4H60A

High resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
120
structure length
120
Chain Sequence
AMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 42
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h60A00
2FLWA 3Q9SA 3HVRA 3GA5A 3HS3A 5HKOA 2JB9A 3LUFA 3JS5A 2E4ZA 2FN8A 3LUJA 4XLTA 3OLVA 3CTPA 1SXGA 3QLTA 3LUAA 4FB4A 1JLKA 5C5CA 5ED4A 1PHRA 2PUFA 4RK5A 4EVRA 1T34A 1NXXA 4ETIA 1CEYA 1JF8A 1DRJA 4HNQA 1JFVA 2QU7A 4HNSA 4YS6A 4N47A 5JNWA 5IULC 1F4VA 1U2PA 1USKA 2TMYA 1QPZA 2NZUG 2QW1A 3KJXA 5IEBA 3KYIB 1M2FA 1IIBA 2E4XA 2B1JA 2LPMA 3F6PA 2P4UA 1MB0A 4LE1A 2WJWA 1DC8A 5PNTA 1ZAYA 2LP4Y 5IUNC 1ZHHA 1MB3A 2J48A 1ABFA 3NNDA 2HJ9A 2WY2D 5KC8A 4Q6WA 4QICA 2A9PA 1NATA 1PUXA 1R8JA 1U8TA 1EFAA 1MIHA 4O5AA 4Q6BA 2FMKA 3C6QA 1ISSA 1JYFA 5B3JC 1DJMA 4MQFA 3MQ4A 4O1HA 3CLKA 3RVLA 3Q7RA 1DRKA 3LMKA 4EYQA 4LE0A 2YHBA 4RK6A 1QO0A 5KWSA 1F51E 4H3HB 4H60A 1NXSA 1Z2DA 2PKXA 3HO1A 1VPWA 2FMFA 3LOPA 1DCKA 4ZPJA 1D1QA 2M98A 5JNVA 2GX6A 4N0QA 1ISRA 3DZDA 3OM1A 2GBPA 4Z4IA 2FSPA 2MYTA 3EGCA 4F8JA 4ZYLA 4S04A 1CYEA 5CNJA 3CZ5A 3TX6A 1J56A 3ILHA 1DCFA 3M9XA 1QKKA 3O2JA 1I3CA 3GYBA 4IILA 4WZZA 2FXIA 3IP5A 2NUBA 4KV7A 2IPNA 5BR1A 3A0RB 2RGYA 5DKFA 2RJNA 1YS6A 3T6KA 4MR8A 3I42A 5EWJB 1KRXA 4YP9A 3MIZA 4EYKA 1NY5A 3CG0A 3HZHA 3LFTA 4WWHA 5DCLA 3HUTA 2B4AA 4B09A 3OQOA 4NICA 3LUHA 1DC7A 3CU5A 5T7BA 1BDHA 3RVSA 1KMIY 1A0OA 4LZLA 4YLEA 1FSPA 2CWDA 1HEYA 1JWLA 4NQRA 1BVHA 1VKRA 1RXIA 2R47A 5TPZA 2FQWA 4RY0A 3RVPA 4MPTA 1Z13A 3K4HA 1SRRA 2N9UA 1TLFA 4HNRA 4WXMA 1Z25A 3OO1A 3DLBA 4KREA 5FWXB 4Z9AA 4ETMA 4G0YA 4E7PA 1FFSA 1OXBB 4JA2A 3H75A 4QPJC 4TLMB 2FTKE 1H9CA 4OATA 3TB6A 4NV3A 3UUGA 4PICA 4MLDA 4KMRA 2PUGA 4G97A 1YK1A 2FMIA 4Y9TA 4KFCA 1XWWA 2JBAA 3RQIA 4ZJPA 2FQYA 3K9CA 1KRWA 3I09A 1K66A 4MYRA 3VNBA 2PMCA 5IUKC 2E4VA 3VNAA 5CNIA 5DLEA 2W42A 3A3KA 3IDOA 3L6UA 1QP4A 4RKRA 3SQNA 1YTUA 1ZH2A 4XASA 1DBWA 3NHZA 5TQ2A 4JB0A 3GBVA 1GUBA 3BREA 3R0JA 4MQFB 1K68A 4CBVA 5KQMA 3HK2A 2F8SA 5KC9A 2VUHB 3H6GA 3HEBA 3FDFA 4GNRA 3T8YA 5HQJA 2QSJA 3MM4A 3F6CA 3KYJB 4RWEA 4RDCA 3O74A 1AB6A 1Z18A 2FLKA 3QLVC 1RPJA 3IPAA 2IPLA 4N76A 2OQRA 9ABPA 2QVGA 1P6QA 4UHJA 2FQXA 5I4CA 1RZRA 1FFWA 4ZMSA 4KPYA 4RKQA 1RNLA 1D2AA 1ZGZA 1ZGGA 2QR3A 5F64A 1QMPA 2O20A 4W5OA 3DGEC 2DRIA 3FGZA 1OXKB 2H0AA 3RVQA 3QX9A 3OLYA 5JNSA 1CHNA 4RZSA 3EULA 4YGXB 5HM6A 1YS7A 2WWVD 2XDYA 2MYNA 3DBIA 1DBQA 4G0QA 1YMUA 4LE2A 4MR8B 3T95A 2PL1A 2ZAYA 2E4WA 4KK4A 4LX8A 3O2QB 5FWXA 2KYRA 3FFTA 3KLNA 3RVMA 1JDPA 3SG0A 1EHCA 1BDJA 3N6VA 1ZVVA 4Z4FA 1TMYA 1QQBA 1LK0A 3H6HA 3TD9A 3HXMA 1FFGA 2WRZA 3QK7A 4RK0A 1QP0A 4YV7A 1NXPA 4OLAA 6CHYA 1SD5A 1S8NA 1ZDMA 3LKVA 4G0PA 2NT4A 2MYPA 2WMYA 1LBIA 4G0OA 2MSKA 4MR7A 1YMVA 3Q15C 4OLBA 3MMNA 4MS1A 2IDMA 3C3WA 3LUDA 5TPZD 1EWVA 3N0WA 4YR7A 4RSMA 4RK4A 3EJWA 1EWTA 2AYXA 1NXOA 1JYEA 1NXWA 4TMYA 4Z99A 4W5RA 1C4WA 4FE7A 2JBAB 1VRVA 3EDCA 4LDZA 1D5WA 2WB4A 3F7NA 3IP6A 4YRZA 4MS3A 4ZMRA 4Z4CA 1JX6A 4RV5A 5TQ2B 3GL9A 3GBPA 5CHYA 2FMHA 2ID7A 2A9OA 6ABPA 5TPWB 5BRJA 2PAFA 3O75A 4IF4A 3OO0A 1E6MA 1U04A 3B2NA 3IPCA 2YHAA 3N75A 3SY8A 1AB5A 3NBMA 3P9YA 1D4ZA 4QYWA 1QNLA 3FMVA 1P8AA 2FEKA 3QEKA 5HSGA 1XHEA 4KVFA 3KHTA 2A9QA 4NCBA 3KSMA 2AYZA 5KI6A 2HQOA 5TQ0A 4PE5B 4LDAA 5E3JA 4O1IA 2IPMA 4RK7A 5DTEA 2ZWMA 2NT3A 2P9HA 5B3JA 3TO5A 4FE4A 3O1IC 2VUIB 3HCWA 1TJYA 4MGEA 5BQ3A 3G85A 3QX8A 4JOQA 5CNKA 5FBKA 3H5TA 3HV2A 1Z12A 3JY6A 3NHMA 2PUCA 3IP9A 2QVCA 3EAFA 4JAVC 3H5OA 1RZRD 3FFXA 3D8UA 2H3HA 2V0NA 4G0MA 2E4UA 3QEMA 4KK3A 3RVOA 4QYMA 4WUTA 4G0XA 1Z2EA 2IYNA 2MYUA 3QLUA 1A2OA 1U0SY 1Z15A 2QXYA 3CKMA 3CRNA 3ILYA 3NNNA 3H1FA 1ZY2A 1B00A 3GRCA 1W9HA 3N0RA 3KLOA 2PLNA 3NNSA 4KNYA 1TM2A 1C0EA 4IMIB 4W5QA 2M1ZA 4EVQA 4PZ0A 3GT7A 3CFYA 1PNTA 4JP1A 4KQ9A 1USIA 4MR7B 1LJLA 1L5YA 3RH0A 4PYRA 4DN6A 5TPWA 4MS1B 2PUAA 1ABEA 4EVSA 4MS4A 2HSGA 3HDVA 4ML3A 5JS2A 3JTEA 3ROTA 3HDGA 4OBBA 2R25B 2LBPA 5IX8A 1L5ZA 3F73A 3L49A 2JVIA 2LUOA 4MS3B 4F06A 3H5LA 3S99A 1KGSA 1QO0D 2L18A 1MVOA 3CS3A 1ZESA 3KTOA 3LKBA 3RVKA 5DGCA 4F3TA 3BILA 4Z4HA 2JK1A 1Z17A 1JH9A 4NCAA 1MAVA 1BAPA 1A04A 2FKAA 5TE9A 5IEJA 4EYOA 4OTZA 3M9WA 4KRFA 3EODA 4RU1A 5EWLA 1Z26A 4YCSA 4XXHA 5TQ0B 1U2QA 4LRQA 3N53A 3A10A 3N0XA 1P2FA 1SXIA 2F8TA 2HPHA 4PEVA 4DQDA 2VK2A 5KQLA 4F12A 5BRAA 4IRXA 2L2QA 3OLXA 