4H5JA

Crystal structure of the guanine nucleotide exchange factor sec12 (p64 form)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
343
structure length
343
Chain Sequence
b'KFVTASYNVGYPAYGAKFLNNDTLLVAGGGGEGNNGIPNKLTVLRVDPTKDTEKEQFHILSEFALEDNDDSPTAIDASKGIILVGCNENSTKITQGKGNKHLRKFKYDKVNDQLEFLTSVDFDASTNADDYTKLVYISREGTVAAIASSKVPAIMRIIDPSDLTEKFEIETRGEVKDLHFSTDGKVVAYITGSSLEVISTVTGSCIARKTDFDKNWSLSKINFIADDTVLIAASLKKGKGIVLTKISIKSGNTSVLRSKQVTNRFKGITSMDVDMKGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNYAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-exchange factor SEC12
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title The structure of sec12 implicates potassium ion coordination in sar1 activation.
pubmed doi rcsb
total genus 83
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4h5jA00
5EM2B 1GG2B 4UI9R 3VH0A 3RRMC 2IAAA 2EBSA 3PVUB 5IJ8E 4XYHA 4FAND 4XEIC 5AFU3 4Z8LA 2O9KA 4L1QD 1TYQC 2I3TA 3UKUC 4J84A 5FQDA 3OKWA 3F3GA 4GZ8A 5EAPA 1N6DA 2XL2A 3OKYB 4LG8A 4A09A 4GGCA 5HE1B 2B5MA 4L9OA 5A2Qg 2CE8A 3JROA 2AGXA 2XYIA 4CI3A 4AOWA 4L3HD 4IA9A 3JPXA 4A11A 2HESX 5KDOB 5H17A 4O45A 1JMXB 3C75H 3DWLC 1YFQA 3I8EA 5HE0B 5TEEA 5GXIA 3ULEC 3AFCA 4PXWA 3C5MA 3C99A 3OKTA 4E5ZA 4FA1D 3P4FA 4QT8A 3RN1D 1PGUA 2B4EA 2AGLA 4E54A 3RSEC 3SBRA 3CIKB 4J87A 2P9NC 3KRWB 2H9NA 4K3JB 2PM9A 4ZOXA 2GNQA 5HQGA 4ERYA 2XL3A 5AJAA 2BBKH 2HKMA 3PXSD 3OTTA 3EI2B 1ERJA 2H14A 1U2VC 4TZ4A 3AL9A 1QNIA 5EMMB 4MK0B 5TEFA 3RN0D 5CYKA 2YNOA 2OJYA 3DM0A 3MZLA 4JT5C 3OW8A 3UVLA 2QXVA 3SBPA 4CY1A 3FRXA 1B9YA 4FA9D 3SWSD 3V7DB 2XU7A 4X61B 5I5IA 3IJ0A 4JSXC 4CZYA 3L4OD 3JZHA 3SCYA 3F3PA 4CI2A 1FWXA 2PM7B 3VGZA 3BWSA 2AH0A 1S4UX 5HE3B 4FB1D 5FKQA 4D6VA 3SMRA 4GQBB 5AMSA 2AGWA 1P22A 3AH8B 3NVXA 4J8BA 5CXBB 3EI3B 3NVNA 4BUJC 4EWRA 5FXYA 4J73A 2Z2NA 5SXMA 4A0BA 3EI1B 2OIZA 4FA4D 4HDJA 3MMYA 3UVNA 2CNXA 2Z2PA 2P9SC 3CFSB 5HYNB 2J57G 4IMMA 5K19A 1RI6A 4R7AB 4CZXA 4JT6C 4A0AB 3AL8B 5IJ7E 4O9DA 2GC7A 4A08A 5FLXg 2P9PC 3W15A 4CY3A 4E5ZB 3RLMD 3DXMC 4AEZA 5CYKB 5FA5B 2OK4A 5EALA 2H3XA 1L0QA 2IUPA 3L4MD 1SQ9A 4GM8A 3IIWA 2IUVA 3JAMg 2I0RA 2PM6B 3IJ1A 4QQEA 4ES0A 4GM3A 4OWRA 2OK6A 3GFCA 2IURA 4ZOZA 3BG1A 3UVKA 1VYHC 4ZOVA 1B9XA 4PSXB 2QC5A 1XKSA 5FKTA 5H14A 1U4CA 2H6QA 2IWFA 5CXCA 2J56H 3OL2B 2H13A 1N6EA 1GOTB 3I7HA 5I5MA 4GMBA 2HYEA 5TF2A 3RFGA 5C2VB 4YVDA 2PM9B 2HKRA 3E0CA 2CE9A 2YMUA 3I7KA 4J79A 4OZUA 4A2MA 4CZVA 2H9LA 4Y7RA 1A0RB 4CY2A 3F3FA 4BH6A 2YB8B 3RMZD 2I3SA 3U4YA 3PE7A 4PBZA 1NEXB 3SHFA 1SQJA 3IJCA 5IGQA 3EI4A 2I0SA 4A11B 2H6KA 5TDHB 4X60B 4FA5D 3DXKC 3EI2A 1TBGA 3RFHA 4PC0A 2P9IC 3B7FA 4FAVD 3SJLD 3EI3A 3IKOA 4CC9A 5THAA 3VA6A 4GGAA 5HE2B 4J86A 3SLED 4XYIA 4NSXA 4K3ID 1Q47A 2TRCB 3MKSB 1K8KC 3PXTD 1XIPA 1OMWB 4LGNA 1MG3A 1MDAH 4X3EA 3PXWD 1SHYB 4ERZA 3ZWLB 4PBYA 4O3TB 4JSNC 3BG0A 3UKRC 2BCJB 2H68A 1JJUB 4CI1A 3PSLA 5C9ZB 3JZGA 5C2WB 4ERQA 4J82A 4A0BB 2CN3A 3SVWD 4QRJA 1N6FA 5IT9g 4J0WA 3MZKA 2H6NA 4FHLA 2OVRB 3EU7A 3I89A 2YNNA 4X63B 5JWZA 5GXHA 4G56B 3IIYA 3EWEA 2HJBA 3FGBA 2P9KC 4J0XA 4QL1A 2GC4A 2IUQA 2Q7QA 5EMKB 2B5LA 4BL0A 1PBYB 2J55H 2HJ4A 1GXRA 1JMZB 3UVMA 3V5WB 4D0KA 4LG9A 3NVQA 4J8GA 3K26A 4PSWB 2UZYB 5IGOA 3K27A 4JD2C 2UZXB 4E54B 3UVOA 2CN2A 3EI4B 2OVQB 3I2NA 2AGYA 4N14A 3V9FA 3ORVD 3OL2A 3A0FA 4O3UB 3GREA 4CI8A 5GMKn 1PI6A 4A08B 2Z2OA 5EMJB 3OKYA 5B4WA 5CXCB 4GGDA 3PVWB 2H9PA 3I7PA 4U1EI 2AGZA 2CO0A 4FWWA 3SFZA 1R5MA 4A7JA 