4H60A

High resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
120
structure length
120
Chain Sequence
AMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 42
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h60A00
3QLVA 1RPJA 1QNLA 4ETNA 3D02A 3LOPA 4EYKA 2JVIA 1DBWA 3O2SB 4MAAA 1TM2A 4TLLB 1SXHA 3EQ2A 2L19A 4WZZA 2FQXA 2PAFA 4TN5A 3RH0A 1Z26A 3EGCA 3UUGA 4Z99A 3QEKA 1HEYA 3KSMA 3JTEA 2VUIB 2RJOA 2RDMA 3E3MA 3F7NA 4RK7A 1YVUA 5FBKA 1YTUA 3RQIA 1APBA 1A04A 4HNQA 2E4XA 4Z4CA 1BDIA 3T8YA 1QP7A 1KMIY 2JK1A 2JVJA 3CFYA 2PUAA 3NBMA 3EQZA 2CD7A 1LJUA 2N9UA 4KMRA 1USGA 1ZH2A 4RSMA 5KI6A 5IC5A 3T38A 1JLKA 2I6FA 3MIZA 3HCWA 3B2NA 4OLBA 1BDJA 1DCMA 4DN6A 1ZHHA 2E4YA 5BRJA 3OLWA 1DRKA 1SXGA 3K9CA 3I42A 3O75A 1XHEA 3EJWA 3RVSA 4EY3A 3TD9A 3N8IA 4E7PA 1YMUA 3QELB 4YRZA 1BDHA 3QLVC 5PNTA 2LPMA 4MS1A 1ABFA 1GLGA 1TVMA 4RXMA 1ISSA 4N47A 5B3JC 4ZMRA 5ABPA 2FVYA 4W5QA 1ZVVA 3C3MA 2PMCA 4XARA 3RVLA 1RZRD 2IPNA 3KJXA 2B1JA 3RVMA 3OQMA 4G0MA 4Q6BA 1YIOA 1FSPA 2FMHA 3N75A 5TQJA 2HQRA 3H6HA 3HDVA 1D4ZA 4G0ZA 2HJ9A 4ZPJA 2LP4Y 1NXPA 2IPMA 5KQPA 3VNBA 2VUHB 1ABEA 3SQNA 5JNTA 2FXIA 3KLOA 7ABPA 5FWXA 5CNKA 5JS2A 1MAVA 4HNRA 1JH9A 1MIHA 4RU1A 1C0EA 2YHAA 4RS3A 3O1JC 2MYNA 1Z13A 3A10A 4MQEB 4GNRA 5I4CA 4P98A 2V0NA 2P4UA 2H0AA 2L17A 4XLTA 4JB0A 2NT4A 1M2FA 3H5TA 4N76A 4OTZA 1XHFA 2Q5CA 1GCAA 4XFKA 2CWDA 1Z16A 2WJAA 2GWRA 3ILYA 3FDFA 3O2JA 1GCGA 2R48A 3JPYA 2MYUA 4P1ZA 4Z0NA 3OLYA 3LUCA 1VLZA 5DCLA 1U0SY 3QX8A 5GQSA 3JS5A 3UK0A 4YP9A 1PNTA 4KK3A 4L85A 1LK0A 2MYTA 1EHCA 2A9PA 5KQGA 4EVRA 2PUBA 3NHZA 4MQFB 4DADA 2PUDA 5D2CA 3C3WA 4Z4FA 4YCSA 4TMYA 4KQ9A 4RK1A 4ZMSA 4W5TA 4KRFA 5T7BA 1EAYA 3QK7A 3O1HB 5IX8A 5DGCA 4EYOA 1S8NA 1YK1A 3LUDA 4MRMA 2QZJA 4NCAA 1ZITA 4FB4A 5TPZA 1BAPA 5KQMA 4YS6A 1C4WA 2FMIA 6CHYA 3NNSA 1JX6A 3MM4A 2LIVA 2JCGA 2W42A 2QR3A 3RVPA 3RVQA 2JBAA 2QSJA 3EULA 2M1ZA 1QPZA 2FMFA 4G0XA 3GA5A 3G85A 4NV3A 5HM6A 3UKJA 5KQLA 4W5OA 4JOQA 2NZUG 2OENG 4UHKA 3HO1A 4Z4GA 2NUBA 4M88A 1D1QA 1OXKB 2IOYA 3H1GA 3H1EA 3R0JA 3IP9A 3RVKA 4QYMA 1PEAA 5HKOA 5ED4A 3I5AA 5FBHA 3H75A 1BVHA 3DGEC 3H5IA 1JDPA 1YK0A 3KYJB 3URMA 4DQDA 4KNYA 1SD5A 4MLDA 1QQBA 1ZESA 3JPWA 2WWVD 3DLHA 1WETA 4TLMB 1Z15A 4MS3B 2A9OA 3OLXA 2B4AA 4RK4A 4ETMA 2FLKA 3SG0A 1FQWA 2IPLA 1M2EA 4LE1A 4Y9TA 3TX6A 3GL9A 4QICA 3FFXA 4IGAA 1Z12A 4MR9A 1NXVA 3RVJA 5TQ2B 4Z4HA 2RJNA 2GX6A 5EWLB 3HUUA 1E6LA 3GV0A 3E61A 3QLTA 4MR8A 3SY8A 5IEJA 1W9HA 5JNWA 2FEWB 4KREA 4F12A 4D6YA 2E4VA 4WUTA 2R47A 1YS6A 4RKRA 1NXXA 1J56A 1NXTA 2M98A 3TMYA 4LDZA 4RK6A 1D5WA 2WY2D 2FN9A 4L4UA 3LKVA 3FMVA 2BGGA 4XXHA 4LE2A 5TPWA 4QYWA 4IRXA 3KG2A 3LKBA 1P2FA 3HDGA 3JVIA 1JWLA 4WT7A 3RVOA 3QX9A 4W5NA 2QVCA 3IP6A 2MSKA 3H5WA 2ZWMA 3MF4A 1RXIA 4W5RA 5DLEA 2HPHA 3Q7SA 2WRZA 3BRSA 1DP4A 1SRRA 4MGEA 3KTOA 3VNAA 2YHBA 3ROTA 2O20A 3IPAA 4PZ0A 1VPWA 3GBPA 1B00A 3C3KA 1JL3A 2JBAB 4LX8A 4EVSA 4FE4A 1USKA 3H5LA 4YLEA 4NQRA 1YMVA 1DZ3A 4NICA 4EGSA 2HQOA 1Z17A 3HUTA 4F8JA 1LBIA 3BRQA 1LBHA 2PLNA 4ETIA 3A0RB 3QLUA 2L18A 2E4ZA 1FFGA 3LMKA 1D1PA 2R4QA 3CU5A 1MB3A 3EAFA 3HJFA 4KZKA 1I3CA 1TLFA 3KCNA 3CLKA 4EYQA 1EFAA 1OXBB 4HNSA 1ZN2A 2HQBA 4IMIB 3LUAA 1QO0D 3P9YA 3CHYA 3Q9SA 4ZYLA 2F8SA 2KYRA 3IPCA 2FN8A 3IDOA 1NATA 1QP0A 3FGZA 1NXOA 5DKFA 3FFTA 4MR7B 4MS1B 1CEYA 1Z2EA 4MS3A 3HM9A 1Z18A 2GI4A 3H5VA 3HVRA 2MYPA 3EDCA 3Q7TA 1QKKA 1PEYA 3NHMA 4D6XA 2A9RA 4O1HA 3A3KA 3MQ4A 4S05A 2CHEA 4RY0A 2PJUA 3LUFA 5TPZD 3O21A 1URPA 1XWWA 3F73A 1T34A 1DBQA 4RZSA 4JP1A 4YO7A 4E7OA 2PUCA 3JY6A 1JF8A 1LJLA 1FFWA 3KHTA 4OG2A 4G0PA 4Z9BA 2PL1A 4F3TA 3TO5A 4HYEA 1NXSA 2P9HA 4Z9AA 4PYRA 1EWTA 1AB6A 1ZDMA 4G0YA 2X7XA 4H3KB 3OMWA 4YR7A 4MQEA 3N0WA 3CZCA 2AYZA 3LUJA 4Q7EA 1DJMA 1QQAA 3QEMB 1FFSA 5IEBA 2FSPA 5EWMB 4MS4A 2MSLA 1NTRA 2AYXA 5BQ3A 4RWEA 5EWJA 3IP7A 4EUKA 1PUXA 1NXWA 2OQRA 2R25B 3M6MD 9ABPA 5HSGA 3DLBA 5JS1A 4KPYA 4RY8A 3GWGA 2NT3A 5CHYA 3JVDA 4MR9B 1EWKA 3L49A 3HSYA 1KGSA 1TJYA 1Z25A 2IKSA 3T6KA 4EVQA 3GBVA 3HV2A 5KWSA 4KQCA 5B3JA 3OLVA 4KVFA 4RK0A 5HQJA 1ZGZA 1M5UA 3CZ5A 5EWJB 3A0UA 4YGXB 5T3YA 4ZJPA 5IUNC 1KRXA 4WXMA 2FTKE 3TB6A 4ML3A 1ZY2A 3SAJA 3LTEA 4YWHA 2E4WA 2LUOA 3SNKA 3CG4A 4OATA 2PUFA 1L5ZA 1M5TA 3OM0A 1E6KA 3HZHA 4N0PA 1DRJA 5F64A 3H5OA 2CHFA 4OLAA 2PL9A 4N03A 5CNMA 2WB4A 2WMYA 2FEPA 1DCKA 3C97A 4PEVA 1YS7A 3KLNA 3H6GA 3N6VA 3NNDA 1JYFA 4MLCA 5IBQA 5DTEA 3NNNA 4MYRA 3O1IC 3LFTA 4G97A 2MSWA 3F6CA 3ROFA 3QLUC 5CNJA 1JYEA 2QXYA 5IUKC 5JNSA 5JNUA 2QV0A 1QMPA 2VYCA 3MA0A 5BR1A 4YV7A 2TMYA 2PUEA 3KKEA 2FQYA 5C5EA 1PNRA 2FW0A 1ISRA 3N0XA 1JFVA 2JRLA 2DRIA 4KFCA 3DBIA 5FWYB 1Y1LA 2ZAYA 4JA2A 5EWLA 1H9CA 4XAQA 3DGFC 3T95A 2PKXA 2IYNA 3CG0A 3W9SA 1ZAYA 2J48A 4KV7A 2PE5A 4Z4EA 4KK4A 4MRMB 1DC7A 1RZRA 3GYBA 2GKGA 3HS3A 4MPTA 3LUGA 4CBVA 1CYEA 4IMJB 3N0RA 5JNVA 1F4VA 1P8AA 1DC8A 3OQOA 5KC9A 4G0OA 3L6UA 2L2QA 2F8TA 2HSGA 4F06A 4IILA 4H60A 1K66A 1L5YA 1NY5A 5TQ0B 4RV5A 1SXIA 4N41A 1D2AA 4PICA 3BILA 3GT7A 3F6PA 3Q15C 1A0OA 2ID7A 3LUHA 3Q41A 3KS9A 5CNIA 1USIA 3D8UA 1PHRA 4JASB 3HXMA 3C6QA 3SM9A 5TE9A 2E4UA 3ILHA 2FMKA 