4KZKA 3CZCA 4M88A 7ABPA 5IBQA 1JHZA 2PE5A 1QQAA 4MRMA 1YK0A 2LIVA 3SAJA 1M5UA 1DBPA 8ABPA 1WETA 2A9RA 3LUKA 4H3KB 3QLVA 2L17A 3QEMB 3MF4A 4F11A 2NZVG 5C5EA 4KQCA 1ZH4A 4IMJB 4MQEA 4W5NA 5FWYA 4N41A 2GI4A 3IP7A 1E6KA 2MSWA 3A0UA 1P6UA 4JASB 1LBHA 2FEWB 2PJUA 3O21A 1GUDA 1JFTA 3JPWA 4N03A 2FN9A 2PUEA 3O2SB 3MYYA 1YIOA 3H1GA 1DZ3A 4WXEA 3CHYA 1GCGA 1URPA 4RK1A 3UKJA 1JL3A 2MSLA 3H5WA 3HSYA 4P1ZA 4JB2A 2FW0A 3Q7TA 3HUUA 4L4UA 3KS9A 3BRSA 4MS4B 5JNUA 2GKGA 1EAYA 2OENG 3KG2A 4YO7A 4ETNA 5JS1A 3Q7SA 3KCNA 3OLWA 3I5AA 4TLLB 4XFKA 1BA2A 2BGGA 4OG2A 3SNKA 3EQZA 5D2CA 3CG4A 3UK0A 2R48A 3QELA 4W5TA 4RXMA 1TVMA 5EWMB 3E3MA 4MR9A 3T38A 2JVKA 1UDRA 1Y1LA 2JCGA 3C3KA 1EWKA 3OMWA 4G0ZA 5TQJA 2IPAB 4Q7EA 3H1EA 5KQPA 2PL9A 3QLUC 4D6XA 1M2EA 5FBHA 4MAAA 5KQGA 3ROFA 1VLZA 2FEPA 2GWRA 4L85A 2PUDA 3EQ2A 4MLCA 3OQNA 2RDMA 4YWHA 1E6LA 1SXHA 5CNMA 3HM9A 4WT7A 5EWLB 3JPYA 2ID9A 4UHKA 2Q5CA 1NTRA 2E4YA 2RJOA 2HQRA 2QZJA 3BRQA 3Q41A 1JDNA 1PEYA 2PUBA 1JBEA 1GCAA 4E7OA 5IUJC 1E2BA 1W25A 1D1PA 4Z0NA 1DCMA 5GOTA 3OLZA 1NXTA 2QV0A 4D74A 2HQBA 4DADA 3JVIA 3BBLA 4MRMB 3CNBA 4XARA 4D6YA 3GV0A 4TN5A 5IC5A 2IOYA 3KKEA 5JNTA 3O1JC 1Z16A 3RVNA 1JFSA 3H5IA 3W9SA 4XAQA 3HJFA 4MQEB 2L19A 4EYGA 3C3MA 5FWYB 5T3YA 4G86A 3DGFC 4S05A 2FVYA 3C97A 3RVRA 5GQSA 2WJAA 1XHFA 2JVJA 1ZITA 1FQWA 2X7XA 2IKSA 1LJUA 3MA0A 5ABPA 2CHFA 3SM9A 4P98A 4RY9A 4Z4GA 4Z9BA 3O1HB 1NXVA 3LUCA 4EGSA 3I45A 4GPAA 1PNRA 5EWMA 4HYEA 3G1WA 3D02A 3GWGA 3FFWA 3RVJA 4RY8A 2R4QA 1APBA 3E61A 5JNRA 1BDIA 2JRLA 4RXTA 2CHEA 2VYCA 4Z4EA 3TMYA 4RS3A 3OQMA 3JVDA 4IGAA 3OMXA 1ZN2A 4EY3A 3URMA 3QELB 1PEAA 2I6FA 3N8IA 1M5TA 1RXEA 3H5VA 3LUGA 4MR9B 4RXUA 1USGA 1GLGA 3OM0A 4EUKA 1QP7A 4N0PA 3DLHA 2CD7A 3M6MD 1DP4A 5EWJA 3LTEA 1YVUA 1DG9A
chains in the Genus database with same CATH superfamily
2B83A 1TEXA 4FYHA 1BEZA 4RENA 3E9QA 1A27A 5HKOA 2NSJA 4FGJA 4FFOA 4QAJA 2RHRA 2QUHA 1IN4A 1UFOA 2DPMA 3QLTA 4CM3A 1AMUA 2WNSA 3KWLA 4RK5A 2EFGA 3H42B 4L4XA 4R1MA 2Q7OE 4O4IF 4ER3A 1JILA 3RJZA 2NSYA 1GPBA 3MT7A 2GAIA 1NNUA 1GDHA 4JITA 1LZLA 3LWBA 4R0MA 1C0KA 2VTBA 2O8NA 3LVBA 5JJIA 1IVYA 3D4PA 4GUDA 1BDBA 2NZUG 4FTWA 4IZIA 4HLUC 5IEBA 1EFPB 3Q3VA 4NYMQ 2J3LA 1EDOA 3WICA 1NVEA 2HU7A 5CB6A 3U39A 4BQFA 3VZDA 1D09A 3F7MA 1FRFS 3NNDA 3PC3A 4GPD1 3V97A 2CVFA 3G88A 3OZWA 2Y2UA 2QLBA 5KC8A 4UU8A 2II6A 5EE3A 2NO6A 1C3JA 2FSVA 1AGXA 1KI4A 1K6IA 2NUAA 3A37A 1BCSB 4P36A 3KKKA 4FSDA 5EJ4A 1U8XX 4O1HA 1E2PA 4PZ9A 1NV8A 4DCCA 1U7WA 5DEOA 1TYDE 4M49A 4N40A 5ETJA 3LMKA 1Y81A 1IXKA 2WTXA 3KJIA 3SLGA 3ZEAA 1LDMA 2R1VB 3FIUA 3ND9A 1I2CA 1A9OA 2R00C 1N4DA 5FUBA 4DLNA 1AKYA 1DTEA 4MWCA 3WRVA 3BWDD 1JKXA 3CZMA 1ZD9A 1ZR2A 3KQTA 3DOJA 1E4VA 2O3TA 5JCJD 4PC6A 1M2WA 3KQYA 2MYTA 1S02A 1VHJA 2H1CA 3GHYA 1JU3A 5ALZA 1T4CA 4CG0A 2HJWA 1NXQA 1DEXA 3MB8A 1WDTA 4RX1A 5K4HA 3I05A 3KL2A 3GFVA 4L07A 4N5IX 4WBNB 4JI8B 3HVKA 1VBMA 3CV3A 3DTTA 3JQ8A 3RSLA 3FAZA 4LBYA 4HXEB 1H8EA 4QKQA 3L6RA 3GJXC 3TRJA 3CRVA 3AFIA 2XH8A 4NEHB 4MYHA 1V8OA 2P65A 3IIKA 1R0ZA 1W2HA 3BA6A 4WKPA 1A9SA 2ZBRA 3DFFA 3IJEB 3EZXA 3DCJA 1GLVA 3F3KA 4LF7B 2VXYA 5JSZB 5D3QA 1P73A 3V7FA 3SFTA 2UUAB 2C2GA 3JD2A 3R9KA 1TU4A 5EJAA 4QOJA 4ZGBA 3IV7A 2JAOA 1I51A 4DZZA 3JD1A 2L69A 3L0CA 3U3DA 5HTOA 1FDIA 2IU3A 2XZDA 1SC9A 1CDZA 1TKAA 2QWXA 2V6GA 2WUEA 3D5EA 3EXEB 3J7TA 4H1VA 3PNOA 3PC8C 1U28A 3FZQA 1Z4LA 4J2TA 2VAPA 3AC0A 3MPOA 5FOXA 1VQ1A 2KW5A 3ER8A 4E5UA 2G9ZA 1ZICA 4U7JA 4DZTA 1WOMA 1E3EA 3H9EO 4J0FA 3ZCXA 1RQ2A 2ODNA 2FOXA 4LXYA 4FMCB 5GJCA 4Q37A 2AJBA 3GLIE 2M2IA 1N77A 4NARA 2WHYA 1TK9A 2HXGA 1AUOA 1SBNE 3Q6IA 3OOYA 4FFBB 4JENA 4D56A 1PS9A 5E6UB 5IDWA 4BOYA 1DARA 1T6BY 3M1YA 3R7DA 5CB0A 1TPZA 3OPYB 2VG8A 4I9FA 5MN5A 1QP4A 1TQ4A 2TMDA 3BCUA 2C9MA 3FSGA 5BR8B 3NPAA 4GDMA 1SCAA 4HQ6A 4IL5A 1Z0AA 3L41A 2C7OA 5G4KA 5LQDA 4UVIA 4G01B 4C7VA 2Y0CA 3RBAA 1K3FA 1E9CA 3NBQA 2PUWA 3MM4A 5CDTA 5LZ4A 2YV2A 2Q4OA 4RWEA 3NKLA 3TNJA 5IK2D 2SCUA 2J3EA 2O4UX 2HC9A 2IBTA 3QF4A 5CYGA 1B43A 1S9DA 2W4QA 2YJ6A 3UAYA 5AUNB 4Q9KA 9ABPA 4R2KA 2BT4A 2SKEA 4KGXA 4UHJA 1PLLA 1WPRA 1YH3A 1E99A 1BTOA 5IN4A 5KDDA 4XTRA 4OH7A 4WERA 3VFDA 3VHQA 4D6PA 3G1UA 3UB3A 2PVSA 3F46A 3WLSA 5FBVB 4B1FA 4GBJA 2P0AA 1QCCA 4WXRA 1CHNA 3VM6A 5JNSA 3E1GA 1ZJ5A 1ZJZA 2BISA 4J1QA 1ZXLA 2NGRA 2OV6A 3ITNA 1YS7A 2WSYB 