4H60A

High resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
120
structure length
120
Chain Sequence
b'AMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
molecule tags Signaling protein
source organism Vibrio cholerae
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
total genus 42
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h60A00
3A0UA 3LUKA 3C3KA 2NUBA 5IULC 2FQYA 2IPLA 1UDRA 4OATA 1USKA 1DBPA 4LE2A 2PAFA 3H5IA 1U2PA 4N03A 5KC8A 3IDOA 2PUBA 2H3HA 1NTRA 3K9CA 1OXBB 3JY6A 3TB6A 1RXIA 4MR9B 2QSJA 3RVRA 5JNTA 3ROFA 5C5EA 1JDNA 1K68A 2JBAB 1TM2A 4TLMB 1EHCA 2JBAA 1DG9A 3T8YA 3RH0A 1ABEA 3QEMA 5ED4A 1M2EA 4RSMA 4XXHA 3QLVC 4JA2A 1LBIA 3F6CA 5FWXB 4L4UA 2PUGA 1ZHHA 3M9XA 4MQEA 3QLUC 1P6QA 4OLBA 4YP9A 4HNQA 5EWLA 2JVIA 1W9HA 2GWRA 3OLWA 2ID7A 3KHTA 4YWHA 3N6VA 3NNNA 4IRXA 3BRQA 2PL9A 3Q15C 2QV0A 4ZMSA 1DCMA 1DZ3A 4KNYA 2XDYA 5TQ0B 3FMVA 1DCKA 1KGSA 3HDGA 3RQIA 3HO1A 5FBHA 1JL3A 3LUAA 4TMYA 1EAYA 1LJLA 5E3JA 3K4HA 4IF4A 5HQJA 5IUJC 3Q7TA 3SM9A 3DGFC 4ML3A 5ABPA 4LRQA 2V0NA 3O74A 3CG4A 3RVJA 5FWYB 3KKEA 2NZUG 1YMVA 1QQAA 4LE1A 2IPAB 4MPTA 5B3JC 1GUBA 5EWJB 3GWGA 4YCSA 3H5TA 4JAVC 1K66A 3N8IA 3FFTA 3BILA 4EYGA 3EQZA 1P2FA 1L5ZA 4KK4A 3UUGA 3HSYA 4NCAA 3C6QA 3MIZA 3OLVA 4RK5A 5EWLB 1SRRA 1PNTA 1NXSA 1P6UA 2LPMA 4XARA 1YS6A 3QEMB 4EY3A 3HK2A 2PKXA 4Z4HA 4WXMA 4E7OA 2NT3A 3EDCA 4RS3A 5CNIA 5KQMA 1Z18A 1ISRA 4H60A 4MS4B 2E4UA 3H5OA 4MR8B 8ABPA 3OO1A 3R0JA 4N41A 3QELB 3RVKA 1SD5A 4MS1A 1FFSA 3NNDA 1D2AA 3GBPA 4LDAA 2JCGA 3M9WA 3SNKA 1XHEA 4G0XA 3OMXA 4HNSA 5TPZA 3GT7A 1FFWA 4YLEA 2AYXA 3F73A 2QU7A 3KJXA 1CEYA 2GI4A 2FXIA 4O1HA 4XAQA 3ILHA 3H5WA 5JNVA 3HM9A 1GUDA 4YR7A 2WB4A 3HEBA 5HM6A 4JASB 1JH9A 2WJWA 1U04A 3T6KA 4QYMA 1PHRA 2O20A 3KTOA 1RZRA 3I5AA 5KI6A 2PLNA 4RK4A 3Q7RA 1DC7A 1QP7A 3MF4A 3CS3A 4EVRA 4F11A 1A2OA 6CHYA 3DZDA 1E6MA 1SXGA 3H5VA 4QPJC 1U2QA 3EULA 3MMNA 5HKOA 2E4XA 1JFVA 3RVQA 3O2QB 7ABPA 2HQRA 4YGXB 5JNUA 1F4VA 2B4AA 2FLKA 4FE7A 1ZDMA 2NZVG 3P9YA 1LJUA 3EJWA 1FFGA 2FMFA 3H6GA 3HS3A 4IMIB 1EWTA 4MR9A 2J48A 5IUNC 4W5TA 3GL9A 3G85A 3FFWA 5KQLA 4F12A 3E61A 4KMRA 2HSGA 2QXYA 4NV3A 3H1FA 4Q6WA 1NXTA 3C3MA 1FSPA 2RGYA 2LIVA 5B3JA 5EWMB 5CNKA 3JPYA 4WT7A 3T95A 4MS3B 1JBEA 4B09A 5PNTA 2WJAA 2TMYA 3JVIA 3QK7A 2X7XA 3OM1A 4ZMRA 4RXUA 3CU5A 3MA0A 4MRMB 5TQ2B 5EWMA 1KRWA 5HSGA 3G1WA 2M98A 4EVSA 1L5YA 4DN6A 2FQWA 1SXHA 2N9UA 3FFXA 2F8SA 1B00A 4MQFA 3OQOA 4Q7EA 2ID9A 4NQRA 4Z9AA 2PL1A 1JWLA 2KYRA 3RVPA 1M5TA 5T3YA 1YK0A 3QEKA 3VNBA 3CG0A 3VNAA 2R47A 1DP4A 4MQFB 1YS7A 2FMKA 4Z4FA 3HCWA 4EYQA 2IKSA 3QLVA 4KK3A 1W25A 4MGEA 4QICA 2B1JA 1E6LA 3O1JC 3O1IC 3O75A 4H3HB 1QP4A 3OQNA 1Z15A 3OLZA 3SG0A 3A0RB 4LDZA 3N53A 1GLGA 1MAVA 5BQ3A 2A9OA 3FDFA 3IP7A 4RZSA 1DRJA 2IOYA 3MQ4A 1DCFA 4WWHA 3TX6A 3W9SA 4ETIA 4YV7A 2BGGA 1EWKA 1YIOA 4P1ZA 2VUHB 2MSKA 4Y9TA 5BR1A 1U0SY 1USGA 3CNBA 4O1IA 3L49A 3GYBA 4MS1B 3I09A 1YMUA 4XLTA 5FWXA 2VYCA 2FN9A 1M5UA 1PUXA 3DGEC 3O1HB 2QVCA 3KYJB 3T38A 5JNWA 2CWDA 2MYNA 1AB5A 4KVFA 3RVSA 1DRKA 2MYTA 4MQEB 3HUUA 2PMCA 5KQPA 4DQDA 2FMHA 1JX6A 2E4VA 1F51E 1CYEA 2FW0A 4N0QA 5TQ2A 2FSPA 3JS5A 1U8TA 5TQJA 1QNLA 4GNRA 2A9QA 2R4QA 3HZHA 1Z16A 1CHNA 2FLWA 1ZH2A 1NATA 4H3KB 1VLZA 4KPYA 3A3KA 4Z4CA 3M6MD 1EFAA 2GX6A 1DBWA 4G97A 3TO5A 2P4UA 1TLFA 5DCLA 2IDMA 4LZLA 4RK1A 3ILYA 3NNSA 4PEVA 1KMIY 1QKKA 4MS3A 4RXMA 2PE5A 3CHYA 3RVNA 4PE5B 4O5AA 2FMIA 1AB6A 1VPWA 3OO0A 3DLBA 4RK0A 5KWSA 5DTEA 3C3WA 4KREA 1H9CA 1PEYA 1J56A 3H1GA 1MB0A 2IPMA 3GA5A 1MB3A 2FEKA 1JYFA 2MYPA 4TN5A 1ZGZA 1Z13A 3L6UA 4XASA 1VRVA 1Z12A 2OENG 4PZ0A 1FQWA 1NXOA 3HDVA 4Q6BA 4RK7A 3H75A 4OG2A 2H0AA 4LE0A 1ZAYA 2FEPA 1A04A 2JRLA 3BBLA 3KS9A 4YS6A 2QVGA 4FB4A 4WXEA 4W5OA 2JVJA 5IUKC 1Z17A 2E4ZA 2E4YA 3EODA 3KCNA 1ABFA 2LUOA 4G0PA 4D74A 3BREA 4RV5A 1LK0A 1YVUA 4QYWA 1MVOA 2FKAA 1Z2EA 2GKGA 3EGCA 4W5QA 5FBKA 1EWVA 4RKQA 2JVKA 3QLUA 4N0PA 2PUFA 3IP6A 2AYZA 3QX9A 4KQ9A 1ZN2A 5GQSA 3UKJA 4DADA 2P9HA 3Q9SA 1A0OA 3HV2A 2NT4A 3TD9A 1JFTA 1APBA 1XHFA 3CLKA 4N76A 2CHEA 1C4WA 2IYNA 2MYUA 4MYRA 3SQNA 5F64A 1JFSA 2QW1A 3HUTA 1E2BA 2M1ZA 4Z0NA 2RJOA 3SY8A 1MIHA 3HJFA 3LMKA 2F8TA 4UHJA 3SAJA 3OLYA 4FE4A 4HNRA 1ISSA 4G0MA 4RKRA 5TPWA 3CFYA 1OXKB 2OQRA 4LX8A 2LBPA 5IC5A 3LUDA 3MYYA 4XFKA 4ZJPA 1D5WA 1QQBA 4S04A 2L19A 1URPA 4RK6A 4ETMA 4YRZA 9ABPA 3KSMA 4MLDA 1BVHA 1TJYA 5DKFA 4EUKA 4HYEA 3QELA 3O2SB 1RNLA 4YO7A 4G0OA 5TQ0A 4E7PA 3N75A 3IP9A 4NICA 4F06A 3OLXA 1NXWA 1QO0D 1PNRA 1QP0A 2L18A 4JB0A 2QR3A 3ROTA 3JTEA 1RZRD 1YTUA 1JLKA 5JS1A 3KYIB 4TLLB 1Z2DA 5CNMA 4PICA 1KRXA 1SXIA 3CZ5A 5KC9A 3OM0A 3JVDA 4WZZA 5BRJA 3UK0A 1JDPA 1ZESA 4WUTA 1S8NA 3GV0A 2A9RA 4D6XA 4ZPJA 2QZJA 4UHKA 1PEAA 2WRZA 5EWJA 1RXEA 5JNSA 1ZVVA 4W5NA 2YHAA 2R25B 3EAFA 1JHZA 1BDJA 3CKMA 2WMYA 5IBQA 3CZCA 4ETNA 4S05A 3OQMA 3RVLA 2L17A 3LKVA 1NXXA 4JB2A 1TMYA 1D1PA 3LUGA 1ZGGA 3N0RA 1I3CA 1VKRA 2YHBA 3LKBA 3S99A 4EGSA 3N0WA 1NXVA 2GBPA 4KZKA 5FWYA 3BRSA 3CTPA 3KG2A 2Q5CA 5CHYA 4KFCA 4G86A 3E3MA 3NBMA 2RDMA 4G0YA 4Z4EA 4EYKA 5IEJA 2A9PA 1D4ZA 2PUEA 4RY0A 1C0EA 3NHZA 2VK2A 4KV7A 2VUIB 