4H5JA

Crystal structure of the guanine nucleotide exchange factor sec12 (p64 form)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
343
structure length
343
Chain Sequence
KFVTASYNVGYPAYGAKFLNNDTLLVAGGGGEGNNGIPNKLTVLRVDPTKDTEKEQFHILSEFALEDNDDSPTAIDASKGIILVGCNENSTKITQGKGNKHLRKFKYDKVNDQLEFLTSVDFDASTNADDYTKLVYISREGTVAAIASSKVPAIMRIIDPSDLTEKFEIETRGEVKDLHFSTDGKVVAYITGSSLEVISTVTGSCIARKTDFDKNWSLSKINFIADDTVLIAASLKKGKGIVLTKISIKSGNTSVLRSKQVTNRFKGITSMDVDMKGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNYAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-exchange factor SEC12
publication title The structure of sec12 implicates potassium ion coordination in sar1 activation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 83
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4h5jA00
2AH0A 3W15A 1S4UX 4X60B 4O3UB 2OVQB 5EM2B 4J84A 3FGBA 3PXSD 2O9KA 1B9YA 4E5ZB 3UVLA 1JOFA 2YNNA 1MDAH 2BBKH 2UZXB 3MZKA 4FAVD 5GSAA 1GG2B 4X3EA 2YNPA 5FKQA 5EALA 3DWLC 3VH0A 4K3JB 1RI6A 2AGXA 3CIKB 5I5MA 4Y7RA 3ULEC 1SHYB 2Z2NA 5TF2A 2AH1A 3EI3B 2Z2OA 3JB9L 2P9SC 2YNOA 3DM0A 3RN0D 4L1QD 2J56H 1ERJA 3VA6A 3IIWA 4QT8A 4E54B 3OL2A 3L4MD 5FQDA 1TBGA 3SHFA 3F3GA 4XEIC 5CXCB 4A11A 5K1CC 1K32A 3UVMA 4JXMA 4ERYA 3SFZA 2XU7A 2H9MA 4U7AA 2PBIB 1NR0A 3EI2A 3EI3A 4A2LA 2H6QA 5FLXg 3EU7A 2PM6B 4A09B 5SXMA 4FHLA 2HXCA 4CI3A 1K8KC 2G99A 3F3PA 4ESGA 2CO0C 4D0KA 4LGNA 4ZN4A 3CFVA 3I89A 3SWSD 3PXTD 1JMXB 4LG8A 4ERZA 1NEXB 4X61B 4CY2A 4J0XA 4L3GD 4QRJA 3JROA 3SLED 2Z2PA 4J87A 4CZXA 4O3TB 3IJCA 4JD2C 3UKRC 4JT5C 1N6FA 4XYIA 1GXRA 2B5MA 3OKTA 2H68A 3PE7A 3DXMC 1FWXA 4ZOVA 5JWZA 4J79A 2HKRA 2H3XA 3N0EA 4PSWB 4ZOYA 2HYEA 3MXXA 2I0TA 1MG3A 4OWRA 5I5JA 5C2VB 2H6NA 2QC5A 5KDOB 3UVOA 3C5MA 4Z8LA 5FKRA 5EMLB 5TEEA 3SXTD 2QXVA 4J86A 1OLZA 5IJ8E 1JJUB 4XYHA 2CN2A 2I3TA 3V7DB 4FB1D 4J81A 3I8CA 4H5IA 4BH6A 3KRXB 4BUJC 5IGQA 1B9XA 4CY5A 2P9UC 1Q47A 4KFMB 4J0WA 1OMWB 1N6EA 3UKUC 3U4YA 4H5JA 3E0CA 1MG2A 4A7JA 2HJ4A 3OL2B 3I7KA 4A11B 3JRPA 4JSXC 1TYQC 4J77A 3NVXA 3JZGA 2AGLA 4O1QD 4D6VA 3I8EA 4L9OA 2YB8B 3MZLA 3KRWB 3RN1D 3I7PA 4CY1A 2TRCB 3EI2B 3EG6A 4FA9D 3I2NA 4PBYA 5EAPA 2IUPA 3RFGA 4GGAA 2UZYB 3AL8A 2I3SA 3ODTA 3SMRA 3EWEA 3OKYA 5HE0B 3SBRA 2H9LA 5AJAA 4AEZA 2MTAH 5HE3B 2G9AA 3DXKC 4ERQA 3NVQA 5C2WB 5TDHB 4GGCA 4LG9A 4CI1A 2CNXA 3EI4A 3L4OD 5EMMB 3PSCB 2HESX 2CN3A 4N14A 2W18A 4A2MA 2GC7A 2IURA 3I7OA 4A0AA 1PGUA 1U2VC 4A0BA 4PNKB 3JZNA 2PM9A 3P4FA 1PEVA 3OTTA 3BWSA 3EMHA 5TEFA 2GNQA 3IIYA 4PC0A 3JPXA 5HE2B 3JAMg 4ZOZA 3OKWA 3K26A 4X63B 3AFCA 4O9DA 2H14A 1N6DA 4HDJA 3RRMC 4AOWA 5EARA 1P22A 4IA9A 5EMJB 3F3FA 3B7FA 4GQ1A 4FA4D 2IUVA 5IC7A 5AFU3 3C9CA 1SQJA 2J57G 3SBQA 3ZWLB 4PXWA 3UR4A 5H14A 2HJBA 4UI9R 2IUQA 5CXBA 3FM0A 2H6KA 2YMUA 3MKQA 4JSVC 3EI1A 3N0DA 3J80g 4I79A 4PBZA 4O45A 4A08A 4J73A 5H17A 3PVWB 5CYKA 2I0RA 4CZVA 5A2Qg 2H9PA 3RMZD 4JSPC 3IKOA 5GXHA 5AMSA 4GQ2P 1XHMA 4NSXA 4CI2A 2GC4A 3PVUB 1U4CA 3CFSB 3IJ0A 5HE1B 4QL1A 5FXYA 4J78A 3AL8B 3I7HA 2H47A 2EBSA 4U1EI 3SVWD 4GMBA 3OKYB 3UVNA 4J8BA 3FRXA 3OW8A 2H13A 2P9LC 2XYIA 3BG0A 1QNIA 5HQGA 4EWRA 4K3ID 3BG1A 1GOTB 3EI4B 4CI8A 3GFCA 5EAMA 2CE8A 2J55H 5EM2A 2AGWA 4E5ZA 5FKTA 1VYHC 5GXIA 3C75H 4A0AB 1A0RB 4FA5D 4A0BB 5H1MA 2IWFA 3V5WB 2OK6A 3PSLA 2PM9B 2BCJB 1JMZB 4CZYA 3NVNA 1GP2B 3MKSB 4JSNC 3JZHA 5I5IA 2CO0A 2XL3A 2P9PC 3PXWD 3RLMD 3SJLD 4GM3A 2B5LA 2OJYA 2OIZA 2Q7QA 3AL9A 4IMMA 4TZ4A 1PI6A 2AQ5A 