4H5GA

Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l-arginine, form 2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
240
structure length
240
Chain Sequence
QSAVEAIKQKGKLVVATSPDYAPFEFQSLVDGKNQVVGADIDMAQAIADELGVKLEILSMSFDNVLTSLQTGKADLAVAGISATDERKEVFDFSIPYYENKISFLVHKADVEKYKDLTSLESANIAAQKGTVPESMVKEQLPKAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKNAGLAVATVSLKMKDGDANAVALRKNSDDLKEVVDKVIQKLKDEGTYQSYLEKAASLTEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine, form 2
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords Amino acid ABC superfamily ATP binding cassette transporter,
total genus 84
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h5gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h5gA02
1D9VA 1B52A 2F36A 4QFNA 1LBCA 2G93A 4U1ZA 2OWSA 3PPRA 4R6HA 4GXSB 3SEXA 5ICTA 1NH7A 2Y7KA 3AXFA 2XXYA 5FTHA 3B6WA 2HXWA 2QSXA 2NVUB 3GBAA 3UP9A 4YMAA 5I58A 1SD3A 3BFTA 3IOUA 2AL4A 5DEXA 3HPIA 5H8SA 4QFPA 5HPQA 4YB7A 4R9FA 4OTEA 4LZ7A 3WAFA 4GL8A 1NMUA 3VXBA 1ZU0A 3PUXE 4BDMA 3H6TA 1RYXA 3FVGA 1NNTA 1ZTYA 2G29A 1GTKA 1M5BA 1MM6A 3IO6A 3EHSA 4FJPA 4GXAA 3TTMA 2I4BA 1H44A 3MPLA 2DWAA 4R75A 3RTWB 1HSLA 2R6GE 3EN3A 1UIUA 4LVQA 2B3FA 5I56B 5IKBA 2NXOA 4DXBA 1SW1A 5TU0A 4BDQA 1Y20A 5CMBA 4U23A 2XXUA 3N6TA 2RC8A 4RK9A 5AA2B 1Y1ZA 4TLLB 4DLDA 4NF6B 3CR9A 3BFUA 4EQ9A 1AH5A 1B3GA 3C33A 2V93A 2Z8DA 3OEKA 3HO7A 4FE8A 4ECFA 2XXPA 5K2YA 3TUSA 3MAMA 1M5EA 2ZYMA 2V3UA 4NF6A 4PETA 1XC1A 4RK2A 4GWOA 4XIGQ 5CMCA 3TCHA 3THIA 4R2BA 5I2NB 1USYH 4WXJA 5HBCA 5H8NB 1SW4A 2DWIA 4KR5A 3FVOA 1XHYA 4RPNA 5ICQA 2ABHA 1OVBA 1Z7NE 4PFYA 2O7UA 4H0WA 4F1UA 3KN7A 1B7HA 2DYXA 1SYHA 3SERA 3PMWA 3ZKKA 3FJMA 1UTBB 2I58A 2THIA 1SDXA 4I1DA 1XOCA 3PMXA 1B32A 1TFAA 3D4GA 3OMBA 1B3EA 4X9TA 1MY3A 3OOAA 1YPNA 4G2ZA 3K0VA 1QUJA 2ZNSA 2BJJX 3N94A 1MM7A 4IGTA 2Y7PA 3Q27A 3TZAA 2X7QA 1SW2A 4XKQA 4F1YA 3LSWA 3C32A 4H6DA 4G68C 4R73A 3VVDA 1LBBA 2XXXA 4ZEBA 3K4UA 2B65A 5KDTB 3O29A 4XXUA 1MXVA 2A5SA 1N04A 4F1VA 2DSFA 2AIXA 3PD9A 4KYDA 5EYFA 3OD7A 3K02A 1B1XA 1EH3A 4I8CA 2R71A 1NL5A 4I9DA 4MBPA 4N6PA 4DXCA 2YLNA 4ZEDA 4R2FA 2ZXTA 2DQVA 1PB8A 5H8FB 1QJMA 4IY6A 2O1LA 5TPAA 5AA2D 1Z7ME 2WKYA 4GIZA 1SW5A 4EUOA 1US4A 1PBPA 3OELA 5H8HA 4F2QA 1P1QA 4RXLA 3T66A 2PT1A 3VVEA 3A09A 4JSDA 3V89B 4LP2B 4UA8A 4JDFA 2PX1A 1FQEA 2I4CA 3T93B 3UORA 3TELA 4LATA 1R9QA 1OIBA 5FTIA 4FATA 2AL5A 3C36A 1NFTA 3W9WA 1R9LA 5IAIA 4ISUA 2DWJA 3U94A 1Y4CA 4DDDA 2B3BA 3TMGA 2ANJA 3MUQA 3G3FA 3U8QA 3HN0A 5CBRA 3TPAA 2DE2A 1MY2A 4F19A 2VD3A 1LB8A 1Q1KA 4IO5A 2XD3A 5DYHA 2D21A 1MRPA 4RJZA 3KJ7A 4WKMA 4KCCA 4OYVA 5CMKA 3MBPA 2QMWA 3OO8A 3KSJA 4YKPA 2ONRA 5CRYA 2I0BA 3TTRA 4YMBA 4QFKA 3W15C 3ILTB 2UVJA 4F3PA 3Q26A 3U1OA 3C31A 1DSNA 1FTKA 2E0SA 4OXVA 3FXUA 2DE3A 1II5A 3GBBA 1UTHA 3B7DA 1B58A 3L6HA 1A7LA 2O6AA 4YICA 4FEBA 2Q2AA 1B1HA 2I3VA 1RYOA 3G3KA 1JETA 4Q30B 4XKRA 4U21A 3ZKLA 4ZE9A 1FTMA 4OFJA 2H98A 4LONB 5DT6A 1FTOA 3D4CA 5B70A 2DE4A 1N84A 2VOZA 2XXVA 3ZSFA 4C1UA 3T9UA 1ELJA 2F34A 1NH8A 2ONKE 2QS2A 4NEDA 1IXHA 1UTBA 4FIMA 2I0CA 4LUBA 2XX8A 3KZGA 2UXAA 2GHBA 4IO2A 4JBZA 1QUKA 1EZOA 1JNFA 3LBSA 1DPEA 4KYEA 1ZKBA 1LAHE 4OFOA 3VLVA 4Q8RA 5KCJA 1SI0A 2VD2A 2H5YA 2YJPA 4IO4A 3H3GA 3KOTA 4QFLA 2Y7RA 3RUMA 4RPOA 1USYE 1SYIA 1BKAA 1MQJA 2QJEA 3ILUB 3PUWE 1N0TA 1JW5A 3HSTA 4ONYA 3MP6A 3A3CA 3IAZA 4ZECA 4JB7A 5L9SA 3KN3A 3I3VA 1A8EA 1XVYA 3LSXA 3DP8A 4OEVA 5LOMA 3T96B 3FJGA 3MVYA 3UN6A 1CE2A 2V84A 1OQGA 2NUVA 2OZZA 3DP4A 4F22A 3OO6A 3IB2A 2Q2CA 3C4MA 3I6VA 4DCYA 2O68A 4G77A 3G7WA 4G4PA 1TFDA 1GV8A 1YAEA 2ZNUA 3FZVA 1QULA 4GVOA 4IY5A 4QSDA 1ATGA 3MVWA 3FV2A 4YZZA 5HM4B 1IITA 2OCUA 2OBGA 4F29A 4BDNA 5L9MA 4YAHX 2QS3A 5CMMA 4FECA 1I6BA 2F7AA 4BDLA 3MW0A 2O1MA 1LFHA 1ZLQA 3S9NC 3PUZE 4H1XA 1MXWA 4PFWA 3V8XB 5JTYA 2PT2A 1EU8A 1MXYA 2XXTA 4JSOA 1A55A 3FIRA 1UQWA 5ELVA 2CZLA 3HV1A 3P7IA 3R6UA 1MDQA 5JTYB 2ZYOA 3FD3A 3QIMA 2OJTA 4OZ9A 1KWHA 3UA8A 2QRYA 3RQTA 3GZGA 2O7IA 4Z0IA 5AA4B 3MZ9A 3PUVE 1B0HA 4MF3A 1OMPA 3PPOA 1EZPA 3TTLA 3PUYE 4DIGA 1TWYA 4QSCA 1N7XA 4EDPA 2M8CA 1URGA 3IO4A 1N7WA 2UVIA 3C35A 1PB7A 1WODA 2CMOA 2H4IA 1I6QA 3IOVA 1J1NA 3I5OA 4OVJA 1N3XA 1URDA 1Y9UA 1SI1A 4M1VA 3OO7A 4XKNA 4EQBA 1ANFA 2Z22A 3Q29A 4TOZA 1ZIUA 1D3KA 5DVIA 3VLUA 4DXUA 4LA9A 4BDRA 1MQHA 3RTFB 4C0RA 5I57B 3JV9A 2ESNA 4HCYA 2RKMA 1M5CA 1TT1A 1MY0A 2Q8JA 4OETA 3UK4A 5I2KB 1MQDA 2UYEA 1B0LA 3DM0A 3IB0A 2HQ0A 4KFQA 5H8QB 3TKDA 3TODA 4U22A 1XT8A 5A5XB 1OQHA 1Q35A 4KPTA 1RKMA 3K1PA 3H4ZA 3N26A 3PPQA 1HSEA 1NNFA 1R1NA 4U4SA 4ELOA 3EQ1A 3R26A 4RA1A 4AB5A 1B4ZA 4Z7EA 1WVJA 5I2KA 1US5A 3G3IA 3MC2A 4MH5A 1FQAA 4NMYA 5FHMA 2F5XA 3LUYA 3O9PA 3G3HA 3KOSA 1IQ7A 2HZKA 2YPNA 3H6WA 5FHNA 1ZJLA 2Y84A 1IXGA 1GGGA 2HAVA 2REGA 4O3CA 2NOOA 2XHDA 3PD8A 4O3BA 1QKAA 3OSQA 4NF4A 1H3DA 1NNPA 4U1OA 3SEVA 3L6GA 2P0SA 4YKKA 3GXAA 1FQDA 1TXFA 3K00A 5BWJA 2Y7IA 4H67A 2DXRA 3VE1B 3O2AA 4OMBA 5ITOA 1POY1 5CI5A 4E0XA 1NKXA 5H8HB 3CFLA 3Q28A 3U93A 1O63A 4ESXA 5H8NA 1EZ9A 2F7CA 4EXLA 3U72A 2DVZA 3OEMA 1P99A 3OENA 1H43A 1ZBMA 3O6HA 1UTHB 2NWJA 3T22A 3W9VA 4Q0CA 3M3KA 1MPDA 2W7YA 1I69A 4MFIA 2UYFA 4KCDA 2VHAA 4G8MA 4X1DA 2I49A 4LQ5A 1L5TA 5AA2A 2F7BA 4IO7A 4P0IA 1JVYA 2FA7A 4FEDA 4U4XA 3O6IA 5AA3A 3G3GA 1JW4A 3TDJA 4POXA 2Q88A 4TQUQ 3O28A 1GVCA 4F3SA 1PB9A 2DWHA 2DS9A 3M8UA 4O3AA 3EHTA 3RGYA 3E9XA 2RC9A 4NF4B 3V5AA 4GRKA 3VV5A 3IJXB 4NTLA 3LSLA 3USDA 4ELQA 3MZ1A 1P1NA 2X7PA 1B7ZA 3KBRA 1AL3A 1M5FA 2UVGA 3PGFA 3QUJA 1A8FA 3DELB 5DTBA 2ZMBA 3CI8A 1A99A 5AA1A 3LSFB 2GHAA 4FORA 3SDFA 3LC8A 1H76A 2I6EA 5TP9B 1VSOA 5I58B 5TPAB 2XXHA 1A54A 3C9HA 3SKPA 4QFOA 3TQLA 2F78A 4P11A 1SQYA 1LSTA 3K01A 1PC3A 1JVXA 3JZJA 3LR1A 3PPPA 2OLBA 4NWDA 1DOTA 1Y3QA 3A3UA 2QMXA 4GQOA 4ZEKA 5CC2A 3FV1A 2H9BA 2LAOA 2RF1A 3QSLA 4OWDA 5DVFA 5JEIA 1AIVA 1A40A 2V3QA 3PU5A 2D5WA 4QHQA 4RNSA 3RT8A 2AYSA 2OK2A 1O7TA 3FUZA 5A5XA 3PMVA 2F97A 1LCFA 1IUDA 4UACA 3Q25A 1OVTA 1LLSA 2ALUA 4R72A 4ZE8A 1FTLA 3O66A 1Y3PA 3CSGA 2V3TA 1MPBA 3H03A 2Z8EA 2ZNTA 3RN8A 1P1WA 2XX7A 4JWYA 4G8HA 3H6UA 2Q9TA 3KFMA 3G3JA 3H06B 1P1OA 1UIVA 4KYSA 4R9GA 5BUUA 3V83A 3MVZA 3FASA 4DZ1A 2F6PA 2HZLA 2O51A 3CFXA 3T9XB 1FQFA 3QAXA 2XXWA 3T9VA 4ZZAA 3FXRA 1LGBC 1VE4A 1MS7A 1QW0A 3CSBA 3EHUA 3KSXA 3QK6A 3QXMA 2H99A 4M4GA 4ND9A 4OHNA 3M3FA 3T9HB 4LZ8A 2REJA 3S9MC 2XD2A 1P1UA 3IL1B 1QKBA 4PQJA 1MPCA 4TLMB 5DEXB 3RNNA 5I59B 1R6ZA 3CFZA 1M5DA 3E4RA 4GOTA 3ZS6A 4POWA 4IGRA 1QVSA 3MZBA 4H5GA 4EF2A 3TCGA 4P0GA 1B9JA 1MQGA 2UVHA 3F11A 4E0WA 4OFLA 4N07A 3K2DA 3K1NA 3IK6B 4YKIA 4QF9A 2PYYA 4OQOA 3WAEA 2GRVA 2PMSA 4LQ2A 4ZZEA 2H25A 3QUFA 4ELPA 5I56A 2QS4A 1B7UA 3TYHA 2I48A 4NF8B 4PFTA 4WEDA 1DTGA 3IOTA 1JEUA 3N5LA 3VFJA 1IEJA 1S9TA 3HHFA 1VFDA 4MLVA 1MG1A 2P2AA 3ECRA 3B6QA 3UIFA 3MVXA 4QSEA 4HCWA 3KEIA 2XXQA 1YCJA 4GFRA 4DE8A 3TEPA 3SEYA 4ESWA 3SEWA 4GL0A 1IZ1A 5H8FA 4OENA 3U92A 2F6GA 5I2NA 1QUIA 4DCXA 3EPEA 3MP1A 1LAFE 1MY1A 4NF5B 4BDOA 1MXUA 2RCAA 5L8DA 1Y3NA 1T0KA 2FYIA 1MXZA 3KG2A 4KQPA 1XVXA 2HEUA 1AMFA 4F18A 2P1SA 3BKIB 2QPQA 4OEUA 3TFLA 5FHOA 4YKJA 1JW1A 3O6GA 1CB6A 3FGSA 3E13X 1PDAA 4G8NA 4KHZE 2F35A 3CIJA 4X48A 3VXCA 4F31B 2O69A 2RINA 5B7DA 1B51A 1BLFA 5EHSA 3MWBA 1LFIA 1IXIA 2I3WA 5F7VA 3K6VA 3C34A 3FXQA 3DLNA 1B2HA 4OESA 3MPKA 3VVFA 3E3KA 3SETA 1S50A 1YTVA 1OLCA 5K2XA 4EQ7A 1JEVA 1IXCA 3VLWA 3IR1A 3EF7A 4RYAA 4GF8A 1PBQA 5CBSA 4WEPA 1AOVA 4F39A 5ISUA 2Y7WA 4IO6A 3HCQA 2XXIA 4KI0E 4U2RA 3IOWA 1F9BA 1DTZA 2GFEA 1MH4A 3R7XA 3N6UA 4HTGA 2VP1A 3TAJA 3VDFA 3CG3A 4I62A 4JWXA 4NF5A 1B3LA 4ZEFA 1WDNA 2A5TB 4N13A 4YB5A 2DP8A 3OO9A 1LAGE 1NNKA 4X1BA 5F1QA 4GLIA 4IB2A 3S4UA 1MDP1 3M3LA 4NWCA 5DVJA 1I6AA 4KD5A 1LFGA 3FVKA 2A5TA 3DP6A 4LZ5A 4NE4A 4R74A 1IIWA 5TP9A 1DPPA 5I59A 1H45A 3RY3A 1O64A 2E1SA 4HW8A 4K3FA 1BP5A 3OXNA 1BIYA 4BLAA 1MQIA 2RC7A 4G68A 3B6TA 4H8JA 4PP0A 5ITPA 3FVNA 1B46A 4RY1A 2V25A 1LB9A 1B3HA 3H7MA 2ONSA 4YB6A 4YU0A 1GR2A 5EHMA 3TCFA 5L9OA 1MXXA 2X26A 1D4NA 4F3GA 1JQFA 4G68B 4HS7A 5J1DA 1LAXA 2IA4A 3ODBA 2OWTA 2Z23A 3TTNA 3H6VA 1D9YA 2DOJA 4F2OA 3FATA 4THIA 1B5JA 3O97A 5I84A 3PPNA 3CVGA 1B05A 3IB1A 2RCBA 1B5IA 2HAUA 1FTJA 3JYRA 4H65A 2XXRA 3ONMA 3RPWA 2XX9A 3TQWA 2KLFA 3S9LC 3PV0E 1XS5A 2DXYA 1MH3A 1SVXB 1ZMGA 3FJ7A 4ZEIA 5M2VA 1FQBA 3K6XA 3RLFE 1MY4A 3UGWA 5AA4A 3SESA 5KDTA 1Y4TA 2VGQA 4ZS9A 4IO3A 3QYTA 1URSA 2QL3A 3CRBA 4JXIA 4AQ4A 4EXKA 1OLAA 1DMBA 2Q89A 4Q5TA 1FW0A 1FQCA 2PVUA 2ZYNA 3CG1A 5H8QA 3K6WA 4OERA 1B3FA 3TTKA 1VR5A 2DVCA 2GH9A 1B5HA 3GLBA 1Y1MA 2QS1A 3OSRA 5JK4A 5CM6A 1PEBA 4XKPA 1LCTA 1N3WA 2HFBA 3MJNA 4MLQA 5KCJB 2PBWA 2FNCA 3S2VA 2F8DA 4AB6A 1S7YA 2R9JA 4C1TA 1B4HA 4PFUA 5I57A 3IJOB 4NF8A 1POTA 4H5FA 1N76A 3MP8A 1B6HA 4ZDMA 2HCAA 2IEEA 3HHGA 4JWOA 5AE4A 2Z8FA 4R6KA 4ELRA 1VFEA 3KGCA 1FCKA 3IX1A 3KJTA 3KN8A 4EF1A 5KZTA 3K6UA 1HSJA 3IORA 3K1MA 3MQ9A 4GD5A 4L17A 4QRZA 4XTCQ 3RT6B 4F3BA 4PE5B 1B40A 1BTJA 2O84X 4R6YA 2ZYKA 3SEUA 3S9EA 3BBRA 4FAJA 4H8IA 2D3IA 1SBPA