3C9CA 3JB9L 4CY5A 5EM2A 4A0AA 2IWKA 4PNKB 3ODTA 4ZOYA 2P9LC 3EMHA 3EI1A 5EARA 2AH1A 2W18A 2P9UC 4U7AA 3CFVA 5I5JA 2B5NA 3I7LA 3I8CA 2YNPA 3MXXA 2YBAA 3DSMA 2H47A 5FKSA 3EG6A 4KFMB 4J81A 3AL8A 2I0TA 3N0DA 5IC7A 5FKRA 2MTAH 4H5IA 3HFQA 4J78A 4L3GD 4I79A 3PSCB 3JRPA 5K1CC 4A2LA 3I7OA 3SXTD 3SBQA 4Y5RD 3J81g 3UR4A 4J77A 5EMLB 2HXCA 4A09B 1GP2B 1NR0A 4H5JA 4O1QD 1MG2A 1JOFA 4JXMA 1OLZA 2H9MA 2OVPB 2CO0C 3J80g 4GM9A 4ESGA 3MKQA 1K32A 3N0EA 5CXBA 4JSVC 4GQ1A 1PEVA 3I7NA 3SN6B 2G99A 2AQ5A 2G9AA 2PBIB 5H1MA 4ZN4A 3JZNA 5EAMA 4JSPC 4GQ2P 5GSAA 3KRXB 3FM0A 1XHMA
chains in the Genus database with same CATH superfamily
4MMXA 5EM2B 1GG2B 2VDNA 4UI9R 3VH0A 3RRMC 2IAAA 2EBSA 3PVUB 5IJ8E 4XYHA 4FAND 4AMZA 4WK0A 4XEIC 5AFU3 4Z8LA 1QFMA 2O9KA 1TYQC 4L1QD 2I3TA 3ZE0A 3UKUC 1QFSA 3GC3B 4J84A 5FQDA 3OKWA 3F3GA 4GZ8A 5EAPA 1N6DA 2XL2A 3OKYB 4LG8A 5FFOA 4A09A 4GGCA 5HE1B 2B5MA 4L9OA 5A2Qg 2CE8A 3JROA 1YR2A 2AGXA 2XYIA 3O4IA 4CI3A 4AOWA 2QZPA 4L3HD 4IA9A 3JPXA 4A11A 2HESX 5KDOB 1H2ZA 4O45A 1JMXB 5H17A 3C75H 4BP8A 5M5UA 4JHNA 3DWLC 1YFQA 3I8EA 3IUJA 5HE0B 5TEEA 4UM9A 5GXIA 3ULEC 3AFCA 1O6FA 4MMYA 4PXWA 2VDLA 3C5MA 3C99A 3OKTA 4E5ZA 4FA1D 3P4FA 4QT8A 3RN1D 1PGUA 2B4EA 2AGLA 4E54A 3RSEC 3SBRA 3CIKB 4J87A 2P9NC 3KRWB 4DNUA 3K71A 2H9NA 4K3JB 3ZDXA 2PM9A 4ZOXA 3EQ8A 1H2WA 2VDQA 2GNQA 5HQGA 4ERYA 3T3PA 2XL3A 5AJAA 2BBKH 2EIDA 3PXSD 2HKMA 4O2WA 3OTTA 1VZ3A 3EI2B 1ERJA 2H14A 1U2VC 4TZ4A 4D9SA 3AL9A 3ZE2A 1QNIA 3FCUA 5EMMB 1T2XA 3ZE1A 1H2YA 4MK0B 5TEFA 3RN0D 3V4PA 5CYKA 2YNOA 2OJYA 3DM0A 3MZLA 4JT5C 3OW8A 3UVLA 2QXVA 3SBPA 4CY1A 3FRXA 1B9YA 4FA9D 2XZGA 3SWSD 3V7DB 5M5TA 2XU7A 4X61B 5I5IA 3IJ0A 4JSXC 4CZYA 3VI3A 3L4OD 3MUOA 3JZHA 3SCYA 4NC4A 3F3PA 4CI2A 1FWXA 2PM7B 3VGZA 3MVDK 3BWSA 3IURA 2AH0A 3FCSA 1S4UX 5HE3B 4FB1D 3ZDYA 5FKQA 4D6VA 3SMRA 4GQBB 5AMSA 2AGWA 1P22A 3AH8B 3NVXA 4J8BA 5CXBB 3EI3B 3NVNA 4BUJC 4NENA 1O6GA 4EWRA 1E8NA 5FXYA 4J73A 2Z2NA 5SXMA 4A0BA 3IUMA 3EI1B 2OIZA 4FA4D 4HDJA 1I2MB 3MMYA 3UVNA 2CNXA 2Z2PA 2P9SC 3CFSB 5HYNB 2J57G 4NBMA 4IMMA 2VZ3A 2EIEA 5K19A 1RI6A 4R7AB 4CZXA 4JT6C 4A0AB 1VE6A 3AL8B 2EICA 5IJ7E 4O9DA 1GOFA 2GC7A 4A08A 5FLXg 1U8CA 2P9PC 3W15A 4CY3A 4E5ZB 2VDPA 3RLMD 3DXMC 1JTDB 4AEZA 5CYKB 5FA5B 2OK4A 5EALA 2H3XA 1L0QA 2HU5A 1GOHA 3IULA 2IUPA 3L4MD 1SQ9A 4GM8A 3IIWA 2IUVA 3JAMg 2I0RA 2PM6B 3IJ1A 4QQEA 4ES0A 1C9LA 4GM3A 4OWRA 2OK6A 4IRZA 3GFCA 1H2XA 2IURA 4ZOZA 3BG1A 3UVKA 5M5VA 2BKLA 2XDWA 1VYHC 4ZOVA 1B9XA 4PSXB 2QC5A 1XKSA 5FKTA 5H14A 1U4CA 2H6QA 2IWFA 4WK2A 5CXCA 2J56H 3OL2B 2H13A 1N6EA 1GOTB 3I7HA 4BCDA 4BCBA 1VE7A 4DNVA 5I5MA 2VZ1A 4GMBA 2HYEA 5TF2A 3RFGA 3ZDZA 5C2VB 3O4GA 4YVDA 2PM9B 2HKRA 4L1MA 3E0CA 3K6SA 2CE9A 2YMUA 3I7KA 4AX4A 4J79A 4OZUA 4A2MA 4CZVA 4WJKA 2H9LA 4RE5A 4Y7RA 1A0RB 2VDMA 4CY2A 3F3FA 4JHPC 4BH6A 2YB8B 3RMZD 2I3SA 3U4YA 3PE7A 4PBZA 1NEXB 3SHFA 1SQJA 3IJCA 1UOQA 5IGQA 3EI4A 2I0SA 4A11B 2H6KA 5TDHB 4X60B 4FA5D 3DXKC 3EI2A 5M5RA 3VI4A 1TBGA 3RFHA 2JKXA 4PC0A 2P9IC 3B7FA 4FAVD 3SJLD 3IUNA 2WQ8A 3EI3A 3IKOA 1VZ2A 5FFGA 4CC9A 1L5GA 5THAA 3VA6A 4GGAA 5HE2B 3V4VA 4J86A 3SLED 4XYIA 4NSXA 4K3ID 1Q47A 1M1XA 2TRCB 3MKSB 1K8KC 3PXTD 1XIPA 1OMWB 4LGNA 4G1EA 2VC2A 3QI0A 1MG3A 4O02A 5HDBA 1MDAH 4X3EA 3PXWD 1GOGA 1SHYB 1UOOA 1TYEA 4ERZA 4Z7NA 3ZWLB 5C92A 4PBYA 4O3TB 4JSNC 3BG0A 3UKRC 2BCJB 4Z7OA 4BCCA 2H68A 1JJUB 4CI1A 3PSLA 5C9ZB 3GD1I 3JZGA 5C2WB 4ERQA 4J82A 4A0BB 2CN3A 4AN1A 1A12A 3SVWD 3NIGA 4QRJA 1N6FA 