4MA4A 1OLXA 2ZPAA 3DZHA 3JQ6A 4Y1RA 3KP1A 4XPIA 2WYVA 3FUTA 1FDWA 4RDXA 4W8OA 4RD2A 3VZPA 1R12A 2W2QA 2VDMB 1U2TA 1WLYA 3L7DA 3DEFA 5CJJA 1P0MA 5D5PA 5CDFA 4ZN6A 4I9HA 1Z68A 3IUPA 4G85A 3B51X 3DYIA 2L82A 4HO1X 5ITSA 1OZAA 2PIAA 2R87A 5CT9A 4RGBA 1L4MA 2PRIA 1NUTA 4FS8A 3DKKA 2MU1A 2Q5LA 1P3Y1 1NASA 3E22A 4KVAA 1NBMA 4IIVA 1D6JA 3PC4A 3QM1A 3HEMA 4CG2A 2Q28A 5EJGA 1T8UA 3EQ8A 5CDUA 2QL5A 1TT7A 10MHA 3RHZA 3T06B 5JOQA 5SY9A 2HSWA 2Q29A 1XRSB 1M6VB 2PKWA 3E7FA 3I5MA 4OQXA 1FNCA 3MJSA 4CFYA 4EG4A 2HHCA 3CZ4A 4OHVA 5JO9A 5AW8A 4DPKA 2ATEA 2C92A 5IDQA 1PQWA 2ZEJA 3M4JA 1NL3A 4RK4A 4W5TA 5I5EA 3AIIA 4JX9A 1GPNA 3LS2A 4RTMA 4Z99A 2UYCA 1NJGA 3PFIA 1Q5PA 2RHLA 1NW9B 3BRWA 3CJTA 4D9IA 4QYXA 1H4QA 1UBKS 3NDPA 2P1DA 2G0AA 4KI0A 2JAXA 1X0VA 1A7UA 2LVBA 3RSHA 4RVFA 3UJPA 2ZE5A 3PV0A 4WOJA 3WMEA 4WLVA 3D0RA 3FAKA 5IVDA 1RXUA 2IPOA 3VR4A 1NKTA 4A92A 4FE3A 4B2PA 4WK2B 5AI9A 5FUQA 2XTJA 1U8UA 4X7MA 1AB5A 2WD8A 5IJZA 3OU7A 4BAUA 3HCCA 3I1JA 1GNVA 4RTOA 1UQRA 3U7QA 1T5LA 1XHEA 4P3XA 4FSHA 3SC4A 5JZMA 1T6XA 3NUQA 2XNDD 5DCUA 3BM5A 3LQ4A 2Q8QA 4Z8XA 2WJJA 1OI7A 3K1ZA 4U39A 2XF8A 4R2WA 5AT1A 2Q5FA 1MB9A 1R8XA 3QJ5A 3JQFA 1K86A 3ADPA 4HNTA 1JQJC 3KE9A 3QX8A 5CNKA 1GCIA 4RNDB 3ZQKA 1IM8A 1MB4A 4JNKA 3P9XA 1A9PA 1E1YA 1AQUA 2D3TA 3BQNB 3D8UA 3L0DA 4L4ZA 5CX1B 3RS3A 1K5DA 1EVKA 4K28A 5IP5A 3GZNB 1X87A 3O9MA 4ZHQB 3RUPA 4DR1B 3QEMA 1IZZA 1DKQA 4YV1A 2W9XA 3CT6A 1PGNA 3C6XA 3A27A 1Z2EA 3H6KA 1M74A 4Q02A 1HDCA 4WW0A 1QBGA 5KKNB 5KI6A 1B1CA 1YKFA 3A4TA 3BH7A 1TM3E 3HZZA 4JP8A 4CU2A 4ZTZB 4DR6B 3AETA 3AQ4A 3KLOA 3TGWA 3AEXA 3ZWVA 1NJ5A 4LS3A 1YRLA 2PNJA 3JQDA 1ZOOA 4GSLA 2P6NA 3L6BA 3G9ZA 5KYUB 1IUNA 1Z5VA 4DB2A 4HVTA 1UK9A 4CMAA 4N6GA 4RD4A 5IRCD 1J70A 2HNKA 5J2UA 4JP1A 3HXPA 1QIMA 4HPJB 1A50B 4KQ9A 4QJBA 3RH0A 3VHLB 3WYFA 2P0EA 4J3FA 1Y34E 3ZZTA 4CT5A 4Z7QB 3UUEA 3ESXA 4MS4A 3IPXA 1R4ZA 5DWVA 1E32A 3RJ5A 3ZQUA 2WG1A 5LQAA 4GI3A 5SYMA 4OFXA 1MP0A 4ZHSA 4ROTA 2CUNA 1Q3HA 4GZ3A 3FTCA 1U1IA 4XEHA 2HXSA 3WLFA 3MHTA 2HTFA 1HNWB 4KLRA 1J0DA 5E2IA 3R9WA 4O3FA 2Z6QA 3H2BA 5LQRA 1K06A 1K4YA 1YQTA 3R0QA 4RWZA 1KYXA 3UHPA 2IS2A 4NH0A 3PX3A 2I80A 3DE2X 3LDFA 4MV3A 1OH7A 3L18A 1MAVA 1GA4A 3UOAB 1YRAA 3ENWA 1A04A 3CIFA 1KARA 3M9WA 4HGPA 3GBSA 4MDYA 1EFLA 1QPGA 1TAHA 2G5CA 3EFBA 3VTAA 4RU1A 4E2FA 1Z26A 2B98A 3GJ6A 2AK2A 5DDIP 4M0UA 4YO8A 1JR4A 2MIIA 3EIUA 4YHBA 1W581 1BE1A 3JZIA 1MOZA 1LX7A 3RQSA 4QPPA 1WZIA 3TBFA 1SXIA 1HT3A 4X90A 4H08A 3CLVA 3FPGA 5ALJA 3TVTA 4ZEVA 2DERA 5IT5A 3WXBA 1CQWA 4TWBA 1L0BA 4F4CA 2GBFA 5EHXA 3ILSA 2DR2A 1V71A 2QMHA 1G9XA 2QY9A 3VR4H 3OPMA 1QS0A 2W2KB 4YH1A 4B4KA 5JNLA 2PE5A 4G2TA 2GN2A 2OTCA 1EWRA 2WU3A 3W9BA 1EVQA 4K1LA 3V4PB 1EUDB 1K4MA 1FDOA 1MC4A 1VYTA 1FJHA 1N2CB 3AO0B 1UOQA 4BMSA 2QZZA 4E08A 2V03A 4F7DA 5AK3A 5BOSA 2W2LA 2IYWA 4TSFD 4MI3A 5J1SB 1CVIA 3JYOA 3K0HA 4RM2A 4CDRA 1HZZA 3PLAE 5AK6A 1T1GA 1YC5A 2MSWA 1YCFA 3HNRA 4DM4A 3HYTA 3IKJA 4Q4JA 3WAKA 3A7EA 1VHLA 2K7FA 2FEWB 3G59A 1XEWX 3IV9A 1KQFA 1H5NA 3NHWA 4JEMA 3VGPA 4XQ0A 5REQA 1T5HX 2WM2A 5KSWB 1Q95A 2F9LA 1SZPA 4DXHA 5K3AA 2EFDB 1K6MA 4X7PA 2Z4SA 2FNAA 2G07A 2QF7A 4BS9A 3G8AA 2NQ8A 5A04A 4CQNA 3FWYA 5IASA 3IHTA 5INTA 4HWOA 4L4UA 4WX2B 1U7XA 2YXLA 2NQTA 3KVVA 5H83A 1RHMA 4LISA 1C9DB 4UE2A 4B8WA 3DOHA 1Y8CA 1WCWA 3GVPA 4QEKA 3VR0A 2BR4A 3KUUA 4YRCA 5K01A 1E98A 1CUVA 2DPGA 1RC0A 2W11A 1DAOA 4D4HA 3S8MA 5ANRB 2I2DA 2X13A 3BWXA 3DHYA 4OXQA 4U2GA 1U8FO 2H00A 1DAIA 1T1IA 1O95C 4M76B 2Q3LA 4MX8A 3W7AA 3UC5A 1IJBA 2ZUSA 3R6TA 4FNAA 4BX2A 4J9UE 2WT9A 4A6XA 1N25A 3CB4A 3QUAA 4HGNA 1W44A 1T4BA 4IOJA 5LWQA 2QUJA 2XD9A 1KFCB 5AUOB 1CEQA 3LCCA 1TYCA 2VPQA 2WHQA 4IKEA 2NO0A 2O6LA 5DHFA 1CZLA 4G5HA 1V4NA 4JJ4A 1MQSA 2DBZA 1N2JA 3MW8A 3RWMB 1Q6ZA 1BMFD 1SXHA 1HYEA 2R6FA 3NKVA 3V48A 3WZ2A 2VDUE 1AY0A 1E0KA 1E2JA 2C04A 4JNCA 4INOA 4MVJP 4B8ZA 1T8RA 4K0RA 3Q3HA 2ZBPA 4LVOA 4X1OA 1IN5A 3HCAA 5E9QA 1M2VB 3W4JA 3RF7A 4GZ6A 2G06A 4DKXA 2LRHA 3WISA 4BBAA 3LCMA 1SPBS 3GJ8A 4QPNA 2R4TA 5CD9A 5JPIA 3AHFA 1KJZA 2WUWE 1PK7A 2P6RA 4PHGA 5JSQA 1BRTA 2G9VA 3MBKA 4O2BF 2B1QA 4JT4A 3GR6A 1CUXA 2CNWA 2PS1A 4YAJA 3U4MA 3GUCA 4M0PA 1VJ0A 1ZW6A 3VZBA 3LT1A 5JNTA 2H1RA 5ALGA 1Z16A 4KPEC 4MW0A 2CCKA 2WJPA 1IDN1 3KLMX 2XB4A 4TTVA 4G1UC 5T3YA 3N2IA 2YMPA 2OAGA 4G86A 4CODB 1R9GA 1NP7A 2ZBVA 