2FEWB 4RY8A 4D6YA 2JK1A 1DBQA 2FVYA 3LUJA 1XWWA 3B2NA 4W5RA 1JYEA 1IIBA 4MAAA 2L2QA 1LBHA 4OLAA 2HPHA 5CNJA 1BAPA 2E4WA 4KQCA 2W42A 5GOTA 3HXMA 4PYRA 1T34A 3LUHA 3D8UA 3I45A 4MLCA 4RDCA 3IP5A 4EVQA 6ABPA 1QPZA 1USIA 2I6FA 4RWEA 3H5LA 3JPWA 4GPAA 2ZWMA 1DC8A 4NCBA 1TVMA 2MSLA 5C5CA 2DRIA 1HEYA 1ZITA 2IPNA 3H1EA 3GRCA 3LFTA 1GCAA 4Z4IA 1QO0A 3DLHA 3Q7SA 3IPCA 4G0QA 4F8JA 1QMPA 1D1QA 3LTEA 2FN8A 4M88A 4L85A 1NXPA 4Z99A 4MR7B 1ZY2A 2PJUA 4JOQA 5D2CA 3Q41A 1BA2A 3LOPA 3KLOA 3F7NA 1RPJA 1WETA 2PUDA 3QLTA 4IILA 5IEBA 1GCGA 1M2FA 1BDHA 1ZH4A 3NHMA 2LP4Y 3O21A 3RVOA 3QX8A 3N0XA 1JF8A 1P8AA 4MS4A 2HQBA 4MR8A 2PUAA 5DLEA 4RU1A 4F3TA 2JB9A 3H6HA 2RJNA 1R8JA 4ZYLA 4Z9BA 3LUFA 5I4CA 5BRAA 3MM4A 3URMA 5IX8A 4OTZA 5TE9A 5TPWB 1YK1A 3CRNA 3OMWA 1NY5A 2PUCA 3HVRA 3C97A 3IPAA 2CD7A 4IGAA 4N47A 4RY9A 5JNRA 3FGZA 1DJMA 1E6KA 1Y1LA 4G0ZA 3I42A 3EQ2A 4IMJB 2WY2D 4JP1A 2FQXA 2CHFA 3KLNA 3RVMA 3LUCA 5KQGA 4CBVA 3DBIA 5JS2A 1Z25A 4EYOA 2MSWA 4RXTA 4MRMA 4OBBA 4MR7A 4KRFA 5T7BA 4P98A 1Z26A 1BDIA 3TMYA 3A10A 3F6PA 2FTKE 2HJ9A 5TPZD 2R48A 4Z4GA 3D02A 2WWVD 5DGCA 2HQOA 3GBVA 2ZAYA 3O2JA
chains in the Genus database with same CATH superfamily
5IDVA 2JGMA 3K6SA 2JCVA 2AKAB 4GBED 1YJQA 4QOHA 3EIOA 4OATA 5CB4A 1Q0HA 2GCGA 2ECKA 2PAFA 1RRFA 1JKIA 2FZKA 4NBVA 5EFZA 5IFLA 1Z0SA 3T9BA 3IEPA 2R7MA 5L3RA 3V2UA 5ALLA 1DRUA 4KIUA 1WQ1R 3BZWA 3FKQA 3QUSA 4ZAWA 1MTOA 1T2NA 3LCVB 4DG5A 2QTRA 1EE1A 2OYSA 3HV0A 3V6LA 4ZYWA 2HQSA 4CKWA 1YTLA 3GY0A 3NT4A 5ALQA 4RTMA 3COJA 1DC5A 1HT3A 2JS7A 5JDIA 2WTUA 5EWLA 1HDGO 3OLWA 3TLMA 5FUYA 5L4LA 3DTYA 2VATA 1XPRA 1P3JA 2VDRB 4CKXA 3RUEA 4ZEVA 4TSRA 2XDYA 4DCPA 1VDZA 4RTNA 5I7VA 5KTTA 3DH0A 3KFXA 3GNQA 4FKZA 4HD8A 5BYAA 3KXIA 4CMEC 1WKCA 1OBHA 2EQBA 4MUAA 3ZY5A 3K96A 3DAPA 5EXDA 4BQQA 2HJRA 2XIJA 2GCPA 4F2PA 2JC3A 1IZYA 3HGQA 1FB5A 2Q1UA 2QPOA 3NHSA 5IUJC 3WA6A 1N2CE 1RHMA 4Z53A 1T43A 2JI9A 1VI2A 3LQKA 1OI3A 3SM9A 4ML3A 3HB1A 1VCMA 4CIWA 2NU9A 1JJFA 3UGJA 1FDSA 1KR5A 2AFHB 2G63A 2AD1A 4JVNA 4MWGA 3OKAA 4IHAA 5I7FA 1M6VB 3E9EA 4GEKA 1L1RA 1TGYA 4L4XA 1P2SA 1P9LA 4YCSA 1K66A 3AUYA 2C8KA 2RHHA 2FKNA 4EYGA 3KK0A 4OI1A 3MAAC 5FQNA 1HQDA 3ESDA 5HR5A 4CEHA 1KIAA 3PD1A 1ZP6A 5C8ZA 4A36A 3FYSA 1NXSA 4Y0AA 1KEEB 4IV0A 1BFKA 4QUKA 4Z3KA 4X84A 1XDZA 3L2OB 4KFTA 1V11B 3A6LA 3D7RA 4BO7A 1MO3A 2ZJ8A 5K0EA 3U19A 4N8EA 1EVIA 4IS2A 3VMFA 1FLVA 4AMYA 3LH5A 3RUHA 3WGLA 2DM6A 5FNZA 3WDKA 1JEEA 4MR8B 2E4UA 2WAOA 3L7AA 4FBGA 2YH2A 4X45A 3N86A 3EOAI 4Z9FA 5EE1A 3JWEA 4H7PA 4RENA 4EY5A 2DERA 3RC2A 1YDWA 2FOXA 3LBHA 1MN6A 4JX8A 4LTDA 3VDMA 4AJ9A 3QJYA 1E3WB 4OSEA 1YA4A 3LDFA 4MB6A 1SOAA 4MEJA 3RTEA 4HQFA 4D9MA 4ZV7A 4EABA 3KJXA 1ZONA 3VNQA 1ODLA 2OPBA 1JV2B 1PO7A 1Y5RA 4S1NA 3ZQ4A 4TM8A 3IOEA 1PF7E 1D4OA 3BERA 1EK0A 3DMTC 4FW8A 4LA4A 4YJFB 4KPUB 4EEKA 4OUKX 4E94A 3ESXA 4QPCA 3FZNA 1E3MA 2CNKA 3B8EA 2NAPA 3WGOA 1UBNA 1ONPA 3Q9LA 2WAYA 4IG9A 1E64A 5FQOA 4QPJC 4DLKA 1Y5NA 3HZRA 5IM4F 5AW9A 5K1ZA 1PWEA 2J32A 7ABPA 3KT8A 3W1WA 2BSQA 5F7OA 3RHZA 3OZFA 3PVZA 5EIEA 1LVGA 4RHYA 3B1YA 4AYTA 3PGA1 3HS3A 1X13A 2AFRA 3G9UA 3R3YA 2Y99A 1R9GA 2F2TA 2WA1A 3FFWA 4TLCA 1DBVO 2HBZA 4ZTUB 4I66A 2CXRA 2WWRA 3VBCA 4FEEA 1XMSA 2X9QA 4YPVA 2CDAA 2HSGA 4NV3A 3ROEA 1SQ0A 1IM2A 4YLGA 1JHDA 1PEKE 5AHWA 3DAGA 2NWQA 1CNFA 4FUTA 1CF4A 4JBLA 3T54A 1YZUA 1RWWA 4L73A 3T95A 2P35A 1C9YA 3QXCA 4FN4A 2P6NA 3LLCA 3PXGA 1ZC4A 4YRMA 2NO1A 2ZDHA 4Y30A 4ZMRA 4RGBA 3R74A 4BVEA 2Y77A 3T3GA 4AS2A 2IZ7A 4K2HA 4XIJA 3FIUA 1II9A 2DJ5A 3ZJTA 1KWKA 4FU0A 3IMCA 4E13A 3OF3A 3WMEA 4F97A 3RG8A 2WDPA 1FXWF 2N1BA 3VZQA 5KYXA 4RTPA 1AURA 5EHZA 5J4LA 5CIQA 5JSKA 4CI9A 3EY9A 3PUXA 4AKSA 1Z6GA 4FXOA 2ZXUA 2G9NA 4RVUA 3UICA 3L3BA 4KMSA 2GH1A 2YMMA 1CQIA 4QDTA 3DE1X 3THYA 5EL0A 5A0VA 1E1CB 1KOJA 1YKSA 3UXMA 1C1HA 2GAOA 1PBNA 4U7HA 1PJ3A 4QQRA 1THTA 2PD4A 4WL0A 1G5IA 2Z4RA 3P45A 5K0NA 1XN1A 5T57A 4E11A 4TV8B 4BYGA 4E5SA 2XZOA 1FMTA 3QVUA 5ELXA 3HHPA 1HLPA 1BJTA 1VE3A 1OX6A 2ZSFA 3OU2A 5T4EA 1XEXB 1HO3A 4ZZ1A 2DMRA 3DFFA 3EIFA 4MVJA 5FT9A 2HIMA 5FR1A 1ZSVA 4WWHA 1XVUA 4IHQA 3D43A 3C4JA 2XVYA 1OKKD 1U94A 3DZJA 4O2RA 4OCZA 2V4ZA 3PDCA 3R7LA 6LDHA 3D4NA 1A1VA 1NNLA 4N48A 1N2CB 2VUHB 1D2HA 2F8LA 3LX4A 4ZI7B 1QTQA 4Y9TA 3GDGA 1QTIA 1UODA 5BQPA 1YR6A 2OD7A 1GNTA 3AZQA 3ZHQA 1KR2A 5J4VA 3ENKA 2XWQA 1G7CA 3O91A 3PXXA 4M86A 3PJEA 4EDHA 4FT2A 1C2YA 5I7WA 1WMBA 4ZIRA 5KJ6A 4XLTA 2EKLA 5HIJA 3QWFA 1HE2A 1P0MA 1PJLA 2CNDA 5ALMA 3JQ8B 3STVA 3TQSA 4BX2A 2Q3FA 3NATA 3ZV5A 1O8BA 5JJCA 3QMWA 2R4TA 2GK3A 3RVSA 2OMKA 3MTDA 5JZBA 1DRKA 1YZKA 2OCAA 2PIDA 3OZDA 2FMXA 3UGTA 2B2XA 2ZBEA 1XDUA 4DQDA 3AU9A 1WBJB 2GUGA 3FYUC 4N0QA 2XD4A 2UAGA 2HF2A 4DLXA 1AOXA 1WSBA 1IK4A 5CRIA 1ZUHA 3FCAA 3ONWA 4G89A 3WHLA 5FHQA 2CMKA 2IXGA 2J5KA 2QA5A 2XMRA 4GZLA 1MB4A 3IA2A 2EL9A 2ZI7A 4WZ6A 3B78A 1U99A 4KN8A 4BUJA 1KMIY 2GBIA 4DNFA 4Q18A 4J94A 1JVSA 4KVGA 5A05A 2WIBA 4K6OA 3PSAA 5AKKA 1IN1A 5KHLB 4J91A 3M6UA 4F3RA 1X7YB 4P2BA 4CRWB 3CX4A 3O8NA 1CP3A 3OO0A 4DIEA 3DLBA 1LDBA 2BUCA 4WCFB 3RC7A 2WDZA 3MMXA 3A1DA 4OGFA 2VHQA 3E3AA 1VIYA 3AH8A 5FP0A 3CKKA 