chains in the Genus database with same CATH superfamily
1B52A 1LBCA 2G93A 3PPRA 5ICTA 3B6WA 2HXWA 3UP9A 5I58A 3BFTA 2AL4A 1IMAA 5HPQA 4YB7A 1NMUA 1ZU0A 3FVGA 3TTMA 2Y5LA 1H44A 2R6GE 2ZZVA 1UIUA 2B3FA 5I56B 2NXOA 4BDQA 1Y20A 5CMBA 2XXUA 2RC8A 5AA2B 1Y1ZA 2QVUA 3BFUA 4EQ9A 3OEKA 4ECFA 4XIGQ 4PETA 4GWOA 5I2NB 2OWZA 2DWIA 3FVOA 1XHYA 4RPNA 5ICQA 4PFYA 2O7UA 4PGNA 2I58A 2THIA 4I1DA 1TFAA 3OMBA 1B3EA 4X9TA 1YPNA 3N94A 4IGTA 4XKQA 3VVDA 2B65A 5KDTB 3O29A 4MNPA 4XXUA 1MXVA 2DSFA 3PD9A 1B1XA 4QXDA 4R2FA 2DQVA 5H8FB 4IY6A 5TPAA 1XI6A 1SW5A 1G0HA 1US4A 3V89B 4JDFA 4LATA 3EKIA 2AL5A 3C36A 3W9WA 1Y4CA 4DDDA 3HN0A 4F19A 1NUYA 5EQ7A 1MRPA 3TTRA 3Q26A 1DSNA 3LUZA 4OXVA 1UTHA 3B7DA 1B58A 4YICA 3PTYA 4N6KA 4FEBA 1B1HA 3G3KA 1JETA 3ZKLA 4LONB 5B70A 2DE4A 4C1UA 2F34A 1NH8A 4NEDA 2I0CA 4LUBA 1QUKA 1EYIA 1EZOA 3LBSA 3VLVA 4Q8RA 1SI0A 2YJPA 4IO4A 3RUMA 4RPOA 2QJEA 2FVZA 3SZPA 4ONYA 3IAZA 4JB7A 4MX6A 1A8EA 4MIJA 4F22A 2Q2CA 4DCYA 2O68A 4G77A 3G7WA 4G4PA 5A5LA 1GV8A 4GVOA 3FZVA 2OCUA 4YAHX 2F7AA 3KC1A 1EU8A 3HV1A 5JTYB 3QIMA 2O7IA 4NAPA 3MZ9A 1OMPA 3PPOA 1EZPA 2DDKA 4QSCA 1BK4A 1URGA 1I6QA 3I5OA 3OO7A 4TOZA 4X8RA 4DXUA 1ZIUA 4BDRA 1MQHA 3RTFB 3JV9A 2ESNA 5DW8A 3UK4A 4U22A 1XT8A 4P9KA 4KPTA 1RKMA 3H4ZA 1HSEA 4U4SA 5I2KA 4O94A 2FBPA 4N4UA 4RA1A 4AB5A 1WVJA 4Z7EA 1KA0A 3CHGA 4MH5A 1FQAA 4NMYA 3O9PA 3MSTA 1IQ7A 2YPNA 3H6WA 1ZJLA 4O3CA 2VT5A 4U1OA 4NF4A 5ESYA 1TXFA 5BWJA 2Y7IA 3VE1B 3O2AA 4E0XA 1NKXA 5H8HB 5IZ1A 3U93A 2F7CA 2DVZA 3HFUA 3OENA 1P99A 4Q0CA 2HPGA 1I69A 4KCDA 1L5TA 2F7BA 1JVYA 4U4XA 4FEDA 5AA3A 1GVCA 3M8UA 2XA5A 2RC9A 4NF4B 1FBGA 3VV5A 3LSLA 1B7ZA 1A99A 3LSFB 2GHAA 1G0IA 1SQYA 1FPGA 3K01A 3LR1A 1JVXA 3PPPA 4NWDA 1DOTA 1Y3QA 2CEXA 4OWDA 2LAOA 3QSLA 1A40A 2XWKA 2OK2A 3RYDA 5A5XA 3PMVA 2F97A 1LLSA 4P1EA 1FTLA 3CSGA 3H03A 3RN8A 1P1WA 4JWYA 3G3JA 4R9GA 3IFAA 1FBHA 4I40A 2HZLA 3QAXA 2PFZA 1LGBC 1QW0A 4PDDA 4M4GA 3M3FA 4LZ8A 3IFCA 3IL1B 4PQJA 5I59B 4POWA 4QBAA 4HE2A 4H5GA 4EF2A 1B9JA 2UVHA 2BJIA 4E0WA 4PBQA 2GRVA 4ZZEA 5I56A 2QS4A 4WEDA 3N5LA 3HHFA 2P2AA 3B6QA 3UIFA 3MVXA 4DE8A 2XXQA 3SEYA 3U92A 5I2NA 3EPEA 3MP1A 4OVQA 5L8DA 2FYIA 4KQPA 2P1SA 3BKIB 2QPQA 4OEUA 4OVRA 3FGSA 4KHZE 3VXCA 1BLFA 5I5PA 3MWBA 1IXIA 2I3WA 3K6VA 4GWXA 3E3KA 1IXCA 3IR1A 3EF7A 1PBQA 5CBSA 4WEPA 4F39A 5ISUA 1K9ZA 4IO6A 1FPJA 3IOWA 1DTZA 3R7XA 2XWIA 3N6UA 4PCDA 3CG3A 1B3LA 4YB5A 3OO9A 4IB2A 2WYPA 4LZ5A 3FVKA 2A5TA 1H45A 5IZ3B 3OXNA 4G68A 3FVNA 3TCFA 4YU0A 1GR2A 5L9OA 5J1DA 2Z23A 2RCBA 1FTJA 3RPWA 4PE3A 3TQWA 1XS5A 4PDHA 3FJ7A 3RLFE 3K6XA 2VGQA 2QL3A 3CRBA 4JXIA 1OLAA 2Q89A 4O7IA 3CG1A 3OSRA 2HFBA 3MJNA 4MLQA 4C1TA 5I57A 4PFUA 1N76A 3MP8A 4ZDMA 4ELRA 1FCKA 3KN8A 4PC9A 3K1MA 4XTCQ 4GD5A 4I3EA 1BTJA 4R6YA 3S9EA 1DK4A 4QFNA 2XXYA 2NVUB 4YMAA 1SD3A 5DEXA 4QFPA 3WAFA 4GL8A 1RYXA 3IO6A 1NNTA 2G29A 1M5BA 1MM6A 3EHSA 4MNIA 1FBFA 3EN3A 4NN3A 5IKBA 4DXBA 1SW1A 5TU0A 1NUZA 4RK9A 1AH5A 4NHBA 2Z8DA 4FE8A 2XXPA 3MAMA 1M5EA 4NF6A 4RK2A 4R2BA 4WXJA 5HBCA 3MYUA 1SW4A 2WBBA 1NV7A 5J16A 3KN7A 1SYHA 3SERA 1FPEA 1FRPA 1SDXA 3PMXA 1MY3A 2ZNSA 1MM7A 4F1YA 3LSWA 4R73A 1N04A 4KYDA 3K02A 2R71A 4MBPA 4N6PA 4ZEDA 2ZXTA 1QJMA 1Z7ME 2WKYA 5H8HA 2PT1A 4HXVA 3T93B 1NUWA 3UORA 1R9QA 4FATA 2FIEA 3U65A 3U94A 2DWJA 1EYJA 2ANJA 3G3FA 3U8QA 3TPAA 2DE2A 2VD3A 1Q1KA 2P3VA 2WX9A 2XD3A 2D21A 5DYHA 4RJZA 3KJ7A 5CMKA 3OO8A 2ONRA 5CRYA 2I0BA 4OVSA 4QFKA 2UVJA 2MKZA 3C31A 5EYGA 1FTKA 2E0SA 2DE3A 1NUXA 2WBDA 1A7LA 2O6AA 4XKRA 4U21A 5DT6A 1FTOA 3T9UA 2L5VA 2QS2A 1IXHA 1UTBA 1DPEA 4KYEA 2VD2A 4MNCA 1AWBA 3KOTA 2B4LA 2Y7RA 1SYIA 1MQJA 3ILUB 3PUWE 1N0TA 3HSTA 5L9SA 4ZECA 3KN3A 1XVYA 4OEVA 3FJGA 3UN6A 2NUVA 3C4MA 3I6VA 2ZNUA 2HHMA 4IY5A 1LBVA 2XWOA 5L9MA 2QS3A 4BDLA 3MW0A 3PUZE 5JTYA 2PT2A 1MXYA 1A55A 3FIRA 1UQWA 3B50A 1DCUA 4MF3A 3TTLA 1TWYA 1N7XA 2M8CA 2UVIA 4X04A 2H4IA 4JVCA 1N3XA 4M1VA 3ISPA 1ANFA 5DVIA 4C0RA 4O7MA 1M5CA 2Q8JA 5I2KB 1MQDA 1LBWA 5H8QB 5A5XB 3PPQA 3EQ1A 2R8TA 3MC2A 2F5XA 3LUYA 4GWYA 2Y84A 1GGGA 4O3BA 2XHDA 1QKAA 3OSQA 1FPKA 3L6GA 4YKKA 3GXAA 1FQDA 3K00A 4H67A 2DXRA 5ITOA 1O63A 2QFLA 4ESXA 5H8NA 4O8MA 4EXLA 3O6HA 3T22A 3W9VA 1FJ6A 3M3KA 4GX3A 2UYFA 2VHAA 4G8MA 2I49A 4P0IA 2FA7A 3O6IA 1YZ0A 2Q88A 1FSAA 4F3SA 3USDA 4ELQA 1AL3A 2UVGA 3SDFA 3LC8A 4MAGA 5TP9B 5I58B 2XXHA 3C9HA 4QFOA 2F78A 2ZZXA 1LSTA 1PC3A 2OLBA 5IZZA 3FV1A 5DVFA 3PU5A 2B4MA 3Q25A 4R72A 4ZE8A 3O66A 2ZNTA 2QVVA 3H06B 5BUUA 3MVZA 1FQFA 3RPLB 3FXRA 3KSXA 3QK6A 3QXMA 4ND9A 1CNQA 5DEXB 4XEQA 2VPOA 1R6ZA 3E4RA 1M5DA 3ZS6A 1VDWA 4P1LA 4N07A 2PYYA 3WAEA 2PMSA 4ELPA 2H25A 3QUFA 5LTCA 1B7UA 2I48A 1JEUA 5F24A 4N81A 1YCJA 4GFRA 4ESWA 5H8FA 4OENA 1QUIA 2HXRA 1MY1A 4BDOA 5FBPA 4GBWA 2VPNA 4YKJA 3O6GA 4G8NA 2F35A 2O69A 1LFIA 5F7VA 3FXQA 3DLNA 2FIXA 3MPKA 4PFRA 1S50A 5K2XA 4U2RA 1F9BA 1FPBA 3TAJA 4ZEFA 3E79A 4GX6A 1WDNA 2A5TB 1NNKA 4X1BA 1MDP1 5ET8A 3DP6A 1IIWA 1DPPA 3RY3A 2E1SA 4HW8A 1BIYA 1NV0A 4BLAA 5EYHA 4PP0A 1B46A 1LB9A 1B3HA 5EHMA 1MXXA 1D4NA 4F3GA 1JQFA 1NV1A 2OWTA 4PAIA 1FPLA 4F2OA 4THIA 3B8BA 3PPNA 4QSDA 3CVGA 1B05A 2XXRA 5M2VA 2DXYA 1MH3A 1ZMGA 4ZEIA 1FQBA 3QYTA 4PAKA 1URSA 4AQ4A 1DMBA 4Q5TA 1FQCA 2ZYNA 1VR5A 1B5HA 5JK4A 1Q9DA 1PEBA 1LCTA 2PBWA 4AB6A 1B4HA 2HCAA 5AE4A 5KCJA 2Z8FA 1VFEA 4F3BA 4QRZA 3RT6B 1B40A 2D3IA 4R6HA 3SEXA 4GXSB 1NH7A 5FTHA 4R9FA 4OTEA 4LZ7A 1LBXA 1GTKA 4FJPA 4GXAA 2I4BA 3MPLA 2CEYA 2DWAA 3RTWB 1HSLA 3N6TA 4DLDA 4NF6B 3CR9A 4JVIA 1B3GA 1YYZA 2V93A 3C33A 5K2YA 2ZYMA 2V3UA 5CMCA 1XC1A 3THIA 1USYH 4GWUA 1OVBA 1B7HA 3FJMA 1UTBB 3D4GA 4GBVA 4IR8A 2QVRA 2BJJX 4MEVA 2Y7PA 3Q27A 4PF6A 3C32A 3K4UA 4XF5A 4I8CA 4DXCA 1PB8A 5AA2D 1FBEA 3OELA 4F2QA 1FBDA 1P1QA 4RXLA 3VVEA 3A09A 2I4CA 5I3SA 1IMFA 3TELA 5FTIA 1NFTA 2Q8MA 3TMGA 3MUQA 5CBRA 1FPIA 1MY2A 4OYVA 3MBPA 2QMWA 4F3PA 2F3BA 3KBZA 4Q30B 2I3VA 1FTMA 4OFJA 1LBZA 3D4CA 2XXVA 3NOHA 2ONKE 4FIMA 2XX8A 4IO2A 2GHBA 1JNFA 3E78A 1LAHE 2H5YA 4QFLA 1USYE 1BKAA 1JW5A 4NGUA 3MP6A 3A3CA 3LSXA 3DP8A 3MVYA 1OQGA 3DP4A 3OO6A 4GWZA 3IB2A 3FV2A 1IITA 4BDNA 1I6BA 2O1MA 1LFHA 4H1XA 5I7IA 2V4CA 5IM2A 5ELVA 1MDQA 1INPA 2OJTA 2QRYA 3BIHA 5AA4B 1B0HA 4DIGA 4EDPA 3C35A 1WODA 3IOVA 4OVJA 1SI1A 4XKNA 3Q29A 4H45A 3VLUA 4OVPA 2RKMA 1MY0A 4OETA 3TODA 2UYEA 3IB0A 2HQ0A 3TKDA 1Q35A 1RDZA 4PTKA 3K1PA 3N26A 4F1VA 1NNFA 1R1NA 3R26A 1B4ZA 1US5A 3G3IA 1YXIA 2HZKA 4I3YA 2HAVA 3SEVA 1LEVA 4PGPA 1POY1 5CI5A 3Q28A 1EZ9A 3U72A 2P3NA 1H43A 1ZBMA 1UTHB 4P56A 1MPDA 2W7YA 4MFIA 5ET7A 4MHFA 4LQ5A 5AA2A 3G3GA 3TDJA 4POXA 4TQUQ 3O28A 1PB9A 2DWHA 4O3AA 3T1BA 3EHTA 3E9XA 4GRKA 3IJXB 2X7PA 3QUJA 1A8FA 3DELB 5AA1A 3CI8A 1H76A 2I6EA 1VSOA 5TPAB 3SKPA 2QMXA 4GQOA 1QGXA 3RT8A 1O7TA 3FUZA 1LCFA 4UACA 3A29A 2V3TA 4KYSA 1P1OA 1UIVA 1NV6A 3FASA 4N8GA 2F6PA 4GWSA 3CFXA 1MS7A 5CMMA 4FAJA 3EHUA 3TEPA 1LBYA 3T9HB 3S9MC 4TLMB 4GOTA 4IGRA 1QVSA 3MZBA 5EQ9A 3TCGA 1MQGA 3F11A 3K1NA 4YKIA 4QF9A 4PFTA 1DTGA 3VFJA 1VFDA 4MLVA 1NV5A 1MG1A 3ECRA 4QSEA 4HCWA 3KEIA 2PCRA 4GL0A 1IZ1A 4NF5B 1MXUA 2RCAA 1NV4A 1T0KA 3KG2A 2CZKA 1JW1A 3CIJA 4X48A 2RINA 1B51A 1FTAA 3ROJA 3C34A 4AS4A 1B2HA 2ZZWA 3SETA 4P47A 5ET6A 1JEVA 4EQ7A 4GX4A 2Y5KA 4RYAA 4GF8A 4KI0E 2GFEA 1MH4A 4HTGA 2VP1A 4NG7A 4NF5A 4I62A 2XWVA 1LAGE 3M3LA 4KD5A 4NE4A 1O64A 1BP5A 2KR0A 3LV0A 2RC7A 5ITPA 4RY1A 2V25A 2ONSA 2X26A 4LN5A 2CZIA 1LAXA 3H6VA 1D9YA 1B5JA 3IB1A 1B5IA 2HAUA 3ONMA 3S9LC 2XX9A 2KLFA 3PV0E 1SVXB 1Y4TA 4IO3A 4EXKA 1B3FA 3QMFA 1IMBA 4XKPA 1N3WA 5KCJB 2FNCA 1JP4A 2CZHA 3IJOB 4H5FA 1B6HA 2IEEA 4JWOA 4R6KA 3KGCA 3IX1A 3KJTA 4EF1A 5KZTA 3K6UA 1SPIA 4AS5A 2ZYKA 2PFYA 3BBRA 5CM6A 4H8IA 1SBPA 1D9VA 2F36A 4U1ZA 2OWSA 2Y7KA 3AXFA 2QSXA 1FBPA 3GBAA 3IOUA 3HPIA 5H8SA 3VXBA 5EQAA 3PUXE 4BDMA 3H6TA 1ZTYA 4R75A 4LVQA 5T3JA 4U23A 4TLLB 3HO7A 3TCHA 5IGAA 5H8NB 4KR5A 2F3DA 1K9YA 2ABHA 1Z7NE 4H0WA 4F1UA 2DYXA 3ZKKA 3PMWA 2JJKA 4GWWA 1XOCA 1B32A 