2VHZA 4FYXA 4YRMA 4R71A 3JRWA 5DO9A 3WHPA 3OPYI 3P5SA 4D9JA 3FGPA 4MCJA 1C8LA 3VR3D 1LDNA 1CLUA 7REQB 3SZLA 1YDHA 4RY9A 3JW8A 4P32A 1CDDA 4QEZA 1FW8A 1L5VA 1AG9A 1LPOA 3MLEA 4RHTA 2X3FA 1UC4B 4ZYUA 2WQ6A 3IAXA 4FB5A 1WD7A 2BFEA 4YAWA 5B2EA 1YT5A 4OGLA 3VKVA 4D97A 1D4FA 2NU7A 4NF2A 2WP0A 1QYDA 2JFXA 3C3PA 4OK5A 2XUKA 2D1QA 1VXOA 1A5SB 1SZCA 2GBLC 5C8YA 2QW0X 3H86A 3ZJUA 1G2OA 3HWRA 1EB9A 4G4SO 2Q1XA 2V7VA 3H13A 4M7PA 2VYCA 3PLRA 5BW4A 3NV7A 4E32A 1YZTA 3HGMA 1VIVA 2D0IA 5ICCA 1ZN2A 5M5BA 2RBGA 3KAJA 2Q3BA 3PICA 3T61A 1M8PA 2A7QA 2IHKA 4P93A 4RXUA 3LUGA 5GZ1A 2J09A 3IL2A 1UFVA 3R3HA 4O2AF 4U2KA 3W6PA 3WGGA 1ZWLA 3E9ZA 4GSYA 4K87A 1J0EA 4LRXA 1TRKA 1H42A 2JBWA 4MROA 4RA9B 5MFPA 1JB1A 1RLOA 5EWJA 1GYQA 4C21A 3UV6A 4UXHA 3H2JA 4CDMA 3MWYW 4O4IA 1GGKA 1T4CB 4MCIA 4E11A 2DLCX 2GPNA 1E2KA 3G9UA 1YQWA 4N6NA 4UM8B 3FE2A 4FD3A 2KI5A 4B2IA 1CT9A 4XX1A 5GGYA 2IGTA 4Z9XA 1CUCA 3OEHD 3UKOA 2Y1GA 4KO2S 1EGAA 1I7LA 4R7ZA 3OC6A 4FMBB 3KJNA 1TU3A 2X3UA 2OESA 1Q2XA 1QDUA 4HEJA 1JF8A 4XR9A 1ZIDA 3A3PA 1VI2A 5DHAA 3RFUA 4LTMA 1E2LA 4P58A 4MO2A 1PKEA 1G5PA 3EGWA 3PNYA 2BGWA 2AN9A 4QRHA 1LSUA 3KJXA 1KH1A 2CHVA 3F5FA 2E4XA 4TX1A 4U2EA 5AK5A 1L8XA 1KDOA 2ZBFA 3KYBA 3D6AA 3DO6A 4LHVA 2A5DA 5L40A 2GCOB 3IQEA 1ZNQO 4LSWA 2GZ2A 2YVKA 1ABFA 1DXHA 1NT2A 3Q12A 1N3BA 3BIXA 3Q7EA 2GVZC 4NESA 5CLQA 2HJ9A 2XD4A 1RJWA 4Q3BA 1NYRA 3T5DA 2WVAA 3V7WA 3WLKX 4K6OA 4R0VA 4BASA 1E3DA 3EFHA 3KYCA 4TLDA 1U7ZA 3UMRA 1KKMA 2FPLA 3RC8A 2G1AA 4GR9A 2R7KA 3FF1A 1CUWA 1UPFA 2VPYA 2X7HA 4TRRA 1JEAA 4XJXA 4CMIB 3OFKA 4MJ7A 1YBAA 1FRNA 1PBTA 2OEPA 1R0WA 1JALA 1ZM3A 1ZRMA 1G8FA 1IHUA 4D46A 1YVRA 2ZRNA 4H60A 1FMCA 3HO1A 4AWXA 1BDMA 2FJUA 3TGLA 3W6OA 2YRXA 4NDNE 3MS2A 3A4IA 4P33A 5LZ9A 4I5DA 5TGTA 3WYEA 1WXXA 1N0WA 3F3MA 5D6NA 2PKQO 4OM8A 5KOYA 4X61A 3AINA 2GCNA 5CLGA 1DQPA 5G0WA 5JAUA 1U6IA 4LECA 2Z8XA 3DVAA 3INTA 4YCNA 2DTDA 3IMGA 5HRUA 2LIPA 3QA9A 2OT3B 2ZAMA 4IIFA 4YC7A 2FXIA 3GGGA 5BO5A 3VC2A 3ZE0B 1J1IA 3I6ZA 4O08A 1MH1A 2N47A 4NJOA 3D5QA 3SE7A 2P5SA 4UUPA 2PWYA 3EVFA 3AY7A 2PLFA 3QF4B 4AJ1A 1YS6A 5HXAA 1BD4A 1QO7A 3C43A 4OGGA 2C0PA 4IXWA 1V43A 3QE9Y 3C8UA 3A32A 3T1TA 4OJTA 5E2AA 2ID8A 2VPIA 3E4DA 2XQJA 3PNLA 1YVDA 2CKDA 3G3EA 4UFNA 1QV9A 5JQGF 3K0SA 4O3MA 2F4VB 5F9FA 1EP3B 4DM3A 1MEEA 3HL0A 5T7BA 2NO7A 2BI7A 3PG5A 3TW8A 4YJHA 3SYLA 3LDGA 1FS6A 3HRIA 4JLOA 3B1FA 4NQRA 5K3SA 4JLAA 3GUHA 4XPIB 5DJ5A 1X7ZA 2CZCA 2EKPA 2QDXA 4JT8A 4KXVA 2BUCA 5JYDA 4JYAB 5AW7A 1YWGO 1LS6A 2E85A 2JLZA 5J40A 2HTEA 3G23A 1OU4A 2PQ2A 1X6VA 2CFRA 4QDTA 5ENVA 2V4MA 2UYQA 1PX0A 4BC1A 4F5EA 2P1ZA 4UHHA 4PCLA 1VE3A 1K8XB 2VYFA 5AK4A 3AJ8A 3H75A 1WOYA 2XKJE 4IIUA 3G8CA 4AS3A 4DLTA 4NV3A 1C9MA 1ZR4A 3OJFA 2VNKA 4JI6B 3E22B 3RSZA 3RROA 1SK9A 8LDHA 2I2WA 1K97A 1HG1A 4RESA 2JZCA 1CERA 3K9QO 1KTIA 3UWKA 2HF9A 1NQUA 121PA 1DJQA 1I4DD 2A0FA 2RGGA 3FPSA 1F8UA 3Q5DA 5G02A 3RFFA 2QLJA 3UYKA 2UZ1A 3EIWA 4RKRA 4B6GA 1EE2A 2GPAA 1GIAA 1DBWA 3L9WA 4KBGA 2IYPA 4CBVA 3R0JA 2NZYA 4DMGA 2HRBA 1A9XA 3JALB 1VB3A 2PS3A 2GVDC 2Y76A 4ZZ0A 3AX6A 1R74A 1V11A 1GR0A 2D6FA 3A6GA 5EHIA 1RBYA 1EXMA 3SFVA 1E2DA 4KR7A 1IQRA 1CRQA 3KUXA 3EXAA 4QVGA 5DFAA 1W47A 3DL7A 3F2IA 1CNMA 2YV4A 1M8FA 1Z2OX 2E89A 2Q3DA 4KI7A 4JMLA 3SS9X 1JVSA 2O3JA 3D2AA 4FFRA 4IEIA 4KFUA 3THRA 1LBQA 5BSKA 3JWIA 1W0CA 2XNSA 2XIQA 1NVKA 5JJBA 3BMQB 2YXDA 3E8SA 2O20A 3LC0A 1VGRA 5TS3A 5A1TA 5ESDA 4KMOA 4Y9RA 4BNJA 5ICEA 4OREX 3I32A 4H6WA 2GD0A 4OHUA 2A0UA 4QUHA 5C34B 1U4OA 1HYHA 4KYUA 4BFWA 2XVZA 3JQQA 1XDDA 1FJXA 5AKEA 4CKCA 3ZNOA 5K3EA 1DBQA 1YMUA 2YW9A 3F6RA 3OLQA 3T95A 1KR5A 4DIOA 1L7OA 5JHHB 3AVOA 4IUYA 4G3XA 3PNMA 4ZEMA 2OG2A 5C8ZA 3TQCA 3RVMA 4X66B 2C77A 1MKYA 1RYZA 4JBIA 4NBRA 5DYYA 1T9AA 5AR1A 2FSSA 4Z4FA 3LUPA 1KS9A 2ZJ1A 4INPA 3FPBA 4YP7A 3NMUF 3UAWA 5CJPA 3AU8A 4B34A 1JSCA 1UC9A 3IP3A 3IILA 4O63O 4FOPA 5SV2A 4DMHA 4E1AA 5K0LA 3U5ZB 4JC8A 4UKDA 3FOEC 4OLAA 5I7AA 3GNQA 1TO6A 1SD5A 3LKVA 3VU3A 1CXZA 2QTBA 1N2BA 5BORA 1OZGA 2WMYA 5JD6A 1NNSA 2MSKA 2RC6A 1YMVA 3OZXA 2XUPA 4NBUA 3ZK8A 1Y98A 2WSMA 3DEIA 5IARA 3R74A 3SWWA 3LUDA 4I81A 5F12A 5L4LA 2IODA 4RE5A 3W3ZB 3T3DA 3WMWA 4Z9YA 3AETB 2PSJA 1B0UA 2AEFA 3EJWA 4OYYA 5EVJA 1U7PA 3A36A 3GDGA 3DTVB 5TR9A 3VH3A 4M0LA 3L8CA 3L4SO 4B3GA 3PDIB 5EE5B 1ULBA 4ZU3A 4MITA 5T5QA 1T4MA 3FYUA 4U7TB 