1J56A 3R7NA 3RS3A 5HYVA 3CEPB 1MB0A 3C5VA 3GA5A 4Q7MB 4BN5A 1C41A 4QHYA 2Y4OA 1Z82A 1JH8A 4JHXA 1ZW1A 5EJ6A 5FPSA 2VKTA 3A9VA 3BH0A 1GAQA 2ISCA 2XTAA 3OTGA 3I1YA 4LC1A 1HLFA 2OENG 1IRXA 5DSZA 3OPNA 4RK7A 3NI2A 3O47A 2QNIA 2H0AA 4O29A 3TSCA 3VFDA 1PSWA 3NM5A 1M74A 3IOMA 1CUUA 3FOBA 1A9OA 3IKVA 4OU4A 5FLXA 4KAXA 2RAFA 3TQOA 5KNCD 1RC1A 1EYZA 1JMVA 4DLWA 2X7JA 1K63A 2E4YA 1QFMA 1SEVA 1LPOA 1L7AA 1WVGA 2AZMA 2WF6A 3AYZB 3B6KA 3MTBA 3QWHA 4QQKA 4JP2A 2AMLA 4MV1A 5TJ9A 2RHGB 3ZS8A 3EUFA 4L5YA 4GXQA 3EAGA 5F51A 3TFWA 1U4OA 1NJFA 5IFKA 4CM9D 2JAWA 1NE7A 4EPRA 1O1YA 2FKAA 1Q50A 2J7PD 3LLSA 4H4CA 3V8QA 4CE6A 3OQJA 3ANMA 3FCXA 4G01B 2VDWA 5ALVA 5IJ0B 5DX0A 4EJSA 3PDIA 5K6RA 2BMJA 4HH0A 4XJVA 3L6CA 5L3QA 5GQSA 4GR5A 3UKJA 4DADA 1O54A 3D2BA 2QQ5A 1L5OA 2PLRA 3Q9SA 4G5OA 3INNA 2PLWA 4KWEA 4QL3A 1L5VA 4RGVA 4Y2TA 3ZIAA 4QXPA 1I24A 4BLSA 1JFSA 2FUKA 4R71A 5J1SB 2QM8A 4QULA 3SC2A 4QTYA 2FK8A 3D59A 5INTA 2GJSA 3FDIA 4LZWA 3WR5A 4D4JA 4RKEA 2W0MA 1UPUA 3HJFA 1MMFB 2CK3A 3REGA 3SAJA 2OKCA 3EE6A 2KWIA 2C7PA 4ZYZA 3FMFA 2EJBA 2G1UA 2X40A 2CL6X 1CP2A 3JZMA 1A97A 2QBYA 1L7NA 3R8FA 1Q0LA 3L84A 4AZ3B 4MKXA 5JYBA 1W85A 3HYSA 3QENA 5FBVB 1K8ZB 1ISFA 5F5NA 4TRMA 3N2IA 4CM7A 2ODBA 2PYDA 4DMCA 3WAJA 3NCHA 4DGQA 5HF5A 3PFIA 4J2OA 3AW8A 4LZZA 1NQ5A 5DKFA 1DG1G 3AFIA 1NR7A 3C8HA 5KJEA 2HA4A 1L7BA 5CVUA 3TBKA 1JA0A 1Y7IA 4ZICA 1J6UA 3UWMA 5CJJA 1QQ5A 1ZU4A 2F62A 1RJFA 1PW5A 2B6NA 2ZYUX 4KIGA 2IGTA 2OC4A 2NU7B 2F3UA 4KNWA 4RHEA 1U8EA 1IZ7A 3T7JA 2X8LA 2IPOA 1Z7GA 3EZ2A 4TVBA 3SJBA 1OCEA 4F04A 5CG1A 1O95D 4Y1RA 1U4NA 2QL6A 4UASA 1GNSA 1R0BA 2XA2A 3C7TA 3JVDA 4J6FA 4KWIA 2IV7A 3HMQA 3QX7A 3X1XA 3EA5A 5A4AA 2OHVA 5JVDA 2ZWVA 2IS2A 3OU7A 4QEDA 3V4RA 1PT9A 4C29A 1XP8A 2Z6VA 5JNSA 4I1VA 3EAFA 1AGNA 3JSXA 2DTXA 3K9GA 2AWNA 5KNDD 3RSCA 1IYZA 1DJOA 4Q24A 4EW2A 3DMTA 4CKZA 5HRUA 5EJIA 2H18A 2A33A 5ER6A 2IW3A 2P2CA 3LKVA 1KYQA 3WDSA 4Q1EA 3GQBA 2OHHA 1ZWLA 1W36B 4L8VA 3PNVA 5A1JA 1GN8A 2EX4A 3EWIA 1TYDE 4DEVA 3A7EA 3FB1A 4L02A 4WK6A 1SU6A 2CUZA 1DQPA 2GCOB 1GZ5A 1XLTA 2I22A 3C8MA 3CUWA 4I1UA 5E4FA 4C7KA 5HXAA 2WU1A 2V6FA 2DFPA 3BTVA 4MUXA 1SAYA 1V9SA 4CMIA 2OBYA 4RY0A 2KPOA 3JAKA 3ZE7A 1Y9JA 4WJKB 3RYCA 1I5EA 2I2DA 4NBLA 2XUKA 3DOIA 3IIKA 2JD2A 1IHXA 1T25A 3B2NA 2I2BA 4YMSA 2OT3B 1AKVA 3SBEA 4WFIA 3ZHSA 2YYSA 4D96A 1MXFA 1UZLA 3M5WA 4AG3A 1F6BA 3Q2IA 3R3SA 1FUIA 3ZD9A 2OWEA 4OB8A 3EH2A 2O59A 3IQWA 1FSFA 2KQUA 1ADCA 1T34A 2F3QA 5D3MB 4BLWA 2I78A 1L1QA 3WS7A 4ZTBA 3NJ8A 4AG5A 2AGVA 2NNLD 5BXQC 1DQSA 4WX2B 4TXMA 2QNBA 3M6VA 5ALYA 4IRMA 2BGMA 3TRFA 2WWFA 2NV0A 3VO1A 3LRXA 2K7ZA 3SX2A 1XXLA 4H4EA 4I50B 2A9JA 1AF4A 3N2ZB 1L2TA 4DR1B 1MJHA 1ZH6A 2C31A 3CUTA 3ONDA 4K3UA 1D1QA 3RSFA 2CKDA 4EZBA 2ZIGA 4YDSA 3WICA 2PQ6A 5TMBA 4KR6A 2QN8A 1TVKA 4RORA 4P3YA 3RC3A 3KLOA 1M6EX 1UP6A 2Y3IA 4HWOA 5DN9A 4OHZA 5DIZA 4IILA 3SE7A 3CVWA 1BIFA 4QKQA 4OQPA 2CGEA 4KOAA 3BDVA 4YQEA 1RWXA 2BGKA 3G89A 4ISCA 4EJ6A 4QOGA 3ZTTA 1WUHS 4KRGA 3U4AA 3K9HA 4FT4A 5F1PA 1L0BA 4YQYA 1V8DA 1GAJA 1XI2A 2P67A 2JLUA 4CMKA 1X0VA 3RBXA 3CF4A 3W6UA 4B3DA 3V1KA 1R66A 2OCXA 2YIVX 3F5DA 3L77A 5AVVA 3RJ9A 2HYDA 3MJFA 2GQ0A 4PGAA 1ZINA 1ODSA 4UOQA 5FV7A 2J85A 2EBUA 4JT8A 1B16A 3RV3A 3T1QA 2PUCA 4E14A 1YH3A 4MI9A 3DLAA 1G8PA 2RBGA 2NU8B 1MJGA 1OYVA 4Q82A 5EHNA 1PJTA 2D5AA 1C4KA 3I42A 4H0CA 1DJMA 1GZVA 1HUQA 1OFIA 1QYRA 1TRKA 4NAHA 1GFIA 7AT1A 3EGVA 1LNZA 1UIMA 3WBFA 5B12A 5IH3A 3T15A 2EGGA 5CCXA 1ZX1A 5BUQA 4DR2B 1DUSA 1JEJA 3BFVA 2JA1A 2Q2QA 3TUJC 3KYCB 2OA0A 3HKBA 4Z8YA 2I67A 2PGOA 3TW8B 1JS1X 4POAA 1N7JA 4MQLA 4E5YA 1V8FA 1UJCA 1K6MA 4B82A 4BVFA 2Y92A 1YE5A 3H2BA 4OV6B 5BWCA 4TKVA 4WDRA 2OBMA 2X23A 2QMYA 5ICEA 1KMHB 5ALHA 1EZ4A 1XZGA 1JHVA 1KJZA 1NW3A 2HLDD 1DBPA 1E1MA 3DMFA 3NBKA 2GEVA 4IIBA 1QO7A 4US2R 4KR2A 1LGYA 1KI3A 2VYVA 1K5PA 4Y8VA 2BMFA 1BMQA 1JHPA 1HOTA 4L0CA 1E4VA 2Q4DA 2GHQA 1K68A 4WZBE 4FFBB 3H04A 3QE2A 1N3BA 3QMMA 1M2EA 3VHLB 3HNOA 4RA6B 1ZVMA 521PA 3M9LA 2AE2A 3T1NA 3WYCA 4EMSA 5HJ2A 4ZU3A 3UJCA 4ALIA 5A9SA 2QR2A 4INZA 3G8AA 1H4TA 2JFVA 1BW9B 2YZNA 1NOKA 3OOJA 4ZVNA 2ODPA 5LP6A 1FFXA 1NF3A 4QJ5A 4ZVSA 3Q15C 4D8WA 4NK4A 4GOXA 2XWPA 1G5PA 5AK6A 4EZEA 4FNGA 2DETA 1SVKA 3C85A 1BD3A 3FY4A 1J9ZA 4CNQA 1RT9A 4P3KA 5P21A 1HE8B 2V9CA 4D5GA 4TMYA 5LMCA 4EFNA 1EAYA 2FG6C 1Z2NX 3PNMA 4JUAA 2HNKA 3WVNA 9ATCA 1HNZB 1M8KA 3PQFA 4XQ9A 2NG1A 3E9RA 4AN0A 5FAKA 1RTKA 1UFVA 3AEUA 3DYVA 1BXZA 3HRIA 1E79A 4FDTA 4U3JB 2OSVA 2Q4RA 1J5XA 1MA0A 1C8LA 3JAWA 1HDZA 1LW7A 3E5MA 5EWJB 5JLAA 5CA0F 1PR0A 3M5DA 3H5TA 2BFBB 3OPVA 4AULA 1VLHA 2HF8A 2IIPA 3FFTA 3I6ZA 1LBTA 1C8VB 3DT6A 2KE5A 1MAUA 3I3OA 5JVDB 4B48A 5KTYA 4I8XA 1NJ2A 1AHIA 2E6KA 3UUGA 3IPRA 5BSMA 1AV7A 3QBVA 2VT7A 3UV3A 3PHLA 3TW6A 4EM6A 1HFEL 3IDSA 1NRXA 4MUBA 4NF2A 4QIHA 2FPIB 5J40A 5IHXA 1XKTA 2GN8A 4MWSA 4K9LA 3UCEA 2CSXA 2CDNA 3HK2A 5DN6A 1T2VA 2BLLA 3HC7A 3KC2A 2VP5A 3EYWA 4RC9A 1B74A 3EF0A 2B7LA 5FB3A 4H60A 4JVMA 4RIEA 3V3KA 1F06A 2ZJFA 2AYYA 2CN1A 3B89A 4G1CA 2IYAA 3QELB 1PQUA 4GZ6A 2VUUA 2WJ6A 3N59A 3VA7A 3AP2A 1U5AA 4PSKA 2QEQA 1RJ9A 1DJPA 4KYUA 1NVKA 