2OVPB 2P9NC 3J81g 5THAA 4G56B 2P9KC 4ZOXA 2HKMA 2OK4A 3K27A 1XKSA 4E54A 2B4EA 3IJ1A 5CXCA 2B5NA 3GREA 4CY3A 3I7NA 4R7AB 3DSMA 5C9ZB 2IWKA 2YBAA 3HFQA 4GQBB 4CC9A 4FA1D 4J8GA 5CXBB 2IAAA 1SQ9A 5IJ7E 4FWWA 3EI1B 4A09A 3ORVD 3RFHA 4L3HD 3UVKA 5FA5B 4GM8A 4A08B 4BL0A 1L0QA 4GM9A 3SBPA 1R5MA 5CYKB 3A0FA 2P9IC 2XL2A 5K19A 4YVDA 2OVRB 2AGYA 4GGDA 1XIPA 2PM7B 5GMKn 3VGZA 3C99A 4ES0A 4J82A 5FKSA 4FAND 3SCYA 4GZ8A 1PBYB 4MK0B 3RSEC 4QQEA 2I0SA 3SN6B 3MMYA 1YFQA 5IGOA 5IT9g 3I7LA 4PSXB 5HYNB 3V9FA 5B4WA 3AH8B 4OZUA 2AGZA 2H9NA 2CE9A 4Y5RD 4JT6C 5EMKB
chains in the Genus database with same CATH superfamily
2AH0A 3W15A 3NIDA 1S4UX 4X60B 4O3UB 2OVQB 5EM2B 4J84A 3FGBA 3PXSD 2O9KA 1B9YA 4E5ZB 3UVLA 1JOFA 2YNNA 1MDAH 3IUNA 4NENA 4IRZA 2BBKH 2UZXB 4AMYA 3MZKA 4FAVD 1VZ2A 1GG2B 5GSAA 4X3EA 2YNPA 3FCSA 5EALA 1JTDB 5FKQA 3DWLC 3VH0A 1O6GA 1QFSA 4K3JB 2HU7A 1RI6A 2AGXA 3CIKB 3T3PA 5I5MA 5M5UA 4Y7RA 3ULEC 1SHYB 2Z2NA 5TF2A 2AH1A 3K72A 3EI3B 2Z2OA 2EICA 3JB9L 2P9SC 2YNOA 3DM0A 3RN0D 4L1QD 2J56H 1ERJA 4O02A 3VA6A 3IIWA 4QT8A 4E54B 3OL2A 3L4MD 5FQDA 1TBGA 3SHFA 3F3GA 4XEIC 5CXCB 4A11A 5K1CC 1K32A 4BP9A 3UVMA 4JXMA 4ERYA 3SFZA 4Z7QA 3IVMA 2XU7A 5FFGA 2H9MA 4U7AA 2PBIB 1NR0A 3EI2A 3EI3A 2JKXA 4A2LA 2H6QA 5FLXg 2VDOA 3EU7A 2PM6B 3ZE1A 4JHPC 2QR5A 5SXMA 4A09B 4FHLA 1H2WA 2HXCA 4CI3A 1K8KC 2G99A 3F3PA 4ESGA 5M5RA 1O6FA 2CO0C 4D0KA 4LGNA 4ZN4A 1QFMA 3CFVA 3I89A 3SWSD 3PXTD 2VDMA 3IJEA 1JMXB 4LG8A 4ERZA 1NEXB 2XDWA 4X61B 4CY2A 4J0XA 4L3GD 1E5TA 4QRJA 3JROA 4AX4A 1U8CA 3O4HA 3SLED 4DNUA 5M61A 2Z2PA 4J87A 3EQ8A 4O3TB 4CZXA 3IJCA 4JD2C 3UKRC 4JT5C 1N6FA 4XYIA 3MVDK 1GXRA 2B5MA 3OKTA 2H68A 1E8MA 3PE7A 3NIFA 3DXMC 1FWXA 1T2XA 4ZOVA 5JWZA 4J79A 2HKRA 1UTCA 2H3XA 3N0EA 4PSWB 4ZOYA 2HYEA 3MXXA 2VC2A 2I0TA 3O4IA 1E8NA 1MG3A 1UOOA 4OWRA 1BPOA 5I5JA 5C2VB 2H6NA 2QC5A 5M5VA 5KDOB 2XZGA 1C9IA 3UVOA 3C5MA 3IUJA 4Z8LA 5EMLB 5FKRA 5TEEA 3SXTD 2QXVA 4J86A 3KCIA 1OLZA 5IJ8E 1JJUB 4XYHA 2CN2A 3EQ7A 4UM9A 2I3TA 3V7DB 4FB1D 4J81A 3I8CA 4H5IA 2VDNA 3KRXB 4BH6A 4BUJC 5IGQA 1B9XA 4CY5A 2P9UC 4G55A 1Q47A 4KFMB 4J0WA 1OMWB 1N6EA 3UKUC 3IULA 5HDBA 3U4YA 3QHYB 5FFOA 4H5JA 3E0CA 3QI0A 1MG2A 4A7JA 3MUNA 2HJ4A 1UOPA 3EQ9A 3OL2B 3I7KA 4A11B 4BP8A 3JRPA 4JSXC 1TYQC 4J77A 3VI3A 1TYEA 3NVXA 3ZE0A 3JZGA 4WK2A 1A12A 2AGLA 4O1QD 4D6VA 2HU8A 3I8EA 1GOFA 4L9OA 2YB8B 3MZLA 3KRWB 1VE7A 3RN1D 3I7PA 4CY1A 2TRCB 3EI2B 3EG6A 4FA9D 3I2NA 4PBYA 5EAPA 2IUPA 3RFGA 4GGAA 2UZYB 5M5TA 2VDLA 3AL8A 2QZPA 2I3SA 3ODTA 3SMRA 3EWEA 3OKYA 5HE0B 3SBRA 2H9LA 5AJAA 4AEZA 5C92A 2MTAH 3ZE2A 5HE3B 2G9AA 2VDQA 3DXKC 4ERQA 3NVQA 3VI4A 5C2WB 4Z7NA 5TDHB 4GGCA 4LG9A 4MMXA 4G1MA 4DNVA 2CNXA 4CI1A 4NC4A 3EI4A 3L4OD 2EIEA 1VE6A 5EMMB 3PSCB 2HESX 2CN3A 4N14A 3K6SA 2W18A 4A2MA 2GC7A 2IURA 3I7OA 4A0AA 1PGUA 1U2VC 4A0BA 4PNKB 1L5GA 3JZNA 2PM9A 3OF7A 3P4FA 1PEVA 3OTTA 3BWSA 3EMHA 5TEFA 4MMZA 2GNQA 3IIYA 4PC0A 3JPXA 5HE2B 3JAMg 4ZOZA 3OKWA 3K26A 4X63B 3AFCA 4O9DA 2H14A 1N6DA 4HDJA 3RRMC 4AOWA 5EARA 1P22A 2VDKA 3K71A 1C9LA 4IA9A 2VDRA 5EMJB 3F3FA 3B7FA 4G1EA 4GQ1A 2EIBA 4NBMA 1H2XA 4WJKA 4FA4D 1H2ZA 2IUVA 5IC7A 5AFU3 2EIDA 2VZ3A 3C9CA 1SQJA 2J57G 3SBQA 3ZWLB 4AN0A 4PXWA 2BKLA 5E6RA 4O2WA 3UR4A 1I2MB 5H14A 3GD1I 2VZ1A 2HJBA 4UI9R 2IUQA 2VDPA 5CXBA 4QAMA 3FM0A 4UM8A 2H6KA 2YMUA 3MKQA 3NIGA 4L1MA 4JSVC 3EI1A 1UOQA 4RE6A 1VZ3A 3N0DA 3J80g 4I79A 4PBZA 4O45A 4A08A 4J73A 4WK0A 5H17A 3O4JA 3PVWB 1YR2A 5CYKA 2I0RA 4Z7OA 4CZVA 