3T0JA 3OOAA 4G2ZA 3K0VA 1QUJA 3TZAA 4DI3D 2X7QA 1SW2A 4KXPA 4H6DA 4G68C 1LBBA 2XXXA 4ZEBA 1FBCA 2A5SA 2AIXA 4XFEA 3OD7A 4UABA 1EH3A 4PFBA 1NL5A 4I9DA 2YLNA 2O1LA 4GIZA 4EUOA 1NI9A 1PBPA 3RPLA 3T66A 4JSDA 4LP2B 4UA8A 2PX1A 2WEFA 1FQEA 1OIBA 1R9LA 5IAIA 4ISUA 2B3BA 1LB8A 3GYYA 4IO5A 2Q74A 4WKMA 4KCCA 3KSJA 4YKPA 4PBHA 4YMBA 3W15C 3ILTB 3U1OA 3FXUA 1II5A 3GBBA 5EYFA 3L6HA 2Q2AA 1RYOA 2H98A 1N84A 2VOZA 3ZSFA 4OA4A 1ELJA 3KZGA 2UXAA 4JBZA 4N91A 1ZKBA 4OFOA 3H3GA 2XXKA 3I3VA 5LOMA 3T96B 1CE2A 2V84A 2OZZA 1TFDA 1YAEA 1QULA 4YZZA 1ATGA 3MVWA 5IZ3A 5HM4B 2OBGA 4F29A 4FECA 4N17A 1ZLQA 3S9NC 1MXWA 4PFWA 3V8XB 5LDZA 4JSOA 4P3LA 2XXTA 1IMCA 2CZLA 4PF8A 3P7IA 3R6UA 2ZYOA 1FPFA 3FD3A 4DI4B 4OZ9A 1KWHA 3UA8A 3RQTA 3GZGA 4Z0IA 3PUVE 3D1RA 3PUYE 4PAFA 3IO4A 1N7WA 1PB7A 2CMOA 4PFIA 1J1NA 4ZE9A 1URDA 1Y9UA 4EQBA 2Z22A 1D3KA 4LA9A 5I57B 4HCYA 1TT1A 1B0LA 3DM0A 4KFQA 1OQHA 4NQ8A 4ELOA 3FXBA 5EQ8A 1FPDA 4FBPA 1EYKA 5FHMA 3G3HA 3KOSA 5FHNA 1IXGA 2REGA 2NOOA 3PD8A 1H3DA 1NNPA 2P0SA 4P8BA 4NX1A 4OMBA 3CFLA 1D9QA 3OEMA 2NWJA 4JVDA 4N6DA 4X1DA 4IO7A 1JW4A 3KC0A 2DS9A 3RGYA 3V5AA 4NTLA 3MZ1A 1P1NA 3KBRA 1M5FA 3PGFA 1IMEA 5DTBA 2ZMBA 4FORA 1A54A 3TQLA 4P11A 3JZJA 5CC2A 3A3UA 4ZEKA 4N8YA 2H9BA 2RF1A 3BIGA 5JEIA 1AIVA 4RNSA 2V3QA 2D5WA 4QHQA 2AYSA 1IUDA 1OVTA 2ALUA 1Y3PA 4N15A 1MPBA 2Z8EA 2XX7A 4G8HA 3H6UA 2Q9TA 3KFMA 3V83A 1KZ8A 4MJOA 4DZ1A 2O51A 3T9XB 1RDXA 2XXWA 4ZZAA 3T9VA 1VE4A 3CSBA 4OHNA 1NV2A 2H99A 2REJA 2XD2A 3RNNA 1P1UA 1QKBA 1MPCA 4OVTA 3CFZA 4P0GA 4OFLA 3K2DA 3IK6B 4OQOA 4LQ2A 3TYHA 4NF8B 2FHYA 3IOTA 1IEJA 1S9TA 3SEWA 4OANA 4HE1A 2F6GA 4DCXA 1LAFE 1KA1A 1Y3NA 4F18A 1MXZA 1XVXA 2HEUA 1AMFA 3TFLA 1FJ9A 5FHOA 4HE0A 1CB6A 3E13X 1PDAA 4F31B 5B7DA 5EHSA 4NF0A 4OESA 3VVFA 1YTVA 1OLCA 2WYKA 1RDYA 1AOVA 2Y7WA 3HCQA 2XXIA 3VDFA 1NV3A 4JWXA 3FBPA 4N13A 2DP8A 5F1QA 4GLIA 3S4UA 4NWCA 5DVJA 1I6AA 3VLWA 5TP9A 1LFGA 4R74A 5I59A 1IMDA 4K3FA 4H46A 2GQ1A 1MQIA 3B6TA 4H8JA 3H7MA 4YB6A 4G61A 4G68B 4HS7A 2IA4A 3ODBA 3TTNA 2DOJA 5I84A 3FATA 3O97A 4MMPA 3JYRA 4H65A 2OX3A 3UGWA 1MY4A 5AA4A 3SESA 5KDTA 4ZS9A 1FW0A 2PVUA 5H8QA 3K6WA 4OERA 3TTKA 2DVCA 2GH9A 3GLBA 1DBZA 1Y1MA 2QS1A 3S2VA 2F8DA 1S7YA 2R9JA 5ET5A 4MCOA 1POTA 4NF8A 3HHGA 1HSJA 3IORA 3MQ9A 4L17A 2KQZA 4PE5B 2O84X 3SEUA 3TUSA
chains in the Genus database with same CATH topology
1D9VA 1B52A 2F36A 4QFNA 1LBCA 2G93A 4U1ZA 2OWSA 3PPRA 4R6HA 4GXSB 3SEXA 5ICTA 1NH7A 2Y7KA 3AXFA 2XXYA 5FTHA 3B6WA 2HXWA 2QSXA 2NVUB 3GBAA 3UP9A 4YMAA 5I58A 1SD3A 3BFTA 3IOUA 2AL4A 5DEXA 3HPIA 5H8SA 4QFPA 5HPQA 4YB7A 4R9FA 4OTEA 4LZ7A 3WAFA 4GL8A 1NMUA 3VXBA 1ZU0A 3PUXE 4BDMA 3H6TA 1RYXA 3FVGA 1NNTA 1ZTYA 2G29A 1GTKA 1M5BA 1MM6A 3IO6A 3EHSA 4FJPA 4GXAA 3TTMA 2I4BA 1H44A 3MPLA 2DWAA 4R75A 3RTWB 1HSLA 2R6GE 3EN3A 1UIUA 4LVQA 2B3FA 5I56B 5IKBA 2NXOA 4DXBA 1SW1A 5TU0A 4BDQA 1Y20A 5CMBA 4U23A 2XXUA 3N6TA 2RC8A 4RK9A 5AA2B 1Y1ZA 4TLLB 4DLDA 4NF6B 3CR9A 3BFUA 4EQ9A 1AH5A 1B3GA 3C33A 2V93A 2Z8DA 3OEKA 3HO7A 4FE8A 4ECFA 2XXPA 5K2YA 3TUSA 3MAMA 1M5EA 2ZYMA 2V3UA 4NF6A 4PETA 1XC1A 4RK2A 4GWOA 4XIGQ 5CMCA 3TCHA 3THIA 4R2BA 5I2NB 1USYH 4WXJA 5HBCA 5H8NB 1SW4A 2DWIA 4KR5A 3FVOA 1XHYA 4RPNA 5ICQA 2ABHA 1OVBA 1Z7NE 4PFYA 2O7UA 4H0WA 4F1UA 3KN7A 1B7HA 2DYXA 1SYHA 3SERA 3PMWA 3ZKKA 3FJMA 1UTBB 2I58A 2THIA 1SDXA 4I1DA 1XOCA 3PMXA 1B32A 1TFAA 3D4GA 3OMBA 1B3EA 4X9TA 1MY3A 3OOAA 1YPNA 4G2ZA 3K0VA 1QUJA 2ZNSA 2BJJX 3N94A 1MM7A 4IGTA 2Y7PA 3Q27A 3TZAA 2X7QA 1SW2A 4XKQA 4F1YA 3LSWA 3C32A 4H6DA 4G68C 4R73A 3VVDA 1LBBA 2XXXA 4ZEBA 3K4UA 2B65A 5KDTB 3O29A 4XXUA 1MXVA 2A5SA 1N04A 4F1VA 2DSFA 2AIXA 3PD9A 4KYDA 5EYFA 3OD7A 3K02A 1B1XA 1EH3A 4I8CA 2R71A 1NL5A 4I9DA 4MBPA 4N6PA 4DXCA 2YLNA 4ZEDA 4R2FA 2ZXTA 2DQVA 1PB8A 5H8FB 1QJMA 4IY6A 2O1LA 5TPAA 5AA2D 1Z7ME 2WKYA 4GIZA 1SW5A 4EUOA 1US4A 1PBPA 3OELA 5H8HA 4F2QA 1P1QA 4RXLA 3T66A 2PT1A 3VVEA 3A09A 4JSDA 3V89B 4LP2B 4UA8A 4JDFA 2PX1A 1FQEA 2I4CA 3T93B 3UORA 3TELA 4LATA 1R9QA 1OIBA 5FTIA 4FATA 2AL5A 3C36A 1NFTA 3W9WA 1R9LA 5IAIA 4ISUA 2DWJA 3U94A 1Y4CA 4DDDA 2B3BA 3TMGA 2ANJA 3MUQA 3G3FA 3U8QA 3HN0A 5CBRA 3TPAA 2DE2A 1MY2A 4F19A 2VD3A 1LB8A 1Q1KA 4IO5A 2XD3A 5DYHA 2D21A 1MRPA 4RJZA 3KJ7A 4WKMA 4KCCA 4OYVA 5CMKA 3MBPA 2QMWA 3OO8A 3KSJA 4YKPA 2ONRA 5CRYA 2I0BA 3TTRA 4YMBA 4QFKA 3W15C 3ILTB 2UVJA 4F3PA 3Q26A 3U1OA 3C31A 1DSNA 1FTKA 2E0SA 4OXVA 3FXUA 2DE3A 1II5A 3GBBA 1UTHA 3B7DA 1B58A 3L6HA 1A7LA 2O6AA 4YICA 4FEBA 2Q2AA 1B1HA 2I3VA 1RYOA 3G3KA 1JETA 4Q30B 4XKRA 4U21A 3ZKLA 4ZE9A 1FTMA 4OFJA 2H98A 4LONB 5DT6A 1FTOA 3D4CA 5B70A 2DE4A 1N84A 2VOZA 2XXVA 3ZSFA 4C1UA 3T9UA 1ELJA 2F34A 1NH8A 2ONKE 2QS2A 4NEDA 1IXHA 1UTBA 4FIMA 2I0CA 4LUBA 2XX8A 3KZGA 2UXAA 2GHBA 4IO2A 4JBZA 1QUKA 1EZOA 1JNFA 3LBSA 1DPEA 4KYEA 1ZKBA 1LAHE 4OFOA 3VLVA 4Q8RA 5KCJA 1SI0A 2VD2A 2H5YA 2YJPA 4IO4A 3H3GA 3KOTA 4QFLA 2Y7RA 3RUMA 4RPOA 1USYE 1SYIA 1BKAA 1MQJA 2QJEA 3ILUB 3PUWE 1N0TA 1JW5A 3HSTA 4ONYA 3MP6A 3A3CA 3IAZA 4ZECA 4JB7A 5L9SA 3KN3A 3I3VA 1A8EA 1XVYA 3LSXA 3DP8A 4OEVA 5LOMA 3T96B 3FJGA 3MVYA 3UN6A 1CE2A 2V84A 1OQGA 2NUVA 2OZZA 3DP4A 4F22A 3OO6A 3IB2A 2Q2CA 3C4MA 3I6VA 4DCYA 2O68A 4G77A 3G7WA 4G4PA 1TFDA 1GV8A 1YAEA 2ZNUA 3FZVA 1QULA 4GVOA 4IY5A 4QSDA 1ATGA 3MVWA 3FV2A 4YZZA 5HM4B 1IITA 2OCUA 2OBGA 4F29A 4BDNA 5L9MA 4YAHX 2QS3A 5CMMA 4FECA 1I6BA 2F7AA 4BDLA 3MW0A 2O1MA 1LFHA 1ZLQA 3S9NC 3PUZE 4H1XA 1MXWA 4PFWA 3V8XB 5JTYA 2PT2A 1EU8A 1MXYA 2XXTA 4JSOA 1A55A 3FIRA 1UQWA 5ELVA 2CZLA 3HV1A 3P7IA 3R6UA 1MDQA 5JTYB 2ZYOA 3FD3A 3QIMA 2OJTA 4OZ9A 1KWHA 3UA8A 2QRYA 3RQTA 3GZGA 2O7IA 4Z0IA 5AA4B 3MZ9A 3PUVE 1B0HA 4MF3A 1OMPA 3PPOA 1EZPA 3TTLA 3PUYE 4DIGA 1TWYA 4QSCA 1N7XA 4EDPA 2M8CA 1URGA 3IO4A 1N7WA 2UVIA 3C35A 1PB7A 1WODA 2CMOA 2H4IA 1I6QA 3IOVA 1J1NA 3I5OA 4OVJA 1N3XA 1URDA 1Y9UA 1SI1A 4M1VA 3OO7A 4XKNA 4EQBA 1ANFA 2Z22A 3Q29A 4TOZA 1ZIUA 1D3KA 5DVIA 3VLUA 4DXUA 4LA9A 4BDRA 1MQHA 3RTFB 4C0RA 5I57B 3JV9A 2ESNA 4HCYA 2RKMA 1M5CA 1TT1A 1MY0A 2Q8JA 4OETA 3UK4A 5I2KB 1MQDA 2UYEA 1B0LA 3DM0A 3IB0A 2HQ0A 4KFQA 5H8QB 3TKDA 3TODA 4U22A 1XT8A 5A5XB 1OQHA 1Q35A 4KPTA 1RKMA 3K1PA 3H4ZA 3N26A 3PPQA 1HSEA 1NNFA 1R1NA 4U4SA 4ELOA 3EQ1A 3R26A 4RA1A 4AB5A 1B4ZA 4Z7EA 1WVJA 5I2KA 1US5A 3G3IA 3MC2A 4MH5A 1FQAA 4NMYA 5FHMA 2F5XA 3LUYA 3O9PA 3G3HA 3KOSA 1IQ7A 2HZKA 2YPNA 3H6WA 5FHNA 1ZJLA 2Y84A 1IXGA 1GGGA 2HAVA 2REGA 4O3CA 2NOOA 2XHDA 3PD8A 4O3BA 1QKAA 3OSQA 4NF4A 1H3DA 1NNPA 4U1OA 3SEVA 3L6GA 2P0SA 4YKKA 3GXAA 1FQDA 1TXFA 3K00A 5BWJA 2Y7IA 4H67A 2DXRA 3VE1B 3O2AA 4OMBA 5ITOA 1POY1 5CI5A 4E0XA 1NKXA 5H8HB 3CFLA 3Q28A 3U93A 1O63A 4ESXA 5H8NA 1EZ9A 2F7CA 4EXLA 3U72A 2DVZA 3OEMA 1P99A 3OENA 1H43A 1ZBMA 3O6HA 1UTHB 2NWJA 3T22A 3W9VA 4Q0CA 3M3KA 1MPDA 2W7YA 1I69A 4MFIA 2UYFA 4KCDA 2VHAA 4G8MA 4X1DA 2I49A 4LQ5A 1L5TA 5AA2A 2F7BA 4IO7A 4P0IA 1JVYA 2FA7A 4FEDA 4U4XA 3O6IA 5AA3A 3G3GA 1JW4A 3TDJA 4POXA 2Q88A 4TQUQ 3O28A 1GVCA 4F3SA 1PB9A 2DWHA 2DS9A 3M8UA 4O3AA 3EHTA 3RGYA 3E9XA 2RC9A 4NF4B 3V5AA 4GRKA 3VV5A 3IJXB 4NTLA 3LSLA 3USDA 4ELQA 3MZ1A 1P1NA 2X7PA 1B7ZA 3KBRA 1AL3A 1M5FA 2UVGA 3PGFA 3QUJA 1A8FA 3DELB 5DTBA 2ZMBA 3CI8A 1A99A 5AA1A 3LSFB 2GHAA 4FORA 3SDFA 3LC8A 1H76A 2I6EA 5TP9B 1VSOA 5I58B 5TPAB 2XXHA 1A54A 3C9HA 3SKPA 4QFOA 3TQLA 2F78A 4P11A 1SQYA 1LSTA 3K01A 1PC3A 1JVXA 3JZJA 3LR1A 3PPPA 2OLBA 4NWDA 1DOTA 1Y3QA 3A3UA 2QMXA 4GQOA 4ZEKA 5CC2A 3FV1A 2H9BA 2LAOA 2RF1A 3QSLA 4OWDA 5DVFA 5JEIA 1AIVA 1A40A 2V3QA 3PU5A 2D5WA 4QHQA 4RNSA 3RT8A 2AYSA 2OK2A 1O7TA 3FUZA 5A5XA 3PMVA 2F97A 1LCFA 1IUDA 4UACA 3Q25A 1OVTA 1LLSA 2ALUA 4R72A 4ZE8A 1FTLA 3O66A 1Y3PA 3CSGA 2V3TA 1MPBA 3H03A 2Z8EA 2ZNTA 3RN8A 1P1WA 2XX7A 4JWYA 4G8HA 3H6UA 2Q9TA 3KFMA 3G3JA 3H06B 1P1OA 1UIVA 4KYSA 4R9GA 5BUUA 3V83A 3MVZA 3FASA 4DZ1A 2F6PA 2HZLA 2O51A 3CFXA 3T9XB 1FQFA 3QAXA 2XXWA 3T9VA 4ZZAA 3FXRA 1LGBC 1VE4A 1MS7A 1QW0A 3CSBA 3EHUA 3KSXA 3QK6A 3QXMA 2H99A 4M4GA 4ND9A 4OHNA 3M3FA 3T9HB 4LZ8A 2REJA 3S9MC 2XD2A 1P1UA 3IL1B 1QKBA 4PQJA 1MPCA 4TLMB 5DEXB 3RNNA 5I59B 1R6ZA 3CFZA 1M5DA 3E4RA 4GOTA 3ZS6A 4POWA 4IGRA 1QVSA 3MZBA 4H5GA 4EF2A 3TCGA 4P0GA 1B9JA 1MQGA 2UVHA 3F11A 4E0WA 4OFLA 4N07A 3K2DA 3K1NA 3IK6B 4YKIA 4QF9A 2PYYA 4OQOA 3WAEA 2GRVA 2PMSA 4LQ2A 4ZZEA 2H25A 3QUFA 4ELPA 5I56A 2QS4A 1B7UA 3TYHA 2I48A 4NF8B 4PFTA 4WEDA 1DTGA 3IOTA 1JEUA 3N5LA 3VFJA 1IEJA 1S9TA 3HHFA 1VFDA 4MLVA 1MG1A 2P2AA 3ECRA 3B6QA 3UIFA 3MVXA 4QSEA 4HCWA 3KEIA 2XXQA 1YCJA 4GFRA 