2WTNA 3WP0A 1GZ7A 1W48A 3PQ6A 4Y98A 1GY8A 4PQYA 1GTG1 3LHIA 2Q0QA 1A7AA 3CLHA 4UDXX 5DWVA 2WG0A 1ISGA 3AJ9A 3EIXA 1TA9A 3PIDA 3WNZA 5C7OO 3HM9A 1A50B 3ME5A 4RKWA 3AFNA 3HEBA 1QKJA 2O7NA 2YMLA 3B1WA 4Q12A 1AY0A 1GFSA 1Q77A 4FYXA 3IQFA 1KQNA 3E6AA 3EZFA 2FI1A 5K8JB 3O8BA 4RK4A 1VMAA 2H4FA 1DC7A 3PCTA 3CS3A 3UYKA 2JASA 4QG3A 1Y1SA 3UFXB 1WJGA 3FZYA 2NZ8A 3U4QB 5LLDA 3OH8A 3RGWS 1RU3A 1YZTA 4REMA 4RVFA 2PWAA 1PT7A 3SZ3A 1JAYA 1F4VA 3LQRA 3C7DB 3VPFA 2QOEA 3VVMA 3T3EA 2CLFB 2X8JA 3LRTA 4V0SA 4NE7A 4EUNA 2FAXA 2XDWA 4M8LA 1GV1A 3IRUA 4Z86A 2QRQA 2G0TA 2J5RA 5E8RA 1CPYA 1P7WA 5AKGA 3DM9B 4RCZA 3V7FA 1RYDA 1XA0A 1H0KA 2TECE 4YUVA 1BX3A 2B8EA 2F90A 4YA6A 1AO0A 1E6CA 3HKCB 3BWDD 3P0EA 1Q95A 3H1FA 4UPDA 4EY7A 3AF3A 1G5RA 1ORVA 2E1PA 2CLDX 3M6IA 4MP8A 4WXYB 4MKFA 5LP6C 1RAGA 4DA4A 1ORHA 1PKEA 3KSUA 4PTZA 3AEKB 5ITZA 4NMMA 2DPXA 5U1PA 3QA9A 2WQ6A 3DDHA 4QGAA 4U2GA 4K26A 4NC9A 4W7IA 3UK7A 4CCAA 4P58A 4RXUA 1C1XA 4HQLA 1B6GA 3AUTA 4Y6PA 5I7OA 1G8MA 3CCBA 4MUFA 4V0MA 1L5LA 4P0TA 4WTOA 4B3JA 4CGZA 2IYXA 1PFKA 3ZLUA 3K16A 3NIWA 4BS9A 3P2EA 3NOXA 1GP2A 4KLZA 5J2UB 4ZOLA 4D42A 5JZOA 1XLUA 2R65A 2RGNA 1YOVA 5FRDA 3L8YA 1UMBA 4WBXC 4GPTA 1E2GA 1SC1A 2XRYA 3HCBA 1LDYA 2ZRIA 2H1SA 3N7TA 2YDYA 4IGFA 1HEUA 5ALFA 4MWOA 4D0LB 2BFBA 3Q8WA 3VKGA 4EP1A 1E1LA 3QKWA 3IJ5A 4HO1X 3AOEA 2VDNB 2ACKA 3H8WA 1K86A 2JGAA 2ZYDA 3OEHA 3SDBA 3A3OA 2G67A 3F6BX 3CN9A 4G9BA 5BNZA 5EKUA 1XCJA 3TBHA 3Q1KA 4DCJA 3EA0A 5TS3A 4BGDA 2WG1A 1JLLB 5L6MB 3UT5A 1NRWA 4OX9B 1GG9A 3T5MA 4NXNB 4XJSA 3RJMA 1N2EA 1VXOA 1F8YA 1KC1A 3B6EA 3PHIA 3OETA 4IDBA 2J6BA 3GFTA 3VKVA 2V7EA 2XGOA 3W9SA 3LRPA 5DHFA 2BEUA 3STXA 4DJAA 4JZKA 4EAQA 1NVWQ 2I6GA 2NXCA 3KJEA 1N1MA 2AN3A 3AZPA 1IK6A 3QHAA 1KXZA 4K9SA 1C9KA 1XK6A 1XRRA 2VBFA 1YOBA 1PV2A 3CNBA 4OM8A 2N0SA 2HRZA 4RA6A 5DDIP 1SULA 3PQ5A 1ZCFA 5ES3A 1PUXA 1XAIA 1YVPA 2QVCA 1YOVB 3L1UA 4DDTA 3ZIDA 3WLPA 5K2OA 4NLLA 2DFKB 2NYAA 3HB7A 3R0VA 4BIMA 4F60A 1U98A 4B2IA 3R9WA 1WUIS 2P91A 2EFGA 3CLUC 3RASA 4WY5A 4ZQFA 4EJSC 4UVHA 1IG3A 3NWBA 3P0HA 4GX0A 1M2WA 4GHWA 1UXIA 2WABA 4OHVA 5AD1A 1O94A 1XDBA 5M5BA 1FNCA 4IVPA 3VDNB 2VH2A 2QVLA 4JYZA 2FNAA 1T5IA 3HGMA 2R60A 3L4EA 3UA4A 4WXRA 3WWPA 2Z8YA 2HPVA 1NRIA 1RQNA 4OBEA 2J0EA 2A5GA 1ULHA 4XGKA 1RC0A 2JHPA 4E6PA 1TA0A 4URVR 3LNTA 1HDRA 2Y1WA 1RWVA 3U4IA 3AESB 3DLIA 5FA8A 2GESA 3H8JA 1N9GA 1KP2A 5DHRA 5L8VA 2QMOA 4NS1A 1Z0IA 1U3DA 5H9WA 1FCJA 3DFZA 1EU1A 2VPQA 3HVKA 1UOEA 4ENVA 3RADC 3W78A 1E7YA 2EKBA 1W5EA 4GKJB 1A27A 3HXKA 1TE2A 1COZA 1UBEA 3EVDA 3LPMA 3NP9A 1H9CA 1OAAA 1ZNYA 4FNMA 3TZKA 4JLBA 3GJ6A 4PNHA 1BKYA 2BLNA 3PFGA 4GH5A 1WTCA 1AA9A 1O94C 2H5JA 5K99A 5KU7A 2NO7A 6YASA 1ZGZA 1PTKA 2BONA 1C9JA 2O0MA 4J0GA 3L6UA 3CIFA 1NOIA 1SHTX 4ZCSA 3WL6A 2XT9A 4FGZA 4JFRA 3MWJA 3AL0C 1E7RA 4MKZA 2O0LA 3K8OE 4P4LA 4LXYA 3D2AA 3MAGA 3ROXA 1FP7A 3RW9A 2FPKA 4PAOA 4RGQA 1LI4A 4BGVA 1ZGHA 2NN3C 2Y0EA 3HBMA 4FB4A 1J21A 4EELA 3SZOA 4XWTA 2BPOA 1E0AA 5I9IA 1QDEA 3TCKA 3EXG1 2HT6A 1KJ9A 4B3IA 1GPAA 3A6KA 3ZQKA 2OAP1 4B73A 1D07A 4HHEA 4G9GA 2KX7A 4MRPA 2BJVA 4TS9A 9LDBA 1FSGA 3AEKA 1PLJA 1UXOA 3B60A 4RAOA 4US1R 5DHAA 1ECFA 4PAWA 5AW7A 4TYMA 1WDTA 4YMHA 3SQWA 4XQ0A 3MIIA 3NZEA 1DAHA 3QPCA 1EKXA 1CR1A 3LFHA 2XNJA 4W5QA 1BS2A 1MABB 4WKPA 3VSAA 5E9AA 1OXSC 1G2IA 2MIIA 3ZH2A 3G5MA 4LG1A 5DMXA 2QAJA 1OXMA 4MTLA 5SZJA 3HV2A 1WCWA 2XMPA 1KAEA 2EC5A 2ZTMA 3GRZA 2WBLC 4I3GA 1NQVA 3VR4A 4Q93A 2PKYX 5EKSA 1EEHA 2PKQO 1B8NA 1K7FB 1MBZA 2XAUA 5KX5A 2P0EA 3VPAA 3QVGB 2X8JB 4LN1A 3CY6A 4TKUB 1Y1KE 2NSYA 1H6BA 1MIHA 4GKAA 3Q10A 3RTCA 5ERXA 1TPZA 4JL6A 4TKMA 2UDPA 1LTQA 2YICA 1UT8A 1ZI9A 3AF5A 1T10A 1NIJA 1VGRA 3DW1X 1B8PA 1N3YA 3IMGA 1U8XX 4IDGA 4RQAA 5F4BA 3U80A 3MTQA 1IY8A 4D8VA 4HVLA 1JAXA 1VCIA 4JVSB 5BSFA 7MHTA 2W22A 1ECBA 3KUCA 5LSAA 2LTAA 4ZEMA 4ND6A 1URPA 1ZJJA 3HDTA 5DGHA 1JPJA 2AKEA 1YRWA 2WIAA 4G41A 4LISA 1E2DA 4JJ4A 4TWIA 1E4OA 5IBCA 2JLWA 2I6XA 1KI6B 2JEYA 3D5TA 4C4SA 4DR3B 1QRSA 1RNLA 1BGWA 2XCQA 4ZXPA 3L4KA 1MD9A 121PA 3SE0A 1M2OA 1SC6A 4HTFA 3VPBA 5CDHA 2P4SA 2X1VA 4OK3A 1KNXA 1GPKA 2HA5A 3BE4A 1NC3A 4OH1A 5JPCA 1SU8A 1UPCA 5CT5A 1BG6A 2BMEA 2G80A 1ZJ6A 1UAGA 3DPSA 2QZ4A 4P5DA 3BKWA 1KVRA 4WUTA 5H3LA 5FL3A 2X42A 1C4XA 4IG4A 4MEBA 3WB2A 2OCKA 1B6RA 2R2GA 4LHEA 3QVGA 3EUWA 5DI3A 4FR2A 4MCJA 4D4MA 3E9DA 3LF1A 3ZNNA 3L7DA 2YHAA 2QVBA 2AJBA 4HLDA 4NJMA 3VZRA 1ID8A 1I51A 1S02A 4I8IA 5HIAA 2I8CA 3IPLA 4C6RA 3RFUA 1CDDA 1EP9A 3ORFA 1HZZA 4I1YA 2FW7A 4DPLA 2HHHB 3L7CA 4HAZA 2C2XA 2WICA 1E5VA 1XE3A 4ZCTA 5KYWA 2AR0A 1M8JA 5EP1A 2ZJBA 1OD6A 2BP7B 3U44A 4DE5A 4A0QA 3IP8A 1R6AA 3FA2A 3QFFA 3NBMA 3O6VA 2VYVD 2QL9A 2QRJA 1EVLA 1PN3A 3PBKA 4DV0B 1TO2E 4KQ1A 4ABTA 3V7UA 5EESA 2ORYA 4Q4JB 2REQA 2ZBRA 2JHFA 3AFMA 4CDNA 3TTYA 3U6BA 2PZAA 1FFBA 3WYDA 4WZBA 4UCWA 2RG1A 1CV2A 4W1RA 1YC5A 5TS2A 2IITA 3AF6A 2WJZB 2A0YA 3PNQA 3AWDA 2RGXA 4PYRA 3QE0A 2G8NA 4RDCA 4ZARA 3H6KA 1TMKA 4E2FA 1HDYA 3OTIA 3RR2A 1QV9A 4UXJA 3IIEA 1OUMA 3QKIA 2DQSA 1Q3KA 1RLUA 2GJKA 5CFNA 1CETA 4BQNA 4M9CA 3L46A 1QAOA 1NQAO 2IHBA 1Z4KA 1MGPA 2ZAOA 1DC4A 3UAVA 4QGFA 