5A2Qg 2H9PA 3RMZD 4DNWA 4JSPC 3IKOA 2HU5A 5GXHA 5AMSA 4GQ2P 1XHMA 4NSXA 4CI2A 2GC4A 3PVUB 1U4CA 3CFSB 3IJ0A 5HE1B 4QL1A 3DDUA 4J78A 5FXYA 3ZDXA 3AL8B 3I7HA 3GC3B 2H47A 2EBSA 4U1EI 3SVWD 4GMBA 3OKYB 3UVNA 4J8BA 3FRXA 3OW8A 2H13A 2P9LC 2XYIA 3BG0A 1QNIA 5HQGA 1K3IA 4EWRA 3IURA 4K3ID 3BG1A 1GOTB 3EI4B 4CI8A 1JV2A 3GFCA 5EAMA 4D9SA 2CE8A 2J55H 3V4PA 4NAAA 2AGWA 2WQ8A 5EM2A 4E5ZA 5FKTA 1VYHC 3ZDZA 5GXIA 1H2YA 3C75H 4A0AB 5M5SA 1A0RB 4FA5D 3MUOA 5H1MA 2IWFA 3V5WB 3ZDYA 2OK6A 3PSLA 4A0BB 2PM9B 4WK4A 2BCJB 1JMZB 4CZYA 3NVNA 1GP2B 3MKSB 4JSNC 3JZHA 5I5IA 2CO0A 2XL3A 2P9PC 3PXWD 2XE4A 3RLMD 3SJLD 4GM3A 3T3MA 2B5LA 2OJYA 3V4VA 2OIZA 3FCUA 2Q7QA 3AL9A 4IMMA 4TZ4A 1PI6A 2AQ5A 2OVPB 2P9NC 4JHNA 3J81g 5THAA 4G56B 2P9KC 4AN1A 4ZOXA 2HKMA 2OK4A 3K27A 1XKSA 5E6UA 2B4EA 4E54A 3IJ1A 1GOHA 4RE5A 5CXCA 2B5NA 4AMZA 3GREA 4CY3A 3I7NA 4R7AB 3DSMA 5C9ZB 2IWKA 2YBAA 4MMYA 3HFQA 4GQBB 4CC9A 4FA1D 4J8GA 5CXBB 2IAAA 1SQ9A 5IJ7E 4FWWA 3EI1B 4A09A 3ORVD 3RFHA 4L3HD 3UVKA 5FA5B 4GM8A 4A08B 4BL0A 1L0QA 4GM9A 3SBPA 1R5MA 5CYKB 1M1XA 5E6SA 3A0FA 2P9IC 2XL2A 5K19A 4YVDA 2OVRB 2AGYA 4GGDA 1XIPA 2PM7B 5GMKn 3VGZA 3C99A 3IUMA 3O4GA 4ES0A 4BCDA 4J82A 5FKSA 4FAND 3SCYA 4GZ8A 1PBYB 1GOGA 4MK0B 3RSEC 4QQEA 2I0SA 3SN6B 5C86A 3MMYA 1YFQA 5IGOA 5IT9g 3I7LA 4PSXB 5HYNB 3V9FA 4BCBA 5B4WA 4BCCA 3AH8B 4OZUA 2AGZA 2H9NA 2CE9A 4Y5RD 3IUQA 4JT6C 5EMKB
chains in the Genus database with same CATH topology
2AH0A 3W15A 1S4UX 4X60B 4O3UB 2OVQB 5EM2B 4J84A 3FGBA 3PXSD 2O9KA 1B9YA 4E5ZB 3UVLA 1JOFA 2YNNA 1MDAH 2BBKH 2UZXB 3MZKA 4FAVD 5GSAA 1GG2B 4X3EA 2YNPA 5FKQA 5EALA 3DWLC 3VH0A 4K3JB 1RI6A 2AGXA 3CIKB 5I5MA 4Y7RA 3ULEC 1SHYB 2Z2NA 5TF2A 2AH1A 3EI3B 2Z2OA 3JB9L 2P9SC 2YNOA 3DM0A 3RN0D 4L1QD 2J56H 1ERJA 3VA6A 3IIWA 4QT8A 4E54B 3OL2A 3L4MD 5FQDA 1TBGA 3SHFA 3F3GA 4XEIC 5CXCB 4A11A 5K1CC 1K32A 3UVMA 4JXMA 4ERYA 3SFZA 2XU7A 2H9MA 4U7AA 2PBIB 1NR0A 3EI2A 3EI3A 4A2LA 2H6QA 5FLXg 3EU7A 2PM6B 4A09B 5SXMA 4FHLA 2HXCA 4CI3A 1K8KC 2G99A 3F3PA 4ESGA 2CO0C 4D0KA 4LGNA 4ZN4A 3CFVA 3I89A 3SWSD 3PXTD 1JMXB 4LG8A 4ERZA 1NEXB 4X61B 4CY2A 4J0XA 4L3GD 4QRJA 3JROA 3SLED 2Z2PA 4J87A 4CZXA 4O3TB 3IJCA 4JD2C 3UKRC 4JT5C 1N6FA 4XYIA 1GXRA 2B5MA 3OKTA 2H68A 3PE7A 3DXMC 1FWXA 4ZOVA 5JWZA 4J79A 2HKRA 2H3XA 3N0EA 4PSWB 4ZOYA 2HYEA 3MXXA 2I0TA 1MG3A 4OWRA 5I5JA 5C2VB 2H6NA 2QC5A 5KDOB 3UVOA 3C5MA 4Z8LA 5FKRA 5EMLB 5TEEA 3SXTD 2QXVA 4J86A 1OLZA 5IJ8E 1JJUB 4XYHA 2CN2A 2I3TA 3V7DB 4FB1D 4J81A 3I8CA 4H5IA 4BH6A 3KRXB 4BUJC 5IGQA 1B9XA 4CY5A 2P9UC 1Q47A 4KFMB 4J0WA 1OMWB 1N6EA 3UKUC 3U4YA 4H5JA 3E0CA 1MG2A 4A7JA 2HJ4A 3OL2B 3I7KA 4A11B 3JRPA 4JSXC 1TYQC 4J77A 3NVXA 3JZGA 2AGLA 4O1QD 4D6VA 3I8EA 4L9OA 2YB8B 3MZLA 3KRWB 3RN1D 3I7PA 4CY1A 2TRCB 3EI2B 3EG6A 4FA9D 3I2NA 4PBYA 5EAPA 2IUPA 3RFGA 4GGAA 2UZYB 3AL8A 2I3SA 3ODTA 3SMRA 3EWEA 3OKYA 5HE0B 3SBRA 2H9LA 5AJAA 4AEZA 2MTAH 5HE3B 2G9AA 3DXKC 4ERQA 3NVQA 5C2WB 5TDHB 4GGCA 4LG9A 4CI1A 2CNXA 3EI4A 3L4OD 5EMMB 3PSCB 2HESX 2CN3A 4N14A 2W18A 4A2MA 2GC7A 2IURA 3I7OA 4A0AA 1PGUA 1U2VC 4A0BA 4PNKB 3JZNA 2PM9A 3P4FA 1PEVA 3OTTA 3BWSA 3EMHA 5TEFA 2GNQA 3IIYA 4PC0A 3JPXA 5HE2B 3JAMg 4ZOZA 3OKWA 3K26A 4X63B 3AFCA 4O9DA 2H14A 1N6DA 4HDJA 3RRMC 4AOWA 5EARA 1P22A 4IA9A 5EMJB 3F3FA 3B7FA 4GQ1A 4FA4D 2IUVA 5IC7A 5AFU3 3C9CA 1SQJA 2J57G 3SBQA 3ZWLB 4PXWA 3UR4A 5H14A 2HJBA 4UI9R 2IUQA 5CXBA 3FM0A 2H6KA 2YMUA 3MKQA 4JSVC 3EI1A 3N0DA 3J80g 4I79A 4PBZA 4O45A 4A08A 4J73A 