  5ICQ A;  5DTB A;  5ELV A;  2V25 A;  4OHN A;  2DWJ A;  2V3Q A;  4R6Y A;  5I2K B;  2VHA A;  1FQA A;  3O6I A;  4R72 A;  4RJZ A;  1OQH A;  3U92 A;  3C32 A;  3SEW A;  4F39 A;  2F36 A;  3IB2 A;  1B46 A;  2I4C A;  1Y3Q A;  2X7P A;  3DEL B;  3FXU A;  3KZG A;  3N6T A;  1US4 A;  3O97 A;  2H9B A;  3G3K A;  3R7X A;  3RN8 A;  5AA3 A;  4EF2 A;  2HXW A;  3TDJ A;  3T9U A;  4ZE9 A;  3S4U A;  2RC9 A;  1UTH B;  1LAF E;  1N7W A;  3ONM A;  4NE4 A;  2PMS A;  5TU0 A;  1LAG E;  2A5S A;  2ZYN A;  4OMB A;  2XXY A;  3SET A;  3OEM A;  4U1O A;  4ECF A;  4IY5 A;  5H8F A;  3O2A A;  2UVJ A;  4JSD A;  2CMO A;  1XS5 A;  3W15 C;  3VXC A;  2XXU A;  4YKJ A;  1B7U A;  1WOD A;  2XXV A;  1XC1 A;  1RYO A;  1B6H A;  3EHU A;  3DP4 A;  4LA9 A;  3QUF A;  2Z22 A;  2ONS A;  4R6H A;  3ODB A;  3FGS A;  3RPW A;  4MLQ A;  1UTH A;  3B7D A;  2F8D A;  4ZEF A;  4BDR A;  1H43 A;  4ZEK A;  1O64 A;  5FTH A;  3S9N C;  2ZYO A;  2O7I A;  1KWH A;  3KN8 A;  4GL0 A;  3K02 A;  1N3X A;  4NF6 B;  4YB7 A;  3V8X B;  3V5A A;  1IUD A;  4YMA A;  4EXL A;  5FHO A;  3QYT A;  1YAE A;  4EXK A;  1FQD A;  3IR1 A;  2F34 A;  3FUZ A;  3VLW A;  2RC8 A;  3HHG A;  3OEN A;  4OZ9 A;  1YCJ A;  4H8J A;  2F7A A;  1ZIU A;  4KFQ A;  3VVD A;  1A40 A;  1B3G A;  1OMP A;  4EF1 A;  3IJO B;  4XTC Q;  3C4M A;  2Q8J A;  2DP8 A;  2O69 A;  1WVJ A;  2LAO A;  4OEU A;  4P0G A;  3TKD A;  5AA2 D;  1MH4 A;  5TP9 A;  1ZBM A;  4YIC A;  1SW2 A;  5I58 A;  2DE2 A;  3UK4 A;  1SI1 A;  1B3F A;  4WKM A;  1AIV A;  2NXO A;  3SKP A;  4F2O A;  4EQ9 A;  5AA4 B;  1PEB A;  3B6T A;  2Q89 A;  4RNS A;  5CMK A;  1CB6 A;  1Z7N E;  1S7Y A;  2Q2A A;  1Y4T A;  1B2H A;  2P1S A;  2Z23 A;  3I5O A;  3K0V A;  3KFM A;  3O28 A;  1MQJ A;  3R26 A;  4PE5 B;  4G8M A;  2DSF A;  2HAV A;  4FEB A;  3KJ7 A;  3OSR A;  3EPE A;  3FXQ A;  3H03 A;  3DP8 A;  4QRZ A;  3A09 A;  4RK9 A;  4MFI A;  2XX9 A;  3KOT A;  3RGY A;  4DLD A;  1MPC A;  4GQO A;  1A55 A;  1LFG A;  1DOT A;  1P1Q A;  2QSX A;  3PMV A;  1B4Z A;  1QUI A;  1XOC A;  3PV0 E;  1TXF A;  4NWC A;  1O63 A;  1Q35 A;  1Y3N A;  3Q29 A;  4YU0 A;  3QXM A;  5K2X A;  3LSF B;  5HBC A;  1MXZ A;  4U4S A;  3RQT A;  4C1T A;  3O6G A;  4ESW A;  3IK6 B;  1HSJ A;  1QKA A;  2Q9T A;  2DWA A;  2QJE A;  2UYE A;  3MVZ A;  3KBR A;  4IO5 A;  1EH3 A;  3IAZ A;  2XD2 A;  3O9P A;  4G68 B;  4DZ1 A;  3MVY A;  4QFK A;  4R73 A;  3SEV A;  2Y7W A;  3IL1 B;  3N26 A;  1QVS A;  4IO4 A;  1YTV A;  3B6W A;  4FAJ A;  2DOJ A;  4OFL A;  3PUW E;  3FIR A;  2XHD A;  3AXF A;  3HV1 A;  4PET A;  2DS9 A;  3OOA A;  4KYE A;  2QMW A;  1A99 A;  3TAJ A;  2DE3 A;  2HFB A;  3VVE A;  1ZKB A;  3MVX A;  4FED A;  4JXI A;  3U1O A;  2XXR A;  4TQU Q;  4H0W A;  3LSL A;  3G3G A;  4Q30 B;  4YKI A;  3LUY A;  3EQ1 A;  4RPO A;  3CSG A;  3VV5 A;  3ZSF A;  3P7I A;  1NFT A;  4JWO A;  1IEJ A;  2O68 A;  3LSW A;  3S2V A;  1VFD A;  3CVG A;  1SBP A;  1ZJL A;  1UTB B;  1IXI A;  2NOO A;  2P0S A;  2RKM A;  2Y84 A;  4G77 A;  3OMB A;  4F3P A;  4ESX A;  4TLL B;  3UP9 A;  3G3H A;  4RA1 A;  1IXH A;  1N04 A;  1R1N A;  4NTL A;  1B1H A;  4IO7 A;  4F3B A;  4RPN A;  3N5L A;  2ZXT A;  4LVQ A;  4BDQ A;  1SVX B;  1AH5 A;  4H6D A;  4DE8 A;  4JDF A;  3DLN A;  4GXS B;  4IO2 A;  2OCU A;  2XXW A;  5AE4 A;  1B4H A;  1LGB C;  1DSN A;  3W9V A;  2V3T A;  3V89 B;  4O3B A;  1D9V A;  5EHM A;  3O6H A;  3K4U A;  2D3I A;  1JEU A;  3KOS A;  3QSL A;  3WAE A;  4R2F A;  2RF1 A;  4I8C A;  1MY1 A;  4NF6 A;  1MM6 A;  1ATG A;  3Q27 A;  5L9S A;  2M8C A;  1FTL A;  4KPT A;  3USD A;  2G93 A;  5KCJ B;  3H3G A;  3HCQ A;  1R9L A;  4POX A;  1B3E A;  3ZS6 A;  4Z7E A;  5I2N B;  2XXX A;  5KDT A;  4AB5 A;  1SD3 A;  5A5X A;  4F2Q A;  3CG3 A;  4GIZ A;  1GV8 A;  4P11 A;  1R9Q A;  2OLB A;  3FAT A;  4FAT A;  3TEP A;  3U93 A;  4U1Z A;  2F6P A;  4RY1 A;  4RXL A;  4FIM A;  3MVW A;  4UA8 A;  3FV1 A;  2VP1 A;  2G29 A;  4YB5 A;  1PC3 A;  4G2Z A;  1B51 A;  5CM6 A;  5I59 A;  1J1N A;  2PT1 A;  2XXH A;  1MQD A;  1Y1M A;  1P1O A;  3ZKL A;  3L6G A;  2OK2 A;  4YAH X;  2OWS A;  1US5 A;  3QAX A;  5KDT B;  4H5F A;  2AIX A;  1I6B A;  3KN7 A;  4GLI A;  5A5X B;  4XXU A;  1QW0 A;  5IKB A;  1USY H;  5I56 B;  1MS7 A;  1Q1K A;  3MJN A;  1XHY A;  4JWY A;  2Z8F A;  5J1D A;  1DTG A;  4OQO A;  3T22 A;  3OO7 A;  4GFR A;  1H3D A;  2ZNS A;  1T0K A;  1MY3 A;  2CZL A;  1ZU0 A;  3D4C A;  3EF7 A;  5DVF A;  1ZTY A;  4O3C A;  5FTI A;  4NF5 B;  4ZE8 A;  3S9E A;  3H6V A;  3PMW A;  3C36 A;  4OWD A;  3DM0 A;  1IIT A;  2Z8D A;  3RT6 B;  5H8H B;  3T96 B;  3SEX A;  5F7V A;  4IGR A;  1M5F A;  3SES A;  1LFI A;  3TTN A;  4MLV A;  4ZZE A;  4N6P A;  3RY3 A;  1N7X A;  3OO6 A;  2OJT A;  4H1X A;  1EZP A;  1FQB A;  2H99 A;  1SYH A;  2Z8E A;  1JW5 A;  3A3C