1DTSA 4Q47A 2O0HA 1FL9A 1GVHA 1LRLA 4G0QA 1CS4C 3PFWO 3AP1A 4S1VA 2DLCX 3A1UA 2ES4A 4LF4B 3TD6A 2IEBA 3CPJB 3ENVA 3I2KA 4L85A 4GOLD 2QX6A 2I4MA 4KAJA 3IP1A 2JEOA 3HNPA 2BGNA 4EUSA 3ASZA 2GPNA 3EQ7A 4RMHA 2ZCVA 3IL2A 1XRSB 3BD7A 2OHJA 4WH0A 1U28C 3FDZB 1JJ7A 1HL3A 2XTZA 1VHWA 4R8LA 5HDBB 2WUEA 4GOJA 1BDHA 1PVDA 1YIDA 3NYWA 4DUPA 1EB8A 1Z83A 4LMBA 2Q1YA 4ZANA 4CUJA 1MG0A 4YAGA 1SGWA 5LZ2A 1P8JA 2WT4A 1YJ5A 2R8PA 3INRA 3U7JA 2O8BA 1NWHA 2NAFA 2AMFA 3K8ZA 3ND8A 3WLIA 4LJ8A 4LRWA 4CKWB 1TIPA 3I2GA 1PK8A 1V5GA 1OFHA 3FWHA 4OLHA 7REQA 2DPMA 3IOCA 1HWYA 4IBOA 1X8XA 1JNYA 3TECE 4MOWA 5J2TF 3UGQA 2JLXA 2NZWA 4QRIA 5LQSA 1J0XO 1A98A 3S70A 2FR8A 1T4CB 2ZSAA 3K5WA 4BX0A 1N34B 1PD1A 1E9VA 2IBSA 4CQJA 2QW0X 4JBYA 4JP1A 4KYVA 1U28A 3AR8A 3FYTA 3G0IA 4E70A 1PFWA 1PJSA 4HR7A 4H77A 4L8LA 1J9EA 2HA6A 1JHOA 3OJWA 4YBRA 1Y9DA 1S8OA 2DTEA 4EG8A 1C9DB 1M1ZA 2QX9A 4N6GA 3SNHA 4AF7A 3X3HA 1YR1A 2ODWA 2R2AA 3Q5DA 4LVUA 4P98A 2ZETA 2H16A 5TY0A 3BJMA 4HNHA 2JGRA 4Q4AB 5BWLA 3P94A 4ENTA 5I01A 1YRHA 2DPGA 2GSDA 1AN0A 1I0LA 1T1IA 3D8SA 3GJ4A 3I32A 3PGVA 4G81A 4KQXA 1QZXA 5FR2A 3HY4A 5KJ1A 4L4YA 1PJCA 1D1SA 3BRCA 4QU8A 4Z0TA 1OV4A 1UK9A 5DOVA 5IVHA 4QNMA 3VYSB 1NTRA 5F23A 1OA1A 1G2QA 1UDCA 5LYYA 1A1SA 2JGKA 2W2KB 3HKDB 2QSJA 3N8GA 4O4HA 2VVTA 3IXQA 4PTLA 4BJ6A 2X0FA 3F3MA 3DAYA 1JR3A 1L4EA 4AXXA 4MQBA 2TMDA 2O7RA 4ILKA 1ABEA 3WQQA 4CM4B 3P0RA 3QLVC 4JA2A 4QAJA 3NBXX 3F5FA 5K0CA 4YHHB 3QLUC 1P6QA 3C8DA 2CXPA 5CVJA 4PRZA 3RS4A 4GT1A 4JJKA 2HV8A 2JGDA 4WXHA 3KQSA 1TC1A 1EDEA 3QKRA 2W90A 4CF4A 4NOJA 4C7JA 2OCBA 2IXFA 2V65A 1H85A 1Q91A 4I6EA 1MX9A 1YB4A 4TV9F 4BFTA 3H18A 4R1MA 2QI9C 3E2PA 1NLYA 3NB0A 1JAIA 4YP1A 4UNRA 1B3BA 4EI9A 1YL5A 4MVJM 3TG2A 1R00A 2VSOA 5HZKA 1YB1A 4FKMA 1BEZA 4E5MA 1HSZA 4UEJA 1GT6A 3BXPA 1U3UA 3GVIA 3KB8A 4OI2A 3NS7A 3CWZA 5HILA 2PGAA 3NH9A 3RVJA 2C1XA 1UFRA 1SD2A 2PYZA 3RBVA 1M0EA 2JFYA 4G37A 5UKDA 1XVVA 4TQAA 3ZTWA 4E5NA 5LQJA 1A5ZA 2R8BA 1A9TA 1N2OA 2B7CA 2YRXA 3WL7A 1PZGA 1W1UA 4EMTA 4Y2PA 1SKYE 2Q8QA 5ENZA 4C0KA 3C6QA 4RK5A 4X7BA 3NHYA 3H1PA 4BKPA 2B2CA 2B35A 3GUCA 2F59A 5EMJA 2F1OA 4U2EA 5CXQA 4W5HA 2HA7A 4XRGA 3DLTA 3MN1A 4TWRA 1LZLA 3CLRC 2HJGA 4KXFB 1Z18A 3NFYA 1ISRA 3H84A 5JXWA 1BCRB 3DHEA 2YJ4A 3C2QA 2Q5OA 5CB4F 2VCHA 2D5LA 4IAOA 3S2GA 5IARA 2YJ5A 3EMDA 1NNI1 2FFRA 2YOHA 3H13A 1C7FA 3GBPA 2MU1A 2GLXA 2AOVA 3BS4A 1MQAA 3LQ4A 1XHEA 1TAHA 5EPUA 2HJWA 3EW9A 2QLTA 1XTPA 4JN6B 3R9KA 2HEGA 3HCFA 1R0RE 1U7OA 5EUBA 3EG9B 4IYRA 5IAKA 1V6SA 4WASA 3U3DA 4PRLA 4OHYA 2IU4A 2I6SA 4GX2A 5K6AA 4O1HA 1SA0B 2BRUA 3ILHA 1AU9A 4MB2A 4BYMA 4KN5A 3BGDA 1P7ZA 4C2BA 1C50A 1GIAA 1WHTB 4Q3AA 3W8EA 1PT6A 5DCUA 2EG5A 3S81A 1EZ1A 2VJLA 4R9VA 1O9HA 1IUOA 3PHJA 5HKLA 1DWPA 2C9OA 2ZSBA 2W00A 3ESQA 4PFJA 2HSJA 4RJLA 2SHKA 1QHXA 2P0AA 2ZT6A 4L3WA 3AW9A 2W6IA 3K5HA 2P3LA 3RVQA 3WWEA 1I1QB 3DA8A 3FCYA 4YGXB 3QSYA 3JARA 2GXUA 3FUCA 1Y1QA 4AI6A 1UC8A 4MWDA 3MJHA 4WKBA 3P7MA 1UWCA 2OKGA 1JEOA 3R8XA 1Y8RB 3N2EA 3H6GA 5DLDA 2WJJA 2Z5VA 1T1EA 3O4FA 3NWPA 4BO2A 3A6PC 1GQYA 3B51X 2W2KA 1D2EA 4WZAA 3COYA 3Q8LA 4NONA 3D7NA 4C4ZA 3IQHX 2ZZNA 2X76A 2JFXA 4E08A 2IX9A 4GDFA 3UTDA 1MO5A 4LXXA 4PGFA 2FN7A 2IHKA 4BASA 1R6XA 4PC7A 4U7FA 3GLFB 2A1UB 3OCVA 1FSPA 1T6YA 3NV9A 1Z39A 4K1XA 2HW8A 1X1EA 3H97A 1LC0A 1UCFA 3NX4A 5KZMB 3GFSA 4PYNA 5IWCA 1EX6A 1NJGA 3ROGA 1YCGA 1K7YA 2CE7A 4H31A 4OK5A 3GVXA 3CUKA 1XYGA 3R5TA 1PDVA 1BXGB 1QB7A 3LG2A 3MTEA 2RI0A 4RDIA 2F3SA 4P7BA 4AP9A 5KWEA 4I1SA 2Q99A 3UHAA 1TC2A 1JR3E 3KHKA 1ZM3A 5FD8A 5K8VA 3L6OO 3NIDB 5FADA 1CQXA 1VIVA 4WK4B 5LD2C 4F8YA 3J7TA 3OZVA 1CZLA 5DWQA 1DUIA 5JI3E 1ZSYA 1LBEA 3DOFA 1U7XA 3ONVA 5HE8A 2CJWA 2D2XA 1FRNA 4O2AF 1B7GO 2ID9A 3F5SA 2PL1A 1ZZEA 2W6JD 2IU3A 1FMFA 3KTAA 4O2BA 2NUPA 2Z30A 3BB4A 4G8JA 4CM9A 2IIVA 2JFOA 4RULA 2CV0A 3D1JA 1N8SA 2FMKA 2X8WA 3FNIA 3IJEB 1I7NA 4UATA 2OY0A 3EPLA 1IMOA 4MPDA 3CNNA 4U2CA 5E3HA 2WC1A 2P2ZA 4LBYA 1RAEA 3OD5A 4NYJQ 3IQIX 4ZN6A 4NABA 1ZN7A 2GD1O 4WBNA 5TEWA 2CNOA 2UZ1B 2PNJA 5IKOA 2J67A 1R3DA 1SXJC 2OV6A 4M1OA 1VIDA 2R1TB 1HK7A 1R4ZA 3I6IA 3KYCA 1X1CA 1X7WA 2W2TA 1LQUA 3O2NA 3PCXA 2GK6A 1BE1A 4QOEA 3VSDA 3I4CA 4JYBA 2YY7A 3W90A 5L9AA 2HN9A 3M49A 4LHVA 4C87A 1GL3A 3L6BA 1V8BA 1P5JA 4PRKA 1IY1A 2CKMA 2Y0BA 4FB5A 1WB9A 3QVKA 4BCDA 1AKYA 4JUFA 1NLFA 3OJLA 4M0PA 4FNOA 2P0YA 1CUYA 3JD4A 4PLCA 4BQRA 4FM9A 4IYJA 5T41A 1RADA 3BULA 1BN6A 5BXYA 3O4JA 2O2DA 4KB5A 4N54A 4JI1B 1GNVA 4L0MA 1CUZA 2MYNA 5AJZA 3TI7A 3ZXUB 1XKQA 3PQ3A 2W6OA 4CFSA 1EWQA 3WB0A 3TPZA 4EHKA 3PEFA 2EZUA 5MN5A 2QIOA 1K9VF 4HEJA 4FYVA 3D1VA 1R8XA 4AJOA 2HL6A 2BZGA 4Y2XA 3V9PA 1OB2A 4WKCA 3FOAA 2VJDA 4I55A 4GZ3A 3ZW9A 1P19A 4TRRA 3GCDA 3G79A 3ICPA 3QLJA 3ETEA 4JL5A 3HJBA 4JI6B 2HA0A 1P6XA 2WU8A 1GNQA 4PY2A 1JG6A 3LUBA 1GPLA 1T8SA 4JJGA 2B1RA 2J0VA 5F1YA 2PVSA 3KHUA 2M6KA 3SJ7A 3WLEA 4GKBA 1FPMA 3NVDA 1L7DA 3GFGA 1T2FA 1QVVA 1C1DA 4DV4B 1AB6A 4OQYA 4L5AA 3ZJ4A 1N4AA 1MDBA 2NIPA 3GLFA 2ZU6A 5G0WA 4WDQA 1N5DA 4K9QA 4F1WA 1EUYA 4UVEA 2YXNA 4C0XA 5J4KA 4BVHA 4NNJA 1OKKA 1CRZA 3N7AA 1U2TA 2HRDA 4PZUA 3U39A 3UHFA 3BXOA 2OM2A 