5H17A 3PVWB 5CYKA 2I0RA 4CZVA 5A2Qg 2H9PA 3RMZD 4JSPC 3IKOA 5GXHA 5AMSA 4GQ2P 1XHMA 4NSXA 4CI2A 2GC4A 3PVUB 1U4CA 3CFSB 3IJ0A 5HE1B 4QL1A 5FXYA 4J78A 3AL8B 3I7HA 2H47A 2EBSA 4U1EI 3SVWD 4GMBA 3OKYB 3UVNA 4J8BA 3FRXA 3OW8A 2H13A 2P9LC 2XYIA 3BG0A 1QNIA 5HQGA 4EWRA 4K3ID 3BG1A 1GOTB 3EI4B 4CI8A 3GFCA 5EAMA 2CE8A 2J55H 5EM2A 2AGWA 4E5ZA 5FKTA 1VYHC 5GXIA 3C75H 4A0AB 1A0RB 4FA5D 4A0BB 5H1MA 2IWFA 3V5WB 2OK6A 3PSLA 2PM9B 2BCJB 1JMZB 4CZYA 3NVNA 1GP2B 3MKSB 4JSNC 3JZHA 5I5IA 2CO0A 2XL3A 2P9PC 3PXWD 3RLMD 3SJLD 4GM3A 2B5LA 2OJYA 2OIZA 2Q7QA 3AL9A 4IMMA 4TZ4A 1PI6A 2AQ5A 2OVPB 2P9NC 3J81g 5THAA 4G56B 2P9KC 4ZOXA 2HKMA 2OK4A 3K27A 1XKSA 4E54A 2B4EA 3IJ1A 5CXCA 2B5NA 3GREA 4CY3A 3I7NA 4R7AB 3DSMA 5C9ZB 2IWKA 2YBAA 3HFQA 4GQBB 4CC9A 4FA1D 4J8GA 5CXBB 2IAAA 1SQ9A 5IJ7E 4FWWA 3EI1B 4A09A 3ORVD 3RFHA 4L3HD 3UVKA 5FA5B 4GM8A 4A08B 4BL0A 1L0QA 4GM9A 3SBPA 1R5MA 5CYKB 3A0FA 2P9IC 2XL2A 5K19A 4YVDA 2OVRB 2AGYA 4GGDA 1XIPA 2PM7B 5GMKn 3VGZA 3C99A 4ES0A 4J82A 5FKSA 4FAND 3SCYA 4GZ8A 1PBYB 4MK0B 3RSEC 4QQEA 2I0SA 3SN6B 3MMYA 1YFQA 5IGOA 5IT9g 3I7LA 4PSXB 5HYNB 3V9FA 5B4WA 3AH8B 4OZUA 2AGZA 2H9NA 2CE9A 4Y5RD 4JT6C 5EMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH0 A;  3W15 A;  1S4U X;  4X60 B;  4O3U B;  2OVQ B;  5EM2 B;  4J84 A;  3FGB A;  3PXS D;  2O9K A;  1B9Y A;  4E5Z B;  3UVL A;  1JOF A;  2YNN A;  1MDA H;  2BBK H;  2UZX B;  3MZK A;  4FAV D;  5GSA A;  1GG2 B;  4X3E A;  2YNP A;  5FKQ A;  5EAL A;  3DWL C;  3VH0 A;  4K3J B;  1RI6 A;  2AGX A;  3CIK B;  5I5M A;  4Y7R A;  3ULE C;  1SHY B;  2Z2N A;  5TF2 A;  2AH1 A;  3EI3 B;  2Z2O A;  3JB9 L;  2P9S C;  2YNO A;  3DM0 A;  3RN0 D;  4L1Q D;  2J56 H;  1ERJ A;  3VA6 A;  3IIW A;  4QT8 A;  4E54 B;  3OL2 A;  3L4M D;  5FQD A;  1TBG A;  3SHF A;  3F3G A;  4XEI C;  5CXC B;  4A11 A;  5K1C C;  1K32 A;  3UVM A;  4JXM A;  4ERY A;  3SFZ A;  2XU7 A;  2H9M A;  4U7A A;  2PBI B;  1NR0 A;  3EI2 A;  3EI3 A;  4A2L A;  2H6Q A;  5FLX g;  3EU7 A;  2PM6 B;  4A09 B;  5SXM A;  4FHL A;  2HXC A;  4CI3 A;  1K8K C;  2G99 A;  3F3P A;  4ESG A;  2CO0 C;  4D0K A;  4LGN A;  4ZN4 A;  3CFV A;  3I89 A;  3SWS D;  3PXT D;  1JMX B;  4LG8 A;  4ERZ A;  1NEX B;  4X61 B;  4CY2 A;  4J0X A;  4L3G D;  4QRJ A;  3JRO A;  3SLE D;  2Z2P A;  4J87 A;  4CZX A;  4O3T B;  3IJC A;  4JD2 C;  3UKR C;  4JT5 C;  1N6F A;  4XYI A;  1GXR A;  2B5M A;  3OKT A;  2H68 A;  3PE7 A;  3DXM C;  1FWX A;  4ZOV A;  5JWZ A;  4J79 A;  2HKR A;  2H3X A;  3N0E A;  4PSW B;  4ZOY A;  2HYE A;  3MXX A;  2I0T A;  1MG3 A;  4OWR A;  5I5J A;  5C2V B;  2H6N A;  2QC5 A;  5KDO B;  3UVO A;  3C5M A;  4Z8L A;  5FKR A;  5EML B;  5TEE A;  3SXT D;  2QXV A;  4J86 A;  1OLZ A;  5IJ8 E;  1JJU B;  4XYH A;  2CN2 A;  2I3T A;  3V7D B;  4FB1 D;  4J81 A;  3I8C A;  4H5I A;  4BH6 A;  3KRX B;  4BUJ C;  5IGQ A;  1B9X A;  4CY5 A;  2P9U C;  1Q47 A;  4KFM B;  4J0W A;  1OMW B;  1N6E A;  3UKU C;  3U4Y A;  4H5J A;  3E0C A;  1MG2 A;  4A7J A;  2HJ4 A;  3OL2 B;  3I7K A;  4A11 B;  3JRP A;  4JSX C;  1TYQ C;  4J77 A;  3NVX A;  3JZG A;  2AGL A;  4O1Q D;  4D6V A;  3I8E A;  4L9O A;  2YB8 B;  3MZL A;  3KRW B;  3RN1 D;  3I7P A;  4CY1 A;  2TRC B;  3EI2 B;  3EG6 A;  4FA9 D;  3I2N A;  4PBY A;  5EAP A;  2IUP A;  3RFG A;  4GGA A;  2UZY B;  3AL8 A;  2I3S A;  3ODT A;  3SMR A;  3EWE A;  3OKY A;  5HE0 B;  3SBR A;  2H9L A;  5AJA A;  4AEZ A;  2MTA H;  5HE3 B;  2G9A A;  3DXK C;  4ERQ A;  3NVQ A;  5C2W B;  5TDH B;  4GGC