A;  5FHN A;  3UN6 A;  3IJX B;  2ZMB A;  1FQE A;  2R9J A;  5LOM A;  4C1U A;  4KYS A;  4RYA A;  1CE2 A;  4QHQ A;  1B3H A;  2Q2C A;  5I57 A;  4UAC A;  2VGQ A;  4GRK A;  4TOZ A;  1FQC A;  3LR1 A;  5KCJ A;  2DWH A;  3EN3 A;  3FAS A;  5AA4 A;  1F9B A;  3VE1 B;  1XVX A;  2ONK E;  3FJ7 A;  3MZ9 A;  4AB6 A;  3FVK A;  5HPQ A;  1URS A;  1M5C A;  4KCD A;  1P99 A;  2AL5 A;  1URG A;  1PDA A;  3PPR A;  1GVC A;  2UXA A;  4R2B A;  1QJM A;  1A54 A;  2XX8 A;  3MZB A;  4IY6 A;  3VFJ A;  4DXB A;  2PYY A;  3RTW B;  5CC2 A;  5I59 B;  5I57 B;  4YB6 A;  1Z7M E;  1B5H A;  1UTB A;  4LQ5 A;  3U8Q A;  1EZO A;  3KEI A;  2DYX A;  5H8S A;  3MBP A;  1ELJ A;  2H4I A;  3H7M A;  1P1W A;  2XXT A;  4PP0 A;  4GVO A;  2PVU A;  4JWX A;  4OER A;  1B1X A;  2QMX A;  3H6T A;  1B05 A;  1MXX A;  3JZJ A;  4QSD A;  1OQG A;  4M4G A;  1SW4 A;  1VR5 A;  4GOT A;  1B7Z A;  1NNT A;  2F5X A;  1GR2 A;  5JTY B;  2ZYM A;  3LC8 A;  4R9G A;  1UQW A;  3TZA A;  3Q26 A;  4ELQ A;  4N13 A;  4QSE A;  2HQ0 A;  5K2Y A;  3PD9 A;  2NVU B;  2OBG A;  2DQV A;  4R75 A;  5I2K A;  1MQH A;  3K6V A;  1WDN A;  4ONY A;  4OFO A;  2P2A A;  4X1D A;  2PT2 A;  4TLM B;  5JEI A;  3IB1 A;  3I6V A;  4HCY A;  3TTL A;  3OSQ A;  2I0B A;  1PBP A;  2RCA A;  1FTJ A;  4KR5 A;  1TWY A;  1JVX A;  3T9H B;  5JTY A;  3PPQ A;  3CG1 A;  2F97 A;  3FXR A;  4YKK A;  4F3S A;  4ZS9 A;  3O29 A;  3FVN A;  3KSJ A;  1LB8 A;  1FTM A;  3CFL A;  1OLA A;  3OEK A;  4NF4 A;  4I1D A;  4ZDM A;  3SEY A;  3MUQ A;  4U21 A;  4NF8 A;  3FZV A;  3PPO A;  1LAH E;  4KCC A;  1N84 A;  3IX1 A;  3THI A;  4F29 A;  3PUY E;  3MWB A;  4DDD A;  4H8I A;  4YMB A;  5CBS A;  1LFH A;  4P0I A;  4EUO A;  3OXN A;  3UGW A;  2DVC A;  5AA2 B;  3U94 A;  5ITO A;  1IZ1 A;  4BDL A;  3RTF B;  1MY2 A;  4K3F A;  2E0S A;  5L8D A;  5L9O A;  1FW0 A;  2I6E A;  2ZYK A;  5EHS A;  2A5T A;  2QPQ A;  3TCF A;  4FJP A;  1NH8 A;  3KG2 A;  4F1Y A;  1JQF A;  5B7D A;  2IEE A;  2QS1 A;  3MP1 A;  4FOR A;  5ICT A;  3V83 A;  4R9F A;  4HCW A;  3OO9 A;  5ISU A;  2Y7I A;  3JYR A;  3LSX A;  1AL3 A;  2OZZ A;  4PFT A;  3IB0 A;  1EU8 A;  3TPA A;  3D4G A;  1XVY A;  2XXQ A;  1NH7 A;  4BDM A;  4DXC A;  1N76 A;  3MPK A;  1IXC A;  1MXW A;  2UVG A;  3RNN A;  2I4B A;  3M3F A;  2A5T B;  1MH3 A;  1RYX A;  4NMY A;  1N0T A;  4BDN A;  4EQ7 A;  3CIJ A;  1MDQ A;  1ZLQ A;  4Q0C A;  3C31 A;  3C9H A;  2HAU A;  4I62 A;  3OEL A;  4OES A;  3SEU A;  1EZ9 A;  1POY 1;  1ZMG A;  4RK2 A;  3M3L A;  4POW A;  3IOW A;  4XKN A;  1I6Q A;  4PQJ A;  4R74 A;  3VXB A;  1MQG A;  2THI A;  3QIM A;  5BUU A;  4PFW A;  3HPI A;  1SW5 A;  3A3U A;  3BKI B;  4QFO A;  2H25 A;  5DEX B;  4YZZ A;  3SER A;  1B58 A;  4U2R A;  5F1Q A;  4F3G A;  1P1U A;  1UIV A;  2HEU A;  2O84 X;  1MG1 A;  4ZEI A;  2Y7P A;  2F7B A;  2O1L A;  4MF3 A;  3IO6 A;  3Q28 A;  4G4P A;  1IXG A;  4NF5 A;  4ZEB A;  3IOR A;  3K1M A;  3E13 X;  3K6X A;  3MZ1 A;  1JEV A;  4JB7 A;  4GL8 A;  5H8H A;  3HN0 A;  3QUJ A;  3BFT A;  3FVO A;  4XKP A;  1M5D A;  4HTG A;  3DP6 A;  4X48 A;  5H8Q A;  1GTK A;  5EYF A;  1TFA A;  1Y20 A;  1MPD A;  1O7T A;  1MY0 A;  4NWD A;  5I58 B;  3PUV E;  2XD3 A;  2BJJ X;  3MAM A;  2DWI A;  3IOT A;  4G8N A;  4DCX A;  2DE4 A;  3HHF A;  5CRY A;  2O7U A;  1B40 A;  1JET A;  2I3V A;  3TTK A;  1Y9U A;  2V84 A;  3TQW A;  2QS3 A;  3T9X B;  3ECR A;  4IO3 A;  1B5J A;  1POT A;  1Y1Z A;  2QRY A;  2XXI A;  4ELO A;  1Y3P A;  4LZ8 A;  3TMG A;  5ITP A;  4IO6 A;  3KGC A;  2IA4 A;  1BKA A;  1LAX A;  2I48 A;  3CI8 A;  5H8N B;  1B3L A;  1H76 A;  3C34 A;  3E4R A;  4ELP A;  1I6A A;  1A8F A;  2H5Y A;  5H8Q B;  4ZED A;  3GLB A;  4O3A A;  4F19 A;  4U22 A;  5CBR A;  3VLU A;  3K01 A;  2D5W A;  4OET A;  4XIG Q;  2Q88 A;  1QUJ A;  1N3W A;  3TOD A;  2I3W A;  4Q8R A;  5I84 A;  3MP6 A;  1FTO A;  5TPA A;  2E1S A;  3CFZ A;  2XX7 A;  4C0R A;  2F78 A;  4H65 A;  4LZ5 A;  1XT8 A;  1BLF A;  3O66 A;  4GD5 A;  1LB9 A;  5BWJ A;  3IO4 A;  4X9T A;  2F7C A;  2O6A A;  4NED A;  1VFE A;  4OTE A;  3QK6 A;  3MW0 A;  2RC7 A;  2Y7K A;  3M8U A;  4KHZ E;  1DMB A;  4THI A;  4F31 B;  1QKB A;  3K6U A;  3U72 A;  3T9V A;  5TPA B;  4XKR A;  1BP5 A;  1JNF A;  2B3B A;  2ZNU A;  1MXU A;  1DPE A;  1II5 A;  2ESN A;  3E9X A;  1NMU A;  2FA7 A;  1LST A;  2OWT A;  2VD2 A;  3FVG A;  3PPP A;  2UYF A;  4L17 A;  4U23 A;  3TFL A;  2DXY A;  4WED A;  2V93 A;  4X1B A;  1D3K A;  3M3K A;  1BTJ A;  1PB7 A;  1B52 A;  1IIW A;  4JBZ A;  2B3F A;  4G68 C;  3HO7 A;  1MXV A;  2PBW A;  1MXY A;  2YPN A;  1P1N A;  4LZ7 A;  3TYH A;  3H6U A;  1DPP A;  2DXR A;  3R6U A;  3K2D A;  3MQ9 A;  3HST A;  4FEC A;  3FD3 A;  4ISU A;  4E0W A;  2O51 A;  4IB2 A;  3TCH A;  3CRB A;  4FE8 A;  1RKM A;  3KN3 A;  4OXV A;  5DVI A;  