2H3HA 3O2QB 2NZVG 4RXTA 4WWHA 5BRAA 1DBPA 4OBBA 4MR7A 4FE7A 1TMYA 1P6QA 2WJWA 1U04A 3I45A 5TQ0A 4G0QA 5KC8A 3G1WA 3HK2A 1P6UA 1UDRA 4LDAA 1U2PA 4O5AA 5TPWB 1JDNA 3HEBA 1F51E 1KRWA 4JAVC 4RXUA 3S99A 4UHJA 1QO0A 3CKMA 4D74A 5IUJC 1E2BA 2GBPA 4MQFA 2QVGA 4N0QA 5JNRA 2QU7A 1MB0A 1QP4A 4LRQA 1RXEA 3O74A 1GUBA 1K68A 5EWMA 3OQNA 2FLWA 2IDMA 3RVRA 2FQWA 1R8JA 3BREA 8ABPA 1E6MA 3EODA 1AB5A 5E3JA 3DZDA 1ZH4A 2FEKA 3CNBA 3KYIB 3OMXA 1U8TA 4O1IA 2FKAA 1ZGGA 4Q6WA 5GOTA 4RK5A 1DCFA 3K4HA 2JB9A 3N53A 1IIBA 1W25A 2QW1A 3QELA 4G86A 4IF4A 4MS4B 6ABPA 1JFSA 4Z4IA 1Z2DA 3M9XA 1VRVA 1MVOA 4QPJC 1JFTA 4WXEA 3FFWA 3OLZA 4XASA 1BA2A 3RVNA 1U2QA 3MMNA 4NCBA 4B09A 5C5CA 2RGYA 2IPAB 4LE0A 4RDCA 2PUGA 2A9QA 4F11A 2JVKA 4EYGA 3BBLA 1VKRA 3I09A 4LZLA 1RNLA 4PE5B 2VK2A 3Q7RA 1A2OA 2XDYA 3MYYA 4H3HB 3CTPA 4GPAA 1CHNA 4MR8B 5FWXB 3M9WA 3OO0A 3IP5A 1DG9A 3LUKA 5IULC 3OM1A 3H1FA 5TQ2A 1GUDA 3CS3A 1JHZA 4RKQA 4RY9A 2ID9A 2LBPA 1JBEA 1EWVA 3OO1A 4JB2A 5FWYA 4S04A 3CRNA 3GRCA 3QEMA
chains in the Genus database with same CATH superfamily
2R8YA 1HLFA 1RPJA 4IGFA 2ZIVB 1CS4C 2R79A 2BFAA 5AVKA 4TLLB 2G9NA 3B6IA 4D45A 3RH0A 4PZZA 4JHLA 2VQSA 2QZPA 3LDFA 2XQIA 3O4RA 1QGUB 3F7NA 2RDMA 5GONF 1V4NA 4HNVA 1ZSYA 1A04A 1RLMA 4EKNB 2JW5A 2OORA 1CY8A 1GPLA 3BGIA 4JJZA 4MI9A 3TZCA 2HOQA 1T43A 3CFYA 2W2LD 3LGAA 4RORA 4O1MA 1XTKA 4RJTA 3I5YA 1XTJA 1EG2A 4J1TA 1KJQA 4RSMA 5JAZA 4B6QA 4KN6A 5DSTA 2PHZA 3CW9A 1NBME 2O2ZA 3BDVA 1PD1A 1B8OA 2VP6A 3HCWA 3PK0A 4AKHA 4FYVA 4P5PA 1C8KA 5L53A 2OQVA 1ZL0A 3FYTA 3T1HB 3BTSA 3CZAA 2CT8A 3I5MA 1XA3A 3PEUA 5K1ZA 3HU2A 2P1DA 3TW8A 3MB5A 1D8TA 4QA9A 1SVKA 1XZDA 1ZICA 3WAJA 3VKUA 3WQBA 1VZ3A 4A0SA 2LR0A 1LJ8A 1YTLA 4MW0A 1YMUA 1VC2A 4FMBB 3ZWKA 3HWX1 4DSOA 1OXSC 2DBVO 3A2NA 1T2DA 3IHKA 4UTVA 2JEOA 4FQ5A 3DH0A 1ISSA 1INLA 2G6BA 3H9EO 3ER8A 4I9FA 1Y34E 2N0SA 1P8JA 2ZI7A 5FI1B 4MULA 5TQJA 3G0HA 4OFZA 3GR6A 5ALGA 1O94D 4LSGA 1KNXA 3IYLW 3WRWA 3K1AA 4KUHA 4HB0A 1XXLA 1E3WA 3MPUA 4UASA 1NYTA 2GPBA 3K9GA 5T3UA 4B3DA 2ETVA 3MBOA 2YQ5A 4O4LB 5JNTA 4JB3A 3A4MA 4E70A 3M6XA 2ZRCA 5KNDA 5JISA 2HJGA 4X3PA 5KYVA 1M7HA 2VTEA 4FWIB 1AK2A 1VM6A 4XIGS 1C1HA 1B3BA 3JYHA 4M8SA 4MQEB 2R86A 1NVEA 3DEJA 1WAMA 1VHQA 2P4UA 2RCYA 2ZIXA 4GNRA 4L8LA 1UAGA 5J40A 2VA9A 2NUAB 3DWFA 4A36A 1S3IA 4DB4A 4PVDA 1N1DA 3F1LA 3UANA 1LVGA 3QKTA 4JC4A 2PCLA 3AL3A 1I0IA 1K7EB 1WEHA 5HIKA 3TW6A 4ESVA 2GDJA 3K0FB 2YNMA 3C1TA 3I8SA 1YB1A 1NSTA 3LC1O 4GLJA 4HGYA 3K31A 4Q9KA 1G63A 4MWCA 1BVUA 4PYQA 2EFGA 2QRLA 5J63A 3JS5A 2VBFA 3ZWQA 1L7NA 3UCEA 1TYZA 5KX5A 4CLDA 4FYWA 3FNBA 1F17A 3DFMA 1H2YA 3HRHA 2REQB 5U4XA 3V1UA 1DIOB 5I3ZA 4Z4FA 4ODIA 1C3OA 3PCRB 4D8TA 4DR2B 2I4NA 3UAYA 4PHFA 1N32B 1OLSA 2IYQA 1LWOA 3D6VA 5IX8A 5K45A 1CEEA 2GSWA 1X80B 4MRAA 2C04A 3QMVA 5ALNA 2ZRPA 2HO4A 3GLGE 5A5VA 3L18A 1CNEA 3PNKA 2X6RA 4KMSA 1Q6ZA 4C30A 1BZYA 1W47A 1GQQA 3GC6A 1J5EB 2HT1A 1QE3A 1LSUA 1LDEA 3Q5EA 2ZK7A 4WD3A 1HDCA 4YMGA 1WZEA 2KS6A 3ZS8A 4JVNA 1MJNA 2KSQA 3D2AA 1FIUA 1AKEA 1VFNA 2C8VA 2C3PA 2VF2A 4O4JB 1Z4QA 1Y8AA 3BHIA 3UKJA 3UJBA 3LH5A 5C18A 5KKCA 1LNQA 3HGQA 4EW6A 4NDZA 4GZ6A 1TTQB 2ECOA 4PC6A 3X43A 4FHGA 4HWOA 2B1IA 1LF5A 2XWPA 4F5WA 5F35A 2VI5A 2XITA 1YS2X 4I1RA 3TD2A 2X0DA 2PLWA 3DGEC 4W5QA 4J0FA 3VVCA 2H4YA 3VXKA 4LKRA 2ZCJA 3HHEA 4NFYA 2WU8A 3LA6A 2XUGA 4W9NC 2H59A 3Q6NA 3F46A 4RWZA 3DLHA 1G16A 1H6AA 4KAAA 1JTEA 2FSUA 4AMYA 5HWSA 1VPDA 1IY2A 4PQFA 3CXUA 3SG0A 5DYIA 4EQ6A 4IIBA 5IARA 2HMWA 2HX1A 3B7PA 4MEBA 4ZYTA 5HJEA 5A6SA 1QZ3A 1THGA 1Z12A 3CRQA 4GBJA 5JCOC 4R0VA 5TJHA 1T3LA 3UAOA 1E6LA 1Z47A 1NL3A 1GT6A 5HVNA 2FUG1 3JRNA 2GAIA 3O90A 4EGCB 4XVUA 3ZUPA 2PGXA 1NGSA 3EOBI 5CEFA 1SEVA 2QN8A 4LTDA 1YS6A 4FOLA 3ASUA 1I9GA 1ICEA 4O2LA 5LYYA 1ZCJA 1E4EB 1ECLA 4LECA 4EA8A 4M2LA 4PWZA 2BONA 4J7CA 2C9YA 4FYMA 3COSA 3FPFA 1G9TA 5AHXA 1WUTA 1JFFB 1P45A 3NJRA 3PXUA 1D09A 1KJ9A 3ETNA 3JVIA 1X77A 2DWUA 2DBRA 4M8IA 5ALRA 3QX9A 3IP6A 1FJXA 4DYHA 2FPIB 1NLZA 1IOWA 2JJ2A 2ES4A 5EKSA 3KQLA 5ER9A 1U8YA 4Z53A 4ZHQA 1KSJA 1H0RA 3TM5A 1XDSA 3G2HA 3Q85A 4HQFA 4L4ZA 3E7WA 4PN3A 1L7QA 1TMKA 2JFBA 4KGDA 1CQIA 3D3WA 1XEAA 1YASA 3HJAA 2UXBB 2X4LA 3GJXC 4JBYA 2OFWA 3KZNA 1BQ3A 3H65A 3OZSA 4Y2XA 1VPWA 3WYAA 3A04A 2DQYA 4B6RA 1XPJA 5LBIA 3D3QA 3HKEB 1JL3A 4J7AA 5SICE 4WK6A 3PD7A 3H5LA 3RTDA 4NQRA 1LW6E 2X2EA 1D3AA 3L0YA 2PFKA 3IR7A 4QSHA 1Y5LA 2ZVPX 4PPGA 5BT9A 1R9JA 4W9NA 1NC3A 2OV3A 5CVEA 3A0RB 2ORYA 5C5IA 5ADVA 1FFGA 1MB4A 2TS1A 2XCLA 2GEUA 4ZQHA 1M2VA 1T26A 2PS3A 2R4QA 2HEIA 1HYQA 2QD5A 3FSGA 3IVCA 1AQLA 2EJCA 1I3CA 2ISSD 2R8ZA 4MXDA 2WM8A 4EYQA 1KI6A 1NUUA 3F47A 3IS3A 4OBEA 1SZDA 1JP7A 3M6AA 3TR0A 5E6RA 1Q21A 5KX5B 2WF7A 3QWAA 4CDNA 1PR6A 2J6BA 4UU1A 5FHQA 3P0IA 3Q8WA 1ZW6A 3BBPA 3EYAA 3I9KA 3QA9A 4NZ9A 3HBJA 2HD4A 3IPCA 3W77A 2WT9A 3WB1A 3K9LA 1VPVA 2AKAB 3CPJB 4MS1B 5EUQB 2XCQA 4G89A 3HGMA 3UB4A 1MB9A 1AZWA 2Q3CA 1R0XA 1TPYA 1DMSA 3Q5GA 4RD1A 2NU6A 3CR8A 5CYPA 1PGQA 2EDAA 3CLUC 1PLKA 2WP8J 5DWQA 4KX5A 3QMWA 4D6XA 1O8CA 4A4DA 3DL7A 3HKBA 4RTJA 5EUBA 3CB4A 3E9ZA 1T34A 1KQ3A 2QAGA 3CF2A 3K9QO 