3TKYA 4WZBE 3E6AA 3H9GA 3O4RA 1RQ7A 4CGYA 1JKJA 3TE7A 2HFJA 2Q6VA 1E1LA 4MZXA 5AW2A 4H31A 3QZUA 5JZ9A 4BFTA 1HO3A 4QX6A 3AWIA 2GAJA 1S2OA 4UD6A 3REQB 2RC5A 2ZR7A 3AP1A 3SF8B 3C87A 3TWOA 3LU1A 5TGZA 1GARA 2YQ5A 3Q87B 3FHOA 8OHMA 1H5QA 4BQNA 2CEAA 2Q6OA 2Q5QA 4A0HA 1SBYA 4BEJA 4RACA 3JQAA 5AVXA 3T99A 4KVFA 1R6AA 2FPMA 5FB3A 3GNTA 1VMAA 2ECQA 3P2MA 5TQ0A 2BSQA 5FQOA 3A9SA 3IT3A 4U02A 5AVSA 2QW8A 3T7SA 4DMKA 1CUAA 1L5QA 1G66A 1DELA 2HSDA 3EY9A 4OXIA 4WA8A 4ZI5A 2D2FA 3TO5A 1XRQA 3RRXA 5JTTA 5K8CA 4NE7A 3C6KA 2J46A 4U7FA 1DQSA 5FPKA 1OB2A 5D3MB 1T24A 1DBIA 4WECA 1P0IA 3IP9A 3BJMA 3DJFA 2G09A 4X44A 4F4UA 1GTVA 2AQKA 1TEHA 2A0XA 2VHCA 2XMGA 4QSMA 4DABA 4YP5A 5EP1A 4KAXA 4FI3F 2V0NA 4NPHA 1LF0A 1NBAA 3FRJA 4A6DA 2OCPA 1WDLA 3RIXA 4JELA 1JWAB 3HVHA 4NBLA 1QCYA 4MA0A 4E15A 2BI4A 1GPKA 1SXJA 5TF0A 1IBMB 1GKIA 5ALTA 3W2GA 3PTLA 5D87A 4QQRA 3WLOA 2IEAA 2IOFK 2CNLA 4FGWA 2DSTA 2FXVA 3KKLA 3KFLA 2I4NA 3IURA 3EXFB 4ACAA 4XWOA 5LVAA 4LFAB 3EEIA 3RE1A 7AT1A 2C4UA 4F97A 3NFRA 3QLEA 2BOVA 5F2EA 4R40A 2QAIA 4CIDA 4DN6A 4HDQB 2HSGA 1E1RD 3FUVA 1USUA 3L8ZA 4FK8A 1L4GA 2MSEB 3ROTA 4AB1A 4OBBA 3O5AA 4OA5A 3OPNA 2YDXA 4V39A 4WESA 2C4MA 2XADA 1Q1NA 4ZTUB 1BXGA 1UT6A 1V45E 3VHRA 3LX8A 1FTWA 5ECDA 2J67A 4NDZA 3QXGA 5G40A 2V7QD 1GD1O 1JTFA 4MVJI 4XVCA 4MWDA 1H05A 2ZYHA 3P2YA 5KTSA 1ADGA 2BBOA 4N8EA 3V4LA 4GPTA 3L82B 2QU8A 4Z0HO 1XJ0A 4F84A 2QA5A 2ZDQA 3MMXA 1KMHB 1I3LA 4H4DA 1QOZA 1KP3A 2E3JA 4H6VA 4KQKA 1FE8A 2C98A 4RIIA 3WL3A 1F6DA 3ZH9B 3LVQE 4ZYTA 3U3KA 4G9GA 2X8BA 3OECA 1QGAA 3ZNQA 4Q7QA 3W3AA 2IE8A 3QENA 2EFJA 5BW6B 3MC1A 3N0XA 1I9GA 4NATA 1YR8A 3WFIA 3KK0A 4C30A 4C87A 6YASA 2ZYWX 1RXWA 2GPYA 3ND7A 2DBVO 3WC4A 1QUEA 2DJ5A 3MFQA 3TH5A 2WM8A 2R11A 2VDWB 2ZUFA 2HJSA 2EJBA 3L8FA 7ABPA 3MJTA 3KVNA 4N3GA 2KBEA 4M55A 5B1YA 1YS1X 2LIVA 5IG2A 3B3JA 1K75A 8ABPA 1S3GA 1WY5A 2ZB7A 3LUKA 5CB4F 5IM4F 4CLRA 5H59A 1QIKA 2B4TO 4HUTA 4ZZ3A 2BC9A 1F5SA 3B5EA 1FSZA 4P84A 4P5PA 3PITA 2RIRA 3DDCA 1OI2A 4HYQA 4J0CA 2BE7A 1JKMA 2QZPA 1NJ2A 4PX9A 4U9UA 4RL4A 2IBMA 1KPHA 4HDRB 1EJ6A 4C04A 1ORTA 1JQBA 1NI3A 1TMOA 3H3FA 3KSBC 2BDTA 3IBYA 2GBGA 3ZD9A 3LPNA 2SECE 1TQ2A 2ENWA 5AM5A 1JU9A 2GK3A 3OD5A 2C1EA 3WRYA 2RFLA 1ZZGA 2EYUA 1RCUA 3Q6NA 4Q4DA 2FPPB 3GJSA 2C99A 5C8DA 2AIRA 4MVJM 1F20A 5G0UA 4JKYA 2ERXA 5DBFA 2JGFA 1VYHA 1CJMA 1Q50A 5AVKA 3HJAA 3WSWA 1YJQA 3GJ3A 1JEEA 1JFFA 4OXNA 2JK0A 3INNA 3EGOA 1P8JA 3G2OA 1TGYA 4HLCA 2C94A 5ES3A 4BTEA 4DVGA 3H5NA 3Q7SA 4BDTA 4D3FA 1SKMA 3EDRA 3M83A 1O57A 4IDPA 1IFXA 4DMFA 2ZQZA 1CJVC 4IWXA 3SG0A 3DWEX 3PYMA 3N6RA 4JXKA 1HNNA 5I4BA 3HKBA 2YX1A 1XGKA 2P40A 1D5CA 2BFEB 3KOUA 5BSRA 4L1KA 2D7DA 3ADDA 3GFTA 1PYOA 5TQJA 3VKHA 1L8QA 1IONA 1J49A 3WGQA 3QLUC 3KQQA 4E5PA 3U13A 2DUUA 3A1DA 3C48A 5C8YB 2FEPA 2I87A 2GUWA 1ML4A 3A1TA 2SHKA 4MLCA 4R1OA 4I3HA 1SOMA 4UTXA 2JASA 3PWKA 5DGXA 5LZ5A 3FZGA 2OHIA 2W48A 1S4QA 1SKYE 3C8HA 3H1BA 3Q2IA 3RIEA 3THWA 3ILVA 4DR7B 2XBLA 3LLMA 4Q9NA 4O2BA 2JJ2D 2Q5CA 3SFZA 5C32A 2ZB3A 3B70A 3CONA 4X6XA 3ECAA 1W46A 2BM9A 1CU1A 1TMGE 3O91A 1JBEA 3VYTB 3I6IA 3PE6A 4O33A 4O4IB 4PSKA 4F2GA 4N0EA 1P5RA 2ARKA 1QAOA 2HJHA 3UMSA 1UOEA 2VPPA 1KP2A 4GYYA 3UT5B 2HF7A 3ANLA 4J1TC 3CNHA 4OKNA 4RE6A 4TMFA 2J4DA 3BXPA 5GADl 4BZPA 3TCKA 4IS2A 5B1IA 1QH1A 1SUSA 3CWZA 3P71T 1HYGA 3IQDB 4YREA 1V16B 3LSYA 1DE0A 1NQ5A 1WG8A 2WSBA 4UVDA 3UH0A 4CI0B 5B55A 2CHUA 3K70C 3O4VA 4H0CA 1TIPA 4B6FA 4M87A 4CTMA 3RTCA 3W3AH 2VH5R 3KOOA 3LCVB 3STVA 5COQA 1K9VF 4P92A 2Y1KA 1RI4A 1VM6A 5U4QA 2AZXA 1Q1QA 3TMAA 4Y8VA 3IP1A 2JI6A 2PKRA 1BXKA 5CA1B 3KVYA 1YKSA 2EW8A 2GO1A 3SYNA 4FPXA 2BH2A 4M3NA 1XTKA 2GLUA 3VH1A 3NDIA 3P0IA 4BWGA 5LCXA 4NCIA 2GJSA 3UAOA 1GV1A 3TYXA 2VPZA 1NULA 1ZIOA 4P6VF 3IRUA 3MJCA 3Q0EA 3GWGA 2QRUA 2WAAA 1HI9A 4HLDA 2BTEA 1Z5ZA 4R8SA 4UASA 3KDPA 4U9HS 1COWA 3E61A 4NPCA 1UJ5A 4O2AA 1DV1A 2NAPA 4A82A 5LU9A 1FFAA 2XQGA 2EJTA 2VSQA 4RF5A 5DX0A 2RHGB 3PPWA 4EY3A 1TADA 1X15A 1KHTA 5AK0A 2D54A 3PPIA 3NM5A 4U7DA 5C7YA 2H1IA 3J7AC 2DP4E 3GJ0A 2CD7A 1H3EA 1XZ8A 2REQA 3WIDA 3P8ZA 5BRNA 3CKLA 3AFNA 4XDHA 3RKUA 3WA6A 1Q21A 4Z2AA 4RPKA 5J2TB 1W4CA 5KKAA 5KTYA 2AXPA 4UMDA 2O2CA 4KODA 2CWWA 4MULA 1I7QB 2FRDC 1JG1A 1DAFA 1MTOA 1H2ZA 2PT6A 3OJEA 3OT1A 1I6KA 3QTTA 5F5XA 4ZMBA 4B3SB 1A5ZA 1NXXA 2JA2A 1XYGA 2C4VA 4XJVA 1FVXA 