2GHA A;  4HS7 A;  1HSE A;  4WXJ A;  3VLV A;  2GHB A;  4LQ2 A;  2KLF A;  2I0C A;  1M5B A;  1LCT A;  2PX1 A;  4QFP A;  1IQ7 A;  2YLN A;  3Q25 A;  1VSO A;  4BLA A;  4EQB A;  4F1V A;  4KD5 A;  1H45 A;  1SYI A;  5I56 A;  1NNP A;  3IOU A;  4ZZA A;  1LLS A;  5TP9 B;  3W9W A;  3ZKK A;  4BDO A;  1A7L A;  3CSB A;  1LCF A;  3EHT A;  3TUS A;  3RT8 A;  1VE4 A;  3FJG A;  3UIF A;  4YKP A;  1FQF A;  4LAT A;  3SDF A;  4OVJ A;  2RCB A;  5AA2 A;  1S50 A;  1URD A;  4Z0I A;  2UVI A;  1I69 A;  1LBC A;  4IGT A;  3GBB A;  4I9D A;  2ABH A;  4KYD A;  1MY4 A;  3N94 A;  1R6Z A;  3ILU B;  2RIN A;  3JV9 A;  1PB8 A;  1SDX A;  2ANJ A;  1UIU A;  1S9T A;  1PB9 A;  4NF4 B;  1YPN A;  3TTR A;  1JW1 A;  4OEN A;  4NF8 B;  2ZNT A;  4MBP A;  2QL3 A;  3GZG A;  4PFY A;  4DIG A;  3G3I A;  3S9M C;  1D4N A;  4QFN A;  1QUK A;  1ANF A; 
#chains in the Genus database with same CATH topology
 1JVY A;  4E0X A;  3UOR A;  2ONR A;  3PMX A;  2X7Q A;  2FYI A;  1JW4 A;  1SI0 A;  3C35 A;  5BWJ A;  5FBP A;  2R71 A;  1OVT A;  4LON B;  4FBP A;  1MDP 1;  2VD3 A;  4XKQ A;  4AQ4 A;  1B5I A;  5H8N A;  3K6W A;  1FBH A;  1Y4C A;  2REJ A;  3TQL A;  2ALU A;  5L9M A;  2NUV A;  4F22 A;  5CI5 A;  1TT1 A;  1FTK A;  1B0L A;  2D21 A;  2HCA A;  1LBB A;  3BIG A;  3LV0 A;  1DBZ A;  5FHM A;  4WEP A;  1KZ8 A;  2FNC A;  2B65 A;  2R6G E;  2CZK A;  4KQP A;  1PBQ A;  5DT6 A;  5DEX A;  1D9Y A;  2GFE A;  3K00 A;  3TEL A;  1NL5 A;  2HZK A;  1DK4 A;  3H6W A;  3C33 A;  3KSX A;  3G3J A;  4O8M A;  3OO8 A;  5I3S A;  1NNK A;  5IAI A;  5M2V A;  3H06 B;  5ICQ A;  5DTB A;  3O6I A;  4R72 A;  1OQH A;  1NUX A;  1Y3Q A;  3DEL B;  3KZG A;  1US4 A;  3R7X A;  3TDJ A;  5ET7 A;  3T9U A;  1UTH B;  4NE4 A;  1LAG E;  2A5S A;  4ECF A;  1KA0 A;  4U1O A;  3O2A A;  4N8Y A;  3VXC A;  3DP4 A;  4GX6 A;  2Z22 A;  2ONS A;  4R6H A;  3RPW A;  2F8D A;  5FTH A;  2O7I A;  2QVU A;  4YMA A;  2RC8 A;  1YCJ A;  1ZIU A;  4KFQ A;  2DP8 A;  2LAO A;  1MH4 A;  4P1L A;  4MIJ A;  4WKM A;  2L5V A;  1AIV A;  2QFL A;  2Q2A A;  3I5O A;  1MQJ A;  4G8M A;  2FVZ A;  4QRZ A;  4P56 A;  3EPE A;  3FXQ A;  3OSR A;  3RGY A;  4MFI A;  1A55 A;  1LFG A;  2QSX A;  1B4Z A;  1QUI A;  1Y3N A;  3Q29 A;  3QXM A;  5HBC A;  4ESW A;  2VPO A;  4IO5 A;  3MVZ A;  2Y5K A;  3IAZ A;  2P3N A;  2XD2 A;  4HE1 A;  4R73 A;  3FIR A;  4PET A;  3ROJ A;  2DS9 A;  4JXI A;  3U1O A;  4H0W A;  3G3G A;  3LUZ A;  3CSG A;  3LSW A;  1SBP A;  1ZJL A;  1K9Y A;  1NUZ A;  4RA1 A;  4NTL A;  5EQ8 A;  2ZXT A;  4LVQ A;  1AH5 A;  4H6D A;  4DE8 A;  4GXS B;  1B4H A;  3QSL A;  3WAE A;  1ATG A;  2M8C A;  5KCJ B;  2F3D A;  1INP A;  1CNQ A;  5KDT A;  1B3E A;  3ZS6 A;  3B8B A;  5A5X A;  4F2Q A;  5EQ9 A;  1R9Q A;  3FAT A;  3U93 A;  4RY1 A;  4FIM A;  4G2Z A;  1B51 A;  1J1N A;  3T1B A;  2OWS A;  1US5 A;  3QAX A;  2AIX A;  4XXU A;  4JWY A;  3MJN A;  4PAK A;  1DTG A;  4XF5 A;  1T0K A;  1MY3 A;  2XA5 A;  1VDW A;  1ZTY A;  3DM0 A;  2Z8D A;  5IZ3 A;  1M5F A;  3TTN A;  4MLV A;  1FBG A;  1FQB A;  3A3C A;  5LOM A;  1B3H A;  2HPG A;  4UAC A;  2VGQ A;  4GRK A;  4TOZ A;  5DW8 A;  3FAS A;  1F9B A;  1LBZ A;  2ONK E;  4KCD A;  3VFJ A;  5CC2 A;  4IY6 A;  5EYG A;  1UTB A;  5LTC A;  3KEI A;  1ELJ A;  2H4I A;  4PP0 A;  5ESY A;  4QBA A;  4OER A;  2HHM A;  1VR5 A;  1XI6 A;  2CZH A;  1UQW A;  4ELQ A;  3SZP A;  2NVU B;  5K2Y A;  2OBG A;  4R75 A;  3K6V A;  1WDN A;  3BIH A;  4OFO A;  2PT2 A;  3OSQ A;  1PBP A;  3FBP A;  3CG1 A;  3OEK A;  1OLA A;  4I1D A;  3SEY A;  4HXV A;  4MJO A;  1IMF A;  4F29 A;  4HE2 A;  5AA2 B;  4MNC A;  2DVC A;  2WBD A;  5L9O A;  1G0H A;  2HXR A;  2V4C A;  4FJP A;  2QS1 A;  5T3J A;  3JYR A;  3LSX A;  4ESX A;  2ZZV A;  4N91 A;  3D4G A;  3MPK A;  3RNN A;  2A5T B;  4EQ7 A;  3CIJ A;  2Q74 A;  4Q0C A;  1FPJ A;  4I62 A;  4P47 A;  4RK2 A;  3VXB A;  3IOW A;  4PQJ A;  4R74 A;  3NOH A;  3QIM A;  3A3U A;  2H25 A;  2FHY A;  4GX3 A;  4F3G A;  2F7B A;  2O1L A;  3IO6 A;  4NF5 A;  3IOR A;  3K1M A;  4PBQ A;  3MZ1 A;  2BJI A;  4JB7 A;  5H8H A;  3QUJ A;  4X48 A;  1TFA A;  1MPD A;  4NWD A;  2BJJ X;  2DE4 A;  3HHF A;  5CRY A;  2O7U A;  1B40 A;  1JET A;  1Y9U A;  3KC1 A;  4ELO A;  2XXI A;  4LZ8 A;  2IA4 A;  3CI8 A;  1B3L A;  2H5Y A;  4AS4 A;  4O3A A;  4F19 A;  4OVP A;  3VLU A;  4I3E A;  4IR8 A;  1FTO A;  2F78 A;  3O66 A;  1LB9 A;  3QK6 A;  2Y7K A;  1QKB A;  2ZZX A;  1JNF A;  2MKZ A;  4OVQ A;  1IIW A;  4JBZ A;  2B3F A;  4LZ7 A;  1P1N A;  1DPP A;  4FEC A;  4ISU A;  1RKM A;  1HSE A;  4BDO A;  3W9W A;  3EHT A;  3TUS A;  1VE4 A;  5I7I A;  1FQF A;  2RCB A;  1URD A;  1LBC A;  3GBB A;  2ABH A;  1R6Z A;  1YXI A;  2RIN A;  2XXK A;  3JV9 A;  1UIU A;  1S9T A;  1PB9 A;  3TTR A;  1YPN A;  1JW1 A;  4DIG A;  2WX9 