A;  4LG9 A;  4CI1 A;  2CNX A;  3EI4 A;  3L4O D;  5EMM B;  3PSC B;  2HES X;  2CN3 A;  4N14 A;  2W18 A;  4A2M A;  2GC7 A;  2IUR A;  3I7O A;  4A0A A;  1PGU A;  1U2V C;  4A0B A;  4PNK B;  3JZN A;  2PM9 A;  3P4F A;  1PEV A;  3OTT A;  3BWS A;  3EMH A;  5TEF A;  2GNQ A;  3IIY A;  4PC0 A;  3JPX A;  5HE2 B;  3JAM g;  4ZOZ A;  3OKW A;  3K26 A;  4X63 B;  3AFC A;  4O9D A;  2H14 A;  1N6D A;  4HDJ A;  3RRM C;  4AOW A;  5EAR A;  1P22 A;  4IA9 A;  5EMJ B;  3F3F A;  3B7F A;  4GQ1 A;  4FA4 D;  2IUV A;  5IC7 A;  5AFU 3;  3C9C A;  1SQJ A;  2J57 G;  3SBQ A;  3ZWL B;  4PXW A;  3UR4 A;  5H14 A;  2HJB A;  4UI9 R;  2IUQ A;  5CXB A;  3FM0 A;  2H6K A;  2YMU A;  3MKQ A;  4JSV C;  3EI1 A;  3N0D A;  3J80 g;  4I79 A;  4PBZ A;  4O45 A;  4A08 A;  4J73 A;  5H17 A;  3PVW B;  5CYK A;  2I0R A;  4CZV A;  5A2Q g;  2H9P A;  3RMZ D;  4JSP C;  3IKO A;  5GXH A;  5AMS A;  4GQ2 P;  1XHM A;  4NSX A;  4CI2 A;  2GC4 A;  3PVU B;  1U4C A;  3CFS B;  3IJ0 A;  5HE1 B;  4QL1 A;  5FXY A;  4J78 A;  3AL8 B;  3I7H A;  2H47 A;  2EBS A;  4U1E I;  3SVW D;  4GMB A;  3OKY B;  3UVN A;  4J8B A;  3FRX A;  3OW8 A;  2H13 A;  2P9L C;  2XYI A;  3BG0 A;  1QNI A;  5HQG A;  4EWR A;  4K3I D;  3BG1 A;  1GOT B;  3EI4 B;  4CI8 A;  3GFC A;  5EAM A;  2CE8 A;  2J55 H;  5EM2 A;  2AGW A;  4E5Z A;  5FKT A;  1VYH C;  5GXI A;  3C75 H;  4A0A B;  1A0R B;  4FA5 D;  4A0B B;  5H1M A;  2IWF A;  3V5W B;  2OK6 A;  3PSL A;  2PM9 B;  2BCJ B;  1JMZ B;  4CZY A;  3NVN A;  1GP2 B;  3MKS B;  4JSN C;  3JZH A;  5I5I A;  2CO0 A;  2XL3 A;  2P9P C;  3PXW D;  3RLM D;  3SJL D;  4GM3 A;  2B5L A;  2OJY A;  2OIZ A;  2Q7Q A;  3AL9 A;  4IMM A;  4TZ4 A;  1PI6 A;  2AQ5 A;  2OVP B;  2P9N C;  3J81 g;  5THA A;  4G56 B;  2P9K C;  4ZOX A;  2HKM A;  2OK4 A;  3K27 A;  1XKS A;  4E54 A;  2B4E A;  3IJ1 A;  5CXC A;  2B5N A;  3GRE A;  4CY3 A;  3I7N A;  4R7A B;  3DSM A;  5C9Z B;  2IWK A;  2YBA A;  3HFQ A;  4GQB B;  4CC9 A;  4FA1 D;  4J8G A;  5CXB B;  2IAA A;  1SQ9 A;  5IJ7 E;  4FWW A;  3EI1 B;  4A09 A;  3ORV D;  3RFH A;  4L3H D;  3UVK A;  5FA5 B;  4GM8 A;  4A08 B;  4BL0 A;  1L0Q A;  4GM9 A;  3SBP A;  1R5M A;  5CYK B;  3A0F A;  2P9I C;  2XL2 A;  5K19 A;  4YVD A;  2OVR B;  2AGY A;  4GGD A;  1XIP A;  2PM7 B;  5GMK n;  3VGZ A;  3C99 A;  4ES0 A;  4J82 A;  5FKS A;  4FAN D;  3SCY A;  4GZ8 A;  1PBY B;  4MK0 B;  3RSE C;  4QQE A;  2I0S A;  3SN6 B;  3MMY A;  1YFQ A;  5IGO A;  5IT9 g;  3I7L A;  4PSX B;  5HYN B;  3V9F A;  5B4W A;  3AH8 B;  4OZU A;  2AGZ A;  2H9N A;  2CE9 A;  4Y5R D;  4JT6 C;  5EMK B; 
#chains in the Genus database with same CATH topology
 2AH0 A;  3W15 A;  3NID A;  1S4U X;  4X60 B;  4O3U B;  2OVQ B;  5EM2 B;  4J84 A;  3FGB A;  3PXS D;  2O9K A;  1B9Y A;  4E5Z B;  3UVL A;  1JOF A;  2YNN A;  1MDA H;  3IUN A;  4NEN A;  4IRZ A;  2BBK H;  2UZX B;  4AMY A;  3MZK A;  4FAV D;  1VZ2 A;  1GG2 B;  5GSA A;  4X3E A;  2YNP A;  3FCS A;  5EAL A;  1JTD B;  5FKQ A;  3DWL C;  3VH0 A;  1O6G A;  1QFS A;  4K3J B;  2HU7 A;  1RI6 A;  2AGX A;  3CIK B;  3T3P A;  5I5M A;  5M5U A;  4Y7R A;  3ULE C;  1SHY B;  2Z2N A;  5TF2 A;  2AH1 A;  3K72 A;  3EI3 B;  2Z2O A;  2EIC A;  3JB9 L;  2P9S C;  2YNO A;  3DM0 A;  3RN0 D;  4L1Q D;  2J56 H;  1ERJ A;  4O02 A;  3VA6 A;  3IIW A;  4QT8 A;  4E54 B;  3OL2 A;  3L4M D;  5FQD A;  1TBG A;  3SHF A;  3F3G A;  4XEI C;  5CXC B;  4A11 A;  5K1C C;  1K32 A;  4BP9 A;  3UVM A;  4JXM A;  4ERY A;  3SFZ A;  4Z7Q A;  3IVM A;  2XU7 A;  