2WU4A 3RU9A 3D7SA 3ND7A 1U6KA 1T15A 4E7OA 5KTNA 3B1YA 3TWOA 3WQSB 2QNRA 1SELA 2FOLA 4KMOA 3UAGA 1P17A 4R2LA 3R1IA 4ZCQA 2BSQA 2EVWX 1DEHA 4DC0A 1TE2A 3P19A 1QMGA 1REQA 1JVSA 3D0QA 1YZFA 1V6CA 5B30A 4I1PA 1OGJA 2ZOSA 1VE9A 1TEHA 3ONFA 1K7CA 1PR1A 3ICWA 1I4WA 3FLAA 3G8CA 3LI2A 3LUJA 4LAFA 3KOUA 3IMCA 2DECA 1MD9A 1EJ0A 3DTTA 4G3XA 4JEMA 4W8OA 1LLDA 1M33A 4ADSG 3MILA 1M2NA 1QQ6A 4FHEA 2G09A 3MTAA 3VJLA 4F6LA 4LMRA 4B44A 3GRVA 2EFCB 1YOVA 4HAOA 1QXSA 3DLIA 3VR4H 3KTAB 4OHRA 5FWAA 5C9ZA 4BLTA 2R25B 1R9MA 1XNJA 4XWOA 1C9EA 3EGXA 2XB2A 3GO4A 4YJGA 2HA7A 3L0DA 3ZU4A 2BLLA 2HLDA 3OFND 4LJLA 1R7RA 3RYIA 1KAMA 1MRSA 1PQPA 1TJYA 4WFJA 5E1MA 3IEMA 3EWIA 4PO1A 4ZV7A 3MIIA 4XQGA 3ZWNA 3B9PA 3QX7A 4O4IB 2QRJA 3WP1B 5A0FA 4NABA 4ZJPA 5I45A 1AQUA 1Y9EA 2WBLC 1DKMA 1E63A 2CL0X 3R8XA 3VR1A 1UIRA 1OV4A 2R7KA 3G8DA 1YZQA 1GN9A 3R5JA 4OATA 2PUFA 1AZSC 1L5ZA 4KYIB 1T9BA 1D4AA 4Q1CA 3HZHA 1BCRA 2RH4A 1IL0A 3MUFA 5E2AA 1IJKA 2DBYA 1E5TA 4E2WA 3K6RA 3Q7QA 2HRZA 1J42A 2YV3A 2X9LA 2RB4A 4H7JA 4HVCA 1ENYA 1UF9A 1XN4A 2HWWA 2IXDA 2NYVA 1Y1QA 1H5UA 2QEQA 1UMBB 2WMYA 3A1TA 1NSFA 2IP1A 3NRBA 2P8SA 1T5LA 3IQZA 4XWKA 5IBQA 1B2LA 4JUIA 2PZMA 1VG8A 2P2CA 1FQOA 4N5MA 2VRWA 5TMBA 4UCWA 4JNKA 4IEIA 3CEAA 3CR3C 3QLUC 1QSGA 1XEXA 2N42A 2Q1WA 3FCEA 5FT9A 3TE7A 3QNMA 4OSOA 5T4FA 1P3Y1 2CLSA 5B7GA 1ZL2A 4YYEA 2I76A 4AWAA 3TTSA 3R7DA 2OO7A 3E84A 3P2YA 4MUEA 1EK1A 3I1FA 1F4LA 1U7WA 5IKOA 2FKNA 4Q9NA 4EPVA 4U6SA 5LKRA 4NU0A 1KO5A 1JDJA 4HDCA 1GSIA 1E66A 1Z9BA 2H6EA 2HIMA 4UZEA 3RRZA 3RT7A 3DGFC 3HBAA 4J2HA 1WXQA 3SOZA 3CG0A 4TLBA 3DCYA 2BMFA 1ODFA 2EWVA 1AGRA 2BWJA 3D0RA 3PGVA 4RVSA 4W5HA 1A5SB 4E13A 4DA4A 3FSGD 3W5AA 4G1CA 5COBA 3B6KA 3BWVA 4L8WB 4OHKA 4WNAB 1L5HA 1G2QA 1POXA 1P0CA 1HM5A 1PAUA 1P8AA 1RYHA 4AURA 4BO2A 1S9HA 4GYYA 4P6VF 4ARZB 1U0FA 3GQBB 4NZYA 5CLGA 1T2CA 2JI8A 5E9AA 4TSFD 5C52B 1XYYA 4H60A 1K66A 5AJXA 4DKJA 1J49A 1KAOA 4IGKA 3MTGA 4ZIRA 2I8CA 4K26A 3NANA 5FR1A 4BQNA 2H2AA 3H87A 2OP0A 4X7MA 1KI3A 2C8KA 3BILA 3VSCA 3ADPA 2ZM6B 1SA0A 3HB5X 2H7VA 4ZO6A 5M2QA 3U5TA 1ECPA 2BH2A 1USIA 3VI4B 4C4AA 2BOVA 3ZEAA 3D2LA 2WF5A 4UMEA 3H9UA 2XMRA 4J94A 3BCHA 2FPIA 5H3LA 4ZC1A 4W9MC 3PLNA 5AM1A 3RIHA 3TH5A 2AK3A 1UPBA 4F72A 1UT8A 2OFOA 3BF8A 3QV2A 1TFRA 2I3ZA 4X90A 4IJUA 3A6KA 3VU8A 2HB6A 3OCVA 4NG4A 4P0QB 1C8LA 1VLVA 4M0EA 1MQ9A 3OZIA 1GVNB 4WN3A 1JDNA 3H8SA 3AUSA 1ZN8A 3FVWA 1WDWB 3S1SA 2YTZA 4UTNA 5EHZA 1NBHA 5BNIA 3KJQA 5ES4B 1EP9A 2ZR9A 4J2TA 5ISMA 2VPXA 1EK5A 4A2QA 2HK6A 4LC0A 4PAQA 4CTOA 1XDDA 2NQ8A 3SZUA 3E22A 2G80A 2XTMA 3UJ6A 3FNGA 2YRFA 2FUNB 3NASA 2EZ4A 4LXXA 3WLTA 1XL0A 2D2FA 2WABA 5BQ5A 4B3BA 1EQAA 1MEOA 2NXWA 3NRJA 1RHRA 2OLJA 3KFLA 4AY3A 5MF6A 2DCMA 4GLLA 3EW9A 4KJZA 3E1KA 4LDRA 1N8TA 4MUBA 1DAGA 1JFSA 3CH6A 1FDTA 1LPSA 1MG5A 1WCV1 4HYYA 3WL4A 3RW9A 2EJWA 2IHVA 2XRYA 3SQMA 3X2EA 4PAOA 1GA4A 5ALDA 4N49A 4AZ0B 1PHPA 4RV4A 1QIFA 1C7JA 3O7MA 1ML3A 2GK4A 1EXMA 4HEHA 1XWFA 2PYDA 2QQGA 1P2TA 3AUKA 5K0LA 2DLDA 2ZB8A 3QU7A 4HH3C 3U4AA 3W1WA 3L4EA 3DYIA 3I09A 4LZLA 3RSZA 4DVJA 3W9YA 3CKYA 2XUHA 1DFHA 3L6DA 4B8WA 4LEIA 4DV0B 1EGMB 3OJLA 1U2SA 1C1DA 1MF7A 3R8CA 3RKUA 2WYUA 3PDIB 4X1YA 3JTMA 2OCGA 4KOEC 3KBBA 4ZYZA 3L8DA 1DFIA 5JXHA 3EGXB 1Z74A 3DMPA 2V7QD 1UXOA 2JD1A 3E7PA 1YZLA 2RHCA 2CDAA 3TZEA 3LCVB 5C3MA 4RMNA 2XXAB 3CO5A 3CV3A 3P5BA 4R1LA 3KHUA 4TQGA 4UNNA 4ZEWA 3T0IA 1NY6A 9GPBA 1T9AA 3I3SR 3KXDA 3PEVA 4G9GA 4YT5A 5G4LA 4DLVA 2GZ1A 3ORFA 1V26A 3HB9A 1PL0A 2BGTA 1V37A 5HRAA 3I04M 2NO9A 3COZA 2O2CA 4K9LA 1X94A 3KU4A 5HE9A 3A26A 2DSTA 1W8IA 3EGCA 5CYGA 4P34A 2YOHA 4LQLA 1VJCA 3GEIA 7REQB 1ZJ6A 4HWKA 4LDPA 1MQ8B 2QE7A 4WADA 1IN4A 1F2VA 2VWHA 1MX5A 2R1TB 4FYKA 3EH2A 3TL2A 3NUQA 3FCOA 3OLCX 1QH9A 3NBMA 4Y2TA 1Y42X 3DLAA 1QB8A 4LISA 4NC9A 4KJXA 3M5DA 3QHQA 1ZM4A 2HHCA 5HUJA 1QS0B 3B9RA 5KHOC 2J7PD 4US1R 5K4HA 2QTCA 1HE4A 4K46A 4OYHA 1JHQA 4XYEA 4YJ3F 3EIHA 5TNXA 2P4QA 1HX7A 1IWOA 2HMSA 1YHZA 5EHNA 5EJ6A 3F9RA 2ATXA 4PAWA 3PSAA 5C2JB 5A7FA 3GD7A 4Q01A 4URXR 1JE1A 4KFUA 4Y2RA 1C9JA 1E1CA 1W88A 1X8XA 2QVYX 3TD9A 3OWXA 4YRZA 2V9PA 4TZKA 4YYZA 5CDUA 3L92A 3FHJA 2ZIFA 1NFQA 1DUIA 1Y5MA 4N48A 2IEGA 2L0XA 3JQPA 1CD5A 1TC2A 4LIPD 5CT8A 3VR5A 1Z4MA 2XIJA 3BJIC 2PQMA 3OQMA 3IT1A 2H1VA 4CMCA 1PJ3A 1WB6A 4E51A 2BCEA 4JYBA 1G66A 1KDOA 1ZBDA 2PIDA 3TM4A 5GIPE 3W5VA 1FS4A 1YZUA 2WSYB 3E27A 3AO0B 4NHOA 3ZCTA 2H29A 2ACVA 1FP1D 4M1WA 1SURA 2PSSA 2V4MA 4GEKA 4RF3A 2IHZA 4TTPA 3I8XA 4MZXA 1RBZA 3V32A 1NYRA 2YHAA 4QQKA 3IDAA 4RS3A 3TXAA 1NMEA 1U80A 1T5SA 4C7VA 4ZEMA 2QMYA 2RAFA 5DISB 3RTEA 5JROA 4RANA 1XD9A 1BFDA 4N76A 3R5FA 1Z36A 1K0FA 4UREA 1VE5A 3OQVA 4HVLA 5F21A 3TSWA 2DTDA 1FFHA 4P7BA 1L1RA 3QMMA 3ABRB 4N54A 4HS9A 1AG9A 4AULA 3LZ6A 1U8AA 2WFZA 1NVVQ 2ODPA 1FDUA 1HURA 1OHHD 2NVUA 2R48A 2ZBUA 3ESBA 5JXWA 5INTA 2XGMA 5CLLA 4EUHA 1ZVKA 2AIRA 2VH5R 4QFMA 4TQUS 3G0IA 5KB3A 1PNTA 2VA8A 3UWMA 1JAZA 5IJZA 3WLJA 1LK0A 2HSDA 2ZIGA 2BISA 3HDYA 4FFNA 3FWYA 1DB3A 1O97C 4NNJA 4UOQA 3K1JA 4JX8A 4DDVA 4NE9A 4OQQA 2QTBA 4QGSA 3VYVA 4ZMSA 4PC3A 5CDYA 3W5BA 5JSHA 3MJRA 1X14A 4F6CA 