A;  3TTL A;  1AOV A;  2REG A;  5HM4 B;  3B6Q A;  1QUL A;  2B4M A;  3UA8 A;  2O1M A;  3K1N A;  4G68 A;  3WAF A;  1H44 A;  4H5G A;  4F1U A;  1SW1 A;  4PTK A;  4I3Y A;  4H67 A;  1GGG A;  4GX4 A;  1NNF A;  3G7W A;  1RDZ A;  1HSL A;  3VVF A;  3L6H A;  4F18 A;  5H8N B;  3BBR A;  1B7H A;  3BFU A;  4GF8 A;  5CMM A;  5JK4 A;  3ILT B;  2AYS A;  2V3U A;  4ZEC A;  4ND9 A;  3VDF A;  3PUX E;  1FBP A;  2QS4 A;  4NG7 A;  4JSO A;  4N07 A;  4OVT A;  5DVJ A;  4ELR A;  4OFJ A;  1BIY A;  4PFU A;  2Y7R A;  1AMF A;  2F35 A;  3K1P A;  2H98 A;  1DTZ A;  4LP2 B;  5ELV A;  2XWI A;  2V3Q A;  2VHA A;  4RJZ A;  3U92 A;  4F39 A;  3SEW A;  3N6T A;  2H9B A;  3G3K A;  5AA3 A;  4EF2 A;  2HXW A;  5TU0 A;  4EF1 A;  5H8F A;  4IY5 A;  2UVJ A;  1XS5 A;  3RPL A;  4GBV A;  2XXU A;  1RYO A;  4P8B A;  1B6H A;  3EHU A;  1UTH A;  3B7D A;  4BDR A;  4NX1 A;  4GL0 A;  3K02 A;  4NF6 B;  3V8X B;  3V5A A;  4EXL A;  4EXK A;  3IR1 A;  3FUZ A;  3VLW A;  3HHG A;  4OZ9 A;  3VVD A;  3IJO B;  2Q8J A;  5AA2 D;  1WVJ A;  3TKD A;  4P0G A;  4PDH A;  5I58 A;  2DE2 A;  1SI1 A;  3SKP A;  1PEB A;  3B6T A;  1FJ9 A;  5CMK A;  2P1S A;  1B2H A;  2Z23 A;  4PGP A;  3KFM A;  4MEV A;  2HAV A;  5H8Q A;  3H03 A;  4DLD A;  4NWC A;  1O63 A;  4PFB A;  4U4S A;  4C1T A;  3O6G A;  1QKA A;  2QJE A;  4G68 B;  4DZ1 A;  3SEV A;  1YTV A;  3A29 A;  3AXF A;  3HV1 A;  3OOA A;  1A99 A;  2DE3 A;  2HFB A;  3VVE A;  4FED A;  1KA1 A;  4Q30 B;  3EQ1 A;  1NFT A;  1IEJ A;  1VFD A;  2Y84 A;  2NOO A;  4F3P A;  4TLL B;  3RPL B;  4JDF A;  2B4L A;  1D9Q A;  2XXW A;  1LGB C;  1DSN A;  2DDK A;  3V89 B;  4O3B A;  5EHM A;  5I5P A;  3K4U A;  2D3I A;  3KOS A;  4N4U A;  2RF1 A;  4I8C A;  4GWS A;  1MM6 A;  1FBD A;  3Q27 A;  5L9S A;  2G93 A;  2KQZ A;  1NV2 A;  1R9L A;  5I2N B;  2XXX A;  2FIX A;  4P11 A;  2OLB A;  3TEP A;  4U1Z A;  4RXL A;  1LBX A;  4PE3 A;  4UA8 A;  1PC3 A;  1LEV A;  4H46 A;  2XXH A;  4NGU A;  4GLI A;  1K9Z A;  5I56 B;  1Q1K A;  1XHY A;  2Z8F A;  1NV6 A;  4GFR A;  2CZL A;  5EYH A;  3C36 A;  5F7V A;  1LFI A;  4ZZE A;  3OO6 A;  5FHN A;  3UN6 A;  2KR0 A;  4C1U A;  1CE2 A;  1DCU A;  3HFU A;  3FJ7 A;  3MZ9 A;  1URS A;  1P99 A;  3PPR A;  1GVC A;  1PDA A;  2XX8 A;  4DXB A;  2PYY A;  3RTW B;  4NHB A;  1EZO A;  1P1W A;  3H6T A;  1B05 A;  1MXX A;  4QSD A;  1OQG A;  1NNT A;  1GR2 A;  3LC8 A;  3TZA A;  1BK4 A;  4N13 A;  2DQV A;  1MQH A;  3I6V A;  1FTJ A;  4ZS9 A;  3KSJ A;  4DI3 D;  3CFL A;  4NF4 A;  4U21 A;  1LAH E;  4YMB A;  1N84 A;  1LFH A;  3PUY E;  3MWB A;  4EUO A;  1FPI A;  3U94 A;  1IZ1 A;  1MY2 A;  4K3F A;  2E0S A;  1Q9D A;  1NH8 A;  5ICT A;  4R9F A;  4DXC A;  3IB0 A;  1IXC A;  1MXW A;  2UVG A;  1IMA A;  1MH3 A;  2OX3 A;  1N0T A;  4BDN A;  5LDZ A;  1ZLQ A;  3C31 A;  4OES A;  3OEL A;  1NV5 A;  4XKN A;  1I6Q A;  3KC0 A;  1MQG A;  2THI A;  1YZ0 A;  4PFW A;  1SW5 A;  3CHG A;  5DEX B;  4N6K A;  3SER A;  1B58 A;  4U2R A;  5F1Q A;  1P1U A;  2Y7P A;  5ET8 A;  1IME A;  1IXG A;  3K6X A;  4GL8 A;  3HN0 A;  3FVO A;  1GTK A;  5I58 B;  1O7T A;  3IOT A;  3T9X B;  4I40 A;  5ITP A;  1Y1Z A;  3KGC A;  4ELP A;  1I6A A;  1A8F A;  4ZED A;  3GLB A;  4HE0 A;  4XIG Q;  1QUJ A;  2I3W A;  5I84 A;  4H65 A;  3IO4 A;  1VFE A;  4OTE A;  2RC7 A;  4KHZ E;  3M8U A;  4THI A;  5F24 A;  4F31 B;  4GWY A;  1AWB A;  1BP5 A;  2ZNU A;  1MXU A;  1II5 A;  3E9X A;  1NMU A;  3PPP A;  2OWT A;  4U23 A;  2DXY A;  4X1B A;  1D3K A;  3HO7 A;  4GWZ A;  3TYH A;  3R6U A;  2DXR A;  4E0W A;  2O51 A;  4IB2 A;  3CRB A;  4FE8 A;  2XWK A;  2GHB A;  1M5B A;  4N81 A;  1NNP A;  3ZKK A;  3RT8 A;  3FJG A;  3UIF A;  4YKP A;  2WBB A;  4Z0I A;  2UVI A;  4KYD A;  4IGT A;  3N94 A;  4MHF A;  1NV4 A;  4OEN A;  2ZNT A;  3GZG A;  3FXB A;  5IZ1 A;  4QXD A;  4R6K A;  2WKY A;  5B70 A;  2QS2 A;  1FTA A;  2GRV A;  2VPN A;  4QF9 A;  4MAG A;  2DVZ A;  1NKX A;  3OD7 A;  5KZT A;  1NI9 A;  1QGX A;  2FBP A;  3E3K A;  3IOV A;  4X8R A;  2OWZ A;  3B50 A;  2NWJ A;  1TFD A;  2UVH A;  4UAB A;  2W7Y A;  4JVI A;  2XXP A;  4U4X A;  3PU5 A;  1OIB A;  2AL4 A;  4G8H A;  3G3F A;  1OVB A;  4PAF A;  3CR9 A;  1USY E;  1NUW A;  4Q5T A;  1FPK A;  4GWW A;  1B9J A;  3T66 A;  3CFX A;  3KJT A;  2GH9 A;  3N6U A;  3H4Z A;  1MM7 A;  1L5T A;  3FJM A;  3RLF E;  3I3V A;  4KXP A;  4OEV A;  3F11 A;  1M5E A;  3MC2 A;  3PPN A;  3EHS A;  4PFR A;  5I2N A;  1FPG A;  5H8F B;  4R6Y A;  1FQA A;  2P3V A;  4XFE A;  4X04 A;  3O97 A;  3S4U A;  2RC9 A;  3ONM A;  2PMS A;  4JVC A;  2ZYN A;  2XXY A;  4JSD A;  3W15 C;  3PTY A;  2XXV A;  1XC1 A;  2Y5L A;  4LA9 A;  3FGS A;  4MLQ A;  4ZEF A;  4DXU A;  3KN8 A;  1N3X A;  1IUD A;  1FPD A;  1YAE A;  2PFZ A;  2F34 A;  2JJK A;  2F7A A;  1B3G A;  3C4M A;  4OEU A;  