5IT9g 4J0WA 1JV2A 3MZKA 2H6NA 4FHLA 2QR5A 2OVRB 3EU7A 3I89A 2YNNA 4X63B 4BP9A 2VDRA 5JWZA 5GXHA 4G56B 3IIYA 3T3MA 5E6SA 3EWEA 2HJBA 3FGBA 3O4HA 5C86A 2P9KC 4J0XA 4QL1A 2GC4A 2IUQA 2Q7QA 5EMKB 2B5LA 4G1MA 4BL0A 3OF7A 1PBYB 2J55H 2HJ4A 1GXRA 1JMZB 3UVMA 3V5WB 4G55A 4D0KA 3QHYB 3IJEA 4LG9A 3NVQA 1E8MA 1E5TA 4J8GA 3K26A 4PSWB 2UZYB 5IGOA 3NIDA 3K27A 4JD2C 5E6UA 2UZXB 5M5SA 3NIFA 4E54B 3UVOA 2CN2A 3EI4B 4RE6A 2OVQB 3I2NA 2AGYA 4N14A 3V9FA 3ORVD 3OL2A 3A0FA 4O3UB 3GREA 3IUQA 4CI8A 5GMKn 3EQ7A 1PI6A 4UM8A 4A08B 5E6RA 2Z2OA 5EMJB 3OKYA 1UOPA 5B4WA 5CXCB 4GGDA 3PVWB 2H9PA 3I7PA 4U1EI 4DNWA 2AGZA 2CO0A 4FWWA 3SFZA 1R5MA 4A7JA 3C9CA 3JB9L 4CY5A 5EM2A 4A0AA 2IWKA 4PNKB 3ODTA 4ZOYA 2P9LC 2HU7A 3EMHA 2HU8A 3EI1A 5EARA 3DDUA 2AH1A 2W18A 2P9UC 4U7AA 3CFVA 5I5JA 2B5NA 3I7LA 3I8CA 2YNPA 3MXXA 2YBAA 3DSMA 2H47A 5FKSA 3EG6A 4KFMB 5M61A 1BPOA 2VDKA 4J81A 2XE4A 2I0TA 3AL8A 3N0DA 5IC7A 3KCIA 5FKRA 2MTAH 4H5IA 4MMZA 3HFQA 4Z7QA 4J78A 4L3GD 4I79A 4QAMA 3EQ9A 3PSCB 3JRPA 5K1CC 4A2LA 3I7OA 3SXTD 3SBQA 2EIBA 3MUNA 3K72A 4Y5RD 3J81g 3UR4A 4J77A 5EMLB 2HXCA 3IVMA 1GP2B 1NR0A 4A09B 2VDOA 4H5JA 4O1QD 1MG2A 1JOFA 4JXMA 1OLZA 2H9MA 2OVPB 4AN0A 1C9IA 2CO0C 3J80g 3O4JA 1UTCA 4GM9A 4ESGA 4WK4A 3MKQA 1K32A 3N0EA 5CXBA 4JSVC 4GQ1A 1PEVA 4NAAA 1K3IA 3I7NA 3SN6B 2G99A 2AQ5A 2G9AA 2PBIB 5H1MA 4ZN4A 3JZNA 5EAMA 4AMYA 4JSPC 4GQ2P 5GSAA 3KRXB 3FM0A 1XHMA
chains in the Genus database with same CATH topology
5EM2B 1GG2B 4UI9R 3VH0A 3RRMC 2IAAA 2EBSA 3PVUB 5IJ8E 4XYHA 4FAND 4XEIC 5AFU3 4Z8LA 2O9KA 4L1QD 1TYQC 2I3TA 3UKUC 4J84A 5FQDA 3OKWA 3F3GA 4GZ8A 5EAPA 1N6DA 2XL2A 3OKYB 4LG8A 4A09A 4GGCA 5HE1B 2B5MA 4L9OA 5A2Qg 2CE8A 3JROA 2AGXA 2XYIA 4CI3A 4AOWA 4L3HD 4IA9A 3JPXA 4A11A 2HESX 5KDOB 5H17A 4O45A 1JMXB 3C75H 3DWLC 1YFQA 3I8EA 5HE0B 5TEEA 5GXIA 3ULEC 3AFCA 4PXWA 3C5MA 3C99A 3OKTA 4E5ZA 4FA1D 3P4FA 4QT8A 3RN1D 1PGUA 2B4EA 2AGLA 4E54A 3RSEC 3SBRA 3CIKB 4J87A 2P9NC 3KRWB 2H9NA 4K3JB 2PM9A 4ZOXA 2GNQA 5HQGA 4ERYA 2XL3A 5AJAA 2BBKH 2HKMA 3PXSD 3OTTA 3EI2B 1ERJA 2H14A 1U2VC 4TZ4A 3AL9A 1QNIA 5EMMB 4MK0B 5TEFA 3RN0D 5CYKA 2YNOA 2OJYA 3DM0A 3MZLA 4JT5C 3OW8A 3UVLA 2QXVA 3SBPA 4CY1A 3FRXA 1B9YA 4FA9D 3SWSD 3V7DB 2XU7A 4X61B 5I5IA 3IJ0A 4JSXC 4CZYA 3L4OD 3JZHA 3SCYA 3F3PA 4CI2A 1FWXA 2PM7B 3VGZA 3BWSA 2AH0A 1S4UX 5HE3B 4FB1D 5FKQA 4D6VA 3SMRA 4GQBB 5AMSA 2AGWA 1P22A 3AH8B 3NVXA 4J8BA 5CXBB 3EI3B 3NVNA 4BUJC 4EWRA 5FXYA 4J73A 2Z2NA 5SXMA 4A0BA 3EI1B 2OIZA 4FA4D 4HDJA 3MMYA 3UVNA 2CNXA 2Z2PA 2P9SC 3CFSB 5HYNB 2J57G 4IMMA 5K19A 1RI6A 4R7AB 4CZXA 4JT6C 4A0AB 3AL8B 5IJ7E 4O9DA 2GC7A 4A08A 5FLXg 2P9PC 3W15A 4CY3A 4E5ZB 3RLMD 3DXMC 4AEZA 5CYKB 5FA5B 2OK4A 5EALA 2H3XA 1L0QA 2IUPA 3L4MD 1SQ9A 4GM8A 3IIWA 2IUVA 3JAMg 2I0RA 2PM6B 3IJ1A 4QQEA 4ES0A 4GM3A 4OWRA 2OK6A 3GFCA 2IURA 4ZOZA 3BG1A 3UVKA 1VYHC 4ZOVA 1B9XA 4PSXB 2QC5A 1XKSA 5FKTA 5H14A 1U4CA 2H6QA 2IWFA 5CXCA 2J56H 3OL2B 2H13A 1N6EA 1GOTB 3I7HA 5I5MA 4GMBA 2HYEA 5TF2A 3RFGA 5C2VB 4YVDA 2PM9B 2HKRA 3E0CA 2CE9A 2YMUA 3I7KA 4J79A 4OZUA 4A2MA 4CZVA 2H9LA 4Y7RA 1A0RB 4CY2A 3F3FA 4BH6A 2YB8B 3RMZD 2I3SA 3U4YA 3PE7A 4PBZA 1NEXB 3SHFA 1SQJA 3IJCA 5IGQA 3EI4A 2I0SA 4A11B 2H6KA 5TDHB 4X60B 4FA5D 3DXKC 3EI2A 1TBGA 3RFHA 4PC0A 2P9IC 3B7FA 4FAVD 3SJLD 3EI3A 3IKOA 4CC9A 5THAA 3VA6A 4GGAA 5HE2B 4J86A 3SLED 4XYIA 4NSXA 4K3ID 1Q47A 2TRCB 3MKSB 1K8KC 3PXTD 1XIPA 1OMWB 4LGNA 1MG3A 1MDAH 4X3EA 3PXWD 1SHYB 4ERZA 3ZWLB 4PBYA 4O3TB 4JSNC 