4DE8A 3TEPA 3SEYA 4ESWA 3SEWA 4GL0A 1IZ1A 5H8FA 4OENA 3U92A 2F6GA 5I2NA 1QUIA 4DCXA 3EPEA 3MP1A 1LAFE 1MY1A 4NF5B 4BDOA 1MXUA 2RCAA 5L8DA 1Y3NA 1T0KA 2FYIA 1MXZA 3KG2A 4KQPA 1XVXA 2HEUA 1AMFA 4F18A 2P1SA 3BKIB 2QPQA 4OEUA 3TFLA 5FHOA 4YKJA 1JW1A 3O6GA 1CB6A 3FGSA 3E13X 1PDAA 4G8NA 4KHZE 2F35A 3CIJA 4X48A 3VXCA 4F31B 2O69A 2RINA 5B7DA 1B51A 1BLFA 5EHSA 3MWBA 1LFIA 1IXIA 2I3WA 5F7VA 3K6VA 3C34A 3FXQA 3DLNA 1B2HA 4OESA 3MPKA 3VVFA 3E3KA 3SETA 1S50A 1YTVA 1OLCA 5K2XA 4EQ7A 1JEVA 1IXCA 3VLWA 3IR1A 3EF7A 4RYAA 4GF8A 1PBQA 5CBSA 4WEPA 1AOVA 4F39A 5ISUA 2Y7WA 4IO6A 3HCQA 2XXIA 4KI0E 4U2RA 3IOWA 1F9BA 1DTZA 2GFEA 1MH4A 3R7XA 3N6UA 4HTGA 2VP1A 3TAJA 3VDFA 3CG3A 4I62A 4JWXA 4NF5A 1B3LA 4ZEFA 1WDNA 2A5TB 4N13A 4YB5A 2DP8A 3OO9A 1LAGE 1NNKA 4X1BA 5F1QA 4GLIA 4IB2A 3S4UA 1MDP1 3M3LA 4NWCA 5DVJA 1I6AA 4KD5A 1LFGA 3FVKA 2A5TA 3DP6A 4LZ5A 4NE4A 4R74A 1IIWA 5TP9A 1DPPA 5I59A 1H45A 3RY3A 1O64A 2E1SA 4HW8A 4K3FA 1BP5A 3OXNA 1BIYA 4BLAA 1MQIA 2RC7A 4G68A 3B6TA 4H8JA 4PP0A 5ITPA 3FVNA 1B46A 4RY1A 2V25A 1LB9A 1B3HA 3H7MA 2ONSA 4YB6A 4YU0A 1GR2A 5EHMA 3TCFA 5L9OA 1MXXA 2X26A 1D4NA 4F3GA 1JQFA 4G68B 4HS7A 5J1DA 1LAXA 2IA4A 3ODBA 2OWTA 2Z23A 3TTNA 3H6VA 1D9YA 2DOJA 4F2OA 3FATA 4THIA 1B5JA 3O97A 5I84A 3PPNA 3CVGA 1B05A 3IB1A 2RCBA 1B5IA 2HAUA 1FTJA 3JYRA 4H65A 2XXRA 3ONMA 3RPWA 2XX9A 3TQWA 2KLFA 3S9LC 3PV0E 1XS5A 2DXYA 1MH3A 1SVXB 1ZMGA 3FJ7A 4ZEIA 5M2VA 1FQBA 3K6XA 3RLFE 1MY4A 3UGWA 5AA4A 3SESA 5KDTA 1Y4TA 2VGQA 4ZS9A 4IO3A 3QYTA 1URSA 2QL3A 3CRBA 4JXIA 4AQ4A 4EXKA 1OLAA 1DMBA 2Q89A 4Q5TA 1FW0A 1FQCA 2PVUA 2ZYNA 3CG1A 5H8QA 3K6WA 4OERA 1B3FA 3TTKA 1VR5A 2DVCA 2GH9A 1B5HA 3GLBA 1Y1MA 2QS1A 3OSRA 5JK4A 5CM6A 1PEBA 4XKPA 1LCTA 1N3WA 2HFBA 3MJNA 4MLQA 5KCJB 2PBWA 2FNCA 3S2VA 2F8DA 4AB6A 1S7YA 2R9JA 4C1TA 1B4HA 4PFUA 5I57A 3IJOB 4NF8A 1POTA 4H5FA 1N76A 3MP8A 1B6HA 4ZDMA 2HCAA 2IEEA 3HHGA 4JWOA 5AE4A 2Z8FA 4R6KA 4ELRA 1VFEA 3KGCA 1FCKA 3IX1A 3KJTA 3KN8A 4EF1A 5KZTA 3K6UA 1HSJA 3IORA 3K1MA 3MQ9A 4GD5A 4L17A 4QRZA 4XTCQ 3RT6B 4F3BA 4PE5B 1B40A 1BTJA 2O84X 4R6YA 2ZYKA 3SEUA 3S9EA 3BBRA 4FAJA 4H8IA 2D3IA 1SBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9V A;  1B52 A;  2F36 A;  4QFN A;  1LBC A;  2G93 A;  4U1Z A;  2OWS A;  3PPR A;  4R6H A;  4GXS B;  3SEX A;  5ICT A;  1NH7 A;  2Y7K A;  3AXF A;  2XXY A;  5FTH A;  3B6W A;  2HXW A;  2QSX A;  2NVU B;  3GBA A;  3UP9 A;  4YMA A;  5I58 A;  1SD3 A;  3BFT A;  3IOU A;  2AL4 A;  5DEX A;  3HPI A;  5H8S A;  4QFP A;  5HPQ A;  4YB7 A;  4R9F A;  4OTE A;  4LZ7 A;  3WAF A;  4GL8 A;  1NMU A;  3VXB A;  1ZU0 A;  3PUX E;  4BDM A;  3H6T A;  1RYX A;  3FVG A;  1NNT A;  1ZTY A;  2G29 A;  1GTK A;  1M5B A;  1MM6 A;  3IO6 A;  3EHS A;  4FJP A;  4GXA A;  3TTM A;  2I4B A;  1H44 A;  3MPL A;  2DWA A;  4R75 A;  3RTW B;  1HSL A;  2R6G E;  3EN3 A;  1UIU A;  4LVQ A;  2B3F A;  5I56 B;  5IKB A;  2NXO A;  4DXB A;  1SW1 A;  5TU0 A;  4BDQ A;  1Y20 A;  5CMB A;  4U23 A;  2XXU A;  3N6T A;  2RC8 A;  4RK9 A;  5AA2 B;  1Y1Z A;  4TLL B;  4DLD A;  4NF6 B;  3CR9 A;  3BFU A;  4EQ9 A;  1AH5 A;  1B3G A;  3C33 A;  2V93 A;  2Z8D A;  3OEK A;  3HO7 A;  4FE8 A;  4ECF A;  2XXP A;  5K2Y A;  3TUS A;  3MAM A;  1M5E A;  2ZYM A;  2V3U A;  4NF6 A;  4PET A;  1XC1 A;  4RK2 A;  4GWO A;  4XIG Q;  5CMC A;  3TCH A;  3THI A;  4R2B A;  5I2N B;  1USY H;  4WXJ A;  5HBC A;  5H8N B;  1SW4 A;  2DWI A;  4KR5 A;  3FVO A;  1XHY A;  4RPN A;  5ICQ A;  2ABH A;  1OVB A;  1Z7N E;  4PFY A;  2O7U A;  4H0W A;  4F1U A;  3KN7 A;  1B7H A;  2DYX A;  1SYH A;  3SER A;  3PMW A;  3ZKK A;  3FJM A;  1UTB B;  2I58 A;  2THI A;  1SDX A;  4I1D A;  1XOC A;  3PMX A;  1B32 A;  1TFA A;  3D4G A;  3OMB A;  1B3E A;  4X9T A;  1MY3 A;  3OOA A;  1YPN A;  4G2Z A;  3K0V A;  1QUJ A;  2ZNS A;  2BJJ X;  3N94 A;  1MM7 A;  4IGT A;  2Y7P A;  3Q27 A;  3TZA A;  2X7Q A;  1SW2 A;  4XKQ A;  4F1Y A;  3LSW A;  3C32 A;  4H6D A;  4G68 C;  4R73 A;  3VVD A;  1LBB A;  2XXX A;  4ZEB A;  3K4U A;  2B65 A;  5KDT B;  3O29 A;  4XXU A;  1MXV A;  2A5S A;  1N04 A;  4F1V A;  2DSF A;  2AIX A;  3PD9 A;  4KYD A;  5EYF A;  3OD7 A;  3K02 A;  1B1X A;  1EH3 A;  4I8C A;  2R71 A;  1NL5 A;  4I9D A;  4MBP A;  4N6P A;  4DXC A;  2YLN A;  4ZED A;  4R2F A;  2ZXT A;  2DQV A;  1PB8 A;  5H8F B;  1QJM A;  4IY6 A;  2O1L A;  5TPA A;  5AA2 D;  1Z7M E;  2WKY A;  4GIZ A;  1SW5 A;  4EUO A;  1US4 A;  1PBP A;  3OEL A;  5H8H A;  4F2Q A;  1P1Q A;  4RXL A;  3T66 A;  2PT1 A;  3VVE A;  3A09 A;  4JSD A;  3V89 B;  4LP2 B;  4UA8 A;  4JDF A;  2PX1 A;  1FQE A;  2I4C A;  3T93 B;  3UOR A;  3TEL A;  4LAT A;  1R9Q A;  1OIB A;  5FTI A;  4FAT A;  2AL5 A;  3C36 A;  1NFT A;  3W9W A;  1R9L A;  5IAI A;  4ISU A;  2DWJ A;  3U94 A;  1Y4C A;  4DDD A;  2B3B A;  3TMG A;  2ANJ A;  3MUQ A;  3G3F A;  3U8Q A;  3HN0 A;  5CBR A;  3TPA A;  2DE2 A;  1MY2 A;  4F19 A;  2VD3 A;  1LB8 A;  1Q1K A;  4IO5 A;  2XD3 A;  5DYH A;  2D21 A;  1MRP A;  4RJZ A;  3KJ7 A;  4WKM A;  4KCC A;  4OYV A;  5CMK A;  3MBP A;  2QMW A;  3OO8 A;  3KSJ A;  4YKP A;  2ONR A;  5CRY A;  2I0B A;  3TTR A;  4YMB A;  4QFK A;  3W15 C;  3ILT B;  2UVJ A;  4F3P A;  3Q26 A;  3U1O A;  3C31 A;  1DSN A;  1FTK A;  2E0S A;  4OXV A;  3FXU A;  2DE3 A;  1II5 A;  3GBB A;  1UTH A;  3B7D A;  1B58 A;  3L6H A;  1A7L A;  2O6A A;  4YIC A;  4FEB A;  2Q2A A;  1B1H A;  2I3V A;  1RYO A;  3G3K A;  1JET A;  4Q30 B;  4XKR A;  4U21 A;  3ZKL A;  4ZE9 A;  1FTM A;  4OFJ A;  2H98 A;  4LON B;  5DT6 A;  1FTO A;  3D4C A;  5B70 A;  2DE4 A;  1N84 A;  2VOZ A;  2XXV A;  3ZSF A;  4C1U A;  3T9U A;  1ELJ A;  2F34 A;  1NH8 A;  2ONK E;  2QS2 A;  4NED A;  1IXH A;  1UTB A;  4FIM A;  2I0C A;  4LUB A;  2XX8 A;  3KZG A;  2UXA A;  2GHB A;  4IO2 A;  4JBZ A;  1QUK A;  1EZO A;  1JNF A;  3LBS A;  1DPE A;  4KYE A;  1ZKB A;  1LAH E;  4OFO A;  3VLV A;  4Q8R A;  5KCJ A;  1SI0 A;  2VD2 A;  2H5Y A;  2YJP A;  4IO4 A;  3H3G A;  3KOT A;  4QFL A;  2Y7R A;  3RUM A;  4RPO A;  1USY E;  1SYI A;  1BKA A;  1MQJ A;  2QJE A;  3ILU B;  3PUW E;  1N0T A;  1JW5 A;  3HST A;  4ONY A;  3MP6 A;  3A3C A;  3IAZ A;  4ZEC A;  4JB7 A;  5L9S A;  3KN3 A;  3I3V A;  1A8E A;  1XVY A;  3LSX A;  3DP8 A;  4OEV A;  5LOM A;  3T96 B;  3FJG A;  3MVY A;  3UN6 A;  1CE2 A;  2V84 A;  1OQG A;  2NUV A;  2OZZ A;  3DP4 A;  4F22 A;  3OO6 A;  3IB2 A;  2Q2C A;  3C4M A;  3I6V A;  4DCY A;  2O68 A;  4G77 A;  3G7W A;  4G4P A;  1TFD A;  1GV8 A;  1YAE A;  2ZNU A;  3FZV A;  1QUL A;  4GVO A;  4IY5 A;  4QSD A;  1ATG A;  3MVW A;  3FV2 A;  4YZZ A;  5HM4 B;  1IIT A;  2OCU A;  2OBG A;  4F29 A;  4BDN A;  5L9M A;  4YAH X;  2QS3 A;  5CMM A;  4FEC A;  1I6B A;  2F7A A;  4BDL A;  3MW0 A;  2O1M A;  1LFH A;  1ZLQ A;  3S9N C;  3PUZ E;  4H1X A;  1MXW A;  4PFW A;  3V8X B;  5JTY A;  2PT2 A;  1EU8 A;  1MXY A;  2XXT A;  4JSO A;  1A55 A;  3FIR A;  1UQW A;  5ELV A;  2CZL A;  3HV1 A;  3P7I A;  3R6U A;  1MDQ A;  5JTY B;  2ZYO A;  3FD3 A;  3QIM A;  2OJT A;  4OZ9 A;  1KWH A;  3UA8 A;  2QRY A;  3RQT A;  3GZG A;  2O7I A;  4Z0I A;  5AA4 B;  3MZ9 A;  3PUV E;  1B0H A;  4MF3 A;  1OMP A;  3PPO A;  1EZP A;  3TTL A;  3PUY E;  4DIG A;  1TWY A;  4QSC A;  1N7X A;  4EDP A;  2M8C A;  1URG A;  3IO4 A;  1N7W A;  2UVI A;  3C35 A;  1PB7 A;  1WOD A;  2CMO A;  2H4I A;  1I6Q A;  3IOV A;  1J1N A;  3I5O A;  4OVJ A;  1N3X A;  1URD A;  1Y9U A;  1SI1 A;  4M1V A;  3OO7 A;  4XKN A;  4EQB A;  1ANF A;  2Z22 A;  3Q29 A;  4TOZ A;  1ZIU A;  1D3K A;  5DVI A;  3VLU A;  4DXU A;  4LA9 A;  4BDR A;  1MQH A;  3RTF B;  4C0R A;  5I57 B;  3JV9 A;  2ESN A;  4HCY A;  2RKM A;  1M5C A;  1TT1 A;  1MY0 A;  2Q8J A;  4OET A;  3UK4 A;  5I2K B;  1MQD A;  2UYE A;  1B0L A;  3DM0 A;  3IB0 A;  2HQ0 A;  4KFQ A;  5H8Q B;  3TKD A;  3TOD A;  4U22 A;  1XT8 A;  5A5X B;  1OQH A;  1Q35 A;  4KPT A;  1RKM A;  3K1P A;  3H4Z A;  3N26 A;  3PPQ A;  1HSE A;  1NNF A;  1R1N A;  4U4S A;  4ELO A;  3EQ1 A;  3R26 A;  4RA1 A;  4AB5 A;  1B4Z A;  4Z7E A;  1WVJ A;  5I2K A;  1US5 A;  3G3I A;  3MC2 A;  4MH5 A;  1FQA A;  4NMY A;  5FHM A;  2F5X A;  3LUY A;  3O9P A;  3G3H A;  3KOS A;  1IQ7 A;  2HZK A;  2YPN A;  3H6W A;  5FHN A;  1ZJL A;  2Y84 A;  1IXG A;  1GGG A;  2HAV A;  2REG A;  4O3C A;  2NOO A;  2XHD A;  3PD8 A;  4O3B A;  1QKA A;  3OSQ A;  4NF4 A;  1H3D A;  1NNP A;  4U1O A;  3SEV A;  3L6G A;  2P0S A;  4YKK A;  3GXA A;  1FQD A;  1TXF A;  3K00 A;  5BWJ A;  2Y7I A;  4H67 A;  2DXR A;  3VE1 B;  3O2A A;  4OMB