4OVR A;  4YIC A;  1SW2 A;  1B3F A;  1CB6 A;  1S7Y A;  3K0V A;  4PE5 B;  3R26 A;  4DI4 B;  4FEB A;  3KJ7 A;  3DP8 A;  4RK9 A;  3KOT A;  1MPC A;  4GQO A;  1P1Q A;  1DOT A;  1XOC A;  1TXF A;  4YU0 A;  5K2X A;  1HSJ A;  2UYE A;  4P3L A;  1EH3 A;  4QFK A;  3N26 A;  2QMW A;  3MVX A;  4YKI A;  2XXR A;  4RPO A;  3ZSF A;  3P7I A;  4JWO A;  2O68 A;  3CVG A;  2P0S A;  2RKM A;  4PF6 A;  3OMB A;  1IXH A;  1N04 A;  1B1H A;  4BDQ A;  4PCD A;  5EQA A;  3DLN A;  5AE4 A;  1D9V A;  3O6H A;  1JEU A;  3E79 A;  1FTL A;  4KPT A;  1NV0 A;  2R8T A;  3HCQ A;  4AB5 A;  1SD3 A;  4GIZ A;  1GV8 A;  4FAT A;  2F6P A;  4YB5 A;  5I59 A;  3FV1 A;  2G29 A;  2PT1 A;  1P1O A;  3L6G A;  1I6B A;  5IKB A;  1QW0 A;  4OQO A;  3EF7 A;  2PCR A;  4O3C A;  3S9E A;  4OWD A;  1IIT A;  3SEX A;  4IGR A;  3RY3 A;  2OJT A;  1EZP A;  2H99 A;  1SYH A;  4PAI A;  1FQE A;  2Q2C A;  1FQC A;  5KCJ A;  5AA4 A;  4OVS A;  4AB6 A;  5HPQ A;  1M5C A;  2UXA A;  4R2B A;  5I57 B;  5I59 B;  1Z7M E;  2DYX A;  1FPL A;  2XXT A;  2PVU A;  1B1X A;  3JZJ A;  4M4G A;  1SW4 A;  4R9G A;  3Q26 A;  3RYD A;  3ISP A;  5I2K A;  2P2A A;  2I0B A;  2RCA A;  4KR5 A;  3T9H B;  1TWY A;  5JTY A;  3PPQ A;  2F97 A;  3FXR A;  4F3S A;  1FTM A;  4ZDM A;  3MUQ A;  4NF8 A;  4O94 A;  4DDD A;  4P0I A;  3OXN A;  5L8D A;  5EHS A;  1FW0 A;  3TCF A;  1JQF A;  5B7D A;  3MP1 A;  4NN3 A;  4HCW A;  3KBZ A;  3TPA A;  1LBV A;  1XVY A;  2XXQ A;  1NH7 A;  3MST A;  4BDM A;  1N76 A;  3M3F A;  1MDQ A;  1JP4 A;  3C9H A;  2HAU A;  3SEU A;  1POY 1;  3M3L A;  4N8G A;  5BUU A;  3HPI A;  4QFO A;  1UIV A;  4ZEI A;  1MG1 A;  4PF8 A;  3E13 X;  2WEF A;  1JEV A;  3BFT A;  4XKP A;  1M5D A;  1FBE A;  2CZI A;  1MY0 A;  3PUV E;  2DWI A;  4DCX A;  2I3V A;  3TTK A;  2V84 A;  4H45 A;  1EYJ A;  3ECR A;  4IO3 A;  1B5J A;  2QRY A;  1Y3P A;  4IO6 A;  2I48 A;  1H76 A;  3E4R A;  5ET5 A;  1RDX A;  5CBR A;  3K01 A;  2D5W A;  2WYK A;  4OET A;  2Q8M A;  3TOD A;  4Q8R A;  3MP6 A;  5ET6 A;  5TPA A;  2XX7 A;  4LZ5 A;  4LN5 A;  1XT8 A;  1BLF A;  2O6A A;  4NED A;  3MW0 A;  4XKR A;  4OAN A;  1DPE A;  2FA7 A;  1LST A;  2VD2 A;  4L17 A;  2UYF A;  2V93 A;  1MXV A;  2PBW A;  1MXY A;  2YPN A;  5A5L A;  3K2D A;  3KN3 A;  4HS7 A;  2ZZW A;  4LQ2 A;  2PX1 A;  2YLN A;  3Q25 A;  4NAP A;  4BLA A;  4EQB A;  4KD5 A;  5I56 A;  4ZZA A;  4G61 A;  1LLS A;  5TP9 B;  3CSB A;  4LAT A;  3ILU B;  4NF8 B;  3IFA A;  2QL3 A;  3E78 A;  1EYK A;  3S9M C;  1D4N A;  1QUK A;  4QSC A;  1SQY A;  3GYY A;  3PD8 A;  4GWO A;  4LUB A;  1IMD A;  1FPE A;  1NV7 A;  3GBA A;  3GXA A;  2I49 A;  1FPF A;  3LBS A;  3RUM A;  2I58 A;  5AA1 A;  1MRP A;  4HW8 A;  1FCK A;  1MPB A;  3PGF A;  4KI0 E;  4MH5 A;  4MNP A;  4N6D A;  5CMC A;  3T93 B;  2X26 A;  3PUZ E;  4GXA A;  2HZL A;  4M1V A;  4MNI A;  1A8E A;  4N17 A;  2YJP A;  5CMB A;  4DCY A;  3FV2 A;  3TTM A;  1MQI A;  1B32 A;  5IZZ A;  4NQ8 A;  2F6G A;  2VOZ A;  4QFL A;  3TCG A;  5DYH A;  4OYV A;  3MPL A;  4PC9 A;  4EDP A;  3S9L C;  1OLC A;  1B0H A;  3MP8 A;  2V25 A;  4OHN A;  2DWJ A;  5I2K B;  3C32 A;  2F36 A;  3IB2 A;  1B46 A;  2I4C A;  2X7P A;  3FXU A;  2F3B A;  3RN8 A;  4XEQ A;  4ZE9 A;  1LAF E;  1N7W A;  4OMB A;  3SET A;  3OEM A;  2CMO A;  4YKJ A;  1B7U A;  1WOD A;  3T0J A;  3QUF A;  3ODB A;  1NUY A;  1H43 A;  4ZEK A;  1O64 A;  3S9N C;  2ZYO A;  1KWH A;  4YB7 A;  5FHO A;  3QYT A;  1FQD A;  3OEN A;  4H8J A;  1A40 A;  1OMP A;  4XTC Q;  2O69 A;  5TP9 A;  1ZBM A;  3UK4 A;  2NXO A;  4F2O A;  4EQ9 A;  5AA4 B;  2Q89 A;  4RNS A;  1Z7N E;  2XWO A;  1Y4T A;  3O28 A;  2DSF A;  2GQ1 A;  3A09 A;  2XX9 A;  1FPB A;  3PMV A;  3PV0 E;  1Q35 A;  3RQT A;  3LSF B;  1MXZ A;  3IK6 B;  2Q9T A;  2DWA A;  3KBR A;  3O9P A;  3MVY A;  2Y7W A;  3IL1 B;  1QVS A;  4IO4 A;  3B6W A;  4FAJ A;  2DOJ A;  4OFL A;  3PUW E;  5CM6 A;  2XHD A;  1YYZ A;  4KYE A;  3TAJ A;  1ZKB A;  4TQU Q;  3LSL A;  3VV5 A;  3LUY A;  2CEY A;  3S2V A;  1UTB B;  1IXI A;  4G77 A;  4PGN A;  2XWV A;  3UP9 A;  3G3H A;  1R1N A;  4IO7 A;  4F3B A;  4RPN A;  4NF0 A;  3N5L A;  1SVX B;  4IO2 A;  2OCU A;  1RDY A;  3W9V A;  2V3T A;  1IMC A;  4R2F A;  4NF6 A;  1MY1 A;  1IMB A;  3USD A;  3H3G A;  4Z7E A;  4POX A;  3CG3 A;  2FIE A;  2WYP A;  3MVW A;  2VP1 A;  3U65 A;  1MQD A;  1Y1M A;  3ZKL A;  5EQ7 A;  4YAH X;  2OK2 A;  5KDT B;  4H5F A;  3KN7 A;  5A5X B;  1USY H;  1MS7 A;  5J1D A;  3T22 A;  3OO7 A;  1H3D A;  3D4C A;  1ZU0 A;  5DVF A;  5FTI A;  4NF5 B;  4ZE8 A;  5IM2 A;  3H6V A;  3PMW A;  3RT6 B;  1G0I A;  3T96 B;  5H8H B;  3SES A;  1LBW A;  1EYI A;  4N6P A;  4P1E A;  1N7X A;  4H1X A;  2Z8E A;  3D1R A;  1JW5 A;  3IJX B;  2ZMB A;  2R9J A;  4GWX A;  4KYS A;  4RYA A;  5IZ3 B;  4QHQ A;  5I57 A;  3LR1 A;  