3BG0A 3UKRC 2BCJB 2H68A 1JJUB 4CI1A 3PSLA 5C9ZB 3JZGA 5C2WB 4ERQA 4J82A 4A0BB 2CN3A 3SVWD 4QRJA 1N6FA 5IT9g 4J0WA 3MZKA 2H6NA 4FHLA 2OVRB 3EU7A 3I89A 2YNNA 4X63B 5JWZA 5GXHA 4G56B 3IIYA 3EWEA 2HJBA 3FGBA 2P9KC 4J0XA 4QL1A 2GC4A 2IUQA 2Q7QA 5EMKB 2B5LA 4BL0A 1PBYB 2J55H 2HJ4A 1GXRA 1JMZB 3UVMA 3V5WB 4D0KA 4LG9A 3NVQA 4J8GA 3K26A 4PSWB 2UZYB 5IGOA 3K27A 4JD2C 2UZXB 4E54B 3UVOA 2CN2A 3EI4B 2OVQB 3I2NA 2AGYA 4N14A 3V9FA 3ORVD 3OL2A 3A0FA 4O3UB 3GREA 4CI8A 5GMKn 1PI6A 4A08B 2Z2OA 5EMJB 3OKYA 5B4WA 5CXCB 4GGDA 3PVWB 2H9PA 3I7PA 4U1EI 2AGZA 2CO0A 4FWWA 3SFZA 1R5MA 4A7JA 3C9CA 3JB9L 4CY5A 5EM2A 4A0AA 2IWKA 4PNKB 3ODTA 4ZOYA 2P9LC 3EMHA 3EI1A 5EARA 2AH1A 2W18A 2P9UC 4U7AA 3CFVA 5I5JA 2B5NA 3I7LA 3I8CA 2YNPA 3MXXA 2YBAA 3DSMA 2H47A 5FKSA 3EG6A 4KFMB 4J81A 3AL8A 2I0TA 3N0DA 5IC7A 5FKRA 2MTAH 4H5IA 3HFQA 4J78A 4L3GD 4I79A 3PSCB 3JRPA 5K1CC 4A2LA 3I7OA 3SXTD 3SBQA 4Y5RD 3J81g 3UR4A 4J77A 5EMLB 2HXCA 4A09B 1GP2B 1NR0A 4H5JA 4O1QD 1MG2A 1JOFA 4JXMA 1OLZA 2H9MA 2OVPB 2CO0C 3J80g 4GM9A 4ESGA 3MKQA 1K32A 3N0EA 5CXBA 4JSVC 4GQ1A 1PEVA 3I7NA 3SN6B 2G99A 2AQ5A 2G9AA 2PBIB 5H1MA 4ZN4A 3JZNA 5EAMA 4JSPC 4GQ2P 5GSAA 3KRXB 3FM0A 1XHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM2 B;  1GG2 B;  4UI9 R;  3VH0 A;  3RRM C;  2IAA A;  2EBS A;  3PVU B;  5IJ8 E;  4XYH A;  4FAN D;  4XEI C;  5AFU 3;  4Z8L A;  2O9K A;  4L1Q D;  1TYQ C;  2I3T A;  3UKU C;  4J84 A;  5FQD A;  3OKW A;  3F3G A;  4GZ8 A;  5EAP A;  1N6D A;  2XL2 A;  3OKY B;  4LG8 A;  4A09 A;  4GGC A;  5HE1 B;  2B5M A;  4L9O A;  5A2Q g;  2CE8 A;  3JRO A;  2AGX A;  2XYI A;  4CI3 A;  4AOW A;  4L3H D;  4IA9 A;  3JPX A;  4A11 A;  2HES X;  5KDO B;  5H17 A;  4O45 A;  1JMX B;  3C75 H;  3DWL C;  1YFQ A;  3I8E A;  5HE0 B;  5TEE A;  5GXI A;  3ULE C;  3AFC A;  4PXW A;  3C5M A;  3C99 A;  3OKT A;  4E5Z A;  4FA1 D;  3P4F A;  4QT8 A;  3RN1 D;  1PGU A;  2B4E A;  2AGL A;  4E54 A;  3RSE C;  3SBR A;  3CIK B;  4J87 A;  2P9N C;  3KRW B;  2H9N A;  4K3J B;  2PM9 A;  4ZOX A;  2GNQ A;  5HQG A;  4ERY A;  2XL3 A;  5AJA A;  2BBK H;  2HKM A;  3PXS D;  3OTT A;  3EI2 B;  1ERJ A;  2H14 A;  1U2V C;  4TZ4 A;  3AL9 A;  1QNI A;  5EMM B;  4MK0 B;  5TEF A;  3RN0 D;  5CYK A;  2YNO A;  2OJY A;  3DM0 A;  3MZL A;  4JT5 C;  3OW8 A;  3UVL A;  2QXV A;  3SBP A;  4CY1 A;  3FRX A;  1B9Y A;  4FA9 D;  3SWS D;  3V7D B;  2XU7 A;  4X61 B;  5I5I A;  3IJ0 A;  4JSX C;  4CZY A;  3L4O D;  3JZH A;  3SCY A;  3F3P A;  4CI2 A;  1FWX A;  2PM7 B;  3VGZ A;  3BWS A;  2AH0 A;  1S4U X;  5HE3 B;  4FB1 D;  5FKQ A;  4D6V A;  3SMR A;  4GQB B;  5AMS A;  2AGW A;  1P22 A;  3AH8 B;  3NVX A;  4J8B A;  5CXB B;  3EI3 B;  3NVN A;  4BUJ C;  4EWR A;  5FXY A;  4J73 A;  2Z2N A;  5SXM A;  4A0B A;  3EI1 B;  2OIZ A;  4FA4 D;  4HDJ A;  3MMY A;  3UVN A;  2CNX A;  2Z2P A;  2P9S C;  3CFS B;  5HYN B;  2J57 G;  4IMM A;  5K19 A;  1RI6 A;  4R7A B;  4CZX A;  4JT6 C;  4A0A B;  3AL8 B;  5IJ7 E;  4O9D A;  2GC7 A;  4A08 A;  5FLX g;  2P9P C;  3W15 A;  4CY3 A;  4E5Z B;  3RLM D;  3DXM C;  4AEZ A;  5CYK B;  5FA5 B;  2OK4 A;  5EAL A;  2H3X A;  1L0Q A;  2IUP A;  3L4M D;  1SQ9 A;  4GM8 A;  3IIW A;  2IUV A;  3JAM g;  2I0R A;  2PM6 B;  3IJ1 A;  4QQE A;  4ES0 A;  4GM3 A;  4OWR A;  2OK6 A;  3GFC A;  2IUR A;  4ZOZ A;  3BG1 A;  3UVK A;  1VYH C;  4ZOV A;  1B9X A;  4PSX B;  2QC5 A;  1XKS A;  5FKT A;  5H14 A;  1U4C A;  2H6Q A;  2IWF A;  5CXC A;  2J56 H;  3OL2 B;  2H13 A;  1N6E A;  1GOT B;  