5FFG A;  2H9M A;  4U7A A;  2PBI B;  1NR0 A;  3EI2 A;  3EI3 A;  2JKX A;  4A2L A;  2H6Q A;  5FLX g;  2VDO A;  3EU7 A;  2PM6 B;  3ZE1 A;  4JHP C;  2QR5 A;  5SXM A;  4A09 B;  4FHL A;  1H2W A;  2HXC A;  4CI3 A;  1K8K C;  2G99 A;  3F3P A;  4ESG A;  5M5R A;  1O6F A;  2CO0 C;  4D0K A;  4LGN A;  4ZN4 A;  1QFM A;  3CFV A;  3I89 A;  3SWS D;  3PXT D;  2VDM A;  3IJE A;  1JMX B;  4LG8 A;  4ERZ A;  1NEX B;  2XDW A;  4X61 B;  4CY2 A;  4J0X A;  4L3G D;  1E5T A;  4QRJ A;  3JRO A;  4AX4 A;  1U8C A;  3O4H A;  3SLE D;  4DNU A;  5M61 A;  2Z2P A;  4J87 A;  3EQ8 A;  4O3T B;  4CZX A;  3IJC A;  4JD2 C;  3UKR C;  4JT5 C;  1N6F A;  4XYI A;  3MVD K;  1GXR A;  2B5M A;  3OKT A;  2H68 A;  1E8M A;  3PE7 A;  3NIF A;  3DXM C;  1FWX A;  1T2X A;  4ZOV A;  5JWZ A;  4J79 A;  2HKR A;  1UTC A;  2H3X A;  3N0E A;  4PSW B;  4ZOY A;  2HYE A;  3MXX A;  2VC2 A;  2I0T A;  3O4I A;  1E8N A;  1MG3 A;  1UOO A;  4OWR A;  1BPO A;  5I5J A;  5C2V B;  2H6N A;  2QC5 A;  5M5V A;  5KDO B;  2XZG A;  1C9I A;  3UVO A;  3C5M A;  3IUJ A;  4Z8L A;  5EML B;  5FKR A;  5TEE A;  3SXT D;  2QXV A;  4J86 A;  3KCI A;  1OLZ A;  5IJ8 E;  1JJU B;  4XYH A;  2CN2 A;  3EQ7 A;  4UM9 A;  2I3T A;  3V7D B;  4FB1 D;  4J81 A;  3I8C A;  4H5I A;  2VDN A;  3KRX B;  4BH6 A;  4BUJ C;  5IGQ A;  1B9X A;  4CY5 A;  2P9U C;  4G55 A;  1Q47 A;  4KFM B;  4J0W A;  1OMW B;  1N6E A;  3UKU C;  3IUL A;  5HDB A;  3U4Y A;  3QHY B;  5FFO A;  4H5J A;  3E0C A;  3QI0 A;  1MG2 A;  4A7J A;  3MUN A;  2HJ4 A;  1UOP A;  3EQ9 A;  3OL2 B;  3I7K A;  4A11 B;  4BP8 A;  3JRP A;  4JSX C;  1TYQ C;  4J77 A;  3VI3 A;  1TYE A;  3NVX A;  3ZE0 A;  3JZG A;  4WK2 A;  1A12 A;  2AGL A;  4O1Q D;  4D6V A;  2HU8 A;  3I8E A;  1GOF A;  4L9O A;  2YB8 B;  3MZL A;  3KRW B;  1VE7 A;  3RN1 D;  3I7P A;  4CY1 A;  2TRC B;  3EI2 B;  3EG6 A;  4FA9 D;  3I2N A;  4PBY A;  5EAP A;  2IUP A;  3RFG A;  4GGA A;  2UZY B;  5M5T A;  2VDL A;  3AL8 A;  2QZP A;  2I3S A;  3ODT A;  3SMR A;  3EWE A;  3OKY A;  5HE0 B;  3SBR A;  2H9L A;  5AJA A;  4AEZ A;  5C92 A;  2MTA H;  3ZE2 A;  5HE3 B;  2G9A A;  2VDQ A;  3DXK C;  4ERQ A;  3NVQ A;  3VI4 A;  5C2W B;  4Z7N A;  5TDH B;  4GGC A;  4LG9 A;  4MMX A;  4G1M A;  4DNV A;  2CNX A;  4CI1 A;  4NC4 A;  3EI4 A;  3L4O D;  2EIE A;  1VE6 A;  5EMM B;  3PSC B;  2HES X;  2CN3 A;  4N14 A;  3K6S A;  2W18 A;  4A2M A;  2GC7 A;  2IUR A;  3I7O A;  4A0A A;  1PGU A;  1U2V C;  4A0B A;  4PNK B;  1L5G A;  3JZN A;  2PM9 A;  3OF7 A;  3P4F A;  1PEV A;  3OTT A;  3BWS A;  3EMH A;  5TEF A;  4MMZ A;  2GNQ A;  3IIY A;  4PC0 A;  3JPX A;  5HE2 B;  3JAM g;  4ZOZ A;  3OKW A;  3K26 A;  4X63 B;  3AFC A;  4O9D A;  2H14 A;  1N6D A;  4HDJ A;  3RRM C;  4AOW A;  5EAR A;  1P22 A;  2VDK A;  3K71 A;  1C9L A;  4IA9 A;  2VDR A;  5EMJ B;  3F3F A;  3B7F A;  4G1E A;  4GQ1 A;  2EIB A;  4NBM A;  1H2X A;  4WJK A;  4FA4 D;  1H2Z A;  2IUV A;  5IC7 A;  5AFU 3;  2EID A;  2VZ3 A;  3C9C A;  1SQJ A;  2J57 G;  3SBQ A;  3ZWL B;  4AN0 A;  4PXW A;  2BKL A;  5E6R A;  4O2W A;  3UR4 A;  1I2M B;  5H14 A;  3GD1 I;  2VZ1 A;  2HJB A;  4UI9 R;  2IUQ A;  2VDP A;  5CXB A;  4QAM A;  3FM0 A;  4UM8 A;  2H6K A;  2YMU A;  3MKQ A;  3NIG A;  4L1M A;  4JSV C;  3EI1 A;  1UOQ A;  4RE6 A;  1VZ3 A;  3N0D A;  3J80 g;  4I79 A;  4PBZ A;  4O45 A;  4A08 A;  4J73 A;  4WK0 A;  5H17 A;  3O4J A;  3PVW B;  1YR2 A;  5CYK A;  2I0R A;  4Z7O A;  4CZV A;  5A2Q g;  2H9P A;  3RMZ D;  4DNW A;  4JSP C;  3IKO A;  2HU5 A;  5GXH