1L3IA 2JFZA 1Y9ZA 2ERCA 2GH1A 1MJNA 4RD1A 4WKNA 3U31A 1N1GA 2G40A 3W8RA 4F4JA 5JNWA 1KYYA 2QN3A 1LY1A 1ST2A 3ONFA 2RHDA 3P2IA 1IIBA 4IDHA 4WXYB 4EHBA 5KYWB 4CXMA 1WBBA 2O7VA 4AP6A 3I76A 1CR0A 1T3TA 5PNTA 5FUYA 1ZC3A 4BNTA 3NYQA 2VRBA 4GLBA 1I1OA 4ZEXA 1TVKA 2ZUBA 2QTVA 3E1SA 5HZGA 1GPLA 1LFDB 2Y71A 5DN6D 2PV0A 2WWIA 2C2HA 1TT5A 3TLGB 1Z7EA 2JAWA 3QF7A 4RF4A 2EL7A 1ONBA 2ORIA 3M1LA 3EMBA 1A4RA 1CYDA 2P69A 4B44A 3VSCA 1XG5A 3IYLW 1DJMA 2ZPTX 3EAQA 5J63A 1KO1A 4FEYA 3EZFA 1XKQA 3PK0A 3G2MA 3QUTA 4RQBA 4LHEA 1V9CA 1G9TA 3PUYA 5BV7A 5DTRA 2YUIA 2HLHA 3CNLA 3W6UA 1K08A 3A6KA 3SQDA 1NXSA 4RCZA 2X9GA 5EXTA 1Q14A 1X8JA 2QTWB 2IXEA 2VYVA 1B2RA 3C3EA 3R5XA 4Y2VA 1AV6A 4L73A 2QRVB 2O52A 4ND1A 5ALLA 3WMGA 2G0NA 2W43A 5LFAA 2MTBA 2I6GA 3CR3C 2AD1A 2FN4A 2XUZA 1K92A 2YWBA 4G84A 1A9XB 4CR7A 4LW8A 5KTOA 2J5KA 1N8KA 4MGYR 1G98A 4B3CA 2HA6A 3JVEA 1TYBE 1HOTA 1V11B 3CRRA 3O2JA 3S1AA 3V2HA 1I3CA 5H3LA 1G7CA 3ZKAA 2DU8A 4DBLC 5CCXA 1U9IA 2DMRA 2GK6A 5CIQA 3CTMA 4EA7A 1EG2A 3AESA 1V47A 5ELLA 1IQ0A 1V48A 1SUAA 5JQGA 2BMJA 1QHFA 3GPIA 4G26A 1MIOA 3K72B 4IDAA 2BMDA 1IIRA 1PL6A 2Q62A 3G9TA 2GN1A 2O3SA 1F2UA 4S2EA 4U63A 3UF0A 3CGWA 5KAPA 1H6BA 1Q74A 2Q5HA 1FTNA 3DZCA 2NU6B 1K88A 1SKUA 1ZA2A 1T6ZA 4G8JA 4B3IA 4B75A 1P31A 1FXSA 1ONOA 2I9KA 1ANKA 1U2ZA 1YIDA 4ND5A 3PJDA 3TRKA 4KVZA 1IEXA 3ANTA 5JLAA 3UHJA 3X1MA 4LOHA 4R4JA 1BNCA 5ALRA 4A23A 4MWZA 3W06A 4MIOA 5LDGA 4QLBA 3OOHA 2DLNA 3CX6A 2EG5A 4GW3A 4WXMA 1CUBA 4FFPA 1FMTA 1YR9A 2CVHA 1OWMA 4R9UC 1FFSA 3VR2A 3VX4A 4BP1A 3CH4B 1KEEB 4AG6A 3DLAA 1E3SA 5EE0A 1RT9A 2AOVA 5FPTA 4QRDA 1CIJA 5E1MA 1N9GA 4OFWA 4LHZA 5JBQA 1XWWA 2H5IA 3QU9A 1CQIA 3I09A 4MYRA 1O5OA 3L77A 3VNBA 5CNIA 4B85A 3TQRA 1IN7A 2IZOA 3L02A 5DWDA 3TUIC 2O5CA 3OQJA 1XMVA 1MG5A 3W1WA 4CF5A 3DZ8A 1Z0UA 2WU4A 4M1OA 3GLKA 2JD1A 3T3PB 5DF1A 3U9LA 1Z0FA 4HDSB 3DE5X 1NOJA 3LGXA 3LT5A 4RNCA 3ZYZA 3KYJB 4C0HA 1Q1EA 3FNFA 3MN1A 1B8VA 1E63A 1U5BB 1WTCA 3ROZA 1KZ1A 2OCIA 5EJ7A 1JVNA 3TDNA 1HV8A 3H7IA 4C6HA 1A5BB 2PO7A 1ZD5A 5KVSA 1JKJB 4REQB 1X9HA 4QFDA 3U7IA 3UJ8A 1RWBA 1UPXA 1GGFA 3B36A 3W5UA 4NTZA 2DFNA 1XMXA 3COPA 4EO4A 4RHEA 5BNTA 1BVRA 4D3YA 1GKKA 1EZ1A 3OHPA 1C8BA 3BQ9A 3LWDA 2V9CA 2PX3A 4QXMA 3H9QA 3LT4A 3ZWWA 4Y2QA 2FN7A 2OC9A 4R7TA 3BERA 4DWOA 4RIFA 1XE3A 4DG8A 1IM2A 4ZI7B 4F91B 2DY1A 4KR0A 5JMTA 4NZPA 3BDVA 4N5MA 1R66A 2OZKA 1QFYA 4BKPA 1E5LA 2GAAA 4DGQA 3TGPA 1XMOB 1RHUA 4EUSA 3IQGX 3V6LA 4CM5A 4XX0A 4C7MA 4ESVA 1MX5A 2FUNB 2AK3A 2WA1A 1XDUA 3W8EA 4ECAA 3SD7A 5B7PA 4TRMA 5AJTA 4EMUA 1KO4A 1NVVQ 1MVNA 2XTAA 2FPOA 2XRFA 5NULA 2P4QA 2GF9A 1AKVA 5NLLA 3MJEA 4Y6GB 4ZOEA 1S8AA 1YR3A 3KXKA 5C35A 5CA0F 4DW8A 5B4UA 3KSZO 4OLBA 3NIBA 4OAQA 4ITRC 1Z0SA 2HDHA 2YV1A 4M46A 3ZHCA 4RJTA 1JQAA 1UK7A 1JQ3A 1UC8A 4M0CA 4KR2A 2AI3A 2P2NA 2WZQA 1E1MA 3ESAA 2MR5A 4JP2A 3GEHA 4WFKA 2CFSA 1RTKA 3GQVA 2J6CA 1C4WA 4TMYA 4WFIA 4BZQA 3DFZA 2O8FA 1PK8A 2QTCA 2ZJ7A 4LDZA 2GCPA 1KMMA 1ZMRA 2CBXA 4Z4CA 3HB4X 4IXMA 5EIBD 1MPTA 2XDAA 3T1OA 3TOZA 2HCJB 4ROSA 3EZ7A 1XL0A 4IJKA 3VSDA 4MRVA 4OK6A 2C9DA 2V5AA 2IHTA 2PCLA 1JGTA 2DQYA 3IPCA 1R9MA 4L4RA 4BQOA 4F56A 1R3DA 2ATVA 5DP1A 2Z2ZA 1HY3A 4G0WA 2ZZNA 1UBRS 4WESB 4B84A 1QP0A 3BTUA 4GP7A 4LJ8A 4DV2B 1P1RA 1E9FA 2QYOA 2X0KA 3BZUA 4MW1A 4C22A 2UZ3A 2DH6A 4NYJR 5KNBD 3MOSA 3NHFA 1H2FA 2X14A 1JAIA 1PJ2A 4K6MA 3KUCA 9LDBA 1EXWA 1XJQA 5BN5A 1BE6A 2ZWMA 3NDBB 1KO8A 4BNWA 3O1IC 2HAEA 4I46A 1TJYA 1JRLA 4XLZA 3AFMA 2UUBB 2PM8A 1DINA 2Q6LA 4CCSA 4BAGA 1O03A 1CRWG 4AN0A 1RYHA 4DAOA 3P9ZA 2PUCA 2QD4A 1I0ZA 3E9DA 4CMEA 5MDHA 4KV9A 4CW7A 1XL1A 1N6NA 1Y4SA 2Q99A 2XBMA 3QVXA 2JFGA 5E0KB 4EJ2A 2XCRB 3OOEA 4JYBA 1Y5LA 1KK2A 3RS4A 3VO9A 2EIHA 4PW0A 1MD9A 4DLPA 3ITEA 2F2TA 3WMRA 4UUAA 1A2OA 3CKMA 1XTTA 2EIXA 3H17A 3NNNA 1E5TA 2AFHB 2VUTA 3BJRA 3BXGA 2G7ZA 3AR5A 3FDZB 4NBSA 4OXYA 5B30A 1O77A 4C14A 4BECA 5FI5A 5ALVA 1NF8A 4YYZA 1N5MA 5KUTA 4P4UA 3ZV5A 1O87A 3MLBA 2JIZD 1ZFNA 3ODGA 4IMIB 2ZT8A 3Q5GA 2VO1A 1AQIA 2HREA 1TECE 1XR3A 3ESDA 4PZ0A 4CN9A 3N8NA 1G4UR 1H2XA 1LJLA 3ZZUA 2ZUEA 4MW2A 1T9BA 1HE8B 2Z1MA 3GCWA 4IDCA 5FJIA 3ST7A 2OO5C 2JGMA 5FD8A 2J0QA 4QGFA 2GS9A 5IVKA 1T36B 3ROMA 2ZTSA 2QYTA 2R25B 3EWSA 2J4CA 3PNQA 1WU7A 4D9KA 4J0GA 4DV5B 2ZSDA 3MMSA 2I3GA 4MPDA 3F73A 2IH4A 3MUNA 3IKTA 5LIPA 5KHLB 2LUOA 4KITB 4MS3B 3WGIA 