A;  5ITO A;  1POY 1;  5CI5 A;  4E0X A;  1NKX A;  5H8H B;  3CFL A;  3Q28 A;  3U93 A;  1O63 A;  4ESX A;  5H8N A;  1EZ9 A;  2F7C A;  4EXL A;  3U72 A;  2DVZ A;  3OEM A;  1P99 A;  3OEN A;  1H43 A;  1ZBM A;  3O6H A;  1UTH B;  2NWJ A;  3T22 A;  3W9V A;  4Q0C A;  3M3K A;  1MPD A;  2W7Y A;  1I69 A;  4MFI A;  2UYF A;  4KCD A;  2VHA A;  4G8M A;  4X1D A;  2I49 A;  4LQ5 A;  1L5T A;  5AA2 A;  2F7B A;  4IO7 A;  4P0I A;  1JVY A;  2FA7 A;  4FED A;  4U4X A;  3O6I A;  5AA3 A;  3G3G A;  1JW4 A;  3TDJ A;  4POX A;  2Q88 A;  4TQU Q;  3O28 A;  1GVC A;  4F3S A;  1PB9 A;  2DWH A;  2DS9 A;  3M8U A;  4O3A A;  3EHT A;  3RGY A;  3E9X A;  2RC9 A;  4NF4 B;  3V5A A;  4GRK A;  3VV5 A;  3IJX B;  4NTL A;  3LSL A;  3USD A;  4ELQ A;  3MZ1 A;  1P1N A;  2X7P A;  1B7Z A;  3KBR A;  1AL3 A;  1M5F A;  2UVG A;  3PGF A;  3QUJ A;  1A8F A;  3DEL B;  5DTB A;  2ZMB A;  3CI8 A;  1A99 A;  5AA1 A;  3LSF B;  2GHA A;  4FOR A;  3SDF A;  3LC8 A;  1H76 A;  2I6E A;  5TP9 B;  1VSO A;  5I58 B;  5TPA B;  2XXH A;  1A54 A;  3C9H A;  3SKP A;  4QFO A;  3TQL A;  2F78 A;  4P11 A;  1SQY A;  1LST A;  3K01 A;  1PC3 A;  1JVX A;  3JZJ A;  3LR1 A;  3PPP A;  2OLB A;  4NWD A;  1DOT A;  1Y3Q A;  3A3U A;  2QMX A;  4GQO A;  4ZEK A;  5CC2 A;  3FV1 A;  2H9B A;  2LAO A;  2RF1 A;  3QSL A;  4OWD A;  5DVF A;  5JEI A;  1AIV A;  1A40 A;  2V3Q A;  3PU5 A;  2D5W A;  4QHQ A;  4RNS A;  3RT8 A;  2AYS A;  2OK2 A;  1O7T A;  3FUZ A;  5A5X A;  3PMV A;  2F97 A;  1LCF A;  1IUD A;  4UAC A;  3Q25 A;  1OVT A;  1LLS A;  2ALU A;  4R72 A;  4ZE8 A;  1FTL A;  3O66 A;  1Y3P A;  3CSG A;  2V3T A;  1MPB A;  3H03 A;  2Z8E A;  2ZNT A;  3RN8 A;  1P1W A;  2XX7 A;  4JWY A;  4G8H A;  3H6U A;  2Q9T A;  3KFM A;  3G3J A;  3H06 B;  1P1O A;  1UIV A;  4KYS A;  4R9G A;  5BUU A;  3V83 A;  3MVZ A;  3FAS A;  4DZ1 A;  2F6P A;  2HZL A;  2O51 A;  3CFX A;  3T9X B;  1FQF A;  3QAX A;  2XXW A;  3T9V A;  4ZZA A;  3FXR A;  1LGB C;  1VE4 A;  1MS7 A;  1QW0 A;  3CSB A;  3EHU A;  3KSX A;  3QK6 A;  3QXM A;  2H99 A;  4M4G A;  4ND9 A;  4OHN A;  3M3F A;  3T9H B;  4LZ8 A;  2REJ A;  3S9M C;  2XD2 A;  1P1U A;  3IL1 B;  1QKB A;  4PQJ A;  1MPC A;  4TLM B;  5DEX B;  3RNN A;  5I59 B;  1R6Z A;  3CFZ A;  1M5D A;  3E4R A;  4GOT A;  3ZS6 A;  4POW A;  4IGR A;  1QVS A;  3MZB A;  4H5G A;  4EF2 A;  3TCG A;  4P0G A;  1B9J A;  1MQG A;  2UVH A;  3F11 A;  4E0W A;  4OFL A;  4N07 A;  3K2D A;  3K1N A;  3IK6 B;  4YKI A;  4QF9 A;  2PYY A;  4OQO A;  3WAE A;  2GRV A;  2PMS A;  4LQ2 A;  4ZZE A;  2H25 A;  3QUF A;  4ELP A;  5I56 A;  2QS4 A;  1B7U A;  3TYH A;  2I48 A;  4NF8 B;  4PFT A;  4WED A;  1DTG A;  3IOT A;  1JEU A;  3N5L A;  3VFJ A;  1IEJ A;  1S9T A;  3HHF A;  1VFD A;  4MLV A;  1MG1 A;  2P2A A;  3ECR A;  3B6Q A;  3UIF A;  3MVX A;  4QSE A;  4HCW A;  3KEI A;  2XXQ A;  1YCJ A;  4GFR A;  4DE8 A;  3TEP A;  3SEY A;  4ESW A;  3SEW A;  4GL0 A;  1IZ1 A;  5H8F A;  4OEN A;  3U92 A;  2F6G A;  5I2N A;  1QUI A;  4DCX A;  3EPE A;  3MP1 A;  1LAF E;  1MY1 A;  4NF5 B;  4BDO A;  1MXU A;  2RCA A;  5L8D A;  1Y3N A;  1T0K A;  2FYI A;  1MXZ A;  3KG2 A;  4KQP A;  1XVX A;  2HEU A;  1AMF A;  4F18 A;  2P1S A;  3BKI B;  2QPQ A;  4OEU A;  3TFL A;  5FHO A;  4YKJ A;  1JW1 A;  3O6G A;  1CB6 A;  3FGS A;  3E13 X;  1PDA A;  4G8N A;  4KHZ E;  2F35 A;  3CIJ A;  4X48 A;  3VXC A;  4F31 B;  2O69 A;  2RIN A;  5B7D A;  1B51 A;  1BLF A;  5EHS A;  3MWB A;  1LFI A;  1IXI A;  2I3W A;  5F7V A;  3K6V A;  3C34 A;  3FXQ A;  3DLN A;  1B2H A;  4OES A;  3MPK A;  3VVF A;  3E3K A;  3SET A;  1S50 A;  1YTV A;  1OLC A;  5K2X A;  4EQ7 A;  1JEV A;  1IXC A;  3VLW A;  3IR1 A;  3EF7 A;  4RYA A;  4GF8 A;  1PBQ A;  5CBS A;  4WEP A;  1AOV A;  4F39 A;  5ISU A;  2Y7W A;  4IO6 A;  3HCQ A;  2XXI A;  4KI0 E;  4U2R A;  3IOW A;  1F9B A;  1DTZ A;  2GFE A;  1MH4 A;  3R7X A;  3N6U A;  4HTG A;  2VP1 A;  3TAJ A;  3VDF A;  3CG3 A;  4I62 A;  4JWX A;  4NF5 A;  1B3L A;  4ZEF A;  1WDN A;  2A5T B;  4N13 A;  4YB5 A;  2DP8 A;  3OO9 A;  1LAG E;  1NNK A;  4X1B A;  5F1Q A;  4GLI A;  4IB2 A;  3S4U A;  1MDP 1;  3M3L A;  4NWC A;  5DVJ A;  1I6A A;  4KD5 A;  1LFG A;  3FVK A;  2A5T A;  3DP6 A;  4LZ5 A;  4NE4 A;  4R74 A;  1IIW A;  5TP9 A;  1DPP A;  5I59 A;  1H45 A;  3RY3 A;  1O64 A;  2E1S A;  4HW8 A;  4K3F A;  1BP5 A;  3OXN A;  1BIY A;  4BLA A;  1MQI A;  2RC7 A;  4G68 A;  3B6T A;  4H8J A;  4PP0 A;  5ITP A;  3FVN A;  1B46 A;  4RY1 A;  2V25 A;  1LB9 A;  1B3H A;  3H7M A;  2ONS A;  4YB6 A;  4YU0 A;  1GR2 A;  5EHM A;  3TCF A;  5L9O A;  1MXX A;  2X26 A;  1D4N A;  4F3G A;  1JQF A;  4G68 B;  4HS7 A;  5J1D A;  1LAX A;  2IA4 A;  3ODB A;  2OWT A;  2Z23 A;  3TTN A;  3H6V A;  1D9Y A;  2DOJ A;  4F2O A;  3FAT A;  4THI A;  1B5J A;  3O97 A;  5I84 A;  3PPN A;  3CVG A;  1B05 A;  3IB1 A;  2RCB A;  1B5I A;  2HAU A;  1FTJ A;  3JYR A;  4H65 A;  2XXR A;  3ONM A;  3RPW A;  2XX9 A;  3TQW A;  2KLF A;  3S9L C;  3PV0 E;  1XS5 A;  2DXY A;  1MH3 A;  1SVX B;  1ZMG A;  3FJ7 A;  4ZEI A;  5M2V A;  1FQB A;  3K6X A;  3RLF E;  1MY4 A;  3UGW A;  5AA4 A;  3SES A;  5KDT A;  1Y4T A;  2VGQ A;  4ZS9 A;  4IO3 A;  3QYT A;  1URS A;  2QL3 A;  3CRB A;  4JXI A;  4AQ4 A;  4EXK A;  1OLA A;  1DMB A;  2Q89 A;  4Q5T A;  1FW0 A;  1FQC A;  2PVU A;  2ZYN A;  3CG1 A;  5H8Q A;  3K6W A;  4OER A;  1B3F A;  3TTK A;  1VR5 A;  2DVC A;  2GH9 A;  1B5H A;  3GLB A;  1Y1M A;  2QS1 A;  3OSR A;  5JK4 A;  5CM6 A;  1PEB A;  4XKP A;  1LCT A;  1N3W A;  2HFB A;  3MJN A;  4MLQ A;  5KCJ B;  2PBW A;  2FNC A;  3S2V A;  2F8D A;  4AB6 A;  1S7Y A;  2R9J A;  4C1T A;  1B4H A;  4PFU A;  5I57 A;  3IJO B;  4NF8 A;  1POT A;  4H5F A;  1N76 A;  3MP8 A;  1B6H A;  4ZDM A;  2HCA A;  2IEE A;  3HHG A;  4JWO A;  5AE4 A;  2Z8F A;  4R6K A;  4ELR A;  1VFE A;  3KGC A;  1FCK A;  3IX1 A;  3KJT A;  3KN8 A;  4EF1 A;  5KZT A;  3K6U A;  1HSJ A;  3IOR A;  3K1M A;  3MQ9 A;  4GD5 A;  4L17 A;  4QRZ A;  4XTC Q;  3RT6 B;  4F3B A;  4PE5 B;  1B40 A;  1BTJ A;  2O84 X;  4R6Y A;  2ZYK A;  3SEU A;  3S9E A;  3BBR A;  4FAJ A;  4H8I A;  2D3I A;  1SBP A; 
#chains in the Genus database with same CATH topology
 1B52 A;  1LBC A;  2G93 A;  3PPR A;  5ICT A;  3B6W A;  2HXW A;  3UP9 A;  5I58 A;  3BFT A;  2AL4 A;  1IMA A;  5HPQ A;  4YB7 A;  1NMU A;  1ZU0 A;  3FVG A;  3TTM A;  2Y5L A;  1H44 A;  2R6G E;  2ZZV A;  1UIU A;  2B3F A;  5I56 B;  2NXO A;  4BDQ A;  1Y20 A;  5CMB A;  2XXU A;  2RC8 A;  5AA2 B;  1Y1Z A;  2QVU A;  3BFU A;  4EQ9 A;  3OEK A;  4ECF A;  4XIG Q;  4PET A;  4GWO A;  5I2N B;  2OWZ A;  2DWI A;  3FVO A;  1XHY A;  4RPN A;  5ICQ A;  4PFY A;  2O7U A;  4PGN A;  2I58 A;  2THI A;  4I1D A;  1TFA A;  3OMB A;  1B3E A;  4X9T A;  1YPN A;  3N94 A;  4IGT A;  4XKQ A;  3VVD A;  2B65 A;  5KDT B;  3O29 A;  4MNP A;  4XXU A;  1MXV A;  2DSF A;  3PD9 A;  1B1X A;  4QXD A;  4R2F A;  2DQV A;  5H8F B;  4IY6 A;  5TPA A;  1XI6 A;  1SW5 A;  1G0H A;  1US4 A;  3V89 B;  4JDF A;  4LAT A;  3EKI A;  2AL5 A;  3C36 A;  3W9W A;  1Y4C A;  4DDD A;  3HN0 A;  4F19 A;  1NUY A;  5EQ7 A;  1MRP A;  3TTR A;  3Q26 A;  1DSN A;  3LUZ A;  4OXV A;  1UTH A;  3B7D A;  1B58 A;  4YIC A;  3PTY A;  4N6K A;  4FEB A;  1B1H A;  3G3K A;  1JET A;  3ZKL A;  4LON B;  5B70 A;  2DE4 A;  4C1U A;  2F34 A;  1NH8 A;  4NED A;  2I0C A;  4LUB A;  1QUK A;  1EYI A;  1EZO A;  3LBS A;  3VLV A;  4Q8R A;  1SI0 A;  2YJP A;  4IO4 A;  3RUM A;  4RPO A;  2QJE A;  2FVZ A;  3SZP A;  4ONY A;  3IAZ A;  4JB7 A;  4MX6 A;  1A8E A;  4MIJ A;  4F22 A;  2Q2C A;  4DCY A;  2O68 A;  4G77 A;  3G7W A;  4G4P A;  5A5L A;  1GV8 A;  4GVO A;  3FZV A;  2OCU A;  4YAH X;  2F7A A;  3KC1 A;  1EU8 A;  3HV1 A;  5JTY B;  3QIM A;  2O7I A;  4NAP A;  3MZ9 A;  1OMP A;  3PPO A;  1EZP A;  2DDK A;  4QSC A;  1BK4 A;  1URG A;  1I6Q A;  3I5O A;  3OO7 A;  4TOZ A;  4X8R A;  4DXU A;  1ZIU A;  4BDR A;  1MQH A;  3RTF B;  3JV9 A;  2ESN A;  5DW8 A;  3UK4 A;  4U22 A;  1XT8 A;  4P9K A;  4KPT A;  1RKM A;  3H4Z A;  1HSE A;  4U4S A;  5I2K A;  4O94 A;  2FBP A;  4N4U A;  4RA1 A;  4AB5 A;  1WVJ A;  4Z7E A;  1KA0 A;  3CHG A;  4MH5 A;  1FQA A;  4NMY A;  3O9P A;  3MST A;  1IQ7 A;  2YPN A;  3H6W A;  1ZJL A;  4O3C A;  2VT5 A;  4U1O A;  4NF4 A;  5ESY A;  1TXF A;  5BWJ A;  2Y7I A;  3VE1 B;  3O2A A;  4E0X A;  1NKX A;  5H8H B;  5IZ1 A;  3U93 A;  2F7C A;  2DVZ A;  3HFU A;  3OEN A;  1P99 A;  4Q0C A;  2HPG A;  1I69 A;  4KCD A;  1L5T A;  2F7B A;  1JVY A;  4U4X A;  4FED A;  5AA3 A;  1GVC