A;  5AMS A;  4GQ2 P;  1XHM A;  4NSX A;  4CI2 A;  2GC4 A;  3PVU B;  1U4C A;  3CFS B;  3IJ0 A;  5HE1 B;  4QL1 A;  3DDU A;  4J78 A;  5FXY A;  3ZDX A;  3AL8 B;  3I7H A;  3GC3 B;  2H47 A;  2EBS A;  4U1E I;  3SVW D;  4GMB A;  3OKY B;  3UVN A;  4J8B A;  3FRX A;  3OW8 A;  2H13 A;  2P9L C;  2XYI A;  3BG0 A;  1QNI A;  5HQG A;  1K3I A;  4EWR A;  3IUR A;  4K3I D;  3BG1 A;  1GOT B;  3EI4 B;  4CI8 A;  1JV2 A;  3GFC A;  5EAM A;  4D9S A;  2CE8 A;  2J55 H;  3V4P A;  4NAA A;  2AGW A;  2WQ8 A;  5EM2 A;  4E5Z A;  5FKT A;  1VYH C;  3ZDZ A;  5GXI A;  1H2Y A;  3C75 H;  4A0A B;  5M5S A;  1A0R B;  4FA5 D;  3MUO A;  5H1M A;  2IWF A;  3V5W B;  3ZDY A;  2OK6 A;  3PSL A;  4A0B B;  2PM9 B;  4WK4 A;  2BCJ B;  1JMZ B;  4CZY A;  3NVN A;  1GP2 B;  3MKS B;  4JSN C;  3JZH A;  5I5I A;  2CO0 A;  2XL3 A;  2P9P C;  3PXW D;  2XE4 A;  3RLM D;  3SJL D;  4GM3 A;  3T3M A;  2B5L A;  2OJY A;  3V4V A;  2OIZ A;  3FCU A;  2Q7Q A;  3AL9 A;  4IMM A;  4TZ4 A;  1PI6 A;  2AQ5 A;  2OVP B;  2P9N C;  4JHN A;  3J81 g;  5THA A;  4G56 B;  2P9K C;  4AN1 A;  4ZOX A;  2HKM A;  2OK4 A;  3K27 A;  1XKS A;  5E6U A;  2B4E A;  4E54 A;  3IJ1 A;  1GOH A;  4RE5 A;  5CXC A;  2B5N A;  4AMZ A;  3GRE A;  4CY3 A;  3I7N A;  4R7A B;  3DSM A;  5C9Z B;  2IWK A;  2YBA A;  4MMY A;  3HFQ A;  4GQB B;  4CC9 A;  4FA1 D;  4J8G A;  5CXB B;  2IAA A;  1SQ9 A;  5IJ7 E;  4FWW A;  3EI1 B;  4A09 A;  3ORV D;  3RFH A;  4L3H D;  3UVK A;  5FA5 B;  4GM8 A;  4A08 B;  4BL0 A;  1L0Q A;  4GM9 A;  3SBP A;  1R5M A;  5CYK B;  1M1X A;  5E6S A;  3A0F A;  2P9I C;  2XL2 A;  5K19 A;  4YVD A;  2OVR B;  2AGY A;  4GGD A;  1XIP A;  2PM7 B;  5GMK n;  3VGZ A;  3C99 A;  3IUM A;  3O4G A;  4ES0 A;  4BCD A;  4J82 A;  5FKS A;  4FAN D;  3SCY A;  4GZ8 A;  1PBY B;  1GOG A;  4MK0 B;  3RSE C;  4QQE A;  2I0S A;  3SN6 B;  5C86 A;  3MMY A;  1YFQ A;  5IGO A;  5IT9 g;  3I7L A;  4PSX B;  5HYN B;  3V9F A;  4BCB A;  5B4W A;  4BCC A;  3AH8 B;  4OZU A;  2AGZ A;  2H9N A;  2CE9 A;  4Y5R D;  3IUQ A;  4JT6 C;  5EMK B; 
#chains in the Genus database with same CATH homology
 2AH0 A;  3W15 A;  1S4U X;  4X60 B;  4O3U B;  2OVQ B;  5EM2 B;  4J84 A;  3FGB A;  3PXS D;  2O9K A;  1B9Y A;  4E5Z B;  3UVL A;  1JOF A;  2YNN A;  1MDA H;  2BBK H;  2UZX B;  3MZK A;  4FAV D;  5GSA A;  1GG2 B;  4X3E A;  2YNP A;  5FKQ A;  5EAL A;  3DWL C;  3VH0 A;  4K3J B;  1RI6 A;  2AGX A;  3CIK B;  5I5M A;  4Y7R A;  3ULE C;  1SHY B;  2Z2N A;  5TF2 A;  2AH1 A;  3EI3 B;  2Z2O A;  3JB9 L;  2P9S C;  2YNO A;  3DM0 A;  3RN0 D;  4L1Q D;  2J56 H;  1ERJ A;  3VA6 A;  3IIW A;  4QT8 A;  4E54 B;  3OL2 A;  3L4M D;  5FQD A;  1TBG A;  3SHF A;  3F3G A;  4XEI C;  5CXC B;  4A11 A;  5K1C C;  1K32 A;  3UVM A;  4JXM A;  4ERY A;  3SFZ A;  2XU7 A;  2H9M A;  4U7A A;  2PBI B;  1NR0 A;  3EI2 A;  3EI3 A;  4A2L A;  2H6Q A;  5FLX g;  3EU7 A;  2PM6 B;  4A09 B;  5SXM A;  4FHL A;  2HXC A;  4CI3 A;  1K8K C;  2G99 A;  3F3P A;  4ESG A;  2CO0 C;  4D0K A;  4LGN A;  4ZN4 A;  3CFV A;  3I89 A;  3SWS D;  3PXT D;  1JMX B;  4LG8 A;  4ERZ A;  1NEX B;  4X61 B;  4CY2 A;  4J0X A;  4L3G D;  4QRJ A;  3JRO A;  3SLE D;  2Z2P A;  4J87 A;  4CZX A;  4O3T B;  3IJC A;  4JD2 C;  3UKR C;  4JT5 C;  1N6F A;  4XYI A;  1GXR A;  2B5M A;  3OKT A;  2H68 A;  3PE7 A;  3DXM C;  1FWX A;  4ZOV A;  5JWZ A;  4J79 A;  2HKR A;  2H3X A;  3N0E A;  4PSW B;  4ZOY A;  2HYE A;  3MXX A;  2I0T A;  1MG3 A;  4OWR A;  5I5J A;  5C2V B;  2H6N A;  2QC5 A;  5KDO B;  