3ACBA 1E4OA 4LWOA 2G83A 4BO8A 4QUJA 1S8NA 1JJFA 2XE7A 3MGGA 2HK9A 4PGMA 2DJIA 2H2IA 3FDXA 5BMVF 2WYVA 1XZEA 1AGNA 5BV1A 4C78A 1QIGA 4RIEA 1EQUA 1E0AA 2EGUA 2PL5A 3SHFA 1TYDE 1LD3A 4M1ZA 4ZO9A 3H9QA 3IBYA 2ILVA 1FLAA 4QQRA 1WABA 3ZUGA 4IUCS 2E1PA 2XMPA 2E2WA 1N6HA 2ZRGA 5FBWB 1L8QA 2QL6A 4OAPA 1NN3A 4MW9A 4Q4AA 1U8UA 2VXBA 4XEHA 2FN7A 3CRRA 1GSHA 1OWPA 3H1EA 3LC0A 3CGWA 3O83A 4ND2A 1I8TA 3DOUA 2NO4A 4A6PA 4ZI7A 1C3EA 3PPIA 3Q9UA 4RQUA 4GRIA 5FYDA 1WV1A 4NBLA 4FZRA 5DT2A 2H9YA 2O5CA 1Y7PA 5E3HA 4WHMA 3LL4A 4WBNA 2AN9A 4FFWA 4O4JA 1JDPA 2BIFA 3S1AA 1UBLS 1XTSA 1WCYA 3B60A 4GSYA 2BJWA 5GV7A 4BNNA 1QQBA 1TU4A 1BXZA 2WWVD 5BMVA 3T3IA 4P38A 1JSLA 1Z15A 3TIIA 4MS3B 2XUKA 3LVFO 4X94A 2WWYA 3VPHA 3IQIX 3KQKA 3GUUA 2I1WA 4RLQA 2O3JA 1VL1A 3GUZA 4R1TA 3WDMA 4O29A 4B7XA 4FWTA 2ATIA 3AOEA 1CU1A 3AM4A 4QOIA 3L1VA 1E7SA 1GHTA 3D6HA 1JLLA 1FU8A 2RGBA 4KXFB 3PZRA 3QPUA 3FPSA 4H4EA 1M6YA 2AQHA 4WK4B 4EL0A 4EKDA 3D4IA 5BSKA 1RWQA 5I7FA 1RHUA 2HNKA 4CKWA 3WFZA 4XVRA 4IZ6A 1L4YA 2V5VA 4B34A 5LZ8A 2B4KA 4KOAA 1DTWA 3OZ7A 4JX9A 2WT8A 4YCMA 2NTVA 2VDMB 3PGLA 1Y1RA 4GMHA 1JG7A 4MQUA 2FQ1A 2DUMA 2ZYTX 2HLNA 1VBNA 4QLBA 3KYDB 4RACA 1TNDA 2BTOA 4US2R 3PSHA 2ZWOA 4Q12A 2FWPA 4A03A 1IQRA 3SEQA 4PFSA 2IZ7A 4DDTA 5FTMA 2RHOA 3DCJA 4LYYA 3TRKA 3HCAA 3OUTA 2WNIA 1GPMA 1OC2A 1QDEA 5K3FA 1MJ5A 1EE1A 2ZWMA 3MF4A 1NJ5A 3TZ6A 5DP1A 1UH5A 1LRJA 3O8CA 5KU1A 4G4JA 4RAQA 3A6PC 3HCFA 2OHXA 1W85B 2WSMA 1I7DA 2IBMA 2OGZA 3KQTA 2WHXA 4V38A 2JFPA 1SUPA 1T1GA 3LOQA 3LAWA 5JMWA 4IM7A 3JATB 1KWKA 4BFZA 5BXQC 1ZCFA 4U0JA 3KQQA 1EUDA 2ACWA 5CH3A 4BJHB 5AK4A 3AI7A 1M34A 1P9NA 1S2IA 2H07A 3Q1KA 3HR4A 1YO6A 3KLBA 3LW8A 4UBLA 4B6SA 4BNGA 2J9YB 3PFWO 3WRXA 7YASA 4ABTA 3CH5A 3CZRA 2QM7A 2FFQA 2I2DA 5EJ9A 2HMAA 1YZNA 1L4GA 4E2YA 1ZN7A 1D1PA 1CLEA 1FX1A 5AI5A 5F9HA 1B6TA 1TW3A 1QFXA 1KKUA 2WPNA 2WVGA 3AR3A 3C8MA 1DBVO 3OBIA 2RFLA 5I6DA 4OCZA 1ZN2A 5KTYA 3QV1A 2Q2QA 5F7XA 1QF6A 1CC1S 1G2PA 2VK4A 1NJSA 1W4RA 1KJNA 2OILA 4UTXA 1VKOA 1GPYA 4QWWA 4QUGA 5KREA 3RS7A 3T9DA 4C6TB 1UADA 5JWHA 5DX8A 1KKLA 1G21B 1QK3A 1U5CA 1VECA 1A8SA 3EDCA 3ENVA 5KYGA 3KOWA 1N2IA 1ZC3A 3CIOA 3MWKA 4HH1A 3UJ3X 1XRJA 3O21A 1O4VA 1C7RA 2PWZA 4Q9DA 3P45A 3Q0IA 4KLNA 5B6JA 1CJUC 1P0MA 4LGVA 1KZGB 1MOQA 2GXUA 1DKQA 3AY3A 1KE1A 4F3TA 3KKMA 1I6MA 3TO5A 4HDAA 1JJBA 4TUYB 5ITWA 1ECFA 3SM3A 2EC5A 1UBFA 4PYRA 1JA0A 2XD9A 5KAMA 1MX1A 1CUGA 5BN1A 1YRYE 3VR5H 3PXXA 1N0WA 2O7NA 1SIWA 4V0ME 2GHTA 1P1BA 1ZGAA 3IAS6 1JNXX 4KXNA 5TVGA 4CKBA 1E9VA 4UUOA 4M49A 5EWMB 4HX9A 3SEAA 4B2LA 3HKDB 1UK8A 4IXTA 2Y4OA 3RHTA 2PBFA 5G1OA 1EA5A 5B3LA 2AR9A 1UXJA 3NC1C 3IP7A 5BW5A 3IBSA 2BKVA 4ACAA 3P0RA 1P4SA 4U7WA 3U5ZB 1M1ZA 5TEWA 2NACA 4H1UA 3GWGA 2PU5A 5CHYA 3E9YA 2GM5A 4RHXA 5HDQA 4A0HA 2YXDA 3D7LA 1VXRA 2I3DA 1B8NA 4PYKA 2IKSA 3E9QA 3NH9A 1Z8FA 2DFPA 3ZXUB 4QYXA 2DH6A 5BQPA 2HBYA 1N92A 2EBUA 4EB6A 1ZUWA 2V45A 3WRXC 1RC8A 2WJYA 2P5UA 3BS4A 2FEAA 2EHDA 3NX4A 3LQFA 3R4VA 1ZI6A 1Y98A 2VK8A 4KX3A 2GERA 4CR8A 1ZY2A 3SAJA 2A1UB 2DETA 1SVUA 3V7UA 3HKCA 3E3LA 4TYNA 2YJ3A 1P7CA 2X19A 4N0PA 1KVQA 3S2YA 2PZEA 2IODA 4YWJA 4Q9AA 1BKDR 4QPZA 3AFMA 1N2SA 5JUWA 5MFPA 2GHRA 5DMHA 1TF7A 2P9GA 5TS2A 5DLDA 5JDCA 4ND4A 4YJ2F 1ZXLA 5LQNA 2XCUA 2C1ZA 3UPDA 4E5UA 3JQAB 1NJ6A 1V35A 4KKVA 2DHCA 3A06A 5CIQA 4ZZIA 2FFJA 3AINA 1NSYA 4MYRA 2HF2A 5JCXA 3LFTA 3DXYA 1F8FA 4RW0A 4Y6RA 3DEYX 5FUXA 5FWDA 3UUWA 4M7RA 2Z2KA 3T0GA 2GJKA 1AJEA 5IK2D 2B3TA 2PU7A 1T5TA 2QRQA 1JECA 2VP3A 4AKIA 2HV9A 1VG0B 3K1AB 4R1MA 1G7TA 1FW8A 2VDUE 2I8LA 4LTMA 5REQB 5IFLA 5JH7B 3F98A 4C4XA 1HDIA 1BVYF 3FSJX 4ZVRA 1ZAYA 1U8XX 1V45E 4JOCA 4LY0A 3LF1A 4OI1A 3WLKX 3SS8A 3TE6A 4K0KB 5AK0A 1B6SA 3GYBA 5COAA 2W2LA 4K2HA 3GT3A 2YIDA 2BGKA 1U0TA 1VCOA 5AT1A 1SBYA 2CLCX 3RTCA 1TTTA 4X9XA 3TLGB 5JALA 1IVYA 1VYTA 3DE2X 1DC8A 3M1LA 1QYVA 3OPYB 4KWHA 4H1WA 3RASA 4UPEA 1I94B 2B35A 3UUFA 3P2EA 3VBCA 4UBNA 4D4HA 3HXLA 2WUVA 1NRXA 4XQ0A 2J5BA 4DBLC 3QVJA 4DLYA 2O9JA 3OZGA 1P4HA 1BCSB 3A27A 3FTQA 2C2BA 4HR7A 4F9TA 4KVGA 5J2UF 3HXQA 3PQDA 3HWSA 1SUBA 1OF1A 2ID7A 2P78A 3LUHA 2HDOA 2FF5A 3PA8A 3V2UA 4XB2A 1YHNA 5LL6P 1G21E 1PHRA 3UKDA 1U5AA 3G13A 5ULLA 2JLBA 2Q29A 4S0ZA 1LA2A 4BVLA 1Z38A 1WUIS 1W1UA 4QO8A 1OILA 2QBYA 3TMAA 2BTQA 1B0UA 3CINA 5E8RA 4BU0A 2ZRHA 2QX9A 5D6NA 2EX0A 1RLOA 1DBPA 1NVAA 4YECA 1R5JA 3I45A 1M2HA 1G1AA 2PQ0A 5DN9A 5GJVC 4TZ0A 3G1WA 2P9EA 3PUIA 5DULA 5HA5A 2K87A 3ABOB 3U7QA 4XJSA 3QE4A 4BMPB 5MN5A 2JGJA 3L0SA 4FYYA 1DU4A 1EZ1A 1WO8A 4ZOLA 4U5XA 2ZZNA 1UEIA 1U99A 3RJMA 4YUXA 4OGFA 3V8BA 4RH1A 5LLTA 3QVLA 1XAHA 1H6DA 2VNSA 3ZQKA 4AK9A 3ZTWA 2QJWA 3RDPA 1GUBA 2CJWB 4CM6A 2ZBPA 1A7KA 3EY4A 4C08A 4Y9UA 3EMVA 2IDMA 5KTMA 3OT5A 1H22A 1JHDA 3AIIA 2H7YA 3F5DA 4JELA 1X7ZB 3VPCA 2C2HA 2BSXA 3I9MA 4YFVA 3PFCA 4IG9A 4I2VA 3IRUA 4ROTA 3RQSA 2Z2YA 2CLOB 1ZH4A 1CUVA 2H4FA 4LHEA 4MMXB 2JJ8A 2WD8A 3A6HA 4RLHA 4WY5A 3R3WA 3REFA 1JG2A 4GQBA 5T5QA 3ZWPA 5IFKA 4CV1A 3N53A 5IDXA 1E4YA 1SWWA 1GARA 4XDHA 5DYTA 4CM7A 1Z34A 1KHHA 4RMHA 5GJCA 1XJ5A 4WPGA 3CCCA 3G0CA 4HAZA 1W4BA 3USES 3I5UA 2Y6UA 