2CEX A;  2DWH A;  3EN3 A;  3VE1 B;  1XVX A;  3FVK A;  2AL5 A;  1URG A;  1QJM A;  1A54 A;  3MZB A;  4YB6 A;  4LQ5 A;  1B5H A;  3U8Q A;  3EKI A;  5H8S A;  3MBP A;  3H7M A;  4GVO A;  4JWX A;  2QMX A;  4GOT A;  1FBF A;  1B7Z A;  3MYU A;  2F5X A;  5JTY B;  2ZYM A;  4QSE A;  2HQ0 A;  3PD9 A;  4ONY A;  4X1D A;  4TLM B;  5JEI A;  3IB1 A;  4HCY A;  1JVX A;  4YKK A;  3O29 A;  3FVN A;  4AS5 A;  1FSA A;  1LB8 A;  4P9K A;  3FZV A;  3PPO A;  4KCC A;  3IX1 A;  5CBS A;  3THI A;  4O7M A;  1SPI A;  4H8I A;  3UGW A;  5ITO A;  4BDL A;  3RTF B;  2I6E A;  2ZYK A;  2A5T A;  2QPQ A;  4MX6 A;  4F1Y A;  3KG2 A;  5J16 A;  3V83 A;  2IEE A;  4FOR A;  3OO9 A;  5ISU A;  2Y7I A;  4PFT A;  1AL3 A;  2OZZ A;  1EU8 A;  2I4B A;  4JVD A;  1RYX A;  1FRP A;  4NMY A;  1EZ9 A;  1ZMG A;  4POW A;  3BKI B;  4PDD A;  4YZZ A;  1LBY A;  2HEU A;  2O84 X;  4GWU A;  4MF3 A;  3Q28 A;  4G4P A;  4ZEB A;  4HTG A;  3DP6 A;  5EYF A;  1Y20 A;  4GBW A;  1NV1 A;  2XD3 A;  3MAM A;  1FJ6 A;  4G8N A;  1FBC A;  3TQW A;  2QS3 A;  1POT A;  2QVR A;  3TMG A;  4OA4 A;  1BKA A;  1LAX A;  3C34 A;  5H8Q B;  4U22 A;  2Q88 A;  1N3W A;  2E1S A;  3CFZ A;  4C0R A;  1NV3 A;  4GD5 A;  4X9T A;  2F7C A;  4O7I A;  1DMB A;  2VT5 A;  3K6U A;  4PBH A;  3U72 A;  3T9V A;  5TPA B;  2B3B A;  2ESN A;  2PFY A;  3FVG A;  3TFL A;  4WED A;  3M3K A;  1BTJ A;  1PB7 A;  1B52 A;  4G68 C;  5IGA A;  3H6U A;  3MQ9 A;  3HST A;  3FD3 A;  4MMP A;  3TCH A;  4OXV A;  5DVI A;  2GHA A;  2QVV A;  4WXJ A;  3VLV A;  3IFC A;  2KLF A;  2I0C A;  1LCT A;  4QFP A;  1IQ7 A;  1VSO A;  4F1V A;  1H45 A;  1SYI A;  3QMF A;  3IOU A;  1A7L A;  1LCF A;  4MCO A;  4N15 A;  3SDF A;  4OVJ A;  5AA2 A;  1S50 A;  1I69 A;  4I9D A;  1MY4 A;  4PFI A;  1PB8 A;  1SDX A;  2ANJ A;  4NF4 B;  4MBP A;  4PFY A;  3G3I A;  4QFN A;  2ZNS A;  1ANF A; 
#chains in the Genus database with same CATH homology
 1JVY A;  4QSC A;  1AOV A;  2REG A;  2WKY A;  4R6K A;  1SQY A;  4E0X A;  5HM4 B;  3UOR A;  3B6Q A;  1QUL A;  3UA8 A;  5B70 A;  2O1M A;  3K1N A;  3PD8 A;  4GWO A;  2ONR A;  2QS2 A;  3PMX A;  4G68 A;  3WAF A;  4LUB A;  1H44 A;  2X7Q A;  2FYI A;  1JW4 A;  1SI0 A;  2GRV A;  3C35 A;  3GBA A;  4QF9 A;  2DVZ A;  2R71 A;  4H5G A;  4F1U A;  1NKX A;  1SW1 A;  3GXA A;  3OD7 A;  1OVT A;  2I49 A;  5KZT A;  4H67 A;  4LON B;  3LBS A;  1GGG A;  3RUM A;  1MDP 1;  2VD3 A;  4XKQ A;  2I58 A;  3E3K A;  4AQ4 A;  5AA1 A;  3IOV A;  1B5I A;  1MRP A;  5H8N A;  2NWJ A;  1TFD A;  2UVH A;  3K6W A;  1NNF A;  2W7Y A;  3G7W A;  1HSL A;  4HW8 A;  1FCK A;  2XXP A;  1MPB A;  1Y4C A;  2REJ A;  3PGF A;  4KI0 E;  3TQL A;  4U4X A;  3PU5 A;  4MH5 A;  2ALU A;  5L9M A;  5CMC A;  1OIB A;  3VVF A;  2AL4 A;  2NUV A;  3L6H A;  4F22 A;  5CI5 A;  3T93 B;  1TT1 A;  2X26 A;  3G3F A;  4G8H A;  1FTK A;  1B0L A;  4F18 A;  1OVB A;  2D21 A;  1LBB A;  2HCA A;  3BBR A;  5FHM A;  3PUZ E;  1B7H A;  3BFU A;  3CR9 A;  4GXA A;  4WEP A;  4GF8 A;  1USY E;  2HZL A;  4M1V A;  4Q5T A;  1A8E A;  5CMM A;  1B9J A;  2B65 A;  2FNC A;  3ILT B;  4DXU A;  5JK4 A;  2YJP A;  5CMB A;  3T66 A;  2AYS A;  2R6G E;  3CFX A;  4DCY A;  3KJT A;  2GH9 A;  3N6U A;  2V3U A;  3H4Z A;  4KQP A;  1MM7 A;  3FV2 A;  3TTM A;  1L5T A;  1MQI A;  1B32 A;  1PBQ A;  3FJM A;  4ND9 A;  5DT6 A;  3RLF E;  3VDF A;  2F6G A;  4ZEC A;  3PUX E;  2VOZ A;  5DEX A;  2QS4 A;  1D9Y A;  3I3V A;  4QFL A;  2GFE A;  3K00 A;  4JSO A;  4N07 A;  5DVJ A;  4ELR A;  4OEV A;  3TCG A;  5DYH A;  4OFJ A;  4OYV A;  1BIY A;  1NL5 A;  3F11 A;  2HZK A;  3H6W A;  3MPL A;  4PFU A;  3TEL A;  4EDP A;  3S9L C;  1M5E A;  3C33 A;  3MC2 A;  3KSX A;  1OLC A;  2Y7R A;  1AMF A;  1B0H A;  3EHS A;  3G3J A;  2F35 A;  3OO8 A;  3PPN A;  3MP8 A;  1NNK A;  3K1P A;  5I2N A;  5IAI A;  2H98 A;  1DTZ A;  4LP2 B;  5M2V A;  3H06 B;  5H8F B;  5ICQ A;  5DTB A;  5ELV A;  2V25 A;  4OHN A;  2DWJ A;  2V3Q A;  4R6Y A;  5I2K B;  2VHA A;  1FQA A;  3O6I A;  4R72 A;  4RJZ A;  1OQH A;  3U92 A;  3C32 A;  3SEW A;  4F39 A;  2F36 A;  3IB2 A;  1B46 A;  2I4C A;  1Y3Q A;  2X7P A;  3DEL B;  3FXU A;  3KZG A;  3N6T A;  1US4 A;  3O97 A;  2H9B A;  3G3K A;  3R7X A;  3RN8 A;  5AA3 A;  4EF2 A;  2HXW A;  3TDJ A;  3T9U A;  4ZE9 A;  3S4U A;  2RC9 A;  1UTH B;  1LAF E;  1N7W A;  3ONM A;  4NE4 A;  2PMS A;  5TU0 A;  1LAG E;  2A5S A;  2ZYN A;  4OMB A;  2XXY A;  3SET A;  3OEM A;  4U1O A;  4ECF A;  4IY5 A;  5H8F A;  3O2A A;  2UVJ A;  4JSD A;  2CMO A;  1XS5 A;  3W15 C;  3VXC A;  2XXU A;  4YKJ A;  1B7U A;  1WOD A;  2XXV A;  1XC1 A;  1RYO A;  1B6H A;  3EHU A;  3DP4 A;  4LA9 A;  3QUF A;  2Z22 A;  2ONS A;  4R6H A;  3ODB A;  3FGS A;  3RPW A;  4MLQ A;  1UTH A;  3B7D A;  2F8D A;  4ZEF A;  4BDR A;  1H43 A;  4ZEK A;  1O64 