3UVO A;  3C5M A;  4Z8L A;  5FKR A;  5EML B;  5TEE A;  3SXT D;  2QXV A;  4J86 A;  1OLZ A;  5IJ8 E;  1JJU B;  4XYH A;  2CN2 A;  2I3T A;  3V7D B;  4FB1 D;  4J81 A;  3I8C A;  4H5I A;  4BH6 A;  3KRX B;  4BUJ C;  5IGQ A;  1B9X A;  4CY5 A;  2P9U C;  1Q47 A;  4KFM B;  4J0W A;  1OMW B;  1N6E A;  3UKU C;  3U4Y A;  4H5J A;  3E0C A;  1MG2 A;  4A7J A;  2HJ4 A;  3OL2 B;  3I7K A;  4A11 B;  3JRP A;  4JSX C;  1TYQ C;  4J77 A;  3NVX A;  3JZG A;  2AGL A;  4O1Q D;  4D6V A;  3I8E A;  4L9O A;  2YB8 B;  3MZL A;  3KRW B;  3RN1 D;  3I7P A;  4CY1 A;  2TRC B;  3EI2 B;  3EG6 A;  4FA9 D;  3I2N A;  4PBY A;  5EAP A;  2IUP A;  3RFG A;  4GGA A;  2UZY B;  3AL8 A;  2I3S A;  3ODT A;  3SMR A;  3EWE A;  3OKY A;  5HE0 B;  3SBR A;  2H9L A;  5AJA A;  4AEZ A;  2MTA H;  5HE3 B;  2G9A A;  3DXK C;  4ERQ A;  3NVQ A;  5C2W B;  5TDH B;  4GGC A;  4LG9 A;  4CI1 A;  2CNX A;  3EI4 A;  3L4O D;  5EMM B;  3PSC B;  2HES X;  2CN3 A;  4N14 A;  2W18 A;  4A2M A;  2GC7 A;  2IUR A;  3I7O A;  4A0A A;  1PGU A;  1U2V C;  4A0B A;  4PNK B;  3JZN A;  2PM9 A;  3P4F A;  1PEV A;  3OTT A;  3BWS A;  3EMH A;  5TEF A;  2GNQ A;  3IIY A;  4PC0 A;  3JPX A;  5HE2 B;  3JAM g;  4ZOZ A;  3OKW A;  3K26 A;  4X63 B;  3AFC A;  4O9D A;  2H14 A;  1N6D A;  4HDJ A;  3RRM C;  4AOW A;  5EAR A;  1P22 A;  4IA9 A;  5EMJ B;  3F3F A;  3B7F A;  4GQ1 A;  4FA4 D;  2IUV A;  5IC7 A;  5AFU 3;  3C9C A;  1SQJ A;  2J57 G;  3SBQ A;  3ZWL B;  4PXW A;  3UR4 A;  5H14 A;  2HJB A;  4UI9 R;  2IUQ A;  5CXB A;  3FM0 A;  2H6K A;  2YMU A;  3MKQ A;  4JSV C;  3EI1 A;  3N0D A;  3J80 g;  4I79 A;  4PBZ A;  4O45 A;  4A08 A;  4J73 A;  5H17 A;  3PVW B;  5CYK A;  2I0R A;  4CZV A;  5A2Q g;  2H9P A;  3RMZ D;  4JSP C;  3IKO A;  5GXH A;  5AMS A;  4GQ2 P;  1XHM A;  4NSX A;  4CI2 A;  2GC4 A;  3PVU B;  1U4C A;  3CFS B;  3IJ0 A;  5HE1 B;  4QL1 A;  5FXY A;  4J78 A;  3AL8 B;  3I7H A;  2H47 A;  2EBS A;  4U1E I;  3SVW D;  4GMB A;  3OKY B;  3UVN A;  4J8B A;  3FRX A;  3OW8 A;  2H13 A;  2P9L C;  2XYI A;  3BG0 A;  1QNI A;  5HQG A;  4EWR A;  4K3I D;  3BG1 A;  1GOT B;  3EI4 B;  4CI8 A;  3GFC A;  5EAM A;  2CE8 A;  2J55 H;  5EM2 A;  2AGW A;  4E5Z A;  5FKT A;  1VYH C;  5GXI A;  3C75 H;  4A0A B;  1A0R B;  4FA5 D;  4A0B B;  5H1M A;  2IWF A;  3V5W B;  2OK6 A;  3PSL A;  2PM9 B;  2BCJ B;  1JMZ B;  4CZY A;  3NVN A;  1GP2 B;  3MKS B;  4JSN C;  3JZH A;  5I5I A;  2CO0 A;  2XL3 A;  2P9P C;  3PXW D;  3RLM D;  3SJL D;  4GM3 A;  2B5L A;  2OJY A;  2OIZ A;  2Q7Q A;  3AL9 A;  4IMM A;  4TZ4 A;  1PI6 A;  2AQ5 A;  2OVP B;  2P9N C;  3J81 g;  5THA A;  4G56 B;  2P9K C;  4ZOX A;  2HKM A;  2OK4 A;  3K27 A;  1XKS A;  4E54 A;  2B4E A;  3IJ1 A;  5CXC A;  2B5N A;  3GRE A;  4CY3 A;  3I7N A;  4R7A B;  3DSM A;  5C9Z B;  2IWK A;  2YBA A;  3HFQ A;  4GQB B;  4CC9 A;  4FA1 D;  4J8G A;  5CXB B;  2IAA A;  1SQ9 A;  5IJ7 E;  4FWW A;  3EI1 B;  4A09 A;  3ORV D;  3RFH A;  4L3H D;  3UVK A;  5FA5 B;  4GM8 A;  4A08 B;  4BL0 A;  1L0Q A;  4GM9 A;  3SBP A;  1R5M A;  5CYK B;  3A0F A;  2P9I C;  2XL2 A;  5K19 A;  4YVD A;  2OVR B;  2AGY A;  4GGD A;  1XIP A;  2PM7 B;  5GMK n;  3VGZ A;  3C99 A;  4ES0 A;  4J82 A;  5FKS A;  4FAN D;  3SCY A;  4GZ8 A;  1PBY B;  4MK0 B;  3RSE C;  4QQE A;  2I0S A;  3SN6 B;  3MMY A;  1YFQ A;  5IGO A;  5IT9 g;  3I7L A;  4PSX B;  5HYN B;  3V9F A;  5B4W A;  3AH8 B;  4OZU A;  2AGZ A;  2H9N A;  2CE9 A;  4Y5R D;  4JT6 C;  5EMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...