4NQZA 1GN9A 3A2NA 3THXB 4NCXA 1MX9A 2AQHA 5JCPA 1NW3A 4HAWA 5KYYB 5KOHB 4XIJA 3KU4A 3WRXA 2FUKA 5EMMA 1CJBA 2HHAA 3WMXA 5KYNA 2E21A 1NX6A 3R7NA 1GGNA 1RMQA 3ZZMA 4JLWA 1ZNWA 2WWHA 2OHFA 2ZUCA 1GXSA 1BAPA 1X2EA 1XRJA 1I8TA 3ANMA 3L01A 4N9QA 2W70A 3ZD8A 1N5LA 1HDOA 2MINB 1RZVA 5ELMA 3DUFB 2XRYA 2FSFA 1ZK2A 3HO6A 3HKBB 4TS9A 1GRVA 3N53A 3EVZA 2P9JA 2DKNA 1YR1A 2DB3A 4Y0AA 4UE6A 4OBEA 1CHDA 5EMKA 4AN1A 1ULUA 1MLDA 1JKIA 5IM4A 5CB4A 4OKSA 2ZK7A 3TRIA 2L2QA 3OLXA 2VJBA 3IVXA 1XB2A 4FGKA 2QNBA 1XTRA 4BVEA 1R9NA 4JSTA 5T64A 1GQYA 1R0BA 3THWB 3OU2A 2JJ1D 3PD7A 4KXWA 2I6XA 5E9WA 4H3KB 1P2DA 3ZJTA 2DR3A 3JYQA 1U3FA 3FOWA 5JV5A 4HXFB 4X5OA 5L3VA 1WKCA 1RQRA 1XZLA 1ZXBA 3F6YA 3A58B 3A0UA 4Y9UA 1BX3A 1DX6A 4QU0A 3T3HA 1BWQA 3L5OA 3ZBUA 5J47A 2JLVA 5JSYA 1LRLA 1VL5A 2G4VA 3AHDA 4IYJA 2C7BA 2YJTD 4YJDA 5SZJA 1EJ2A 2NYUA 3KZ1E 4FN4A 3TW6A 1E77A 1OWNA 2Z4TA 3UKJA 2YNMC 4C3UA 3FFAA 3VKFA 1KL7A 4IO1A 2FW0A 4TWAA 5MFZA 4OYHA 4WCFA 4US2R 3TIVA 2XT0A 3TOCA 2IHNA 1MGOA 1UJCA 1GT91 1KFJB 2VOEA 1OQAA 1KIMA 5I48A 4S1NA 1N0UA 4AO8A 1A98A 2YN2A 2HIGA 3U81A 4AS1A 3JYHA 2BZ0A 4ILEA 1SG9A 4I5FA 2XUFA 2WWWA 3ADKA 3B6IA 1GL6A 5ITWA 5L45A 5C51B 1MAHA 4IHAA 2C7RA 4QA9A 3E3MA 5IJXA 3DKRA 1CPYA 4DCNA 1M34E 1EWKA 1SVOA 1XZEA 2HDWA 3LPLA 4Q7EA 4IJQA 5L4NA 1MRSA 2NU8B 3ZU3A 2E5WA 3N9IA 4BQSA 1IY1A 2H4ZA 4O2AB 4M1MA 3ZDAA 4MQ5A 4AYTA 2GHQA 1ZN9A 5DGTA 3K9BA 1QO9A 1XOIA 3KJEA 5G3YA 1JIUA 1Y1KE 4G5RA 3E0QA 3TEJA 2FFQA 4LEIA 4UHKA 1N5KA 1BDHA 2J0EA 1B73A 1EK1A 1QCZA 3AXTA 5B1HA 4EGFA 1RJ9A 4NOLA 3PWTA 2E4YA 2EKQA 2CUKA 1WVGA 1JDNA 4DT1A 2EEPA 2P4EA 1W25A 4HX5A 5TMEA 4A36A 1RTTA 2QTTA 3E27A 2A1IA 5BQ5A 5EFOA 3OLZA 2OGSA 4TSKA 4G4JA 1J24A 4EPRA 2GPBA 4DADA 1TVCA 5CCBA 3C1TA 3GV0A 1UJ2A 3KKEA 3KOWA 5D3KA 1J21A 1KEVA 1FP7A 1QJ4A 5TGDA 5TRTA 2GXSA 2F1IA 1ZPDA 4YRJA 4QU8A 3HFSA 3RSQA 2VYNA 4LF5B 1ESEA 1RBZA 4JGGA 2B5OA 2IYLD 2F43A 3SBOA 2VA8A 1P2SA 5JBNA 2HGZA 3NAGA 4K9NA 4X1YA 4CVNA 3PRYA 2ZXUA 1TA9A 2FPSA 1DS6A 3IDAA 4FDLA 3BORA 1NVAA 2IY9A 3GJTA 4NFHA 3WHIA 1AH2A 2BR3A 3L7YA 2X19A 5BSTA 3U3JA 3OTOB 3AR7A 4U8HA 3U44A 2BDEA 4CR6A 1YDEA 1O0BA 3CINA 4ZGWA 5FA6A 2C57A 1N3LA 3JQ7A 2FI1A 3GFRA 1HQYE 3BN3A 2R4QA 4QJIA 4CKWA 4PYOA 1A96A 5HW0A 1PQYA 1U2GC 4JVNA 5FUXA 1APBA 4XWTA 1A4UA 1XK7A 3ZUGA 3PWSA 1VHWA 2HRCA 1OA0A 4NENA 4C3OB 3W6ZA 4Q7LA 4A15A 2GYUA 3NIFB 3PHGA 3AILA 3JQBA 2V7WA 4F4HA 4NOMA 1IZ0A 1I3NA 4QXPA 4BGDA 1FP4A 1SIOA 1FYEA 1BGVA 1QQ7A 1RXEA 1SEVA 2BGIA 3QYPA 4L5AA 3FVQA 4LXUA 3UMYA 1RRCA 2LKCA 2V9PA 2EZUA 1X1EA 2HMUA 1QFZA 3USCS 4D4LA 5T4EA 4GPZA 2J9YB 1OH5A 3JQ9C 2XWQA 1KERA 1NF2A 5EPEA 2HCFA 2FLWA 3Q9SA 4IMRA 2RGRA 2ZYAA 3LCJA 3HS3A 4G56A 2FW1A 2XYQA 4L2IB 2X15A 4D8TA 1JHDA 1KIAA 4XYEA 4ERXA 2I4MA 3JRNA 5C5CA 1YB5A 5JXHA 4JOBA 1INLA 5JQGB 2IC5A 3VR6D 1T8YA 3RUCA 1EU1A 3H04A 1DJOA 2ORED 1H1DA 3EMDA 4X20B 2BFAA 2FF7A 1TW2A 1UPBA 1DT3A 2GK4A 5CIWA 3W5VA 1L7AA 4I1OA 4ENUA 2ADFA 3S4YA 4Q1DA 3F6PA 4F93B 2B1JA 2QZSA 4N5HX 3W2TA 4LE1A 1ZH8A 1XZQA 3JZMA 1EWYA 4JYZA 1BMQA 3OOJA 4F5YA 2OPBA 3E5RA 3I2GA 1FLAA 3MGCA 1U3TA 4QICA 4U4AA 2WY2D 3RAGA 4DZRA 4EF4A 1FF9A 4KFRA 5B1EA 1ODCA 5GIPE 2H4HA 1JHAA 3C6QA 2C31A 3ELWA 4MUGA 5B3JC 2ZT7A 2EDAA 5A6SA 2JANA 2V74B 4LA4A 4M1YA 3TM5A 3VMFA 2X6RA 1GV0A 2RKBA 1IVNA 2B61A 1XXLA 2HV8A 3RNLA 2RHCA 3VISA 4E4YA 4EYQA 1A8PA 1YZUA 3T0FA 1MBZA 2WQZA 4PR3A 1AK9A 3ND5A 4LSGA 3N1UA 3WLLA 3Q88A 2IQIA 4N0QA 4ODIA 3LXUX 2H7CA 4BLUA 5E7MA 4EKEA 2NVOA 3OTWA 3WWCA 3IAM1 1RZUA 3MELA 3HP4A 1EFHA 1O6FA 8GPBA 2C5SA 4YWJA 1P4JA 1UK6A 1U0BB 1D04A 4QNNA 2EBFX 1HL7A 4P83A 3M49A 4XVRA 1M1XB 2VSFA 3EN0A 3SDBA 4UXJA 4DCTA 4IGKA 3D6UA 4RFLA 3F49S 2C5GA 4DSZA 3KT3A 4CT0A 4EJFA 2UYGA 2W8BB 4KXFB 4DB4A 3PC6A 2J85A 4PO1A 3T52A 2VTKA 3V4ZA 3HACA 4M6WB 4LYJA 4YJ2B 5JVDB 3WGZA 2OL4A 4AJ2A 2Z6AA 4EIWA 1OLUB 2WZDA 4I3FA 3R0ZA 5AVQA 3H8SA 2QN8A 4FFNA 1SZDA 3B3GA 3NASA 3OF3A 3PIDA 3LPAA 4HSEA 3CVUA 3IEVA 1JIJA 1J39A 3OA0A 5BMOA 2QD2A 1P75A 2FQWA 1G5TA 1NN5A 3AV3A 2D5IA 5SZKB 4MPTA 4TQGA 4J6FA 5FBZA 1SRRA 2QK4A 2JAHA 4QDUA 2WI8A 1M8KA 3JX9A 4MB6A 2JNWA 4GRIA 5HK8A 2Q4RA 5BR4A 1DKUA 1TKCA 5AM1A 4DR2B 2WG0A 1I3OA 2OO7A 3C3XA 5BWLA 1W59A 1OHHD 3UXMA 2HK7A 4KNVA 3TTSA 1DUIA 4GOND 1D2EA 5AKJA 4BZWA 2YXNA 4LNUB 1EXDA 5L3QB 1YE5A 4JI0B 3DAHA 5DHRA 2NOAA 