3I7H A;  5I5M A;  4GMB A;  2HYE A;  5TF2 A;  3RFG A;  5C2V B;  4YVD A;  2PM9 B;  2HKR A;  3E0C A;  2CE9 A;  2YMU A;  3I7K A;  4J79 A;  4OZU A;  4A2M A;  4CZV A;  2H9L A;  4Y7R A;  1A0R B;  4CY2 A;  3F3F A;  4BH6 A;  2YB8 B;  3RMZ D;  2I3S A;  3U4Y A;  3PE7 A;  4PBZ A;  1NEX B;  3SHF A;  1SQJ A;  3IJC A;  5IGQ A;  3EI4 A;  2I0S A;  4A11 B;  2H6K A;  5TDH B;  4X60 B;  4FA5 D;  3DXK C;  3EI2 A;  1TBG A;  3RFH A;  4PC0 A;  2P9I C;  3B7F A;  4FAV D;  3SJL D;  3EI3 A;  3IKO A;  4CC9 A;  5THA A;  3VA6 A;  4GGA A;  5HE2 B;  4J86 A;  3SLE D;  4XYI A;  4NSX A;  4K3I D;  1Q47 A;  2TRC B;  3MKS B;  1K8K C;  3PXT D;  1XIP A;  1OMW B;  4LGN A;  1MG3 A;  1MDA H;  4X3E A;  3PXW D;  1SHY B;  4ERZ A;  3ZWL B;  4PBY A;  4O3T B;  4JSN C;  3BG0 A;  3UKR C;  2BCJ B;  2H68 A;  1JJU B;  4CI1 A;  3PSL A;  5C9Z B;  3JZG A;  5C2W B;  4ERQ A;  4J82 A;  4A0B B;  2CN3 A;  3SVW D;  4QRJ A;  1N6F A;  5IT9 g;  4J0W A;  3MZK A;  2H6N A;  4FHL A;  2OVR B;  3EU7 A;  3I89 A;  2YNN A;  4X63 B;  5JWZ A;  5GXH A;  4G56 B;  3IIY A;  3EWE A;  2HJB A;  3FGB A;  2P9K C;  4J0X A;  4QL1 A;  2GC4 A;  2IUQ A;  2Q7Q A;  5EMK B;  2B5L A;  4BL0 A;  1PBY B;  2J55 H;  2HJ4 A;  1GXR A;  1JMZ B;  3UVM A;  3V5W B;  4D0K A;  4LG9 A;  3NVQ A;  4J8G A;  3K26 A;  4PSW B;  2UZY B;  5IGO A;  3K27 A;  4JD2 C;  2UZX B;  4E54 B;  3UVO A;  2CN2 A;  3EI4 B;  2OVQ B;  3I2N A;  2AGY A;  4N14 A;  3V9F A;  3ORV D;  3OL2 A;  3A0F A;  4O3U B;  3GRE A;  4CI8 A;  5GMK n;  1PI6 A;  4A08 B;  2Z2O A;  5EMJ B;  3OKY A;  5B4W A;  5CXC B;  4GGD A;  3PVW B;  2H9P A;  3I7P A;  4U1E I;  2AGZ A;  2CO0 A;  4FWW A;  3SFZ A;  1R5M A;  4A7J A;  3C9C A;  3JB9 L;  4CY5 A;  5EM2 A;  4A0A A;  2IWK A;  4PNK B;  3ODT A;  4ZOY A;  2P9L C;  3EMH A;  3EI1 A;  5EAR A;  2AH1 A;  2W18 A;  2P9U C;  4U7A A;  3CFV A;  5I5J A;  2B5N A;  3I7L A;  3I8C A;  2YNP A;  3MXX A;  2YBA A;  3DSM A;  2H47 A;  5FKS A;  3EG6 A;  4KFM B;  4J81 A;  3AL8 A;  2I0T A;  3N0D A;  5IC7 A;  5FKR A;  2MTA H;  4H5I A;  3HFQ A;  4J78 A;  4L3G D;  4I79 A;  3PSC B;  3JRP A;  5K1C C;  4A2L A;  3I7O A;  3SXT D;  3SBQ A;  4Y5R D;  3J81 g;  3UR4 A;  4J77 A;  5EML B;  2HXC A;  4A09 B;  1GP2 B;  1NR0 A;  4H5J A;  4O1Q D;  1MG2 A;  1JOF A;  4JXM A;  1OLZ A;  2H9M A;  2OVP B;  2CO0 C;  3J80 g;  4GM9 A;  4ESG A;  3MKQ A;  1K32 A;  3N0E A;  5CXB A;  4JSV C;  4GQ1 A;  1PEV A;  3I7N A;  3SN6 B;  2G99 A;  2AQ5 A;  2G9A A;  2PBI B;  5H1M A;  4ZN4 A;  3JZN A;  5EAM A;  4JSP C;  4GQ2 P;  5GSA A;  3KRX B;  3FM0 A;  1XHM A; 
#chains in the Genus database with same CATH topology
 4MMX A;  5EM2 B;  1GG2 B;  2VDN A;  4UI9 R;  3VH0 A;  3RRM C;  2IAA A;  2EBS A;  3PVU B;  5IJ8 E;  4XYH A;  4FAN D;  4AMZ A;  4WK0 A;  4XEI C;  5AFU 3;  4Z8L A;  1QFM A;  2O9K A;  1TYQ C;  4L1Q D;  2I3T A;  3ZE0 A;  3UKU C;  1QFS A;  3GC3 B;  4J84 A;  5FQD A;  3OKW A;  3F3G A;  4GZ8 A;  5EAP A;  1N6D A;  2XL2 A;  3OKY B;  4LG8 A;  5FFO A;  4A09 A;  4GGC A;  5HE1 B;  2B5M A;  4L9O A;  5A2Q g;  2CE8 A;  3JRO A;  1YR2 A;  2AGX A;  2XYI A;  3O4I A;  4CI3 A;  4AOW A;  2QZP A;  4L3H D;  4IA9 A;  3JPX A;  4A11 A;  2HES X;  5KDO B;  1H2Z A;  4O45 A;  1JMX B;  5H17 A;  3C75 H;  4BP8 A;  5M5U A;  4JHN A;  3DWL C;  1YFQ A;  3I8E A;  3IUJ A;  5HE0 B;  5TEE A;  4UM9 A;  5GXI A;  3ULE C;  3AFC A;  1O6F A;  4MMY A;  4PXW A;  2VDL A;  3C5M A;  3C99 A;  3OKT A;  4E5Z A;  4FA1 D;  3P4F A;  4QT8 A;  