1ZJ4A 2QY9A 3CR7A 2C03A 3G59A 4MVXA 4IJMA 5BMVB 2NTYC 1ONBA 2WQZA 3OOJA 4URZR 4I14A 5C3UA 2CL6X 1YR2A 4HADA 2WAAA 3KWJA 3FIJA 1D6JA 2Z57A 5LU8A 5EHGA 3EGIA 2GXSA 1RRFA 5I4BA 2ZS8A 1V7PC 1WSWA 3C3XA 3GNSA 4JBHA 5EN4A 3AL0C 5K6AC 2WTXA 1V3TA 1KJWA 1R6VA 3NHYA 3RARA 4OJYA 2QRZA 2QTZA 2YZKA 2RAVA 4MR8B 3SIXA 3WMEA 3ISTA 3U61B 3MWGA 5FI3A 3OSUA 2JZOA 3ADBA 4FNGA 2ZI4A 3BMOA 2W00A 4WFIA 5HIIA 4D41A 1IULA 1XP5A 3WMXA 4HEA1 1FSFA 4TVOA 1POWA 4PZEA 3BCSA 5DWDA 1HQCA 4Z8XA 2ZBRA 4N40A 1PYOA 5CCDA 3E5MA 3R7LA 3FPEA 5LU9A 4BV9A 1KOJA 3QLVA 4GX5A 1YJBA 2HA3A 3C1OA 4QDXA 4R2JA 3SHVA 3VO2A 1V1JA 1N25A 3MHTA 2Q4RA 2YN0A 1P2VA 1SFRA 1RJEA 3EQ2A 4HYTA 4ZAFA 1GNQA 5EP4A 5L3VA 3U6BA 3E2IA 4BX8A 3EZ7A 3SSNA 2Q21A 2ON6A 4RTOA 1YTUA 4KTVE 4O59O 3ULKA 2FZWA 2O8FA 1QP7A 1C5KA 1BWRA 1DLIA 1U3CA 1QGYA 2IEZA 3LDAA 3K8YA 4MIOA 3RC2A 4COKA 1LSOA 2IU3A 1A72A 4UUMA 1Z5UA 2N9UA 1GXSB 3HLTA 4LRYA 2AV6A 2PDAA 5JC8A 3MTIA 1PKEA 1YC5A 2I6FA 3N2KB 2BI4A 4JP2A 4KPUB 3KETA 5AM4A 3EISA 1E2LA 3O9MA 2H1LA 3PIIA 1BGWA 1CV2A 2WAOA 2AOTA 4IHJF 3OEED 3EZNA 1QGUA 1SPXA 1QG6A 1W93A 3DAGA 1NLUA 4UBMA 1XAJA 2WJIA 4OHXA 4X20B 3W5DA 1OHHA 5ERGB 4ABYA 2JI6A 3I42A 4EY3A 4NDNE 4PG6A 5LN1A 1UL1X 1NU6A 1PVOA 2JIRA 5EZ5A 2O48X 4JMPA 3EXEA 2B1GA 3K96A 2V5AA 1EVYA 4JLPA 4WKCA 1VJ5A 2G17A 3DDZX 1ABFA 2GDZA 4GDMA 4RYLA 5AW6A 1Y4DE 3RUDA 1ZPDA 1GADO 4JI8B 3RS3A 4MAMA 1SVLA 3B1FA 2KM1A 1YQQA 4HRXA 3LDGA 3PD0A 1Q16A 3OM8A 2GZMA 4HDNA 5KJFA 1EXNA 4G25A 1E0KA 1AN0A 4OBWA 1DNPA 4PQGA 4HDSA 4MVJP 1LZKA 1PSDA 5JZBA 1XRLA 2IEBA 2FDRA 4LVCA 4NH0A 3RC1A 4WCFA 3DYBA 5K09A 1M2OA 2FXIA 4QTXA 3ZZUA 4YBRA 5F2NA 1IZ7A 2R6HA 4NE2A 2OXIA 1JS1X 2XJ4A 1Q83A 3SHTA 4G1VA 3FWPA 3N5CA 1A5AB 5AOVA 3RD5A 4OXKA 2ZI6A 1FFDA 1GPNA 3LX5A 1UBJS 4UEKA 1O94A 1QRRA 4BN0A 1VYHA 3JQBA 4LXGA 3ZKWB 1JQJC 3ZS9A 3EFBA 5AJZA 1FB5A 3M4XA 3FMFA 3PTLA 3PNBA 5BQOA 1YAHA 2JCSA 1SZJG 1CEQA 1Z0FA 3PI6A 2GEKA 2GEJA 1QYWA 2WC1A 1MDBA 2A88A 2FH5B 2Q50A 3BC1A 3CISA 2D0OB 3UVEA 1YB5A 2P6PA 3EARA 3EGWA 4E1BA 3MOSA 3CRVA 3WK8A 5IM5A 3T9AA 3EXAA 5IS2A 2XKAA 2DHQA 1JVNA 1RHMA 2GNAA 3ILVA 1FUEA 2C5GA 3GQVA 5AKXA 4JLDA 5AUOB 2IIPA 1Z6TA 2A9PA 1W46A 2NVOA 4I1VA 1T0HB 2PUBA 1VL0A 5JSQA 4RKWA 3RSFA 2IEDA 2XV1A 2JZNA 1H2BA 4TMYA 5DEOA 4YPVA 2ENUA 1QNFA 1S2OA 2JFQA 2XUOA 3T7CA 3SXUB 3O9ZA 1KHTA 3UATA 4KO3S 4PGGA 1NIPA 3ETHA 1NAHA 4V03A 4NCAA 4AF8A 1O9HA 4H77A 3MELA 1FYXA 1T36B 3AF1A 2WWGA 2G70A 3AUTA 2FHPA 1KK1A 2C20A 2JCGA 2OORC 3HWWA 1Y1KE 2FWIA 1O87A 5BSWA 2WDZA 2J31A 5DW0A 3EA0A 1MO2A 4IX1A 4WH0A 3GB9A 3AHHA 3RK0A 1ZJWA 5IASA 1ZAKA 4B5KA 1ZXXA 1UDXA 3TFQA 1Z3IX 4K9RA 1MUUA 4AWBA 5ENDA 4RTSA 3WIUA 1J9ZA 4FDVA 4LYEA 3BGWA 4TRMA 3RANA 1CDDA 3LE8A 5AQEA 3SU8A 5IW8A 2VRNA 5KSOA 1MR3F 4GQAA 5KYTA 2VF8A 1ISFA 3HHPA 1D2RA 2J6IA 3ZHTA 4I2NA 2IITA 4XX1A 2YKGA 2OBFA 3SIRA 1JAIA 1MXFA 2WG1A 1CZRA 5HKOA 2GO1A 3EXFA 3PFFA 3H75A 3QM1A 2HJVA 3LY5A 2ONCA 4IUYA 2VOEA 1DBIA 4ZT5A 4P3NA 5T8KC 4FEEA 4A0FA 1SD5A 3NDRA 1GKKA 1H0KA 3PNPA 3QVMA 3OTWA 1QZTA 4GXNA 4RYDA 5AKEA 3PC2A 2ZUUA 3SHQA 1WETA 3EZLA 3RFCA 3L7OA 1BFKA 5JY6A 2X76A 4HXEB 3HKCB 1WXXA 4NBRA 1X7ZA 3QUTA 4XWAA 2QMQA 2MMCA 3AUFA 1N4AA 2GN6A 2PLAA 2POQX 4PNZA 4OY3A 4AMUA 1ZNZA 3KOOA 2VTBB 3DOOA 2XEXA 1KPGA 5I7RA 3CLSC 2NVBA 4WA7A 3DT9A 1ESNA 4EB6B 3RKSA 2QVZX 1Z2CA 5JJKA 2AMYA 1QLHA 2FPWA 1QH8B 5A3RA 4MR8A 2ZTMA 4M83A 1W2HA 4LTNA 4KO4S 1W36B 4EPRA 4D6YA 5CDHA 3WJ2A 3IIKA 4BLUA 4ZQFA 3TQSA 1UCFA 1NXTA 3DHWC 2J3DA 4FX5A 1FMLA 3G2OA 3OIVA 3LKVA 3MCTA 2VF4X 4KO2S 2BGGA 3OEHD 1NJ1A 4BKRA 1UBTS 4NYMQ 3TLYA 4DLBA 2X0FA 4EQ6B 3B6MA 2ZRAA 4JROA 2I2WA 2UZAA 3R5TA 4CDMA 1BXKA 4MKXA 1V8ZA 1VLLA 3R6WA 5DNAA 3WSTA 4XLZA 2HDHA 2OEPA 3WRYC 3BRCA 4YCCA 3NHBA 4FFSA 3I4FA 5FB3A 1JEAA 1JHPA 2D74A 3SF8B 2RAPA 2RHRA 3SFTA 1TDJA 4ZYWA 7GPBA 4URWR 3W2IA 2KB0A 4QUBA 4HLQB 4GR4A 2XRFA 5HIMA 5MDHA 3HFRA 2PVSA 4RPLA 3K3PA 3VNAA 4LOIA 4WXHA 3RVBA 1XEWY 2FPGA 3PXAA 1CS0A 1OE0A 4MKIA 1JDBB 3KKZA 5LBTA 2ZUSA 3WNQA 4F9FA 3VPGA 3VU0A 1Y9ZA 4ND8B 1SK8A 1OW3B 1T25A 4RE5A 4UM5A 4YLEA 2GAOA 2DT5A 1QVAA 1ZIYA 3HN6A 1ZJ5A 3AKDA 3CF6R 1P9RA 1ZGCA 1O1YA 3F4BA 3PWZA 4J7XA 2Z2ZA 4R5MA 4W6ZA 4DDHA 4EYSA 4ETIA 1VB3A 4IHQA 4JXXA 5I7OA 3IE0A 3AY0A 3PL5A 2V0CA 4COOA 3QKWA 1SVOA 3R7FA 3WYNA 4BNDA 3HJFA 1K8YB 2GJ9A 3HYNA 1XRPA 2IDZA 4ZCMA 3KJEA 4OHUA 2HQBA 3W3ZB 1HKUA 5FOSA 4C2AA 3ZW8A 5JD6A 3QLJA 5EQDA 3P9YA 4M21A 2NUPB 1DELA 4R9SA 5FADA 2A94A 2PSJA 4NBWA 1DAKA 3SZMA 4ZYLA 1UC9A 3EMKA 4BPBA 4Q02A 2KYRA 4GLOA 3AF6A 10MHA 3CTMA 5AQ1A 1D1SA 4AS3A 1E4VA 2QL9A 2PQ6A 3TDMA 1CEYA 1VCHA 5JFTA 3V3KA 4K9QA 3AUYA 1KZ6A 1X7DA 4QARA 3Q7TA 2ZSHA 4DILA 3Q88A 1JQKA 1L6RA 4RY0A 4IIJA 1D2EA 1UM9B 4FYHA 4UHDA 4BQIA 5ICCA 3IAM1 4JLKA 3UF0A 2HK7A 1LJLA 3K5HA 2AR0A 3CWQA 1QBKC 1D07A 2PL1A 3IPYA 3NFYA 5ESDA 4EM6A 2HBQA 3CN7A 1FMJA 5AICA 3HXKA 1NDUA 4OMCA 4WZAE 4NOJA 4DM4A 5K0GA 2CUNA 3T5CA 2Q1YA 1XTUA 2AN4A 4F97A 4MQEA 1G7RA 1GWNA 3KRTA 5FPHA 1DWQA 4HLDA 1IPFA 1RQ2A 1Z0SA 3HCPA 5A7HA 1C9MA 3GLFE 4PRYA 3RS4A 2VJOA 3LPNA 1GPWB 3WI7A 1YBHA 1QB7A 2W43A 4L50A 