A;  3M8U A;  2XA5 A;  2RC9 A;  4NF4 B;  1FBG A;  3VV5 A;  3LSL A;  1B7Z A;  1A99 A;  3LSF B;  2GHA A;  1G0I A;  1SQY A;  1FPG A;  3K01 A;  3LR1 A;  1JVX A;  3PPP A;  4NWD A;  1DOT A;  1Y3Q A;  2CEX A;  4OWD A;  2LAO A;  3QSL A;  1A40 A;  2XWK A;  2OK2 A;  3RYD A;  5A5X A;  3PMV A;  2F97 A;  1LLS A;  4P1E A;  1FTL A;  3CSG A;  3H03 A;  3RN8 A;  1P1W A;  4JWY A;  3G3J A;  4R9G A;  3IFA A;  1FBH A;  4I40 A;  2HZL A;  3QAX A;  2PFZ A;  1LGB C;  1QW0 A;  4PDD A;  4M4G A;  3M3F A;  4LZ8 A;  3IFC A;  3IL1 B;  4PQJ A;  5I59 B;  4POW A;  4QBA A;  4HE2 A;  4H5G A;  4EF2 A;  1B9J A;  2UVH A;  2BJI A;  4E0W A;  4PBQ A;  2GRV A;  4ZZE A;  5I56 A;  2QS4 A;  4WED A;  3N5L A;  3HHF A;  2P2A A;  3B6Q A;  3UIF A;  3MVX A;  4DE8 A;  2XXQ A;  3SEY A;  3U92 A;  5I2N A;  3EPE A;  3MP1 A;  4OVQ A;  5L8D A;  2FYI A;  4KQP A;  2P1S A;  3BKI B;  2QPQ A;  4OEU A;  4OVR A;  3FGS A;  4KHZ E;  3VXC A;  1BLF A;  5I5P A;  3MWB A;  1IXI A;  2I3W A;  3K6V A;  4GWX A;  3E3K A;  1IXC A;  3IR1 A;  3EF7 A;  1PBQ A;  5CBS A;  4WEP A;  4F39 A;  5ISU A;  1K9Z A;  4IO6 A;  1FPJ A;  3IOW A;  1DTZ A;  3R7X A;  2XWI A;  3N6U A;  4PCD A;  3CG3 A;  1B3L A;  4YB5 A;  3OO9 A;  4IB2 A;  2WYP A;  4LZ5 A;  3FVK A;  2A5T A;  1H45 A;  5IZ3 B;  3OXN A;  4G68 A;  3FVN A;  3TCF A;  4YU0 A;  1GR2 A;  5L9O A;  5J1D A;  2Z23 A;  2RCB A;  1FTJ A;  3RPW A;  4PE3 A;  3TQW A;  1XS5 A;  4PDH A;  3FJ7 A;  3RLF E;  3K6X A;  2VGQ A;  2QL3 A;  3CRB A;  4JXI A;  1OLA A;  2Q89 A;  4O7I A;  3CG1 A;  3OSR A;  2HFB A;  3MJN A;  4MLQ A;  4C1T A;  5I57 A;  4PFU A;  1N76 A;  3MP8 A;  4ZDM A;  4ELR A;  1FCK A;  3KN8 A;  4PC9 A;  3K1M A;  4XTC Q;  4GD5 A;  4I3E A;  1BTJ A;  4R6Y A;  3S9E A;  1DK4 A;  4QFN A;  2XXY A;  2NVU B;  4YMA A;  1SD3 A;  5DEX A;  4QFP A;  3WAF A;  4GL8 A;  1RYX A;  3IO6 A;  1NNT A;  2G29 A;  1M5B A;  1MM6 A;  3EHS A;  4MNI A;  1FBF A;  3EN3 A;  4NN3 A;  5IKB A;  4DXB A;  1SW1 A;  5TU0 A;  1NUZ A;  4RK9 A;  1AH5 A;  4NHB A;  2Z8D A;  4FE8 A;  2XXP A;  3MAM A;  1M5E A;  4NF6 A;  4RK2 A;  4R2B A;  4WXJ A;  5HBC A;  3MYU A;  1SW4 A;  2WBB A;  1NV7 A;  5J16 A;  3KN7 A;  1SYH A;  3SER A;  1FPE A;  1FRP A;  1SDX A;  3PMX A;  1MY3 A;  2ZNS A;  1MM7 A;  4F1Y A;  3LSW A;  4R73 A;  1N04 A;  4KYD A;  3K02 A;  2R71 A;  4MBP A;  4N6P A;  4ZED A;  2ZXT A;  1QJM A;  1Z7M E;  2WKY A;  5H8H A;  2PT1 A;  4HXV A;  3T93 B;  1NUW A;  3UOR A;  1R9Q A;  4FAT A;  2FIE A;  3U65 A;  3U94 A;  2DWJ A;  1EYJ A;  2ANJ A;  3G3F A;  3U8Q A;  3TPA A;  2DE2 A;  2VD3 A;  1Q1K A;  2P3V A;  2WX9 A;  2XD3 A;  2D21 A;  5DYH A;  4RJZ A;  3KJ7 A;  5CMK A;  3OO8 A;  2ONR A;  5CRY A;  2I0B A;  4OVS A;  4QFK A;  2UVJ A;  2MKZ A;  3C31 A;  5EYG A;  1FTK A;  2E0S A;  2DE3 A;  1NUX A;  2WBD A;  1A7L A;  2O6A A;  4XKR A;  4U21 A;  5DT6 A;  1FTO A;  3T9U A;  2L5V A;  2QS2 A;  1IXH A;  1UTB A;  1DPE A;  4KYE A;  2VD2 A;  4MNC A;  1AWB A;  3KOT A;  2B4L A;  2Y7R A;  1SYI A;  1MQJ A;  3ILU B;  3PUW E;  1N0T A;  3HST A;  5L9S A;  4ZEC A;  3KN3 A;  1XVY A;  4OEV A;  3FJG A;  3UN6 A;  2NUV A;  3C4M A;  3I6V A;  2ZNU A;  2HHM A;  4IY5 A;  1LBV A;  2XWO A;  5L9M A;  2QS3 A;  4BDL A;  3MW0 A;  3PUZ E;  5JTY A;  2PT2 A;  1MXY A;  1A55 A;  3FIR A;  1UQW A;  3B50 A;  1DCU A;  4MF3 A;  3TTL A;  1TWY A;  1N7X A;  2M8C A;  2UVI A;  4X04 A;  2H4I A;  4JVC A;  1N3X A;  4M1V A;  3ISP A;  1ANF A;  5DVI A;  4C0R A;  4O7M A;  1M5C A;  2Q8J A;  5I2K B;  1MQD A;  1LBW A;  5H8Q B;  5A5X B;  3PPQ A;  3EQ1 A;  2R8T A;  3MC2 A;  2F5X A;  3LUY A;  4GWY A;  2Y84 A;  1GGG A;  4O3B A;  2XHD A;  1QKA A;  3OSQ A;  1FPK A;  3L6G A;  4YKK A;  3GXA A;  1FQD A;  3K00 A;  4H67 A;  2DXR A;  5ITO A;  1O63 A;  2QFL A;  4ESX A;  5H8N A;  4O8M A;  4EXL A;  3O6H A;  3T22 A;  3W9V A;  1FJ6 A;  3M3K A;  4GX3 A;  2UYF A;  2VHA A;  4G8M A;  2I49 A;  4P0I A;  2FA7 A;  3O6I A;  1YZ0 A;  2Q88 A;  1FSA A;  4F3S A;  3USD A;  4ELQ A;  1AL3 A;  2UVG A;  3SDF A;  3LC8 A;  4MAG A;  5TP9 B;  5I58 B;  2XXH A;  3C9H A;  4QFO A;  2F78 A;  2ZZX A;  1LST A;  1PC3 A;  2OLB A;  5IZZ A;  3FV1 A;  5DVF A;  3PU5 A;  2B4M A;  3Q25 A;  4R72 A;  4ZE8 A;  3O66 A;  2ZNT A;  2QVV A;  3H06 B;  5BUU A;  3MVZ A;  1FQF A;  3RPL B;  3FXR A;  3KSX A;  3QK6 A;  3QXM A;  4ND9 A;  1CNQ A;  5DEX B;  4XEQ A;  2VPO A;  1R6Z A;  3E4R A;  1M5D A;  3ZS6 A;  1VDW A;  4P1L A;  4N07 A;  2PYY A;  3WAE A;  2PMS A;  4ELP A;  2H25 A;  3QUF A;  5LTC A;  1B7U A;  2I48 A;  1JEU A;  5F24 A;  4N81 A;  1YCJ A;  4GFR A;  4ESW A;  5H8F A;  4OEN A;  1QUI A;  2HXR A;  1MY1 A;  4BDO A;  5FBP A;  4GBW A;  2VPN A;  4YKJ A;  3O6G A;  4G8N A;  2F35 A;  2O69 A;  1LFI A;  5F7V A;  3FXQ A;  3DLN A;  2FIX A;  3MPK A;  4PFR A;  1S50 A;  5K2X A;  4U2R A;  1F9B A;  1FPB A;  3TAJ A;  4ZEF A;  3E79 A;  4GX6 A;  1WDN A;  2A5T B;  1NNK A;  4X1B A;  1MDP 1;  5ET8 A;  3DP6 A;  1IIW A;  1DPP A;  3RY3 A;  2E1S A;  4HW8 A;  1BIY A;  1NV0 A;  4BLA A;  5EYH A;  4PP0 A;  1B46 A;  1LB9 A;  1B3H A;  5EHM A;  1MXX A;  1D4N A;  4F3G A;  1JQF A;  1NV1 A;  2OWT A;  4PAI A;  1FPL A;  4F2O A;  4THI A;  3B8B A;  3PPN A;  4QSD A;  3CVG A;  1B05 A;  2XXR A;  5M2V A;  2DXY A;  1MH3 A;  1ZMG A;  4ZEI A;  1FQB A;  3QYT A;  4PAK A;  1URS A;  4AQ4 A;  1DMB A;  4Q5T A;  1FQC A;  2ZYN A;  1VR5 A;  1B5H A;  5JK4 A;  1Q9D A;  1PEB A;  1LCT A;  2PBW A;  4AB6 A;  1B4H A;  2HCA A;  5AE4 A;  5KCJ A;  2Z8F A;  1VFE A;  4F3B A;  4QRZ A;  3RT6 B;  1B40 A;  2D3I A;  4R6H A;  3SEX A;  4GXS B;  1NH7 A;  5FTH A;  4R9F A;  4OTE A;  4LZ7 A;  1LBX A;  1GTK A;  4FJP A;  4GXA A;  2I4B A;  3MPL A;  2CEY A;  2DWA A;  3RTW B;  1HSL A;  3N6T A;  4DLD A;  4NF6 B;  3CR9 A;  4JVI A;  1B3G A;  1YYZ A;  2V93 A;  3C33 A;  5K2Y A;  2ZYM A;  2V3U A;  5CMC A;  1XC1 A;  3THI A;  1USY H;  4GWU A;  1OVB A;  1B7H A;  3FJM A;  1UTB B;  3D4G A;  4GBV A;  4IR8 A;  2QVR A;  2BJJ X;  4MEV A;  2Y7P A;  3Q27 A;  4PF6 A;  3C32 A;  3K4U A;  4XF5 A;  4I8C A;  4DXC A;  1PB8 A;  5AA2 D;  1FBE A;  3OEL A;  4F2Q A;  1FBD A;  1P1Q A;  4RXL A;  3VVE A;  3A09 A;  2I4C A;  5I3S A;  1IMF A;  3TEL A;  5FTI A;  1NFT A;  2Q8M A;  3TMG A;  3MUQ A;  5CBR A;  1FPI A;  1MY2 A;  4OYV A;  3MBP A;  2QMW A;  4F3P A;  2F3B A;  3KBZ A;  4Q30 B;  2I3V A;  1FTM A;  4OFJ A;  1LBZ A;  3D4C A;  2XXV A;  3NOH A;  2ONK E;  4FIM A;  2XX8 A;  4IO2 A;  2GHB A;  1JNF A;  3E78 A;  1LAH E;  2H5Y A;  4QFL A;  1USY E;  1BKA A;  1JW5 A;  4NGU A;  3MP6 A;  3A3C A;  3LSX A;  3DP8 A;  3MVY A;  1OQG A;  3DP4 A;  3OO6 A;  4GWZ A;  3IB2 A;  3FV2 A;  1IIT A;  4BDN A;  1I6B A;  2O1M A;  1LFH A;  4H1X A;  5I7I A;  2V4C A;  5IM2 A;  5ELV A;  1MDQ A;  1INP A;  2OJT A;  2QRY A;  3BIH A;  5AA4 B;  1B0H A;  4DIG A;  4EDP A;  3C35 A;  1WOD A;  3IOV A;  4OVJ A;  1SI1 A;  4XKN A;  3Q29 A;  4H45 A;  3VLU A;  4OVP A;  2RKM A;  1MY0 A;  4OET A;  3TOD A;  2UYE A;  3IB0 A;  2HQ0 A;  3TKD A;  1Q35 A;  1RDZ A;  4PTK A;  3K1P A;  3N26 A;  4F1V A;  1NNF A;  1R1N A;  3R26 A;  1B4Z A;  1US5 A;  3G3I A;  1YXI A;  2HZK A;  4I3Y A;  2HAV A;  3SEV A;  1LEV A;  4PGP A;  1POY 1;  5CI5 A;  3Q28 A;  1EZ9 A;  3U72 A;  2P3N A;  1H43 A;  1ZBM A;  1UTH B;  4P56 A;  1MPD A;  2W7Y A;  4MFI A;  5ET7 A;  4MHF A;  4LQ5 A;  5AA2 A;  3G3G A;  3TDJ A;  4POX A;  4TQU Q;  3O28 A;  1PB9 A;  2DWH A;  4O3A A;  3T1B A;  3EHT A;  3E9X A;  4GRK A;  3IJX B;  2X7P A;  3QUJ A;  1A8F A;  3DEL B;  5AA1 A;  3CI8 A;  1H76 A;  2I6E A;  1VSO A;  5TPA B;  3SKP A;  2QMX A;  4GQO A;  1QGX A;  3RT8 A;  1O7T A;  3FUZ A;  1LCF A;  4UAC A;  3A29 A;  2V3T A;  4KYS A;  1P1O A;  1UIV A;  1NV6 A;  3FAS A;  4N8G A;  2F6P A;  4GWS A;  3CFX A;  1MS7 A;  5CMM A;  4FAJ A;  3EHU A;  3TEP A;  1LBY A;  3T9H B;  3S9M C;  4TLM B;  4GOT A;  4IGR A;  1QVS A;  3MZB A;  5EQ9 A;  3TCG A;  1MQG A;  3F11 A;  3K1N A;  4YKI A;  4QF9 A;  4PFT A;  1DTG A;  3VFJ A;  1VFD A;  4MLV A;  1NV5 A;  1MG1 A;  3ECR A;  4QSE A;  4HCW A;  3KEI A;  2PCR A;  4GL0 A;  1IZ1 A;  4NF5 B;  1MXU A;  2RCA A;  1NV4 A;  1T0K A;  3KG2 A;  2CZK A;  1JW1 A;  3CIJ A;  4X48 A;  2RIN A;  1B51 A;  1FTA A;  3ROJ A;  3C34 A;  4AS4 A;  1B2H A;  2ZZW A;  3SET A;  4P47 A;  5ET6 A;  1JEV A;  4EQ7 A;  4GX4 A;  2Y5K A;  4RYA A;  4GF8 A;  4KI0 E;  2GFE A;  1MH4 A;  4HTG A;  2VP1 A;  4NG7 A;  4NF5 A;  4I62 A;  2XWV A;  1LAG