4XGIA 4BV2A 4EHNA 4O3FA 4CI0B 1EE2A 4D9CA 1QCDA 3BB1A 1YVEI 1XTSA 4J2TA 2ZUSA 1SBZA 2AOWA 4Q00A 3I9JA 2BGUA 2Y1GA 1BDMA 2DCMA 1CXZA 3K1ZA 1NVAA 4IEEA 4KIJA 3DE0X 4QNNA 5HGXA 3VR0A 1GQQA 2HMSA 2QAGA 1F0PA 2J3EA 3PNLA 4HQNA 2N75A 1XTVA 2R5NA 4Z2YA 2QE7A 1Z5UA 2FGKA 4BFVA 3AP3A 3BBLA 3F98A 3W2HA 5CA1A 3HXTA 1AZLA 3RT9A 1J2EA 1PU2A 4P86A 1UPBA 2ZREA 4ATNA 1RCFA 4D79A 4EQZA 1DX9A 1U9CA 2SECE 4OQMA 3U3ZA 3TWOA 1P80A 4TMVA 4WERA 2Y66A 3OLCX 2VAXA 3KHSA 4JC4A 1SA0A 4RLSA 1V9CA 5LC1A 3UTCA 4AKIA 3MT8A 1Y5LA 1YQGA 3GHYA 1T8WA 3RU7A 5F78A 2PBFA 5E7MA 3SIRA 4UUAA 1CZOA 1S2OA 1E6WA 5A4JA 2F1JA 3HVHA 3PG5A 3LM8A 4U5XA 3D8TA 1BW9A 1O5TA 2QF7A 4NWIA 5BRNA 2GXAA 3GDWA 3LVQE 1R5OA 1ZN2A 4UCQA 5JJ5A 1Z0UA 4PSAA 3AZOA 3TTTA 4DMFA 2CB0A 5I51A 2OFPA 3EDQA 1VHLA 2HHJA 3F47A 1ZIOA 2ON6A 1C4WA 1FFEA 2QT9A 4TL7A 2FJPA 4X8HA 2XXAA 1LSSA 1GRVA 1RLJA 4D57A 4YUZA 3JQPA 4FFBA 4U7PB 3IKTA 4QVGA 4MH0R 3VHQA 1GUFA 3N2GA 3SY8A 2CHVA 1F8UA 3EPRA 1PWXA 2TYSB 5ALKA 5EQJB 5EJMA 5FJJA 4FE4A 1P9RA 2Y1XA 2FH5B 4QQNA 1VYUA 5TPWA 5C2JB 1DEAA 3U1VA 1Z45A 1BKDR 1REQA 4PANA 2VEDA 3SQDA 1F7UA 1I3LA 4DKJA 2NO6A 4ZVRA 2EZ4A 3EN0A 4L4RA 4CR7A 2GPWA 1EP2B 2FPLA 2O2HA 4B9AA 1J24A 1IJEA 1AGYA 2I65A 3A3YA 3N39C 2FY8A 4EUKA 2WWGA 1JW9B 1QYXA 4OAPA 4V0ME 1ODFA 2VHYA 1L4UA 3JYLA 1QV7A 4KSYA 1GARA 1O6FA 1Z8NA 4JQZA 4LDPA 3BG5A 1L1FA 2XUJA 3RM3A 3T4XA 1I7SB 4CQLB 2GF0A 3OQ6A 3RSQA 5A3RA 1UBCA 2CW5A 4X54A 5AP9A 3K32A 4XPIA 4YJ2A 2CXQA 3CKYA 1P4RA 3DCJA 4I55B 1KRHA 1VQ1A 3DXZA 3NWOA 4GPZA 5CGZA 4X64B 2A3RA 5LQUA 3ADPA 4HNAA 5EPEA 1ENPA 1QHGA 5CFRA 2YZ2A 3HSSA 1BEEA 4LNAA 4EG1A 5JPDA 4NQZA 1W36C 4M7RA 1TQ6A 4LGVA 4O25A 3LGSA 2UYQA 4QOJA 1Z68A 1VBMA 2QTCA 3N0VA 5THQA 4B71A 4XYMA 3TZBA 2XB4A 1Q7BA 4LOJA 3ZDQA 2ZTVA 2WMYA 1O58A 4UMFA 3L05A 3K6SB 5CDSA 2O8VA 2X4IA 3DEJA 3TXXA 2Q07A 4LVOA 4G0UA 2I8AA 2Y4NA 1G20B 3F97A 4S1TA 3VR5D 3HJUA 3FF1A 1HE3A 3HDHA 5LP6F 4HRVA 1K8XB 1V5FA 3WTBA 3KG2A 2YHSA 2P2LA 1IBKB 3AX6A 4CG2A 4BOYA 2IP2A 3QHPA 4IRUB 3DD5A 2XEDA 1KFBB 3NTUA 4KRXA 4KV7A 4ND4A 3ZHTA 3CNLA 3KZNA 4J90A 5BO5A 5KDDA 5C8YA 1JPVA 2OXFA 2WF5A 1LSJA 1M33A 3FTPA 1NMQA 4IDFA 3EZYA 2O5RA 3H83A 4M99A 1K6XA 4P5PA 1K8YB 4EG7A 3WSVA 1LX6A 3MBIA 5AJYA 1F5NA 4HZIA 2CMFA 5GOTA 2WJYA 3W5JA 4UAUA 1Q19A 2GETA 4YMUA 3FOCA 1CDOA 2Y1EA 4ADSG 4JGIA 1NNSA 1RCTE 3ZY3A 1QPZA 2VUTA 3CB2A 3GLQA 5DI3B 3GRAA 4M7PA 1P75A 2E49A 2XGGA 2YZMA 3I0ZA 4FK8A 4II2A 1UQTA 4GRAA 2AFHE 2X0JA 1NONA 3V46A 3WWYA 4DFDA 3N5KA 4FIZA 1GCAA 3Q87B 4RD0A 3FAZA 4Z4IA 2I1QA 1X2BA 1IVSA 1W5FA 3NC1C 4DM4A 1EQAA 3U9TA 3T5TA 1IVNA 2AZDA 2XYRA 4PYOA 3UH1A 1SVNA 3L7OA 4DQXA 1A4RA 1UADA 3IVAA 2HMTA 3OX4A 1ADYA 3TD2A 5BSGA 4TUYA 2P68A 1ZKMA 4M0UA 2OLJA 5D2CA 5EHXA 1MLDA 1A8HA 3Q41A 5CAEA 3N2LA 3UJNA 1EFCA 1R5JA 5JJKA 1E1RD 1MORA 4ETWA 3BFXA 2AVNA 3AJ8A 3R3WA 4LI0A 2A5JA 1W1IA 2GM9A 2WVJA 3HA7A 1BVUA 1DO0A 1SPXA 3EAQA 5A02A 4ND5A 1AS3A 1DT3A 4DM7A 1JP7A 3SDSA 1LCIA 4M36A 4YFYA 2GNAA 1KIMA 2XDQB 3MINA 2A67A 3OVMA 4WMLA 2ONKA 3UKDA 3R0XA 1C7RA 2YWFA 4QU9A 3TDNA 1AKRA 1ICIA 3CX6A 2R8XA 4CYMA 1MA3A 4Y2SA 2C4MA 2B94A 4L8WB 1V5EA 3TNJA 3B9PA 3FBGA 2XUPA 4M1YA 4HPJB 4XDZA 3VR4H 5JXJA 3E03A 4DLPA 4JD5A 4FC7A 2PRKA 2GF9A 4JVOA 5L95A 1ENZA 3VJRA 3QEOA 3IPAA 3PL5A 2LV8A 2O3RA 1Z5WA 3JVVA 2QX7A 4IGAA 3ND9A 4JZYA 4BP9A 3II6X 2E5LB 4Q7JB 4W1SA 2TMKA 4CM8A 5CFQA 1DPFA 4G4IA 2PS0A 5IAJA 2NSJA 4JL8A 2J5XA 2BFMA 3WKAA 1VL1A 1SCUB 4YRRA 2ZYSA 3GZNB 2QIPA 3O8QB 2VAVA 3FOZA 2J0SA 2MSWA 3DJYA 1ZS9A 3LDAA 1JDUA 5TXGA 3ECCA 3VZDA 4PQRA 4CLHA 4GRIA 3WL3A 3RJZA 4Z4GA 1M8GA 2C5EA 2UU9B 2RC5A 4HOYA 1W44A 4CQMA 2OAGA 2HXYA 5DGCA 1UR5A 5IXJA 4ALJA 3HZOA 2QMEA 3RQIA 3GLFE 3G1UA 1PVOA 2QYSA 4BNIA 4EI8A 3TUIC 3AR4A 2XGMA 3OA0A 3Q3IA 5LU9A 1DLIA 2QJRA 2X5KO 4E2WA 1R0WA 3MWLA 1U80A 3H5IA 1Z5OA 5HS6A 4DCSA 3ITKA 1KQGA 5A4FS 1ML4A 2FPIA 2QL5A 2NM0A 2SKEA 3K9CA 1OXBB 1JKFA 4KLAA 3TB6A 4MR9B 4CM3A 3UHPA 1KK3A 2OBFA 3PUJA 2P4HX 5C5EA 5C80A 5K03A 1JT2A 2X3FA 2P1DA 4PC2A 4KQKA 4XSHA 3UVEA 2IUEA 3NRJA 3WNVA 4BECA 2VSXA 3BEOA 4ZP1A 3SVTA 4LIPD 3IBSA 3M9XA 2V97A 4OQEA 4JBGA 3U4QA 3TCNA 4EECA 3C1UA 4AMGA 2ZWPA 2GWRA 3JYQA 3VM6A 3LX8A 1TKCA 3RYHA 3WJ2A 5HPYB 2I03A 2Z4SA 1BFUA 5AHOA 3BRQA 3GEPA 2BMWA 3H7IA 5FCDA 1M83A 4MUHA 3KAQA 3V4OA 2FWRA 4YRBA 5KREA 1SC9A 1QVZA 1WXXA 2LRHA 2UZ4A 1Y6GA 4QXOA 4E2ZA 1HRKA 1S2MA 2B8WA 3ETLA 5CVCA 4G4GA 4P31A 1E94E 3AUSA 1Z56C 5C35A 4F1JA 3Q7TA 5A1TA 4MMZB 4E31A 4LRQA 4H7HA 3NT5A 4BFCA 3L1JA 4KQJA 4HMPA 5FWYB 4E1AA 4X1YB 3OIWA 1N33B 1QPGA 1GRQA 4PIPA 5ETJA 5K9ZA 2I80A 4HN9A 4MYHA 3PWKA 4JAVC 3C3YA 1ZCBA 5ALRA 2PLFA 3G6WA 3N8IA 5TF0A 1HG1A 1OZFA 4C78A 3ZWKA 1CRLA 3SF0A 4A8JB 4DS3A 2C7QA 5HUHA 1NVDA 4KK4A 5CA1B 1IY9A 4QM6A 1AZSC 3DNMA 1A88A 3MWKA 1FDVA 1OFVA 2XKBA 3SKVA 2ZK7A 3N7UA 3GHHA 3HU2A 1WKVA 2H2DA 4XWOA 1Z9BA 4YO8A 5AW0A 2PMBA 3HN2A 4XQGA 4DDHA 5K3DA 3ZDZB 5B1YA 3H7AA 3HCOA 8ABPA 4OXIA 3ZX5A 1GUYA 3ZUPA 3TDKA 4BGIA 3ZYZA 2OBXA 2OGZA 4GPBA 2E82A 2JDIA 1D0SA 3KZXA 1XTBA 2GM3A 2KSQA 4GZMA 4K28A 2VBCA 5BNFA 4L5CA 3VDXA 4D0SA 4YLEA 2BEJA 3ZVLA 5LJIA 1HZJA 