4BMVA 5FKJA 1MBZA 3TL3A 3F9IA 2MSLA 3PDJA 1UJ4A 4YJHA 1K88A 3N0TA 4B3GA 1K8ZB 3DLBA 5F98A 1MENA 5L3SA 2Y1CA 9ABPA 5HSGA 1H3EA 1CUUA 3K2QA 3ZBUA 2B5VA 4MVWA 2ODEA 4RZ3A 3K94A 2ZJ2A 2DULA 1QQ5A 4FEYA 3A1CA 4GZ5A 1MFZA 3OU7A 1AUXA 1SCAA 4EVQA 3NVKI 4M89A 1YCFA 2A5DA 4AKTA 2A2ZA 3EAGA 2EZ9A 4BNMA 4EAAA 1LZLA 2ZJ0A 1XA4A 1OBOA 4OGLA 5H9WA 3LPLA 5D01A 2B99A 2GBGA 3BXEA 3BTVA 1G6Q1 5DBOA 4G81A 4DQKA 1MO4A 3B3FA 4HUQB 4NF2A 1NR1A 2E6UX 2E4WA 4PZ9A 1EGHA 2X5OA 1YS1X 3AIMA 3DMGA 2CXRA 2EWWA 4K8OA 2J0VA 1J6UA 4E12A 4EA7A 3Q7IA 1AKRA 1UM8A 4NZPA 4EX6A 2BFFB 1IZZA 4A8HA 2WLSA 5IWAB 2QZZA 4WJZA 4WSOA 4O8CA 5LDDC 1G17A 4MPRA 4YPFA 4ARVA 5B7QA 3HP4A 3U4QB 2CFSA 4BMDA 1RRVA 3HY3A 3LV8A 3KLNA 4CQNA 2IYAA 1VLQA 5BN4A 2P62A 4IW3B 4BEWA 2IXEA 1PT6A 3HQ4O 4G5SA 4PLZA 5BR7A 4C6TA 4DRXA 3ZEIA 5BYKA 3Q8MA 4BQSA 4PLPA 1DQPA 4K9KA 2FPKA 3SPXA 1MQAA 5AVJA 3PLRA 4XR9A 3QU4A 3ZWMA 1GKYA 2QXYA 4EFLA 1UBOS 2ZRMA 3KNZA 2QT0A 4AF6A 2OGUA 4DLPA 2ZB2A 3THWB 4KN9S 4TGLA 5J2TA 5KUTA 3DSRA 5LP1A 2X4IA 3RIMA 2UAGA 1E98A 4TLDA 1V3QE 2F67A 1JQDA 5EWLA 3M6LA 4UBJA 1WSDA 5IT0A 4B7ZA 1DI0A 4M1QA 3FZYA 4J3NA 2PSEA 3AB7A 1Z45A 2CNBA 1ZISA 3KU1A 3PR1A 3MGAA 5FD8A 4ZFNA 3D8HA 1E3EA 3NKVA 1X7YB 2DPHA 2LZ0A 4Z2YA 1Y80A 3EX7C 4JP3A 3N0RA 2BFEA 2CJXA 3JZDA 2WAMA 3QSGA 1XZGA 3V3TA 3IR5A 4NV0A 1GNRA 4D4LA 1AXGA 2ZTHA 5BWNA 2O3RA 3P9PA 4V0MA 3SMVA 4BGIA 1GFSA 1P5HA 4RQAA 1IJEA 2Z6UA 2BY4A 1KYYA 3FA2A 3OVMA 1AS0A 1VJ0A 1Q5PA 3OIWA 4LVNA 4IG4A 3GA0A 4KV9A 4NZZA 4Q00A 2GB4A 4S1VA 3GRYA 4CF6A 3PBKA 2BP7B 3D3KA 3HO8A 4M8KA 4RQBA 1NRIA 5DYWA 3HE3A 4DARA 1D6SA 5MGNA 1XRSB 2IZOA 1AUQA 1M6EX 1TF2A 1DDOA 2OHHA 3IB3A 1AKVA 1T4BA 1U7DA 3BE6A 1Y1SA 4GMXA 4TT8A 1G5HA 3IIJA 2IUUA 3ZPXA 4A8PA 5IT4A 3B82A 4OF4A 2XVAA 4CVNA 4QM7A 2CLDX 2G72A 3C6QA 4CQLA 3FVVA 4F3RA 3HXMA 4J2OA 2AFIE 1NXQA 3QTLA 3SM9A 3SVZA 4QNRA 2AX4A 3IBGA 1FU4A 2XUDA 4EO9A 2GVZC 1II0A 4N0EA 3VZRA 2J07A 3RI3A 3S6JA 4AUMA 3R0IA 1OFGA 2B9EA 4FIZA 4L5AA 1QONA 4WZAB 4DG8A 5KTTA 1CG6A 3ORRA 3I28A 2FPXA 2X1HA 1TKAA 2ZYUX 3QPBA 1U04A 3OD1A 4Y1EA 4JLBA 3ZWYA 2QQEA 3HCCA 3CBQA 2NG1A 5AVZA 4U3JA 3PWKA 3VHLB 2KE5A 4BNJA 1OX5A 2ZITA 2G8NA 2RHLA 4UHJA 1WPQA 4X1IB 4RIFA 5DCWA 1PQUA 4KLAA 1J0EA 2BI8A 2QF7A 1H0SA 1WVIA 3AF3A 1IB0A 3FCAA 4U7JA 4XJXA 5G0WA 1NKSA 3QKIA 3BD6A 3MWJA 4DJJA 3C6BA 2CLIB 1XK6A 2ZJ3A 3S70A 5C1DA 4TKUA 5FTWA 3Q8LA 5EP1A 1XYGA 4MVJG 1X1RA 5DPMA 8ABPA 2WKRA 5L3SB 4Q7LA 4LS3A 4C88A 4FUQA 2WOJA 3OPXA 3AG6A 4CTNA 2QL7A 4QEDA 3L5KA 1T6NA 3I4LA 4IF4A 1Z7GA 1VSVA 3HB4X 2Y0EA 4CNBA 4Z86A 4HDQB 2A8YA 4Z4IA 4YTEA 3NKLA 5ELMA 1HRKA 1WUHS 3OZVA 4HZGA 3H5NA 1CY2A 3NOQA 4BO4A 2W2XA 1Y4UA 1KVUA 3TW8B 3K5IA 1U2QA 4HFMA 2VQ6A 2VNHA 2YHUA 5IF9A 4KQKA 4ZO7A 5MN4A 1YL5A 5KYYB 1O9GA 2F43A 3O31A 4HLUC 1CJVC 1ECJA 3GWZA 1RAHA 2A9QA 2EBWA 3B48A 3E7XA 2IUSA 1IXZA 4L4XA 4OHCA 5K9ZA 4MRNA 3LFHA 3BZBA 3MJEA 5E7JA 4GG1A 3WE7A 2UZ1A 2CV0A 4FE3A 4BLSA 4OQLA 4QNMA 4JUCA 2XDYA 5SZIA 1IH8A 4WZBE 3VH1A 5BV0A 2GOYA 5AD1A 1UJCA 1OLUA 4HOYA 4B3JA 2EW2A 3Q3VA 4X93A 1E1DA 5IAEA 1PK7A 3GOQA 4F2PA 1WDLA 1YULA 3JR7A 1KEZA 2EWMA 4NJMA 4QULA 1PLLA 1XRRA 5BNTA 3NT4A 3UT5A 2QSUA 3QEMA 5DW3A 4QTYA 4FGSA 3LT4A 4R1QA 1DBWA 1Z3CA 1IM2A 4MEJA 5ALLA 4F4JA 2R00A 5H80A 4AZVA 4WZZA 3AIKA 4H17A 2GGSA 2JGRA 1QV6A 3LSYA 4QM6A 3TQOA 3AZOA 3N59A 3R3VA 1E3TA 4L6IA 2VHCA 2GA9A 3BXPA 4RD2A 1C7ZA 3R7WB 2ZSFA 3LC7O 1T9KA 2F2TA 2R68A 1NI5A 2FW6A 2ZR8A 1I3NA 2RKOA 4L3WA 4DSTA 3RUPA 5EIAA 1T0PA 5KX5F 5L51A 1K3FA 4OL0A 1USGA 3AZPA 3SF8A 4GL2A 3D7MA 2XHEA 4X8MA 2PZAA 2HNBA 2YNMD 2QVBA 3MQFA 1XU9A 2ZU6A 4DNPA 5C37A 4IINA 2V6GA 3ORYA 2PJZA 4HHEA 4OLBA 2HMYB 2XOXA 4MIKA 1P4JA 1PGJA 3ZOZA 3AJAA 1RZUA 4ZO8A 2DE0X 1H66A 1A71A 3MWYW 4IYRA 4X95A 3ZY3A 5LOVA 1E89A 1JKFA 3H3FA 4HSGA 3A4IA 3OJEA 2PEYA 1LK7A 2PMWB 4ZVKA 4AZ3A 3ACDA 3O4FA 1YJ5A 1N2CB 5CD9A 3JALA 4M1MA 4D9GA 1PR2A 4B4VA 3JWEA 4B87A 4EFNA 1MKYA 4OP1A 1WMAA 2UXCB 2LPMA 1U0HC 4UOEA 1GLGA 4EKYA 1RJ9A 5E3IA 3ROMA 1JH9A 3DL4A 4GYJA 1HRDA 3TNLA 4IXNA 1KAEA 1TO2E 3CVXA 1ENZA 4TVSA 2YY6A 3NHUA 3QE9Y 1XF1A 3NBXX 4K40A 3RTGA 3ZHOA 2WV7A 2G6TA 2Y3IA 3HDVA 4O2BA 4A6XA 1OB5A 3B38A 2IX9A 4ZPJA 4ESEA 3GLHA 5L3RA 2NLOA 3RJTA 3CF4A 4TXMA 4JGGA 1Y7LA 2BBSA 2XQVA 2UVDA 2GBCA 3O26A 3VV2A 3EEBA 3ZLJA 2VBCA 3BMXA 4YIKA 4BO0A 1DUSA 1OFTA 3EUEA 3QKRB 2Q9AA 5AOBA 4LF4B 4RU1A 2X9QA 1FFEA 3GP3A 4Q03A 1JEYA 2OPHA 3ZE2B 5KCZA 4GDFA 1O0CA 1CWUA 521PA 4DLWA 1KRHA 4I5FA 4KQWA 3Q12A 4Q3EA 1L7RA 1TLTA 4EHIA 1NVDA 1U0BB 4LVUA 3UOWA 3OOWA 1GT91 1P75A 4I1OA 2IU0A 3OFJA 5EUCA 2GZSA 2ECPA 2J9GA 2JH8A 2PXCA 3NP7A 2YXPX 3WKDA 3WGVA 3I0MA 3V2HA 1W35A 1U7PA 3OD5A 4QOFA 3BMCA 5FBLB 4E5DA 3WAKA 3G2PA 3STYA 3AFOA 7REQA 3DVAA 1NNI1 4M0DA 5FPTA 4V0QA 2X0JA 3TLJA 1U2GC 2O3SA 3DONA 4BL5A 4S12A 3GLHE 4FD2A 4LYFA 2YZNA 3K1ZA 5IT5A 4I8XA 2WJZB 3LBAA 2IYYA 1OC4A 4B81A 1Q77A 1DTEA 3AVTA 4G09A 2EJTA 2V7VA 2W93A 3EPRA 3ESZA 4D9KA 3GAAA 4EVRA 1JHYA 1GUYA 1TJ3A 1X1EA 4XVHA 4ZVPA 5M04A 5IJAA 2C7GA 4J07A 3C3JA 4CT4B 2ECKA 4IIXA 1NVWQ 3ICOA 1M2OB 4RETA 2FP3A 2YHSA 3IVXA 