A;  5FTH A;  3S9N C;  2ZYO A;  2O7I A;  1KWH A;  3KN8 A;  4GL0 A;  3K02 A;  1N3X A;  4NF6 B;  4YB7 A;  3V8X B;  3V5A A;  1IUD A;  4YMA A;  4EXL A;  5FHO A;  3QYT A;  1YAE A;  4EXK A;  1FQD A;  3IR1 A;  2F34 A;  3FUZ A;  3VLW A;  2RC8 A;  3HHG A;  3OEN A;  4OZ9 A;  1YCJ A;  4H8J A;  2F7A A;  1ZIU A;  4KFQ A;  3VVD A;  1A40 A;  1B3G A;  1OMP A;  4EF1 A;  3IJO B;  4XTC Q;  3C4M A;  2Q8J A;  2DP8 A;  2O69 A;  1WVJ A;  2LAO A;  4OEU A;  4P0G A;  3TKD A;  5AA2 D;  1MH4 A;  5TP9 A;  1ZBM A;  4YIC A;  1SW2 A;  5I58 A;  2DE2 A;  3UK4 A;  1SI1 A;  1B3F A;  4WKM A;  1AIV A;  2NXO A;  3SKP A;  4F2O A;  4EQ9 A;  5AA4 B;  1PEB A;  3B6T A;  2Q89 A;  4RNS A;  5CMK A;  1CB6 A;  1Z7N E;  1S7Y A;  2Q2A A;  1Y4T A;  1B2H A;  2P1S A;  2Z23 A;  3I5O A;  3K0V A;  3KFM A;  3O28 A;  1MQJ A;  3R26 A;  4PE5 B;  4G8M A;  2DSF A;  2HAV A;  4FEB A;  3KJ7 A;  3OSR A;  3EPE A;  3FXQ A;  3H03 A;  3DP8 A;  4QRZ A;  3A09 A;  4RK9 A;  4MFI A;  2XX9 A;  3KOT A;  3RGY A;  4DLD A;  1MPC A;  4GQO A;  1A55 A;  1LFG A;  1DOT A;  1P1Q A;  2QSX A;  3PMV A;  1B4Z A;  1QUI A;  1XOC A;  3PV0 E;  1TXF A;  4NWC A;  1O63 A;  1Q35 A;  1Y3N A;  3Q29 A;  4YU0 A;  3QXM A;  5K2X A;  3LSF B;  5HBC A;  1MXZ A;  4U4S A;  3RQT A;  4C1T A;  3O6G A;  4ESW A;  3IK6 B;  1HSJ A;  1QKA A;  2Q9T A;  2DWA A;  2QJE A;  2UYE A;  3MVZ A;  3KBR A;  4IO5 A;  1EH3 A;  3IAZ A;  2XD2 A;  3O9P A;  4G68 B;  4DZ1 A;  3MVY A;  4QFK A;  4R73 A;  3SEV A;  2Y7W A;  3IL1 B;  3N26 A;  1QVS A;  4IO4 A;  1YTV A;  3B6W A;  4FAJ A;  2DOJ A;  4OFL A;  3PUW E;  3FIR A;  2XHD A;  3AXF A;  3HV1 A;  4PET A;  2DS9 A;  3OOA A;  4KYE A;  2QMW A;  1A99 A;  3TAJ A;  2DE3 A;  2HFB A;  3VVE A;  1ZKB A;  3MVX A;  4FED A;  4JXI A;  3U1O A;  2XXR A;  4TQU Q;  4H0W A;  3LSL A;  3G3G A;  4Q30 B;  4YKI A;  3LUY A;  3EQ1 A;  4RPO A;  3CSG A;  3VV5 A;  3ZSF A;  3P7I A;  1NFT A;  4JWO A;  1IEJ A;  2O68 A;  3LSW A;  3S2V A;  1VFD A;  3CVG A;  1SBP A;  1ZJL A;  1UTB B;  1IXI A;  2NOO A;  2P0S A;  2RKM A;  2Y84 A;  4G77 A;  3OMB A;  4F3P A;  4ESX A;  4TLL B;  3UP9 A;  3G3H A;  4RA1 A;  1IXH A;  1N04 A;  1R1N A;  4NTL A;  1B1H A;  4IO7 A;  4F3B A;  4RPN A;  3N5L A;  2ZXT A;  4LVQ A;  4BDQ A;  1SVX B;  1AH5 A;  4H6D A;  4DE8 A;  4JDF A;  3DLN A;  4GXS B;  4IO2 A;  2OCU A;  2XXW A;  5AE4 A;  1B4H A;  1LGB C;  1DSN A;  3W9V A;  2V3T A;  3V89 B;  4O3B A;  1D9V A;  5EHM A;  3O6H A;  3K4U A;  2D3I A;  1JEU A;  3KOS A;  3QSL A;  3WAE A;  4R2F A;  2RF1 A;  4I8C A;  1MY1 A;  4NF6 A;  1MM6 A;  1ATG A;  3Q27 A;  5L9S A;  2M8C A;  1FTL A;  4KPT A;  3USD A;  2G93 A;  5KCJ B;  3H3G A;  3HCQ A;  1R9L A;  4POX A;  1B3E A;  3ZS6 A;  4Z7E A;  5I2N B;  2XXX A;  5KDT A;  4AB5 A;  1SD3 A;  5A5X A;  4F2Q A;  3CG3 A;  4GIZ A;  1GV8 A;  4P11 A;  1R9Q A;  2OLB A;  3FAT A;  4FAT A;  3TEP A;  3U93 A;  4U1Z A;  2F6P A;  4RY1 A;  4RXL A;  4FIM A;  3MVW A;  4UA8 A;  3FV1 A;  2VP1 A;  2G29 A;  4YB5 A;  1PC3 A;  4G2Z A;  1B51 A;  5CM6 A;  5I59 A;  1J1N A;  2PT1 A;  2XXH A;  1MQD A;  1Y1M A;  1P1O A;  3ZKL A;  3L6G A;  2OK2 A;  4YAH X;  2OWS A;  1US5 A;  3QAX A;  5KDT B;  4H5F A;  2AIX A;  1I6B A;  3KN7 A;  4GLI A;  5A5X B;  4XXU A;  1QW0 A;  5IKB A;  1USY H;  5I56 B;  1MS7 A;  1Q1K A;  3MJN A;  1XHY A;  4JWY A;  2Z8F A;  5J1D A;  1DTG A;  4OQO A;  3T22 A;  3OO7 A;  4GFR A;  1H3D A;  2ZNS A;  1T0K A;  1MY3 A;  2CZL A;  1ZU0 A;  3D4C A;  3EF7 A;  5DVF A;  1ZTY A;  4O3C A;  5FTI A;  4NF5 B;  4ZE8 A;  3S9E A;  3H6V A;  3PMW A;  3C36 A;  4OWD A;  3DM0 A;  1IIT A;  2Z8D A;  3RT6 B;  5H8H B;  3T96 B;  3SEX A;  5F7V A;  4IGR A;  1M5F A;  3SES A;  1LFI A;  3TTN A;  4MLV A;  4ZZE A;  4N6P A;  3RY3 A;  1N7X A;  3OO6 A;  2OJT A;  4H1X A;  1EZP A;  1FQB A;  2H99 A;  1SYH A;  2Z8E A;  1JW5 A;  3A3C A;  5FHN A;  3UN6 A;  3IJX B;  2ZMB A;  1FQE A;  2R9J A;  5LOM A;  4C1U A;  4KYS A;  4RYA A;  1CE2 A;  4QHQ A;  1B3H A;  2Q2C A;  5I57 A;  4UAC A;  2VGQ A;  4GRK A;  4TOZ A;  1FQC A;  3LR1 A;  5KCJ A;  2DWH A;  3EN3 A;  3FAS A;  5AA4 A;  1F9B A;  3VE1 B;  1XVX A;  2ONK E;  3FJ7 A;  3MZ9 A;  4AB6 A;  3FVK A;  5HPQ A;  1URS A;  1M5C A;  4KCD A;  1P99 A;  2AL5 A;  1URG A;  1PDA A;  3PPR A;  1GVC A;  2UXA A;  4R2B A;  1QJM A;  1A54 A;  2XX8 A;  3MZB A;  4IY6 A;  3VFJ A;  4DXB A;  2PYY A;  3RTW B;  5CC2 A;  5I59 B;  5I57 B;  4YB6 A;  1Z7M E;  1B5H A;  1UTB A;  4LQ5 A;  3U8Q A;  1EZO A;  3KEI A;  2DYX A;  5H8S A;  3MBP A;  1ELJ A;  2H4I A;  3H7M A;  1P1W A;  2XXT A;  4PP0 A;  4GVO A;  2PVU A;  4JWX A;  4OER A;  1B1X A;  2QMX A;  3H6T A;  1B05 A;  1MXX A;  3JZJ A;  4QSD A;  1OQG A;  4M4G A;  1SW4 A;  1VR5 A;  4GOT A;  1B7Z A;  1NNT A;  2F5X A;  