E;  3M3L A;  4KD5 A;  4NE4 A;  1O64 A;  1BP5 A;  2KR0 A;  3LV0 A;  2RC7 A;  5ITP A;  4RY1 A;  2V25 A;  2ONS A;  2X26 A;  4LN5 A;  2CZI A;  1LAX A;  3H6V A;  1D9Y A;  1B5J A;  3IB1 A;  1B5I A;  2HAU A;  3ONM A;  3S9L C;  2XX9 A;  2KLF A;  3PV0 E;  1SVX B;  1Y4T A;  4IO3 A;  4EXK A;  1B3F A;  3QMF A;  1IMB A;  4XKP A;  1N3W A;  5KCJ B;  2FNC A;  1JP4 A;  2CZH A;  3IJO B;  4H5F A;  1B6H A;  2IEE A;  4JWO A;  4R6K A;  3KGC A;  3IX1 A;  3KJT A;  4EF1 A;  5KZT A;  3K6U A;  1SPI A;  4AS5 A;  2ZYK A;  2PFY A;  3BBR A;  5CM6 A;  4H8I A;  1SBP A;  1D9V A;  2F36 A;  4U1Z A;  2OWS A;  2Y7K A;  3AXF A;  2QSX A;  1FBP A;  3GBA A;  3IOU A;  3HPI A;  5H8S A;  3VXB A;  5EQA A;  3PUX E;  4BDM A;  3H6T A;  1ZTY A;  4R75 A;  4LVQ A;  5T3J A;  4U23 A;  4TLL B;  3HO7 A;  3TCH A;  5IGA A;  5H8N B;  4KR5 A;  2F3D A;  1K9Y A;  2ABH A;  1Z7N E;  4H0W A;  4F1U A;  2DYX A;  3ZKK A;  3PMW A;  2JJK A;  4GWW A;  1XOC A;  1B32 A;  3T0J A;  3OOA A;  4G2Z A;  3K0V A;  1QUJ A;  3TZA A;  4DI3 D;  2X7Q A;  1SW2 A;  4KXP A;  4H6D A;  4G68 C;  1LBB A;  2XXX A;  4ZEB A;  1FBC A;  2A5S A;  2AIX A;  4XFE A;  3OD7 A;  4UAB A;  1EH3 A;  4PFB A;  1NL5 A;  4I9D A;  2YLN A;  2O1L A;  4GIZ A;  4EUO A;  1NI9 A;  1PBP A;  3RPL A;  3T66 A;  4JSD A;  4LP2 B;  4UA8 A;  2PX1 A;  2WEF A;  1FQE A;  1OIB A;  1R9L A;  5IAI A;  4ISU A;  2B3B A;  1LB8 A;  3GYY A;  4IO5 A;  2Q74 A;  4WKM A;  4KCC A;  3KSJ A;  4YKP A;  4PBH A;  4YMB A;  3W15 C;  3ILT B;  3U1O A;  3FXU A;  1II5 A;  3GBB A;  5EYF A;  3L6H A;  2Q2A A;  1RYO A;  2H98 A;  1N84 A;  2VOZ A;  3ZSF A;  4OA4 A;  1ELJ A;  3KZG A;  2UXA A;  4JBZ A;  4N91 A;  1ZKB A;  4OFO A;  3H3G A;  2XXK A;  3I3V A;  5LOM A;  3T96 B;  1CE2 A;  2V84 A;  2OZZ A;  1TFD A;  1YAE A;  1QUL A;  4YZZ A;  1ATG A;  3MVW A;  5IZ3 A;  5HM4 B;  2OBG A;  4F29 A;  4FEC A;  4N17 A;  1ZLQ A;  3S9N C;  1MXW A;  4PFW A;  3V8X B;  5LDZ A;  4JSO A;  4P3L A;  2XXT A;  1IMC A;  2CZL A;  4PF8 A;  3P7I A;  3R6U A;  2ZYO A;  1FPF A;  3FD3 A;  4DI4 B;  4OZ9 A;  1KWH A;  3UA8 A;  3RQT A;  3GZG A;  4Z0I A;  3PUV E;  3D1R A;  3PUY E;  4PAF A;  3IO4 A;  1N7W A;  1PB7 A;  2CMO A;  4PFI A;  1J1N A;  4ZE9 A;  1URD A;  1Y9U A;  4EQB A;  2Z22 A;  1D3K A;  4LA9 A;  5I57 B;  4HCY A;  1TT1 A;  1B0L A;  3DM0 A;  4KFQ A;  1OQH A;  4NQ8 A;  4ELO A;  3FXB A;  5EQ8 A;  1FPD A;  4FBP A;  1EYK A;  5FHM A;  3G3H A;  3KOS A;  5FHN A;  1IXG A;  2REG A;  2NOO A;  3PD8 A;  1H3D A;  1NNP A;  2P0S A;  4P8B A;  4NX1 A;  4OMB A;  3CFL A;  1D9Q A;  3OEM A;  2NWJ A;  4JVD A;  4N6D A;  4X1D A;  4IO7 A;  1JW4 A;  3KC0 A;  2DS9 A;  3RGY A;  3V5A A;  4NTL A;  3MZ1 A;  1P1N A;  3KBR A;  1M5F A;  3PGF A;  1IME A;  5DTB A;  2ZMB A;  4FOR A;  1A54 A;  3TQL A;  4P11 A;  3JZJ A;  5CC2 A;  3A3U A;  4ZEK A;  4N8Y A;  2H9B A;  2RF1 A;  3BIG A;  5JEI A;  1AIV A;  4RNS A;  2V3Q A;  2D5W A;  4QHQ A;  2AYS A;  1IUD A;  1OVT A;  2ALU A;  1Y3P A;  4N15 A;  1MPB A;  2Z8E A;  2XX7 A;  4G8H A;  3H6U A;  2Q9T A;  3KFM A;  3V83 A;  1KZ8 A;  4MJO A;  4DZ1 A;  2O51 A;  3T9X B;  1RDX A;  2XXW A;  4ZZA A;  3T9V A;  1VE4 A;  3CSB A;  4OHN A;  1NV2 A;  2H99 A;  2REJ A;  2XD2 A;  3RNN A;  1P1U A;  1QKB A;  1MPC A;  4OVT A;  3CFZ A;  4P0G A;  4OFL A;  3K2D A;  3IK6 B;  4OQO A;  4LQ2 A;  3TYH A;  4NF8 B;  2FHY A;  3IOT A;  1IEJ A;  1S9T A;  3SEW A;  4OAN A;  4HE1 A;  2F6G A;  4DCX A;  1LAF E;  1KA1 A;  1Y3N A;  4F18 A;  1MXZ A;  1XVX A;  2HEU A;  1AMF A;  3TFL A;  1FJ9 A;  5FHO A;  4HE0 A;  1CB6 A;  3E13 X;  1PDA A;  4F31 B;  5B7D A;  5EHS A;  4NF0 A;  4OES A;  3VVF A;  1YTV A;  1OLC A;  2WYK A;  1RDY A;  1AOV A;  2Y7W A;  3HCQ A;  2XXI A;  3VDF A;  1NV3 A;  4JWX A;  3FBP A;  4N13 A;  2DP8 A;  5F1Q A;  4GLI A;  3S4U A;  4NWC A;  5DVJ A;  1I6A A;  3VLW A;  5TP9 A;  1LFG A;  4R74 A;  5I59 A;  1IMD A;  4K3F A;  4H46 A;  2GQ1 A;  1MQI A;  3B6T A;  4H8J A;  3H7M A;  4YB6 A;  4G61 A;  4G68 B;  4HS7 A;  2IA4 A;  3ODB A;  3TTN A;  2DOJ A;  5I84 A;  3FAT A;  3O97 A;  4MMP A;  3JYR A;  4H65 A;  2OX3 A;  3UGW A;  1MY4 A;  5AA4 A;  3SES A;  5KDT A;  4ZS9 A;  1FW0 A;  2PVU A;  5H8Q A;  3K6W A;  4OER A;  3TTK A;  2DVC A;  2GH9 A;  3GLB A;  1DBZ A;  1Y1M A;  2QS1 A;  3S2V A;  2F8D A;  1S7Y A;  2R9J A;  5ET5 A;  4MCO A;  1POT A;  4NF8 A;  3HHG A;  1HSJ A;  3IOR A;  3MQ9 A;  4L17 A;  2KQZ A;  4PE5 B;  2O84 X;  3SEU A;  3TUS A; 
#chains in the Genus database with same CATH homology
 1D9V A;  1B52 A;  2F36 A;  4QFN A;  1LBC A;  2G93 A;  4U1Z A;  2OWS A;  3PPR A;  4R6H A;  4GXS B;  3SEX A;  5ICT A;  1NH7 A;  2Y7K A;  3AXF A;  2XXY A;  5FTH A;  3B6W A;  2HXW A;  2QSX A;  2NVU B;  3GBA A;  3UP9 A;  4YMA A;  5I58 A;  1SD3 A;  3BFT A;  3IOU A;  2AL4 A;  5DEX A;  3HPI A;  5H8S A;  4QFP A;  5HPQ A;  4YB7 A;  4R9F A;  4OTE A;  4LZ7 A;  3WAF A;  4GL8 A;  1NMU A;  3VXB A;  1ZU0 A;  3PUX E;  4BDM A;  3H6T A;  1RYX A;  3FVG A;  1NNT A;  1ZTY A;  2G29 A;  1GTK A;  1M5B A;  1MM6 A;  3IO6 A;  3EHS A;  4FJP A;  4GXA A;  3TTM A;  2I4B A;  1H44 A;  3MPL A;  2DWA A;  4R75 A;  3RTW B;  1HSL A;  2R6G E;  3EN3 A;  1UIU A;  4LVQ A;  2B3F A;  5I56 B;  5IKB A;  2NXO A;  4DXB A;  1SW1 A;  5TU0 A;  4BDQ A;  1Y20 A;  5CMB A;  4U23 A;  2XXU A;  3N6T A;  2RC8 A;  4RK9 A;  5AA2 B;  1Y1Z A;  4TLL B;  4DLD A;  4NF6 B;  3CR9 A;  3BFU A;  4EQ9 A;  1AH5 A;  1B3G A;  3C33 A;  2V93 A;  2Z8D A;  3OEK A;  3HO7 A;  4FE8 A;  4ECF A;  2XXP A;  5K2Y A;  3TUS A;  3MAM A;  1M5E A;  2ZYM A;  2V3U A;  4NF6 A;  4PET A;  1XC1 A;  4RK2 A;  4GWO A;  4XIG Q;  5CMC A;  3TCH A;  3THI A;  4R2B A;  5I2N B;  1USY H;  4WXJ A;  5HBC A;  5H8N B;  1SW4 A;  2DWI A;  4KR5 A;  3FVO A;  1XHY A;  4RPN A;  5ICQ A;  2ABH A;  1OVB A;  1Z7N E;  4PFY A;  2O7U A;  4H0W A;  4F1U A;  3KN7 A;  1B7H A;  2DYX A;  1SYH A;  3SER A;  3PMW A;  3ZKK A;  3FJM A;  1UTB B;  2I58 A;  2THI A;  1SDX A;  4I1D A;  1XOC A;  3PMX A;  1B32 A;  1TFA A;  3D4G A;  3OMB A;  1B3E A;  4X9T A;  1MY3 A;  3OOA A;  1YPN A;  4G2Z A;  3K0V A;  1QUJ A;  2ZNS A;  2BJJ X;  3N94 A;  1MM7 A;  4IGT A;  2Y7P A;  3Q27 A;  3TZA A;  2X7Q A;  1SW2 A;  4XKQ A;  4F1Y A;  3LSW A;  3C32 A;  4H6D A;  4G68 C;  4R73 A;  3VVD A;  1LBB A;  2XXX A;  4ZEB A;  3K4U A;  2B65 A;  5KDT B;  3O29 A;  4XXU A;  1MXV A;  2A5S A;  1N04 A;  4F1V A;  2DSF A;  2AIX A;  3PD9 A;  4KYD A;  5EYF A;  3OD7 A;  3K02 A;  1B1X A;  1EH3 A;  4I8C A;  2R71 A;  1NL5 A;  4I9D A;  4MBP A;  4N6P A;  4DXC A;  2YLN A;  4ZED A;  4R2F A;  2ZXT A;  2DQV A;  1PB8 A;  5H8F B;  1QJM A;  4IY6 A;  2O1L A;  5TPA A;  5AA2 D;  1Z7M E;  2WKY A;  4GIZ A;  1SW5 A;  4EUO A;  1US4 A;  1PBP A;  3OEL A;  5H8H A;  4F2Q A;  1P1Q A;  4RXL A;  3T66 A;  2PT1 A;  3VVE A;  3A09 A;  4JSD A;  3V89 B;  4LP2 B;  4UA8 A;  4JDF A;  2PX1 A;  1FQE A;  2I4C A;  3T93 B;  3UOR A;  3TEL A;  4LAT A;  1R9Q A;  1OIB A;  5FTI A;  4FAT A;  2AL5 A;  3C36 A;  1NFT A;  3W9W A;  1R9L A;  5IAI A;  4ISU A;  2DWJ A;  3U94 A;  1Y4C A;  4DDD A;  2B3B A;  3TMG A;  2ANJ A;  3MUQ A;  3G3F A;  3U8Q A;  3HN0 A;  5CBR A;  3TPA A;  2DE2 A;  1MY2 A;  4F19 A;  2VD3 A;  1LB8 A;  1Q1K A;  4IO5 A;  2XD3 A;  5DYH A;  2D21 A;  1MRP A;  4RJZ A;  3KJ7 A;  4WKM A;  4KCC A;  4OYV A;  5CMK A;  3MBP A;  2QMW A;  3OO8 A;  3KSJ A;  4YKP A;  2ONR A;  5CRY A;  2I0B A;  3TTR A;  4YMB A;  4QFK A;  3W15 C;  3ILT B;  2UVJ A;  4F3P A;  3Q26 A;  3U1O A;  3C31 A;  1DSN A;  1FTK A;  2E0S A;  4OXV A;  3FXU A;  2DE3 A;  1II5 A;  3GBB A;  1UTH A;  3B7D A;  1B58 A;  3L6H A;  1A7L A;  2O6A A;  4YIC A;  4FEB A;  2Q2A A;  1B1H A;  2I3V A;  1RYO A;  3G3K A;  1JET A;  4Q30 B;  4XKR A;  4U21 A;  3ZKL A;  4ZE9 A;  1FTM A;  4OFJ A;  2H98 A;  4LON B;  5DT6 A;  1FTO A;  3D4C A;  5B70 A;  2DE4 A;  1N84 A;  2VOZ A;  2XXV A;  3ZSF A;  4C1U A;  3T9U A;  1ELJ A;  2F34 A;  1NH8 A;  2ONK E;  2QS2 A;  4NED A;  1IXH A;  1UTB A;  4FIM A;  2I0C A;  4LUB A;  2XX8 A;  3KZG A;  2UXA A;  2GHB A;  4IO2 A;  4JBZ A;  1QUK A;  1EZO A;  1JNF A;  3LBS A;  1DPE A;  4KYE A;  1ZKB A;  1LAH E;  4OFO A;  3VLV A;  4Q8R A;  5KCJ A;  1SI0 A;  2VD2 A;  2H5Y A;  2YJP A;  4IO4 A;  3H3G A;  3KOT A;  4QFL A;  2Y7R A;  3RUM A;  4RPO A;  1USY E;  1SYI A;  1BKA A;  1MQJ A;  2QJE A;  3ILU B;  3PUW E;  1N0T A;  1JW5 A;  3HST A;  4ONY A;  3MP6 A;  3A3C A;  3IAZ A;  4ZEC A;  4JB7 