3RN1 D;  1PGU A;  2B4E A;  2AGL A;  4E54 A;  3RSE C;  3SBR A;  3CIK B;  4J87 A;  2P9N C;  3KRW B;  4DNU A;  3K71 A;  2H9N A;  4K3J B;  3ZDX A;  2PM9 A;  4ZOX A;  3EQ8 A;  1H2W A;  2VDQ A;  2GNQ A;  5HQG A;  4ERY A;  3T3P A;  2XL3 A;  5AJA A;  2BBK H;  2EID A;  3PXS D;  2HKM A;  4O2W A;  3OTT A;  1VZ3 A;  3EI2 B;  1ERJ A;  2H14 A;  1U2V C;  4TZ4 A;  4D9S A;  3AL9 A;  3ZE2 A;  1QNI A;  3FCU A;  5EMM B;  1T2X A;  3ZE1 A;  1H2Y A;  4MK0 B;  5TEF A;  3RN0 D;  3V4P A;  5CYK A;  2YNO A;  2OJY A;  3DM0 A;  3MZL A;  4JT5 C;  3OW8 A;  3UVL A;  2QXV A;  3SBP A;  4CY1 A;  3FRX A;  1B9Y A;  4FA9 D;  2XZG A;  3SWS D;  3V7D B;  5M5T A;  2XU7 A;  4X61 B;  5I5I A;  3IJ0 A;  4JSX C;  4CZY A;  3VI3 A;  3L4O D;  3MUO A;  3JZH A;  3SCY A;  4NC4 A;  3F3P A;  4CI2 A;  1FWX A;  2PM7 B;  3VGZ A;  3MVD K;  3BWS A;  3IUR A;  2AH0 A;  3FCS A;  1S4U X;  5HE3 B;  4FB1 D;  3ZDY A;  5FKQ A;  4D6V A;  3SMR A;  4GQB B;  5AMS A;  2AGW A;  1P22 A;  3AH8 B;  3NVX A;  4J8B A;  5CXB B;  3EI3 B;  3NVN A;  4BUJ C;  4NEN A;  1O6G A;  4EWR A;  1E8N A;  5FXY A;  4J73 A;  2Z2N A;  5SXM A;  4A0B A;  3IUM A;  3EI1 B;  2OIZ A;  4FA4 D;  4HDJ A;  1I2M B;  3MMY A;  3UVN A;  2CNX A;  2Z2P A;  2P9S C;  3CFS B;  5HYN B;  2J57 G;  4NBM A;  4IMM A;  2VZ3 A;  2EIE A;  5K19 A;  1RI6 A;  4R7A B;  4CZX A;  4JT6 C;  4A0A B;  1VE6 A;  3AL8 B;  2EIC A;  5IJ7 E;  4O9D A;  1GOF A;  2GC7 A;  4A08 A;  5FLX g;  1U8C A;  2P9P C;  3W15 A;  4CY3 A;  4E5Z B;  2VDP A;  3RLM D;  3DXM C;  1JTD B;  4AEZ A;  5CYK B;  5FA5 B;  2OK4 A;  5EAL A;  2H3X A;  1L0Q A;  2HU5 A;  1GOH A;  3IUL A;  2IUP A;  3L4M D;  1SQ9 A;  4GM8 A;  3IIW A;  2IUV A;  3JAM g;  2I0R A;  2PM6 B;  3IJ1 A;  4QQE A;  4ES0 A;  1C9L A;  4GM3 A;  4OWR A;  2OK6 A;  4IRZ A;  3GFC A;  1H2X A;  2IUR A;  4ZOZ A;  3BG1 A;  3UVK A;  5M5V A;  2BKL A;  2XDW A;  1VYH C;  4ZOV A;  1B9X A;  4PSX B;  2QC5 A;  1XKS A;  5FKT A;  5H14 A;  1U4C A;  2H6Q A;  2IWF A;  4WK2 A;  5CXC A;  2J56 H;  3OL2 B;  2H13 A;  1N6E A;  1GOT B;  3I7H A;  4BCD A;  4BCB A;  1VE7 A;  4DNV A;  5I5M A;  2VZ1 A;  4GMB A;  2HYE A;  5TF2 A;  3RFG A;  3ZDZ A;  5C2V B;  3O4G A;  4YVD A;  2PM9 B;  2HKR A;  4L1M A;  3E0C A;  3K6S A;  2CE9 A;  2YMU A;  3I7K A;  4AX4 A;  4J79 A;  4OZU A;  4A2M A;  4CZV A;  4WJK A;  2H9L A;  4RE5 A;  4Y7R A;  1A0R B;  2VDM A;  4CY2 A;  3F3F A;  4JHP C;  4BH6 A;  2YB8 B;  3RMZ D;  2I3S A;  3U4Y A;  3PE7 A;  4PBZ A;  1NEX B;  3SHF A;  1SQJ A;  3IJC A;  1UOQ A;  5IGQ A;  3EI4 A;  2I0S A;  4A11 B;  2H6K A;  5TDH B;  4X60 B;  4FA5 D;  3DXK C;  3EI2 A;  5M5R A;  3VI4 A;  1TBG A;  3RFH A;  2JKX A;  4PC0 A;  2P9I C;  3B7F A;  4FAV D;  3SJL D;  3IUN A;  2WQ8 A;  3EI3 A;  3IKO A;  1VZ2 A;  5FFG A;  4CC9 A;  1L5G A;  5THA A;  3VA6 A;  4GGA A;  5HE2 B;  3V4V A;  4J86 A;  3SLE D;  4XYI A;  4NSX A;  4K3I D;  1Q47 A;  1M1X A;  2TRC B;  3MKS B;  1K8K C;  3PXT D;  1XIP A;  1OMW B;  4LGN A;  4G1E A;  2VC2 A;  3QI0 A;  1MG3 A;  4O02 A;  5HDB A;  1MDA H;  4X3E A;  3PXW D;  1GOG A;  1SHY B;  1UOO A;  1TYE A;  4ERZ A;  4Z7N A;  3ZWL B;  5C92 A;  4PBY A;  4O3T B;  4JSN C;  3BG0 A;  3UKR C;  2BCJ B;  4Z7O A;  4BCC A;  2H68 A;  1JJU B;  4CI1 A;  3PSL A;  5C9Z B;  3GD1 I;  3JZG A;  5C2W B;  4ERQ A;  4J82 A;  4A0B B;  2CN3 A;  4AN1 A;  1A12 A;  3SVW D;  3NIG A;  4QRJ A;  1N6F A;  5IT9 g;  4J0W A;  1JV2 A;  3MZK A;  2H6N A;  4FHL A;  2QR5 A;  2OVR B;  3EU7 A;  