3N9IA 1FVHA 1BFDA 2AI1A 4HGRA 5IP5A 3IE1A 2M6LA 1OXTA 2I91A 3R5JA 1MC5A 1NUSA 5DK4A 1JLLA 2YN2A 1HE5A 1JKXA 3STWA 1SUAA 4BKMA 1GITA 5DNEA 2ZRKA 5J63A 2H17A 2UVDA 4AC9A 3B1KA 3ZWAA 2ORVA 4PG6A 1CUBA 1HYBA 3FI9A 5EY5B 4ZI3A 3GJSA 5IJAA 2I7DA 2YXPX 2WFLB 1RI1A 2IVFA 3DQQA 1DOAA 2JAOA 4LJ7A 4OIFA 5JNUA 5JYCA 4JT9A 4HDKA 2VP2A 4C0AC 3STTA 2BZSA 2IIBA 2WYOA 1ZCJA 3L04A 4Q16A 4GGPA 2H2FA 2FCAA 2VH5R 3X44A 5JYDA 2B37A 3ON5A 5KTSA 5IABA 1NP6A 4M83A 3I2JA 1AS0A 5ESXA 1LV7A 3BAZA 4M0DA 1XJ5A 1UWLA 3PXDA 3DKIA 2HZBA 2C9YA 2FZCA 4ESEA 2ZRBA 1RRKA 4R2WA 5AXAA 1QIEA 3QPAA 3DB2A 3UYLA 2RKWA 4ISBA 1R0CA 2XJ4A 1NLZA 3KUXA 1RSZA 1KEUA 1Y4SA 2D5IA 4I9UA 1WZ2A 4B09A 5M29A 5AI4A 5P8WA 2CF5A 2VJQA 3DEIA 3KXKA 4AFNA 5BW5A 1S2IA 4LDQA 1JQEA 3IBGA 3OM1A 3OOWA 3UB3A 5ICGA 1QHEA 4MRMB 4R1PA 5IBRA 5IVIA 2IX3A 4WOJA 3VC3A 5HSGA 4GX5A 2FWIA 1HETA 2JJ1D 4MB0A 4O4HF 3O84A 3PUIA 1GQSA 3WKDA 4EVSA 2ZI5A 5IJ9A 1QIGA 5LN1A 2Q27A 3C48A 4RTQA 2FQWA 1F4LA 2BUBA 1QHFA 1B76A 1J4AA 1UXHA 2E55A 3SIXA 3VR3A 2FWPA 1NKTA 3TXAA 3IMFA 4B6PA 1WP9A 2GCEA 1ECGA 3NKFA 1JQLB 4J76A 4O4IB 1MUUA 4G67A 4CIBA 3D7LA 1TIKA 2C2GA 2ZB7A 4YJHB 2JAUA 3SD7A 4Z6KA 4X8LA 3BD9A 4EYQA 3QFHA 1QP7A 1GGNA 4CEHB 2IWHA 1SVMA 1P44A 1TJPB 1IVYA 4HEQA 4QD3A 4UUNA 4CIAA 1QFSA 3PENA 1USVA 4S1PA 3CURA 5JASA 4YCCA 1QG6A 3ZKWB 1C3OB 1MOZA 4DRZA 2WZCA 2XUAA 3HU3A 4N82A 4ZODA 4CVNA 2BFNA 5ADWA 1OBVA 1Z08A 2RHDA 4ED9A 1XTQA 5ULLA 3PUKA 2XMQA 3V8NA 4OSPA 4P1ZA 1VYVA 2YWHA 3I37X 3H4VA 5JAIA 3S2IA 2OO3A 3CBGA 3SN6A 4D3YA 1UZAA 2VBIA 3CPSA 4O1IA 3WFJA 4UTVA 1T2DA 4PC1A 3UH0A 4M8KA 1CYDA 3U7HB 2FWJA 2LIPA 4BFXA 4DCNA 4D0GA 2VYCA 3R0QA 3UJ6A 2XWBF 3BCSA 2OLEA 3NBUA 3P26A 4ZAYA 1EPUA 3EXIB 4DY4A 2CWDA 3EPHA 4CWAA 2VSYA 3DEAA 4BU0A 3SR3A 1FSZA 3BGVA 1Z63A 3FHOA 1JI3A 3HCAA 1Y5MA 4Q21A 3DEFA 1PTJA 3PQCA 3BL8A 3W3AA 3W1VA 4F7WA 2ZIFA 2JFFA 1NW9B 1ORWA 3FZGA 5HIMA 4BFWA 5JI2E 2WR8A 3HJNA 3L8MA 5TQJA 4V02A 2AL7A 3U4HA 4BNKA 3PDJA 5CH3A 4KACA 1TUEA 4R83A 2C97A 2W8ZA 3T99A 4D9FA 1IL0A 2DLNA 5LPNA 1TNDA 2WNIA 4IJWA 1YDMA 4J0FA 4O8CA 1DWUA 3NNSA 2C96A 3N2YA 3GRUA 3GGPA 3RANA 1YQTA 2YRFA 3IALA 2OZKA 3B52X 3N8NA 4IDPA 4YBZA 4EPVA 1OASA 3NU1A 3C70A 3MBOA 3R76A 4CFYA 3PR1A 2Q1WA 3EGDA 1JQDA 3UOGA 4HF7A 4OXNA 2EJCA 4RSRA 2MR6A 2VYNA 1P17A 5JD6A 4OB6A 2DFLA 2WF7A 1VLVA 4XVRA 3E5HA 4IIFA 3U40A 3WGYA 1SMKA 1C7ZA 3IBCA 1BMFD 2WIKA 3IDAA 3NHKA 1LSOA 3D7KA 4FQ8A 5LWHA 5C46F 3PRKE 3Q0IA 2QHXA 4CKBA 5ITWA 1V3QE 3FCEA 4M1KA 3M4ZA 3KEQA 3KSAC 4I4LA 2NTEA 3C15C 3SYRA 2ATXA 1Z0AA 1P77A 3I34X 1F17A 1Y3BE 1ZIPA 2ZYWX 4IL5A 3TIVA 2CXNA 2MMCA 2V0GA 4CV3A 5JEEA 2V7QA 2FEPA 1A04A 1BXGA 4H6VA 3IUQA 2GEJA 1Z4MA 3PSHA 3W79A 3KL4A 1POWA 3IELA 1KH2A 1YZYA 3ER6A 4BIIA 4JLDA 2JVJA 4XWKA 3JD1A 2ZUWA 3EC2A 2CCJA 1KIFA 4TROA 4D8XA 5ICCA 5HUJA 3U9LA 3LBIA 5JCPA 3T7EA 3CSUA 4N5MA 2QE6A 4FYYA 4XSGA 1KY4A 2HBYA 4CKEB 4ARZB 1PFGA 1ZC3A 2JANA 3RG2A 4QYWA 4IR7A 2Q1XA 2EKQA 3OCWA 2ZPAA 4CJXA 3DMRA 3P52A 4LZPA 1T4DA 3PEWA 2VEOA 5FBKA 3U4DA 4BBPA 1P7YA 1E99A 4Y2UA 4BKOA 1WOMA 2OHXA 2JKYA 1MAWA 4XA8A 2DZDA 5AK3A 1P2GA 3QFCA 1N2JA 3Q9UA 5EMMA 3V32A 1QK4A 3FPSA 2PKCA 2V7WA 2C58A 4KE9A 2GRAA 5F64A 3DBHB 3NMUF 3QZUA 5HHTA 4H1VA 5HUQA 5KNLA 1PWYE 5CLQA 3RYIB 1JRLA 2HKIA 5L3SB 4H3SA 4MUIA 4XUEA 3E0XA 2RH5A 5JSZA 1SCBA 4DLLA 5CW1A 2DBYA 3C45A 3PC2A 3PNOA 1AKWA 3VTAA 4HNRA 1FDWA 2BMVA 3O94A 1L7EA 4C0SA 4W6QA 5DM0A 1M1NA 3CFYA 1OXKB 3FTDA 1XBTA 2OQRA 4P6VF 3SMQA 2LBPA 2FW9A 2FMTA 4CNBA 1SELA 2V7GA 2MWMA 4UFPA 5BPFA 1W36D 3GT0A 4IJ6A 3R3UA 4MTCA 4RH3A 3SC6A 4HNVA 3GRRA 3GLGB 2I29A 4WLOA 4YRZA 3MINB 3MTIA 1KAGA 4LYGA 4WVFA 4PHTA 5KIAA 2F43A 2C42A 4Z7OB 2MDTA 3VVCA 3U7QA 3T1OA 4RGYA 2LCFA 1SH7A 3AC0A 2YBEA 4KBFA 2HJVA 2VTBB 4CHTA 3OF5A 4PHHA 4RF2A 3Q11A 4PSDA 1HNNA 5HCUA 1B8UA 2PD3A 3F6RA 3EZLA 4MVYA 8GPBA 1NPTO 3R6WA 2KLBA 2P2YA 1II8B 1GPWB 4I81A 4B6OA 3J80A 2HUNA 4R51A 4G2NA 1XMOB 4P0PB 1V6CA 1O96B 4Y1EA 3M8KA 3L1IA 3WFZA 1DCTA 4EEXA 4B6FA 4P7JA 3K09A 1G8GA 4WZZA 1IAVA 2HMVA 1ZESA 1MNAA 4IQ0A 3NANA 2LXNA 1SHLA 3D0QA 5B1IA 4LRYA 1E9RA 3MXTA 5HDQA 3WYGA 2WTBA 1O0SA 1T36A 1EVZA 1KHHA 3DUFA 2WUFA 2Z8ZA 5NULA 1NBAA 2C2YA 3F6EX 1CK4A 1V7PC 3E82A 3VO2A 3BE8A 3RIGA 3RLFA 1MU0A 2QZSA 4GMDA 4LY6A 1ULUA 3GMSA 5LDDC 4S0XA 1VKNA 1W30A 1OX4B 1N2ZA 3EDRA 4H15A 4QQ8A 4PS0A 1N78A 2CJXA 4Q19A 4MNTA 3M1YA 5TT1A 2GBPA 4J3JA 3JAKB 3LQ1A 3ICEA 1SCJA 3QOFA 3O9VA 3KR9A 4K6KA 5EE9A 2ZSJA 1R6DA 2ZRNA 2XE4A 4EUEA 3DVQX 5JAMA 3BTSA 3ZJYA 1L4KA 1LPAB 1G21A 2JGDB 4AZVA 4JBXA 1Y7LA 2DG2A 2YV3A 5IWAB 1JZQA 1UM9B 2C8VA 4C01A 3F8SA 5GGXA 1XMXA 5GJVC 5C1BA 2YXDA 2C98A 3IQXA 3WK7A 4RZ2A 4U2BA 5C8VA 4YXFA 2B20A 2WTMA 3NT2A 2H65A 1YAJA 2BKEA 4NBSA 2C2ZA 4RE5A 3N8DA 1VPTA 3UAOA 1JQ5A 2HF7A 3IESA 4MLCA 4Q4HB 3A1NA 4Y9RA 3UJAA 5ALDA 1QVRA 3FNRA 3QOWA 1Z7BA 2IQ5A 4GQBA 1L5KA 1VJCA 1P9WA 5J59A 4N3NA 5LM3A 2VT2A 1I3KA 4G07A 2X3UA 3WRWA 1D0IA 3B1ZA 3FWKA 4QUDA 3ZCQA 3GRCA 2G5GX 1H65A 1NN1A 5KS2A 3HB4X 1JHRA 4L9WA 3I2YX 3N2KA 2YVQA 3QNWA 5AW1A 2Z6AA 4ARBA 2G1KA 3G5UA 3M2TA 4I6JA 3SF8B 4BNHA 4U2FA 3SMVA 2J7PA 