2C9MA 1Z6PA 2AC7A 1SKYE 4CL8A 3EBOA 2VCEA 1FFXA 3F0TA 2C5BA 3B52X 5DSZA 4C9BA 4NJEA 3Q7EA 4EG8A 1E9EA 1ARZA 1Y4SA 3AV3A 1HG0A 1PK8A 4ZALA 4AO8A 3FH0A 3TLKA 2QDXA 2BMAA 3F5MA 1I6LA 5ANRB 2RKBA 5CFPA 3UIEA 1H5NA 4ENWA 1W52X 3FMOB 1T9GR 3C70A 3H6KA 4C4TA 2WYHA 1T4CA 1Z6XA 2XYVA 3ISJA 2LVBA 3WHLA 1HSOA 2JZCA 2CLMB 4JI0B 4LJYA 2J45A 4MP6A 3ZCRA 4RABA 3WDSA 2W0MA 2GVNA 3IUMA 3P2MA 1XVVA 4LYGA 3PGXA 3IP9A 5EMMA 1R0KA 3LPDA 4ZVUA 2YZGA 4FP9A 1XVAA 1YK0A 1KYVA 4R8MA 3T9CA 4NU8X 4G0VA 3GD5A 4OSPA 4Z0TA 5K8VA 2BVNA 5LZ5A 3G8BA 2ZJAA 1I3OA 1A1SA 2C9CA 2QTGA 3HUDA 4E31A 2H57A 4TS4A 4DIUA 1ZD5A 1XQVA 4ETMA 4MUJA 3BX1A 5ILQA 3PX2A 4EENA 4YUZA 1J2YA 3RJ5A 3BVPA 1OGYA 4I6EA 4OPMA 1JHUA 4QICA 2DMRA 5KTRA 1QWSA 2WI8A 2GCEA 2D3WA 3HUUA 4GT1A 4JODA 1JXQA 1MGOA 3AUUA 4J0GA 4UU0A 5I9SA 2Y1LA 4MO2A 1IDOA 3JQFA 3T7DA 3IJPA 3U9LA 1F9EA 3I9OA 2IPXA 4PZUA 4REQB 2AHRA 2QB5A 3VYRB 3DMTA 4QL3A 4GBGA 1RT9A 1Z2AA 2M98A 4S1PA 3V9AA 3GJ7A 3VC7A 4EATA 4DMGA 3NBFA 3FSEA 4BQFA 4H7HA 1Q91A 3ZHUA 1ST2A 4LE2A 4FW8A 5FUYA 4C0BA 4CTJA 4D44A 2W4IA 1C1YA 2I6UA 2JIMA 3QHAA 1EB9A 2ONZA 3IP3A 4L72A 2GJAA 1HDGO 1K92A 3G8AA 1MPXA 1W88B 2W48A 4QTZA 5JANA 4HLUA 2VJMB 2IGTA 2NTNA 1O6GA 4KPUA 4W5NA 1T2FA 1VI5A 4E5VA 2PV0A 1T9DA 1JIUA 1ZQ9A 1G41A 2HHAA 2HPHA 1KXJA 1MO3A 3CB2A 1XEFA 4MX8A 2O1EA 1E6CA 2V5UA 5EJFA 2R5FA 2XVXA 3DVSX 4QHYA 4US0R 3AY6A 3A6GA 4QODA 4PR0A 4RJ2A 4JR0A 3LHIA 1A8HA 2NM0A 4RHUA 3SK0A 2C99A 4LHZA 4U9UA 3T3GA 3OQIA 1YBMA 3IBCA 4K7JA 1GKUB 4HZIA 1D2HA 3BK7A 1KKMA 2NYRA 4MWEA 4NJEB 4P82A 4QLOA 5GP1A 4HATA 3OQJA 3VVLA 4DRYA 4FE4A 3K9HA 5BSGA 1JBQA 2AN5A 3M82A 4NH4A 3IV7A 2O7QA 3AP2A 4C7JA 5DGTA 3V55A 3BQ9A 1DINA 3PX3A 1RRPA 4C04A 4IZOA 4AVYA 3QY9A 1FYDA 2B4RO 4R6WA 4EJSC 3CRMA 4TKUB 4XRGA 3GARA 3QIVA 4AECA 3AF0A 3NFRA 5A05A 4HEQA 5LMNB 1OXBB 3E7DA 1IN1A 1PJCA 4EFKA 3WJAA 2CSUA 3U16A 1CSEE 5IC6A 2GK6A 3RYCB 4WKPA 3WXMA 1HLPA 2FXVA 3BK1A 1I80A 4HT3B 3VPBA 1RQRA 2DU8A 5AVQA 3RYTC 1M1YE 2GKSA 3H5VA 2WQ6A 4DV4B 2CNNA 1I4EB 4OP3A 2NN3C 4V02A 2YY5A 1ZOPA 4URFA 1DJQA 1BHQ1 2CHEA 2W8BB 3H1TA 3KT6A 4QNNA 1M2GA 3R9XB 3GJ6A 1P4AA 3SZ3A 4OHYA 1XWIA 1DBQA 1EVQA 5FL7A 5EG5A 3ZLVA 1IB6A 1RE0A 2Q3JA 2XE6A 4ZCRA 2HV8A 5B1IA 4EBFA 5EJEA 4UD6A 4DBLE 5BNZA 4YI5A 1W73A 4J49A 4EX7A 1U28A 2X1LA 2GHIA 1AB6A 4DIFA 1OJ7A 1SXJE 1DBSA 1TGVA 2EP8A 3C15C 1JIXA 1QFMA 5DXFA 4N82A 3U19A 3NHRA 1PZHA 5LJIA 1T2VA 4NARA 4EFMA 2H8GA 4QEZA 1QQAA 1Z29A 1HLDA 3OJFA 3C8ZA 1AT1A 1OJLA 2D00A 4DSZA 3W4IA 1RKUA 3MFYA 4A2PA 4URVR 1FPMA 2BHRA 4H7KA 3QBJA 4O3FA 3S55A 4FHFA 3C8UA 3A2LA 5CXQA 3BJZA 5KPJA 4OHFA 3GLIE 2Z2IA 1F2DA 3V8VA 5DU2A 4YXWA 2K2QB 221PA 3N2GA 1F8UA 4U2CA 4C01A 3HBNA 3QWIA 4DY4A 2Q0QA 1XQ9A 2IW1A 5T4EA 1TA0A 5EMLA 3L06A 3BXOA 1U3TA 5K0TA 1V3VA 4FJ2A 3LVRE 2HYDA 2UYOA 2I22A 1E8DA 2Q3LA 4UMVA 1RRGA 1YT5A 3H8JA 1WHTB 3GMSA 3IBTA 3F3MA 1P2DA 4GE3A 1QBGA 1QGED 2BFDB 1I13A 2D8AA 3DEFA 2CHUA 3P9SA 4MVJA 4QRDA 1RP7A 1HDYA 3CZ5A 3DOIA 4GPBA 5EWJB 5T3YA 1KRXA 1NMXA 2FX5A 2IVFA 4H7PA 3TB6A 3V9PA 1FPQA 1BX3A 4ML3A 3VA7A 1TO1E 4GP9A 4GBMA 1SC6A 2B34A 2CFOA 2YXEA 4KWEA 1FVFA 2R1ZA 6GPBA 4PSUA 4TWBA 3IL2A 3EZ6A 3V1MA 3G2MA 4AUKA 3KT8A 5A5DA 2VSXA 4RQTA 4BXOB 3HTXA 2RIRA 2C1EA 3JD1A 1R15A 1QRUA 1MFPA 1Z4KA 3EGVA 1N3IA 3PGKA 4K0RA 1A7UA 1AZLA 2FEPA 5F33A 5TV2A 1DCKA 4DTIA 2PUJA 3IOCA 4NOMA 4DDWA 4PC7A 3IODA 3NNDA 1IQ0A 1Y3FE 5EHQA 1RU3A 4I50A 5AVTA 1CRPA 2OCPA 1O89A 4NEGA 5ALVA 4X8OA 4ZRDA 3W5CA 3TW0A 5D3ZA 3MMXA 1WNFA 4TVKA 3D2CA 3MBIA 1KWGA 4XR4A 5E2IA 1YKFA 4YRQA 2EOAA 3M49A 4BFYA 2CUZA 3E9CA 4P83A 4YBZA 4MYTA 2R8XA 5JNUA 4JYZA 1CR1A 2W37A 4HYQA 2JIZA 4NCKA 2C5SA 5CFMA 4B84A 3PEEA 2FW0A 2ZR0A 3VHRA 4I4TA 4JEIA 4OUKX 4NJOA 2D0IA 1DVRA 2VZEA 3U1BA 3SKVA 1IBMB 3FSRA 4MUKA 3V1LA 5HM8A 5A3VA 4OKSA 2NP7A 3WHPA 4EKGA 2G25A 2UZ3A 1DXQA 3QUQA 3OA0A 1Y8ZA 4M6WA 1JLRA 1Z22A 3GEBA 3ZR4B 3SHWA 1NDQA 4ZODA 5IKXA 1CNFA 1QTNA 1JE0A 1QCYA 4IQGA 3OQPA 4J0QA 5L4SA 5EMNA 2RG1A 3BPSA 5FAXA 2BMDA 3BQNB 1IEXA 2P7IA 4JNCA 5IJ0B 1Z5PA 4I50F 4JI2B 3K4PA 1B23P 3QXHA 1PUJA 2EJUA 4YGYA 3JQ6A 4X8LA 2FWRA 2EW1A 1XZBA 1GZ4A 4L73A 1R6TA 1UOOA 4D96A 2O57A 5D86A 4Z8YA 3RRBA 1L5YA 3A4TA 3QFHA 1JDSA 1J20A 1EJ2A 4F2DA 5BOSA 1GOTA 2VEDA 4J0HA 3TVTA 4KPEC 3Q6IA 4CMBA 2W11A 2VZ8A 1OWOA 4CGYA 4R2XA 3RIYA 2GRJA 1XXHE 4Q1DA 3VGJA 3C6XA 3CEHA 3WLEA 5CXUA 3VVBA 4JASB 3AJRA 4XWTA 2RH9B 1O95A 1Z7WA 3L8EA 4JB8A 1YI8A 2HSZA 3DHEA 4JC8A 1KPIA 2J3IA 2FEOA 4BRWA 4DCVA 2A1UA 4B7CA 1RM3A 1YUMA 3EE6A 4K03A 1J0BA 4IHAA 3HC7A 5TX7A 4FMDB 4QGGA 1DKRA 4EHAA 2BP7A 1CUCA 4TM8A 4FE7A 3VOSA 4DYDA 3JD0A 2DPXA 4BBAA 3EW7A 1OLXA 4K6HA 5A9RA 4G0QA 3D8RA 1ULAA 4EUSA 3LQ4A 1RW4A 1XPOA 3FNQA 2IHNA 2VP4A 3TQHA 5K3BA 5ILGA 3TF5A 2PZKA 4LZJA 4EO7A 1Z0UA 5GGXA 4ER7A 2NV0A 2CLEB 1LXCA 3LM8A 1ORDA 4AO6A 5BV2P 1BE0A 3JASA 4EG5A 4YXWD 1J33A 1GTMA 1XX6A 2FNAA 1WTCA 2A14A 2YWEA 2A5LA 1NJFA 2Z43A 4YASA 3J7AC 5CFQA 1FZTA 4OI4A 1R8JA 1KY5A 2QD4A 2VPYA 2WUDA 4DANA 4G5HA 5LQAA 2WIDA 1AB5A 4NCXA 1EVLA 2QORA 1EXWA 4A6EA 4R3WA 1L4FA 3HXPA 1E7QA 3WK9A 1KL7A 3TNJA 