3I89 A;  2YNN A;  4X63 B;  4BP9 A;  2VDR A;  5JWZ A;  5GXH A;  4G56 B;  3IIY A;  3T3M A;  5E6S A;  3EWE A;  2HJB A;  3FGB A;  3O4H A;  5C86 A;  2P9K C;  4J0X A;  4QL1 A;  2GC4 A;  2IUQ A;  2Q7Q A;  5EMK B;  2B5L A;  4G1M A;  4BL0 A;  3OF7 A;  1PBY B;  2J55 H;  2HJ4 A;  1GXR A;  1JMZ B;  3UVM A;  3V5W B;  4G55 A;  4D0K A;  3QHY B;  3IJE A;  4LG9 A;  3NVQ A;  1E8M A;  1E5T A;  4J8G A;  3K26 A;  4PSW B;  2UZY B;  5IGO A;  3NID A;  3K27 A;  4JD2 C;  5E6U A;  2UZX B;  5M5S A;  3NIF A;  4E54 B;  3UVO A;  2CN2 A;  3EI4 B;  4RE6 A;  2OVQ B;  3I2N A;  2AGY A;  4N14 A;  3V9F A;  3ORV D;  3OL2 A;  3A0F A;  4O3U B;  3GRE A;  3IUQ A;  4CI8 A;  5GMK n;  3EQ7 A;  1PI6 A;  4UM8 A;  4A08 B;  5E6R A;  2Z2O A;  5EMJ B;  3OKY A;  1UOP A;  5B4W A;  5CXC B;  4GGD A;  3PVW B;  2H9P A;  3I7P A;  4U1E I;  4DNW A;  2AGZ A;  2CO0 A;  4FWW A;  3SFZ A;  1R5M A;  4A7J A;  3C9C A;  3JB9 L;  4CY5 A;  5EM2 A;  4A0A A;  2IWK A;  4PNK B;  3ODT A;  4ZOY A;  2P9L C;  2HU7 A;  3EMH A;  2HU8 A;  3EI1 A;  5EAR A;  3DDU A;  2AH1 A;  2W18 A;  2P9U C;  4U7A A;  3CFV A;  5I5J A;  2B5N A;  3I7L A;  3I8C A;  2YNP A;  3MXX A;  2YBA A;  3DSM A;  2H47 A;  5FKS A;  3EG6 A;  4KFM B;  5M61 A;  1BPO A;  2VDK A;  4J81 A;  2XE4 A;  2I0T A;  3AL8 A;  3N0D A;  5IC7 A;  3KCI A;  5FKR A;  2MTA H;  4H5I A;  4MMZ A;  3HFQ A;  4Z7Q A;  4J78 A;  4L3G D;  4I79 A;  4QAM A;  3EQ9 A;  3PSC B;  3JRP A;  5K1C C;  4A2L A;  3I7O A;  3SXT D;  3SBQ A;  2EIB A;  3MUN A;  3K72 A;  4Y5R D;  3J81 g;  3UR4 A;  4J77 A;  5EML B;  2HXC A;  3IVM A;  1GP2 B;  1NR0 A;  4A09 B;  2VDO A;  4H5J A;  4O1Q D;  1MG2 A;  1JOF A;  4JXM A;  1OLZ A;  2H9M A;  2OVP B;  4AN0 A;  1C9I A;  2CO0 C;  3J80 g;  3O4J A;  1UTC A;  4GM9 A;  4ESG A;  4WK4 A;  3MKQ A;  1K32 A;  3N0E A;  5CXB A;  4JSV C;  4GQ1 A;  1PEV A;  4NAA A;  1K3I A;  3I7N A;  3SN6 B;  2G99 A;  2AQ5 A;  2G9A A;  2PBI B;  5H1M A;  4ZN4 A;  3JZN A;  5EAM A;  4AMY A;  4JSP C;  4GQ2 P;  5GSA A;  3KRX B;  3FM0 A;  1XHM A; 
#chains in the Genus database with same CATH homology
 5EM2 B;  1GG2 B;  4UI9 R;  3VH0 A;  3RRM C;  2IAA A;  2EBS A;  3PVU B;  5IJ8 E;  4XYH A;  4FAN D;  4XEI C;  5AFU 3;  4Z8L A;  2O9K A;  4L1Q D;  1TYQ C;  2I3T A;  3UKU C;  4J84 A;  5FQD A;  3OKW A;  3F3G A;  4GZ8 A;  5EAP A;  1N6D A;  2XL2 A;  3OKY B;  4LG8 A;  4A09 A;  4GGC A;  5HE1 B;  2B5M A;  4L9O A;  5A2Q g;  2CE8 A;  3JRO A;  2AGX A;  2XYI A;  4CI3 A;  4AOW A;  4L3H D;  4IA9 A;  3JPX A;  4A11 A;  2HES X;  5KDO B;  5H17 A;  4O45 A;  1JMX B;  3C75 H;  3DWL C;  1YFQ A;  3I8E A;  5HE0 B;  5TEE A;  5GXI A;  3ULE C;  3AFC A;  4PXW A;  3C5M A;  3C99 A;  3OKT A;  4E5Z A;  4FA1 D;  3P4F A;  4QT8 A;  3RN1 D;  1PGU A;  2B4E A;  2AGL A;  4E54 A;  3RSE C;  3SBR A;  3CIK B;  4J87 A;  2P9N C;  3KRW B;  2H9N A;  4K3J B;  2PM9 A;  4ZOX A;  2GNQ A;  5HQG A;  4ERY A;  2XL3 A;  5AJA A;  2BBK H;  2HKM A;  3PXS D;  3OTT A;  3EI2 B;  1ERJ A;  2H14 A;  1U2V C;  4TZ4 A;  3AL9 A;  1QNI A;  5EMM B;  4MK0 B;  5TEF A;  3RN0 D;  5CYK A;  2YNO A;  2OJY A;  3DM0 A;  3MZL A;  4JT5 C;  3OW8 A;  3UVL A;  2QXV A;  3SBP A;  4CY1 A;  3FRX A;  1B9Y A;  4FA9 D;  3SWS D;  3V7D B;  2XU7 A;  4X61 B;  5I5I A;  3IJ0 A;  4JSX C;  4CZY A;  3L4O D;  3JZH A;  3SCY A;  3F3P A;  4CI2 A;  1FWX A;  2PM7 B;  3VGZ A;  3BWS A;  2AH0 A;  1S4U X;  5HE3 B;  4FB1 D;  5FKQ A;  4D6V A;  3SMR A;  4GQB B;  5AMS A;  2AGW A;  1P22 