2FXVA 2C4WA 1N0HA 2JCBA 3R3VA 3SSMA 1J8MF 5AOBA 2PJUA 4HXGA 2REQB 3B38A 4YMWA 4QWMA 1H4VB 4P7GA 2WT8A 1K5DA 1T3ZA 4FEAA 4C0HA 4XYLA 3F7NA 1WETA 2PUDA 1MO6A 3UWOA 5C7YA 4LFAB 5GOZA 5EZ5A 5F35A 3RU2A 5IK2A 4IHKA 1M2FA 2ZVDA 5C34B 1ZH4A 2I4OA 2XVAA 4E5KA 3GP8A 1XZ8A 4ZWNA 2HJSA 5TEVA 1RMYA 2AUMA 4RU1A 3SS9X 4OHWA 4NBNA 5F12A 4U6SA 5CYPA 2JB9A 2VNHA 1UL1X 2A78A 1ZXBA 4GUDA 4HN4B 5FPTA 3GGCA 5IKXA 3MD9A 3A04A 4ILEA 5GM1A 3IUEA 4JCCA 4G8DA 1HE4A 3R75A 1AHNA 1UEXC 1LVHA 3GB9A 3OMWA 4M1WA 5I9TA 1LBSA 1XCLA 1HDIA 4BMDA 2OMEA 5EMKA 1QZUA 3PX3A 5EERA 3ZU3A 2VDQB 4RY9A 5JYEA 5E4JA 1UF9A 3OU6A 1YD7A 1KEKA 3C5WP 3UXYA 2HU2A 4MVWA 1LA2A 2O0KA 3S2YA 2BKXA 2C9DA 4JI5B 3NXSA 4NP6A 2FZ4A 2VP9A 2AXNA 1I2MA 1NUAA 4J0HA 4ZYUA 3B2QA 2EAUA 3EBPA 1AN9A 1HC7A 2GARA 3ICCA 3P4YA 4RXTA 2JI7A 2IYFA 1R6BX 3HXPA 1KZ1A 4OXRA 4MQMA 4TVKA 4B74A 1RXSA 1US8B 2EXXA 3R44A 2R48A 4HAUA 4M1SA 3THXA 3FSRA 4K6HA 5JHGB 1VE7A 5E6UA 5FX2A 5LD2B 1JPUA 3EOBI 1GO2A 3OPQA 2OGUA 2W2QA 3KXDA 2YXBA 4F4JA 3F8WA 2AG0A 3P4XA 4KHZA 3WLNA 4FZ5A 1T2AA 4U7DA 2NUBA 2FQYA 1FJXA 3MWFA 4I5GA 2FRVA 3MGBA 2VDMB 1N1EA 4A0HA 3GQBB 4JUCA 5BWNA 3D54D 5JRJA 2WWHA 2B98A 2XW6A 1XKLA 2PUBA 2FZLA 2WZBA 4PX3A 1RXIA 3EPPA 1H8HD 4UTZA 1LS6A 3D8RA 3OJFA 4GIBA 2VPXA 5AVKA 3RUPA 1DG9A 2PX6A 1QH9A 1XQ1A 2AOUB 2BHNA 3RS5A 3FN4A 3LWZA 4BVBA 3A9UA 3GFOA 5FWXB 1TJNA 3JQ7B 3M34A 1ACMA 1Y3DE 2W4QA 3BSSA 4PLYA 4UM7A 4CODB 1ZQ9A 4TOIA 2O1XA 2GMWA 2ID7A 3T52A 2MINA 4DABA 4F4CA 3FOEC 2V96A 1CUDA 3R3JA 3DL4A 3ONEA 4H6PA 3M0EA 1S4MA 2QV0A 1B1AA 5E1BA 1R15A 2IEAA 1JH9A 4WIAA 4LNUA 4YROA 1TADA 4OUDA 3JR7A 5LKRA 3H87A 1BJKA 1JHYA 4GYJA 3D3NA 3PNBA 2QLFA 4E07A 1I10A 4JYMA 2Q1SA 5A06A 2W2PA 2BISA 1YQDA 1KBOA 3K4HA 4CEJB 1LVUA 5T6MA 4QUAA 1S9DA 4GXTA 2RAPA 1MXHA 4AY4A 1UIRA 2Y1LA 2WUVA 2WYWA 2WD7B 1FUUA 3KKEA 1TMGE 1NZJA 4BAGA 1Z47A 1A9XA 1KFKB 4EX6A 2IPAB 3QVJA 5LIRA 2EOAA 3AMVA 4IIYA 3BXXA 3TUZC 3C3XA 1QR2A 1U65A 4OF4A 2PQ2A 1FMCA 1IOZA 3KKZA 4UNQA 5KQSA 1JIQA 3QH4A 2GYUA 4M6WB 3U1TA 5JD5A 4HK4A 3CLSC 3ELBA 4JUDX 1O6GA 1BHJA 2Y0CA 1NTOA 3NOVA 1L8AA 1CU1A 4ZAVA 4EY3A 1EIWA 4XGNA 4NYJR 4OA5A 4IWXA 4KU4A 2A4MA 4WSOA 2WG2A 1R4MA 2ERXA 1P1RA 2YIMA 2CUKA 4N41A 3H9GA 4K9RA 2CVZA 3HFGA 4L9RA 1PWHA 4OIMA 4QDXA 3ULKA 4HGPA 2YHUA 5BVHA 4ZAZA 4LDAA 3ONFA 2DF8A 3GU3A 3QVVA 3V7NA 2O2EA 1VB3A 1YQUA 3CLRD 3OMLA 4O4JA 3H05A 3L7LA 2QU7A 5DMHA 5BN4B 4HFNA 3RYFB 4FHGA 3S1LA 5B1HA 2XX3A 4W1QA 1I2DA 4MDYA 4HGQA 4M1EA 4DCGA 2CLIB 4YR7A 4KODA 4NS4A 2WJWA 4YRJA 4RDXA 3JVEA 5KNBH 1Y98A 2QRMA 4FQ7A 4QYMA 3DAFA 4YC7A 2CFOA 2DUMA 1B0AA 4Q0MA 1U1IA 1Z75A 2IYEA 3KVVA 3ZUGA 1ECLA 3EVTA 1CQIB 1AO3A 1GSIA 2ZBPA 3A3NA 4JBWA 4WE3A 1U2QA 2FA9A 3EULA 3LYAA 2E4XA 3M1IA 3OE1A 2ZIEA 1RHRA 5A5FA 4D4KA 4X8OA 2RHWA 4B17A 2F4VB 3H2HA 3LX5A 5MGNA 1JGTA 2B4AA 4QBHA 2AE1A 3N2GB 3O3OB 3OIDA 4EDFA 2A57A 2I2CA 3TF5A 1V35A 3QF4B 3GQVA 4RZXA 3CXRA 1YZGA 2ZUEA 1PR4A 3AFOA 3VO9A 3GFVA 3ZWXA 1PNVA 2JCYA 2Q4BA 4PN7A 5FFMA 2D1FA 3GLRA 4FIDA 5CB0A 1GL7A 4C2TA 3IP3A 4P80A 3JWPA 2Z56A 2NVBA 1CY1A 1DIOB 1UOQA 4QRHA 2ZFUA 1H2XA 1XK7A 1M34A 2AZTA 5L3VA 2QRLA 3SOPA 1RBMA 1YB6A 1G8YA 4DSTA 3SHFA 3BIOA 5DNVA 1HEIA 3NKVA 4GPIB 1ZMBA 3PWZA 2FR1A 1MQ8B 3D5EA 3WRXA 3C1OA 2GXSA 2JBHA 4RUKA 5PNTA 3SEAA 3UJPA 1NVBA 4ARAA 4B3CA 2NUTA 5B58C 4RYDA 3VTZA 3LC2O 2GZSA 1MAAA 2QPLA 2ZI9A 2X9GA 3PFCA 1IONA 4X1KA 4BJ5A 3AKDA 1WABA 3GJ8A 1BRTA 3PIRA 1U3TA 4M0FA 4C7MA 5IU6A 3PHGA 4HEHA 4PXSA 2VPYA 5CIWA 1F7VA 1J33A 4XVHA 4ZO7A 1ZUD1 4A3SA 2EW1A 2BELA 1KJNA 4GMHA 4HVCA 2QY6A 1W5AA 4DZTA 4FGWA 4NV0A 4EFLA 3VNBA 1RYYA 1M9NA 1R5BA 2R47A 3VNRA 2XCUA 3OUTA 5AK5A 3W7AA 4LPSA 4KK3A 13PKA 4X24A 4QVIA 4TWAA 1OT3A 1T0PA 3E4CA 3EIEA 5C8DA 1GL6A 3LOQA 2I7CA 1TZKA 4G1FA 3UHJA 3UBTA 1UOPA 1QBGA 2ZR9A 3BM5A 4V2IA 4X63A 5DWDA 3VOAA 2JEZA 3RRBA 4W7SA 4RZQA 1GPJA 2ZAIA 3DL0A 4ZVUA 1R6VA 1QLHA 4Q7KA 2BGIA 5ITZB 1T6XA 2PUHA 1QU3A 1MT3A 1IPFA 5H82A 3H1TA 1VOTA 3HY3A 1TKRA 3MMZA 4IJMA 4UMVA 4CETA 5JO0A 3VR1A 1OILA 1ULBA 2QGZA 3Q40A 1YZ3A 5DGTA 3S2UA 2MSKA 2X4GA 2DHRA 1LQ2A 4QJBA 4FFSA 5BR1A 1USGA 1N5MA 3HY6A 2NUPB 4GLBA 1C3VA 4YY3B 3QFTA 4EF6A 4BLVA 5BN5B 1TTHA 1M0WA 1RI2A 2QENA 5IRCD 1U0LA 3BH7A 2P9QA 3SQMA 1HGXA 2JLVA 2HMWA 2FSSA 2YMPA 3COVA 4EZIA 3GPIA 4CF6A 1I2AA 2PMCA 4FPXA 1Q0QA 3ZGVA 3K1YA 2VBGA 4MJXA 2E4VA 1G6OA 1O2DA 3MOSA 5TQ2A 3QBDA 1SUPA 4X94A 1LDEA 1PL0A 1KKMA 2Q9CA 2XZDA 3DR5A 1QWOA 3K2BA 4PSVA 2R4QA 1JQ3A 3K6RA 4WY2A 1CHNA 1NVGA 1VLZA 1JKJB 2ZYGA 1PK9A 1ZQ1A 3AFHA 4OJMX 3TKLA 4BMSA 3E9YA 3TW0A 4KR7A 3W77A 1MEEA 2XECA 1H5NA 3JD3A 2RH4A 1IHUA 1RLOA 5G1OA 1M66A 1E89A 1MP0A 3VRHA 2PXHA 4IW3B 3FTCA 1H1LA 4MWCA 4B47A 2E48A 2H07A 4DB2A 1PTJC 3CA8A 1GA6A 4XE5A 1GG8A 5DTEA 1J00A 3RHFA 1BS9A 3LSYA 1NYTA 1P3Y1 3U3JA 3CRW1 5JQGB 4KREA 4A7PA 1T13A 3TIGA 5CTAA 4W1PA 4ECAA 3HQ4O 4BQFA 3I12A 3P9RA 3B6MA 4GSLA 3OBBA 1I7LA 2BUAA 4R0NA 4XASA 4AZWA 3ZH9B 1DMRA 2J6CA 1X1SA 2RSLA 1XC7A 1NM5C 3FSEA 3H75A 4TM7A 4UDNA 4L9AA 3DHWC 2R97A 3K30A 1JEQB 1KVSA 3KUDA 4Q3EA 3ZK7A 4NR0A 4IQ8A 1F9EA 4LBVA 4Q1BA 4R5MA 3OPMA 3R5FA 3EYAA