3LQ2A 3T5PA 1PQWA 3DKRA 5AKKA 1M0WA 4B1FA 2PQ2A 3CMCO 4N7JA 4Q6WA 3TZKA 4M0UA 3KFXA 1IIBA 4HPJB 3UM9A 2VT3A 3QJ5A 4GWLA 5DV9A 2NZ2A 3AKCA 4X63A 4DLNA 5A02A 4MHTA 2FRVA 1A88A 2AR7A 3M9XA 4K6CA 3ETLA 1CQZA 3N86A 5EJIA 3MMNA 4EZIA 3VR3D 1QANA 3KKPA 1XCGB 2A4MA 3KPUA 2FWJA 1V9LA 1AGXA 2PTHA 4YP7A 1R4NA 1U2TA 3IUQA 2LCFA 3RC3A 4PANA 3UBMA 3EG5A 2OCDA 4KITB 2ZXUA 1CVIA 2PT6A 3NEYA 3VHXA 2NSYA 3IILA 1AXRA 4RGBA 5DM1A 4FR2A 1YKSA 3NR2A 1DQZA 1C41A 3OQBA 4NATA 5GPBA 3DZCA 2X8JB 2X0EA 1Y3DE 2Y1GA 3P32A 1SQFA 1LLFA 5BUQA 1Q50A 3A6LA 4ALJA 1UEXC 4GPAA 2C2WA 3BXXA 3DO8A 3EWAA 3Q3IA 1GZDA 4Y6PA 1XD2B 4Y9RA 3IP5A 5ARDA 4ZAZA 1P5JA 4E15A 4Z1MD 4B7UA 3H1FA 5TQ2A 2HU5A 1J8YF 2J7KA 1QIKA 2H5LA 4W99A 5BSTA 1IFXA 2ET6A 3S8YA 2F1RA 3I0NA 2BR4A 1TCUA 1PE0A 1YS9A 4JB2A 4S04A 1T0IA 2CEKA 2PV7A 1KDPA 1SHZA 1G98A 1JJIA 3AJEA 1FP7A 2CL5A 3DZBA 3FM9A 4G1BA 4IGEA 4L51A 3VNQA 3FZQA 4EHJA 1DT5A 4PN7A 4Z0HO 3N2GB 4ZHQF 4LF5B 2YWXA 5DBFA 3UV6A 2DR3A 2W58A 2QUAA 2VT7A 3E8MA 2A0WA 4YH1A 3OOYA 5SYNA 1KI9A 2REBA 2PLFA 1YQEA 3GRAA 3OF3A 2JH9A 2ZJFA 3IURA 4LFAB 2R84A 4FOPA 1M9NA 4GP7A 1H94A 1YB6A 4ZOLF 2GCPA 1WTAA 1U0EA 2ZYIA 1RRMA 3K9BA 5D00A 1IAQA 5F5XA 3A25A 2DVMA 1FDIA 2EJVA 2PBZA 4PSVA 5J2TF 3PX7A 1EX1A 2WSBA 1USWA 4WN9B 2FSFA 3UHPA 2OLKA 2ORIA 3BD9A 3ZVNA 4AS2A 5CVVA 3LBHA 2DSNA 1JT9A 1QHIA 3N2IA 2ZSDA 4AMGA 3CE6A 3O73A 4JXKA 4DV7B 2GJ4A 3T7SA 1II9A 3RABA 4BVBA 5B12A 3P9NA 1GJRA 1OV6A 2XYGA 5DBEX 2XSZA 3WVNA 4DN6A 5C32A 1B16A 1MW8X 3KEMA 1LRKA 4PFKA 3ANMA 1KQPA 5BSUA 1GNVA 1PJRA 3O0DA 2O8EB 4FUTA 4GXQA 4MNTA 1YCGA 5HCIA 5HIJA 3ECCA 4ZJUA 4QREA 3B1JA 3LA8A 5HQ3A 5ALUA 2GAAA 4XOUA 4IHJB 3R6DA 1T3TA 5KSWB 2IH4A 5HTOA 4XARA 3RVLA 2Z3WA 1NUTA 3ZE8A 1TYCA 3AHGA 4NLLA 1U8ZA 1JWBB 4G0MA 3SR4A 1M6VA 2BKXA 1P60A 2PNJA 4TS3A 3IQEA 2R751 3PQ3A 2NUPA 2BL4A 5J1TB 4QC2A 4E4YA 5LOVB 4XJVA 1IZ9A 3T7EA 5AM0A 5KQPA 2O05A 1EP3B 1GPBA 1YR1A 1JR4A 4XCXA 3VNBA 3KWMA 3E23A 1MA3A 4PGHA 1F9AA 3SQNA 3DV0A 1RWOA 3FETA 4BB0A 2Q1TA 1H65A 1XZHA 1U31A 4BVGA 1W59A 3C4QA 3DMNA 4M46A 2JJ1D 3D64A 3A6FA 3AEKB 2DFKB 4HZUA 4DZZA 5I7VA 4FR5A 1MZPA 1GAXA 2R3SA 4ZDWA 1BOFA 2B83A 3LRTA 3BWYA 1RD4A 2L17A 3HJGA 4J03A 1BWPA 4Q1EA 1I7LA 1US8B 1Y8RA 3RBAA 5L40A 4HDKB 3C3PA 4BXOA 2E7ZA 2HREA 2FPGB 3EGEA 4QXPA 1CW2B 1IXSB 4NYIQ 4E5YA 4HGQA 2WJAA 1LQUA 2J3LA 3CNEA 2JGLA 2FR1A 3PV0A 1S1CA 1N6IA 4HQLA 4ZI5A 4GYKA 3O2JA 1Y7TA 4LV8B 2GPYA 4XYBA 2Q2NA 4Z0NA 5TQVA 1ZXBA 3LYHA 4YLYA 1U98A 2IYZA 4BO7A 4PRLA 5L95A 1VSUA 5JR3A 5GADl 1GZ7A 5TLSA 4XX0A 5T64A 4YPOA 2ZIZA 4JCCA 5BURA 2X4GA 4KR7A 3WRVA 5G3ZA 2IS4A 4GQIA 1Z37A 1Z0ZA 2QGFA 2Z1NA 3C3WA 4JJGA 4S1OA 4TV9F 1Q1QA 3JSAA 3E8SA 1EAYA 2BFDA 2PNFA 3STUA 1UJ6A 4JQCA 3W06A 1IY1A 2BKUA 4GI1A 4MRMA 1L5KA 2AJTA 1H69A 3F6SA 2HUPA 3PDIA 2VS1A 4B6OA 4C7KA 5FULA 2E5WA 2HCJB 2J3QA 2IXAA 3DNFA 1PFYA 2AD1A 3JARB 4GR5A 4N18A 2G06A 4CI0B 1GL7A 1RYDA 4Q3AA 3MJCA 1P33A 3A70A 3V6MA 4BATA 4NNPA 2M1ZA 3X1KA 4CLXA 4OHBA 5AVUA 1ZD1A 2JF0A 2MSNA 1V5GA 3PNYA 1OZHA 1AURA 1HT1E 3HO1A 2CXPA 4Z4GA 4TKVB 1PYDA 4QG3A 1OXKB 2PRYA 2JHCA 5AKJA 3WTCA 3VPFA 3K09A 4RL4A 1CZKA 5EZYA 2P1ZA 5LDGA 4EUEA 1OT5A 4R40A 5DGDA 3ZV4A 3ANSA 3HCEA 4QYMA 4UEWA 5CM9C 1WY5A 3ROPA 2AI1A 3U0BA 4D9MA 3NONA 5ED4A 4FFBB 1GXSA 1SC1A 3C7CB 3URMA 1J06A 4MK4A 2QLTA 2ZETA 4ED9A 5E7IA 3W8DA 1ZESA 2P9TA 1XE3A 1SCKA 4W1QA 4EEKA 2DR0A 1SC3A 1XD8A 4ER3A 1LC3A 1X38A 1UK9A 4TLEA 4PG4A 1XRNA 5KTKA 3NBUA 2W6ZA 1GZ3A 2ZBVA 2ZJ5A 1N8SA 2Q99A 2WKSA 1GYQA 3LD9A 3QOWA 2A86A 4FU0A 1FK8A 2CB0A 2QTLA 3WLMA 1MIOB 1Q3HA 3GW8A 4C20A 2NYAA 4KH1A 4MROA 4KE9A 2VAWA 2WAXA 4K9DA 3V33A 4WX2B 3A1FA 2R0QC 3D1VA 4QGBA 4JL5A 4JLSA 5G3YA 5KOJA 4EY4A 3EY9A 2FEWB 2V96A 4U0KA 3UK1A 4F12A 4HS4A 3MINA 4OFWA 5HILA 4FYXA 2ONJA 4DGSA 4HWSA 4X8HA 1KVTA 2JLVA 4LDZA 3WLPA 5JQWA 4MINA 2P3LA 2A5YB 2X14A 3RHSA 3ER9A 1Q57A 3FMVA 3T41A 5HZMA 4M1KA 5H3CA 2OKGA 5TPWA 3UOAB 2XUQA 3ENKA 3U3RA 2FPMA 3W5UA 1KOGA 3R23A 1JAHA 1VCMA 5E4TA 3OH8A 1RXYA 3BSFA 1P2FA 3BMQB 1J97A 3HUEA 4CRWB 3AVUA 2BMEA 3BORA 4IOJA 2PAAA 4YRSA 1JUDA 3NEPX 4QPCA 3ZCUA 4DJAA 3BHJA 2C94A 5CP8A 5FJJA 2QVXX 1YZYA 1SUWA 2XZOA 1I3LA 2PPVA 3OJCA 3QP9A 2RKWA 3UAXA 1IATA 5DTMA 2JCVA 9MHTA 2LCQA 2EFHB 3NBZC 2XAAA 4C07A 4D5GA 2R65A 4UMFA 4CCAA 3NTUA 1ZLXA 3IXQA 3ND5A 3V46A 2R6R1 5BN5A 2XKKA 1RAAA 4EJ6A 1YMVA 4XD7A 1QCZA 1LPPA 4YAUA 1NM5A 2XMZA 5G41A 2FSVC 4UZSA 3ZV7A 2F1JA 3PUKA 2QS9A 4LG1A 4TVBA 2NZXA 1G4HA 3QEBZ 4AG3A 5ERYA 4Z7OB 2E0IA 4FNMA 1UP7A 1RPTA 1MIOA 3IMEA 3VR6H 2AF4C 2ZGVA 4O2BB 5E4YA 4ZGGA 2EX1A 2XQGA 5EJAA 4C7OA 1E3JA 1G20B 5A4JA 2E49A 5FPKA 1QO0D 3RSHA 2JGDB 4RJLA 4CQJA 5EIBC 3MS2A 4UJ3A 3PUHA 5HEKA 4BFTA 4TLAA 1CP3A 1XKLA 2XYRA 2BHSA 4Q3DA 1KETA 4WJLA 2RGXA 4KR0A 3VH4A 2YQZA 4XDZA 4TMKA 3Q3JB 1G19A 5BSMA 5H81A 4D56A 3ZY5A 5EJ4A 3NHMA 1N6RA 3THRA 2GILA 1MV5A 2GPAA 1CUDA 1K4YA 3GN1A 1LY1A 5F7OA 2ZEJA 3MUOA 1IAVA 3OKCA 5C0OE 1JPNA 1I7QB 4LRWA 3MWDA 1MH1A 4JP1A 1PFWA 4WZBA 3CLSD 5I5EA 3GFRA 2AKEA 1NG1A 2E82A 3JQ8A 4QDKA 1W6UA 4RHYA 3WK4A 2ZYAA 4DXAA 4EAQA 1C9NA 1MEJA 2DFNA 2IEAA