1GR2 A;  5JTY B;  2ZYM A;  3LC8 A;  4R9G A;  1UQW A;  3TZA A;  3Q26 A;  4ELQ A;  4N13 A;  4QSE A;  2HQ0 A;  5K2Y A;  3PD9 A;  2NVU B;  2OBG A;  2DQV A;  4R75 A;  5I2K A;  1MQH A;  3K6V A;  1WDN A;  4ONY A;  4OFO A;  2P2A A;  4X1D A;  2PT2 A;  4TLM B;  5JEI A;  3IB1 A;  3I6V A;  4HCY A;  3TTL A;  3OSQ A;  2I0B A;  1PBP A;  2RCA A;  1FTJ A;  4KR5 A;  1TWY A;  1JVX A;  3T9H B;  5JTY A;  3PPQ A;  3CG1 A;  2F97 A;  3FXR A;  4YKK A;  4F3S A;  4ZS9 A;  3O29 A;  3FVN A;  3KSJ A;  1LB8 A;  1FTM A;  3CFL A;  1OLA A;  3OEK A;  4NF4 A;  4I1D A;  4ZDM A;  3SEY A;  3MUQ A;  4U21 A;  4NF8 A;  3FZV A;  3PPO A;  1LAH E;  4KCC A;  1N84 A;  3IX1 A;  3THI A;  4F29 A;  3PUY E;  3MWB A;  4DDD A;  4H8I A;  4YMB A;  5CBS A;  1LFH A;  4P0I A;  4EUO A;  3OXN A;  3UGW A;  2DVC A;  5AA2 B;  3U94 A;  5ITO A;  1IZ1 A;  4BDL A;  3RTF B;  1MY2 A;  4K3F A;  2E0S A;  5L8D A;  5L9O A;  1FW0 A;  2I6E A;  2ZYK A;  5EHS A;  2A5T A;  2QPQ A;  3TCF A;  4FJP A;  1NH8 A;  3KG2 A;  4F1Y A;  1JQF A;  5B7D A;  2IEE A;  2QS1 A;  3MP1 A;  4FOR A;  5ICT A;  3V83 A;  4R9F A;  4HCW A;  3OO9 A;  5ISU A;  2Y7I A;  3JYR A;  3LSX A;  1AL3 A;  2OZZ A;  4PFT A;  3IB0 A;  1EU8 A;  3TPA A;  3D4G A;  1XVY A;  2XXQ A;  1NH7 A;  4BDM A;  4DXC A;  1N76 A;  3MPK A;  1IXC A;  1MXW A;  2UVG A;  3RNN A;  2I4B A;  3M3F A;  2A5T B;  1MH3 A;  1RYX A;  4NMY A;  1N0T A;  4BDN A;  4EQ7 A;  3CIJ A;  1MDQ A;  1ZLQ A;  4Q0C A;  3C31 A;  3C9H A;  2HAU A;  4I62 A;  3OEL A;  4OES A;  3SEU A;  1EZ9 A;  1POY 1;  1ZMG A;  4RK2 A;  3M3L A;  4POW A;  3IOW A;  4XKN A;  1I6Q A;  4PQJ A;  4R74 A;  3VXB A;  1MQG A;  2THI A;  3QIM A;  5BUU A;  4PFW A;  3HPI A;  1SW5 A;  3A3U A;  3BKI B;  4QFO A;  2H25 A;  5DEX B;  4YZZ A;  3SER A;  1B58 A;  4U2R A;  5F1Q A;  4F3G A;  1P1U A;  1UIV A;  2HEU A;  2O84 X;  1MG1 A;  4ZEI A;  2Y7P A;  2F7B A;  2O1L A;  4MF3 A;  3IO6 A;  3Q28 A;  4G4P A;  1IXG A;  4NF5 A;  4ZEB A;  3IOR A;  3K1M A;  3E13 X;  3K6X A;  3MZ1 A;  1JEV A;  4JB7 A;  4GL8 A;  5H8H A;  3HN0 A;  3QUJ A;  3BFT A;  3FVO A;  4XKP A;  1M5D A;  4HTG A;  3DP6 A;  4X48 A;  5H8Q A;  1GTK A;  5EYF A;  1TFA A;  1Y20 A;  1MPD A;  1O7T A;  1MY0 A;  4NWD A;  5I58 B;  3PUV E;  2XD3 A;  2BJJ X;  3MAM A;  2DWI A;  3IOT A;  4G8N A;  4DCX A;  2DE4 A;  3HHF A;  5CRY A;  2O7U A;  1B40 A;  1JET A;  2I3V A;  3TTK A;  1Y9U A;  2V84 A;  3TQW A;  2QS3 A;  3T9X B;  3ECR A;  4IO3 A;  1B5J A;  1POT A;  1Y1Z A;  2QRY A;  2XXI A;  4ELO A;  1Y3P A;  4LZ8 A;  3TMG A;  5ITP A;  4IO6 A;  3KGC A;  2IA4 A;  1BKA A;  1LAX A;  2I48 A;  3CI8 A;  5H8N B;  1B3L A;  1H76 A;  3C34 A;  3E4R A;  4ELP A;  1I6A A;  1A8F A;  2H5Y A;  5H8Q B;  4ZED A;  3GLB A;  4O3A A;  4F19 A;  4U22 A;  5CBR A;  3VLU A;  3K01 A;  2D5W A;  4OET A;  4XIG Q;  2Q88 A;  1QUJ A;  1N3W A;  3TOD A;  2I3W A;  4Q8R A;  5I84 A;  3MP6 A;  1FTO A;  5TPA A;  2E1S A;  3CFZ A;  2XX7 A;  4C0R A;  2F78 A;  4H65 A;  4LZ5 A;  1XT8 A;  1BLF A;  3O66 A;  4GD5 A;  1LB9 A;  5BWJ A;  3IO4 A;  4X9T A;  2F7C A;  2O6A A;  4NED A;  1VFE A;  4OTE A;  3QK6 A;  3MW0 A;  2RC7 A;  2Y7K A;  3M8U A;  4KHZ E;  1DMB A;  4THI A;  4F31 B;  1QKB A;  3K6U A;  3U72 A;  3T9V A;  5TPA B;  4XKR A;  1BP5 A;  1JNF A;  2B3B A;  2ZNU A;  1MXU A;  1DPE A;  1II5 A;  2ESN A;  3E9X A;  1NMU A;  2FA7 A;  1LST A;  2OWT A;  2VD2 A;  3FVG A;  3PPP A;  2UYF A;  4L17 A;  4U23 A;  3TFL A;  2DXY A;  4WED A;  2V93 A;  4X1B A;  1D3K A;  3M3K A;  1BTJ A;  1PB7 A;  1B52 A;  1IIW A;  4JBZ A;  2B3F A;  4G68 C;  3HO7 A;  1MXV A;  2PBW A;  1MXY A;  2YPN A;  1P1N A;  4LZ7 A;  3TYH A;  3H6U A;  1DPP A;  2DXR A;  3R6U A;  3K2D A;  3MQ9 A;  3HST A;  4FEC A;  3FD3 A;  4ISU A;  4E0W A;  2O51 A;  4IB2 A;  3TCH A;  3CRB A;  4FE8 A;  1RKM A;  3KN3 A;  4OXV A;  5DVI A;  2GHA A;  4HS7 A;  1HSE A;  4WXJ A;  3VLV A;  2GHB A;  4LQ2 A;  2KLF A;  2I0C A;  1M5B A;  1LCT A;  2PX1 A;  4QFP A;  1IQ7 A;  2YLN A;  3Q25 A;  1VSO A;  4BLA A;  4EQB A;  4F1V A;  4KD5 A;  1H45 A;  1SYI A;  5I56 A;  1NNP A;  3IOU A;  4ZZA A;  1LLS A;  5TP9 B;  3W9W A;  3ZKK A;  4BDO A;  1A7L A;  3CSB A;  1LCF A;  3EHT A;  3TUS A;  3RT8 A;  1VE4 A;  3FJG A;  3UIF A;  4YKP A;  1FQF A;  4LAT A;  3SDF A;  4OVJ A;  2RCB A;  5AA2 A;  1S50 A;  1URD A;  4Z0I A;  2UVI A;  1I69 A;  1LBC A;  4IGT A;  3GBB A;  4I9D A;  2ABH A;  4KYD A;  1MY4 A;  3N94 A;  1R6Z A;  3ILU B;  2RIN A;  3JV9 A;  1PB8 A;  1SDX A;  2ANJ A;  1UIU A;  1S9T A;  1PB9 A;  4NF4 B;  1YPN A;  3TTR A;  1JW1 A;  4OEN A;  4NF8 B;  2ZNT A;  4MBP A;  2QL3 A;  3GZG A;  4PFY A;  4DIG A;  3G3I A;  3S9M C;  1D4N A;  4QFN A;  1QUK A;  1ANF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...