A;  3AH8 B;  3NVX A;  4J8B A;  5CXB B;  3EI3 B;  3NVN A;  4BUJ C;  4EWR A;  5FXY A;  4J73 A;  2Z2N A;  5SXM A;  4A0B A;  3EI1 B;  2OIZ A;  4FA4 D;  4HDJ A;  3MMY A;  3UVN A;  2CNX A;  2Z2P A;  2P9S C;  3CFS B;  5HYN B;  2J57 G;  4IMM A;  5K19 A;  1RI6 A;  4R7A B;  4CZX A;  4JT6 C;  4A0A B;  3AL8 B;  5IJ7 E;  4O9D A;  2GC7 A;  4A08 A;  5FLX g;  2P9P C;  3W15 A;  4CY3 A;  4E5Z B;  3RLM D;  3DXM C;  4AEZ A;  5CYK B;  5FA5 B;  2OK4 A;  5EAL A;  2H3X A;  1L0Q A;  2IUP A;  3L4M D;  1SQ9 A;  4GM8 A;  3IIW A;  2IUV A;  3JAM g;  2I0R A;  2PM6 B;  3IJ1 A;  4QQE A;  4ES0 A;  4GM3 A;  4OWR A;  2OK6 A;  3GFC A;  2IUR A;  4ZOZ A;  3BG1 A;  3UVK A;  1VYH C;  4ZOV A;  1B9X A;  4PSX B;  2QC5 A;  1XKS A;  5FKT A;  5H14 A;  1U4C A;  2H6Q A;  2IWF A;  5CXC A;  2J56 H;  3OL2 B;  2H13 A;  1N6E A;  1GOT B;  3I7H A;  5I5M A;  4GMB A;  2HYE A;  5TF2 A;  3RFG A;  5C2V B;  4YVD A;  2PM9 B;  2HKR A;  3E0C A;  2CE9 A;  2YMU A;  3I7K A;  4J79 A;  4OZU A;  4A2M A;  4CZV A;  2H9L A;  4Y7R A;  1A0R B;  4CY2 A;  3F3F A;  4BH6 A;  2YB8 B;  3RMZ D;  2I3S A;  3U4Y A;  3PE7 A;  4PBZ A;  1NEX B;  3SHF A;  1SQJ A;  3IJC A;  5IGQ A;  3EI4 A;  2I0S A;  4A11 B;  2H6K A;  5TDH B;  4X60 B;  4FA5 D;  3DXK C;  3EI2 A;  1TBG A;  3RFH A;  4PC0 A;  2P9I C;  3B7F A;  4FAV D;  3SJL D;  3EI3 A;  3IKO A;  4CC9 A;  5THA A;  3VA6 A;  4GGA A;  5HE2 B;  4J86 A;  3SLE D;  4XYI A;  4NSX A;  4K3I D;  1Q47 A;  2TRC B;  3MKS B;  1K8K C;  3PXT D;  1XIP A;  1OMW B;  4LGN A;  1MG3 A;  1MDA H;  4X3E A;  3PXW D;  1SHY B;  4ERZ A;  3ZWL B;  4PBY A;  4O3T B;  4JSN C;  3BG0 A;  3UKR C;  2BCJ B;  2H68 A;  1JJU B;  4CI1 A;  3PSL A;  5C9Z B;  3JZG A;  5C2W B;  4ERQ A;  4J82 A;  4A0B B;  2CN3 A;  3SVW D;  4QRJ A;  1N6F A;  5IT9 g;  4J0W A;  3MZK A;  2H6N A;  4FHL A;  2OVR B;  3EU7 A;  3I89 A;  2YNN A;  4X63 B;  5JWZ A;  5GXH A;  4G56 B;  3IIY A;  3EWE A;  2HJB A;  3FGB A;  2P9K C;  4J0X A;  4QL1 A;  2GC4 A;  2IUQ A;  2Q7Q A;  5EMK B;  2B5L A;  4BL0 A;  1PBY B;  2J55 H;  2HJ4 A;  1GXR A;  1JMZ B;  3UVM A;  3V5W B;  4D0K A;  4LG9 A;  3NVQ A;  4J8G A;  3K26 A;  4PSW B;  2UZY B;  5IGO A;  3K27 A;  4JD2 C;  2UZX B;  4E54 B;  3UVO A;  2CN2 A;  3EI4 B;  2OVQ B;  3I2N A;  2AGY A;  4N14 A;  3V9F A;  3ORV D;  3OL2 A;  3A0F A;  4O3U B;  3GRE A;  4CI8 A;  5GMK n;  1PI6 A;  4A08 B;  2Z2O A;  5EMJ B;  3OKY A;  5B4W A;  5CXC B;  4GGD A;  3PVW B;  2H9P A;  3I7P A;  4U1E I;  2AGZ A;  2CO0 A;  4FWW A;  3SFZ A;  1R5M A;  4A7J A;  3C9C A;  3JB9 L;  4CY5 A;  5EM2 A;  4A0A A;  2IWK A;  4PNK B;  3ODT A;  4ZOY A;  2P9L C;  3EMH A;  3EI1 A;  5EAR A;  2AH1 A;  2W18 A;  2P9U C;  4U7A A;  3CFV A;  5I5J A;  2B5N A;  3I7L A;  3I8C A;  2YNP A;  3MXX A;  2YBA A;  3DSM A;  2H47 A;  5FKS A;  3EG6 A;  4KFM B;  4J81 A;  3AL8 A;  2I0T A;  3N0D A;  5IC7 A;  5FKR A;  2MTA H;  4H5I A;  3HFQ A;  4J78 A;  4L3G D;  4I79 A;  3PSC B;  3JRP A;  5K1C C;  4A2L A;  3I7O A;  3SXT D;  3SBQ A;  4Y5R D;  3J81 g;  3UR4 A;  4J77 A;  5EML B;  2HXC A;  4A09 B;  1GP2 B;  1NR0 A;  4H5J A;  4O1Q D;  1MG2 A;  1JOF A;  4JXM A;  1OLZ A;  2H9M A;  2OVP B;  2CO0 C;  3J80 g;  4GM9 A;  4ESG A;  3MKQ A;  1K32 A;  3N0E A;  5CXB A;  4JSV C;  4GQ1 A;  1PEV A;  3I7N A;  3SN6 B;  2G99 A;  2AQ5 A;  2G9A A;  2PBI B;  5H1M A;  4ZN4 A;  3JZN A;  5EAM A;  4JSP C;  4GQ2 P;  5GSA A;  3KRX B;  3FM0 A;  1XHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...