A;  5L9S A;  3KN3 A;  3I3V A;  1A8E A;  1XVY A;  3LSX A;  3DP8 A;  4OEV A;  5LOM A;  3T96 B;  3FJG A;  3MVY A;  3UN6 A;  1CE2 A;  2V84 A;  1OQG A;  2NUV A;  2OZZ A;  3DP4 A;  4F22 A;  3OO6 A;  3IB2 A;  2Q2C A;  3C4M A;  3I6V A;  4DCY A;  2O68 A;  4G77 A;  3G7W A;  4G4P A;  1TFD A;  1GV8 A;  1YAE A;  2ZNU A;  3FZV A;  1QUL A;  4GVO A;  4IY5 A;  4QSD A;  1ATG A;  3MVW A;  3FV2 A;  4YZZ A;  5HM4 B;  1IIT A;  2OCU A;  2OBG A;  4F29 A;  4BDN A;  5L9M A;  4YAH X;  2QS3 A;  5CMM A;  4FEC A;  1I6B A;  2F7A A;  4BDL A;  3MW0 A;  2O1M A;  1LFH A;  1ZLQ A;  3S9N C;  3PUZ E;  4H1X A;  1MXW A;  4PFW A;  3V8X B;  5JTY A;  2PT2 A;  1EU8 A;  1MXY A;  2XXT A;  4JSO A;  1A55 A;  3FIR A;  1UQW A;  5ELV A;  2CZL A;  3HV1 A;  3P7I A;  3R6U A;  1MDQ A;  5JTY B;  2ZYO A;  3FD3 A;  3QIM A;  2OJT A;  4OZ9 A;  1KWH A;  3UA8 A;  2QRY A;  3RQT A;  3GZG A;  2O7I A;  4Z0I A;  5AA4 B;  3MZ9 A;  3PUV E;  1B0H A;  4MF3 A;  1OMP A;  3PPO A;  1EZP A;  3TTL A;  3PUY E;  4DIG A;  1TWY A;  4QSC A;  1N7X A;  4EDP A;  2M8C A;  1URG A;  3IO4 A;  1N7W A;  2UVI A;  3C35 A;  1PB7 A;  1WOD A;  2CMO A;  2H4I A;  1I6Q A;  3IOV A;  1J1N A;  3I5O A;  4OVJ A;  1N3X A;  1URD A;  1Y9U A;  1SI1 A;  4M1V A;  3OO7 A;  4XKN A;  4EQB A;  1ANF A;  2Z22 A;  3Q29 A;  4TOZ A;  1ZIU A;  1D3K A;  5DVI A;  3VLU A;  4DXU A;  4LA9 A;  4BDR A;  1MQH A;  3RTF B;  4C0R A;  5I57 B;  3JV9 A;  2ESN A;  4HCY A;  2RKM A;  1M5C A;  1TT1 A;  1MY0 A;  2Q8J A;  4OET A;  3UK4 A;  5I2K B;  1MQD A;  2UYE A;  1B0L A;  3DM0 A;  3IB0 A;  2HQ0 A;  4KFQ A;  5H8Q B;  3TKD A;  3TOD A;  4U22 A;  1XT8 A;  5A5X B;  1OQH A;  1Q35 A;  4KPT A;  1RKM A;  3K1P A;  3H4Z A;  3N26 A;  3PPQ A;  1HSE A;  1NNF A;  1R1N A;  4U4S A;  4ELO A;  3EQ1 A;  3R26 A;  4RA1 A;  4AB5 A;  1B4Z A;  4Z7E A;  1WVJ A;  5I2K A;  1US5 A;  3G3I A;  3MC2 A;  4MH5 A;  1FQA A;  4NMY A;  5FHM A;  2F5X A;  3LUY A;  3O9P A;  3G3H A;  3KOS A;  1IQ7 A;  2HZK A;  2YPN A;  3H6W A;  5FHN A;  1ZJL A;  2Y84 A;  1IXG A;  1GGG A;  2HAV A;  2REG A;  4O3C A;  2NOO A;  2XHD A;  3PD8 A;  4O3B A;  1QKA A;  3OSQ A;  4NF4 A;  1H3D A;  1NNP A;  4U1O A;  3SEV A;  3L6G A;  2P0S A;  4YKK A;  3GXA A;  1FQD A;  1TXF A;  3K00 A;  5BWJ A;  2Y7I A;  4H67 A;  2DXR A;  3VE1 B;  3O2A A;  4OMB A;  5ITO A;  1POY 1;  5CI5 A;  4E0X A;  1NKX A;  5H8H B;  3CFL A;  3Q28 A;  3U93 A;  1O63 A;  4ESX A;  5H8N A;  1EZ9 A;  2F7C A;  4EXL A;  3U72 A;  2DVZ A;  3OEM A;  1P99 A;  3OEN A;  1H43 A;  1ZBM A;  3O6H A;  1UTH B;  2NWJ A;  3T22 A;  3W9V A;  4Q0C A;  3M3K A;  1MPD A;  2W7Y A;  1I69 A;  4MFI A;  2UYF A;  4KCD A;  2VHA A;  4G8M A;  4X1D A;  2I49 A;  4LQ5 A;  1L5T A;  5AA2 A;  2F7B A;  4IO7 A;  4P0I A;  1JVY A;  2FA7 A;  4FED A;  4U4X A;  3O6I A;  5AA3 A;  3G3G A;  1JW4 A;  3TDJ A;  4POX A;  2Q88 A;  4TQU Q;  3O28 A;  1GVC A;  4F3S A;  1PB9 A;  2DWH A;  2DS9 A;  3M8U A;  4O3A A;  3EHT A;  3RGY A;  3E9X A;  2RC9 A;  4NF4 B;  3V5A A;  4GRK A;  3VV5 A;  3IJX B;  4NTL A;  3LSL A;  3USD A;  4ELQ A;  3MZ1 A;  1P1N A;  2X7P A;  1B7Z A;  3KBR A;  1AL3 A;  1M5F A;  2UVG A;  3PGF A;  3QUJ A;  1A8F A;  3DEL B;  5DTB A;  2ZMB A;  3CI8 A;  1A99 A;  5AA1 A;  3LSF B;  2GHA A;  4FOR A;  3SDF A;  3LC8 A;  1H76 A;  2I6E A;  5TP9 B;  1VSO A;  5I58 B;  5TPA B;  2XXH A;  1A54 A;  3C9H A;  3SKP A;  4QFO A;  3TQL A;  2F78 A;  4P11 A;  1SQY A;  1LST A;  3K01 A;  1PC3 A;  1JVX A;  3JZJ A;  3LR1 A;  3PPP A;  2OLB A;  4NWD A;  1DOT A;  1Y3Q A;  3A3U A;  2QMX A;  4GQO A;  4ZEK A;  5CC2 A;  3FV1 A;  2H9B A;  2LAO A;  2RF1 A;  3QSL A;  4OWD A;  5DVF A;  5JEI A;  1AIV A;  1A40 A;  2V3Q A;  3PU5 A;  2D5W A;  4QHQ A;  4RNS A;  3RT8 A;  2AYS A;  2OK2 A;  1O7T A;  3FUZ A;  5A5X A;  3PMV A;  2F97 A;  1LCF A;  1IUD A;  4UAC A;  3Q25 A;  1OVT A;  1LLS A;  2ALU A;  4R72 A;  4ZE8 A;  1FTL A;  3O66 A;  1Y3P A;  3CSG A;  2V3T A;  1MPB A;  3H03 A;  2Z8E A;  2ZNT A;  3RN8 A;  1P1W A;  2XX7 A;  4JWY A;  4G8H A;  3H6U A;  2Q9T A;  3KFM A;  3G3J A;  3H06 B;  1P1O A;  1UIV A;  4KYS A;  4R9G A;  5BUU A;  3V83 A;  3MVZ A;  3FAS A;  4DZ1 A;  2F6P A;  2HZL A;  2O51 A;  3CFX A;  3T9X B;  1FQF A;  3QAX A;  2XXW A;  3T9V A;  4ZZA A;  3FXR A;  1LGB C;  1VE4 A;  1MS7 A;  1QW0 A;  3CSB A;  3EHU A;  3KSX A;  3QK6 A;  3QXM A;  2H99 A;  4M4G A;  4ND9 A;  4OHN A;  3M3F A;  3T9H B;  4LZ8 A;  2REJ A;  3S9M C;  2XD2 A;  1P1U A;  3IL1 B;  1QKB A;  4PQJ A;  1MPC A;  4TLM B;  5DEX B;  3RNN A;  5I59 B;  1R6Z A;  3CFZ A;  1M5D A;  3E4R A;  4GOT A;  3ZS6 A;  4POW A;  4IGR A;  1QVS A;  3MZB A;  4H5G A;  4EF2 A;  3TCG A;  4P0G A;  1B9J A;  1MQG A;  2UVH A;  3F11 A;  4E0W A;  4OFL A;  4N07 A;  3K2D A;  3K1N A;  3IK6 B;  4YKI A;  4QF9 A;  2PYY A;  4OQO A;  3WAE A;  2GRV A;  2PMS A;  4LQ2 A;  4ZZE A;  2H25 A;  3QUF A;  4ELP A;  5I56 A;  2QS4 A;  1B7U A;  3TYH A;  2I48 A;  4NF8 B;  4PFT A;  4WED A;  1DTG A;  3IOT A;  1JEU A;  3N5L A;  3VFJ A;  1IEJ A;  1S9T A;  3HHF A;  1VFD A;  4MLV A;  1MG1 A;  2P2A A;  3ECR A;  3B6Q A;  3UIF A;  3MVX A;  4QSE A;  4HCW A;  3KEI A;  2XXQ A;  1YCJ A;  4GFR A;  4DE8 A;  3TEP A;  3SEY A;  4ESW A;  3SEW A;  4GL0 A;  1IZ1 A;  5H8F A;  4OEN A;  3U92 A;  2F6G A;  5I2N A;  1QUI A;  4DCX A;  3EPE A;  3MP1 A;  1LAF E;  1MY1 A;  4NF5 B;  4BDO A;  1MXU A;  2RCA A;  5L8D A;  1Y3N A;  1T0K A;  2FYI A;  1MXZ A;  3KG2 A;  4KQP A;  1XVX A;  2HEU A;  1AMF A;  4F18 A;  2P1S A;  3BKI B;  2QPQ A;  4OEU A;  3TFL A;  5FHO A;  4YKJ A;  1JW1 A;  3O6G A;  1CB6 A;  3FGS A;  3E13 X;  1PDA A;  4G8N A;  4KHZ E;  2F35 A;  3CIJ A;  4X48 A;  3VXC A;  4F31 B;  2O69 A;  2RIN A;  5B7D A;  1B51 A;  1BLF A;  5EHS A;  3MWB A;  1LFI A;  1IXI A;  2I3W A;  5F7V A;  3K6V A;  3C34 A;  3FXQ A;  3DLN A;  1B2H A;  4OES A;  3MPK A;  3VVF A;  3E3K A;  3SET A;  1S50 A;  1YTV A;  1OLC A;  5K2X A;  4EQ7 A;  1JEV A;  1IXC A;  3VLW A;  3IR1 A;  3EF7 A;  4RYA A;  4GF8 A;  1PBQ A;  5CBS A;  4WEP A;  1AOV A;  4F39 A;  5ISU A;  2Y7W A;  4IO6 A;  3HCQ A;  2XXI A;  4KI0 E;  4U2R A;  3IOW A;  1F9B A;  1DTZ A;  2GFE A;  1MH4 A;  3R7X A;  3N6U A;  4HTG A;  2VP1 A;  3TAJ A;  3VDF A;  3CG3 A;  4I62 A;  4JWX A;  4NF5 A;  1B3L A;  4ZEF A;  1WDN A;  2A5T B;  4N13 A;  4YB5 A;  2DP8 A;  3OO9 A;  1LAG E;  1NNK A;  4X1B A;  5F1Q A;  4GLI A;  4IB2 A;  3S4U A;  1MDP 1;  3M3L A;  4NWC A;  5DVJ A;  1I6A A;  4KD5 A;  1LFG A;  3FVK A;  2A5T A;  3DP6 A;  4LZ5 A;  4NE4 A;  4R74 A;  1IIW A;  5TP9 A;  1DPP A;  5I59 A;  1H45 A;  3RY3 A;  1O64 A;  2E1S A;  4HW8 A;  4K3F A;  1BP5 A;  3OXN A;  1BIY A;  4BLA A;  1MQI A;  2RC7 A;  4G68 A;  3B6T A;  4H8J A;  4PP0 A;  5ITP A;  3FVN A;  1B46 A;  4RY1 A;  2V25 A;  1LB9 A;  1B3H A;  3H7M A;  2ONS A;  4YB6 A;  4YU0 A;  1GR2 A;  5EHM A;  3TCF A;  5L9O A;  1MXX A;  2X26 A;  1D4N A;  4F3G A;  1JQF A;  4G68 B;  4HS7 A;  5J1D A;  1LAX A;  2IA4 A;  3ODB A;  2OWT A;  2Z23 A;  3TTN A;  3H6V A;  1D9Y A;  2DOJ A;  4F2O A;  3FAT A;  4THI A;  1B5J A;  3O97 A;  5I84 A;  3PPN A;  3CVG A;  1B05 A;  3IB1 A;  2RCB A;  1B5I A;  2HAU A;  1FTJ A;  3JYR A;  4H65 A;  2XXR A;  3ONM A;  3RPW A;  2XX9 A;  3TQW A;  2KLF A;  3S9L C;  3PV0 E;  1XS5 A;  2DXY A;  1MH3 A;  1SVX B;  1ZMG A;  3FJ7 A;  4ZEI A;  5M2V A;  1FQB A;  3K6X A;  3RLF E;  1MY4 A;  3UGW A;  5AA4 A;  3SES A;  5KDT A;  1Y4T A;  2VGQ A;  4ZS9 A;  4IO3 A;  3QYT A;  1URS A;  2QL3 A;  3CRB A;  4JXI A;  4AQ4 A;  4EXK A;  1OLA A;  1DMB A;  2Q89 A;  4Q5T A;  1FW0 A;  1FQC A;  2PVU A;  2ZYN A;  3CG1 A;  5H8Q A;  3K6W A;  4OER A;  1B3F A;  3TTK A;  1VR5 A;  2DVC A;  2GH9 A;  1B5H A;  3GLB A;  1Y1M A;  2QS1 A;  3OSR A;  5JK4 A;  5CM6 A;  1PEB A;  4XKP A;  1LCT A;  1N3W A;  2HFB A;  3MJN A;  4MLQ A;  5KCJ B;  2PBW A;  2FNC A;  3S2V A;  2F8D A;  4AB6 A;  1S7Y A;  2R9J A;  4C1T A;  1B4H A;  4PFU A;  5I57 A;  3IJO B;  4NF8 A;  1POT A;  4H5F A;  1N76 A;  3MP8 A;  1B6H A;  4ZDM A;  2HCA A;  2IEE A;  3HHG A;  4JWO A;  5AE4 A;  2Z8F A;  4R6K A;  4ELR A;  1VFE A;  3KGC A;  1FCK A;  3IX1 A;  3KJT A;  3KN8 A;  4EF1 A;  5KZT A;  3K6U A;  1HSJ A;  3IOR A;  3K1M A;  3MQ9 A;  4GD5 A;  4L17 A;  4QRZ A;  4XTC Q;  3RT6 B;  4F3B A;  4PE5 B;  1B40 A;  1BTJ A;  2O84 X;  4R6Y A;  2ZYK A;  3SEU A;  3S9E A;  3BBR A;  4FAJ A;  4H8I A;  2D3I A;  1SBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...