3BIFA 4H17A 4MP6A 3BREA 4US0R 1V41E 5CCEA 2XNDA 1P0FA 2W58A 1IU9A 4K81B 1YGYA 5IJ0A 1DXQA 1MU0A 3EHDA 4H9GA 2FCRA 3H7AA 3M5DA 3U0BA 5DYNA 2I65A 3MZ0A 1V95A 4X3CA 2OV2A 3O84A 4OVKA 1HEUA 1TQ8A 3WGOA 4FCVA 3GFQA 1Y6QA 1CS0A 1OR8A 1T5OA 4LPKA 4NG4A 1L4HA 1WU8A 1Z36A 2ZVPX 4Q18A 4DEYA 1UMDA 4WLOA 2H1LA 3UJDA 4IG9A 3UFBA 1NBHA 2XQFA 2YWXA 2EKBA 4HH4A 4Z6KA 1EVLA 1KZ4A 5AVWA 2ZUWA 2F00A 4QNRA 5IYZB 2DRIA 2GM3A 4MUMA 3EVCA 3PNPA 1Y7IA 2FG6C 3IXQA 4OUDA 2X5NA 3SJZA 4DIUA 3MS4A 4I1IA 2ECKA 2AZMA 2X41A 1XCGB 2BH9A 3T1VA 2K6GA 1X1QA 2JJYA 4WKGA 2VL7A 1XO1A 4MIYA 4KMSA 3AW9A 4IIJB 2NSHA 3VR5D 4F3CA 4MR8B 3L7MA 4FUTA 4F4IA 2ZAYA 5DNDA 1VZ3A 4HFNA 4KK4A 4CQLB 5FWXA 1Q0ZA 1P18A 4WUVA 3N05A 1Z29A 5AM0A 3VH2A 4OD0A 3MWFA 1QG4A 2QX4A 1DVRA 3LOUA 1FDTA 1F14A 5CA0A 3H2HA 4ALIA 3SC3A 4BLPA 3IELA 5EMLA 3HXMA 2QPAA 3BJZA 3P26A 1UBMS 1EQ2A 3AR6A 3QVJA 4TZ0A 4KH1A 1SUCA 2FWRA 2ZCJA 4I55F 2OCAA 3CBQA 1PDWA 3FB4A 4FIZA 1GSOA 1HQKA 1BFDA 4AZTA 1WMDA 5ERGB 3QE3A 4AYWA 4FBMA 2V58A 1HG0A 3N0WA 2BPOA 2XLBA 2VT2A 3NALA 3IAAA 4BMNA 2X8JA 1EWTA 4OQEA 1EJBA 3D8BA 3HN6A 3VR6H 1K7EB 4TRJA 1G8MA 1E3WA 3QKWA 2IWHA 3UMVA 2PGAA 2JGDB 1YF3A 3NV9A 1MRNA 1SELA 3GLIB 5IANA 3SXPA 4BYMA 3F7NA 1GSAA 1XQ9A 1LC3A 3PRJA 2Y93A 2VWPA 3Q1LA 4TXNA 2QRGA 1GFSA 2LGJA 5EZYF 5AJZA 4UOZA 2QVYX 3OO0A 1U04A 1V5FA 2XCOA 3I9V1 3RRFA 2EWMA 1V8ZA 5EERA 2A35A 1B6GA 2A1UB 3DC2A 5C37A 2G4LA 4HLNA 5TMPA 3WL8A 1RQGA 1TUBA 2G6BA 4OHOA 1KI7A 4Z3OA 1FYWA 1WEKA 2FW8A 1SUEA 1A7KA 1P7WA 4DUPA 5D86A 5HQTA 3E3LA 3F5QA 3LXXA 1T91A 3NYIA 1OAOC 3IDFA 1E5VA 2OR3A 3FCXA 3L0PA 3TZEA 4EX7A 5E3HA 2JGKA 2P9CA 3PJEA 1G3IA 4K9KA 3ZY6A 4CFSA 2AV6A 4KIUA 3Q8MA 3F0TA 1BS9A 1RHRA 1N2IA 4FE4A 4HEA1 1E1NA 1TF2A 1X80A 3DHWC 5FBKA 5TX7A 3SXUA 2CZQA 1GXSB 4TSFA 5EP3A 1MCZA 3BVPA 1NRIA 2Q4EA 3LCRA 4ZOLF 1VJGA 3B7WA 4YCMA 3D64A 3G2LA 1XPJA 1F0KA 4WTOA 1OXSC 4DJTA 1WY7A 2OUKA 5GZ3A 4MYTA 3I62A 2Z8ZA 1AD2A 3CRQA 5DTQA 3SHQA 3VOAA 3U7GA 4WUTA 1ORVA 4U2BA 4IFTA 3FHJA 4GMDA 3BL5A 1MQAA 4FYYA 1A9QA 4ADSG 3NTUA 2R2AA 4PG4A 3O38A 3E7WA 2ZS8A 2AEMA 2IXAA 3MPUA 1C1XB 3U4IA 1ZY2A 2CLSA 3ZCTA 2CLIB 2ZJBA 4EDHA 4MHSA 4WACA 1MO5A 4E2YA 4NI5A 1YDWA 3L79A 3R41A 3PUKA 1YVPA 1XTSA 5ULLA 3L0ZA 2ZJ5A 3WK5A 1MC1A 3IERA 4QFCA 1C7FA 1LLUA 4IMPA 1YQEA 2NV2B 3PJGA 4I3GA 4BIMA 1T15A 3OHSX 1UWKA 3DL4A 3K9NA 1PD1A 4LJKA 4UNSA 1G7TA 3DOIA 4INAA 1YVEI 3AJAA 4FGSA 1ZUNA 1UXHA 4K8RB 1DL5A 4ZCRA 5KTNA 3G0IA 3RJMA 3L7BA 1M67A 1KFKB 4HTFA 4K6KA 3L93A 4CUZA 2J9FA 3R3JA 4TT3D 3B60A 3GRZA 1BMFA 1G20B 3H4MA 4AIRA 4WNYA 5DPMA 1N3IA 4IHJF 1LNSA 3GLFA 1KORA 1JMYA 2G8LA 3CS3A 3KU1A 3HJTA 3L0YA 3UT6A 4YDHB 3FMFA 1U2EA 4EPYA 2G63A 3GQBA 3UA4A 1BMDA 1T9DA 2BR5A 2FKAA 3QKRA 4JLBA 1FTGA 4AXXA 1TMKA 1XAIA 1Y8QA 3OP4A 3EVGA 3LNTA 4J43A 4JLUA 2EKDA 2WINI 2I4RA 2YFKA 3DCNA 3KTDA 2FSVC 2B94A 5A62A 3NC1C 5B2FA 5G41A 1S6YA 1Y42X 5IDYA 2CLEB 3RODA 3KTFA 3V4FA 3IR6A 3GZ4A 5F98A 5CTAA 3EX7C 3T3EA 4PEVA 1N2XA 3ZHOA 1SIBE 1ZM2A 4JL6A 1VJTA 4AKTA 1KY4A 1J2EA 1RIIA 2ODBA 4H7FA 4V3BA 3A1CA 2F3SA 3H2KA 1WXQA 3FM9A 4M88A 5EOVA 5EKSA 2ACEA 4NU5A 5BWOA 4MRMA 1O94A 3HN7A 3OVMA 1XDZA 1UKZA 4I4IA 5EKUA 5B7QA 1WETA 3IAM6 4UNNA 2IU6A 3VR3A 2BI8A 1ZRNA 3I4LA 4QWWA 4XEUA 4RD3A 3S5UA 4E2ZA 3ZVKA 5T4FA 4M9CA 3EMVA 3RKSA 1E6KA 2HF2A 2HL6A 1I2AA 1RU3A 3S2EA 1P6UA 2BM0A 1EBUA 2RGWA 4X60A 3M70A 2RK6A 2Q5OA 1ZGJA 3MRSA 5EA2A 3WTBA 4DPMA 2PUEA 3ZJVA 2R5WA 1O95D 1ZK0A 3H1GA 5CPBA 3ZU2A 1YZFA 4BJHB 1IBLB 5ALWA 1Y7LA 1QHEA 3I2JA 2WB2A 1QTIA 2BKAA 3ZGYA 1WXGA 4BKUA 3T7DA 3JAMA 2Q8NA 1L5NA 5CT8A 3AF4A 3HSYA 1CIPA 1FFEA 2EX0A 3ICCA 3MT0A 2V7GA 4KWTA 1G5HA 3B6MA 1P1IA 1RJDA 2VJMB 4JQYA 3GJRA 2NZ8A 5I6DA 2HV9A 4WZBA 5JROA 3F98A 3HEAA 4KGVA 4NV0A 4X1YB 1N0HA 3KB6A 1NQXA 1VE5A 3Q5EA 3OUZA 4I4TF 2H57A 1LBEA 4K40A 3RU3A 1G59A 1JFLA 3JZAA 3QHPA 1WULS 1T10A 1E79D 4GH5A 1BKYA 1U28C 3EGDA 2XXAA 3UB4A 4BB6A 4DQ0A 4EG7A 2Z9DA 3BMOB 3G0DA 1EJ0A 3QSYA 1T9KA 4EY8A 1GADO 1GL7A 3DV2A 2JHFA 3W5HA 3OEHA 4LC9A 2PYIA 3T35A 4OV6B 4TXHA 4OM7A 2IT1A 2PXHA 3IUBA 4CKWB 1WZUA 4DDHA 3AIMA 1DKLA 1CULC 1XWFA 1NQOA 3QVGA 2I99A 4KFSA 2W6CX 2HA5A 3QVSA 4L5JA 2X86A 3RVDA 3UV3A 4MAFA 1AV7A 2CY0A 2JL1A 2XB9A 2ZI9A 3GJYA 4GFDA 4NENB 4UHDA 2PPVA 1O5TA 1EHYA 3FPJA 3K6RA 4OHXA 4GBED 5CNMA 2NV6A 5TB5A 3NVKI 4QE3A 1FSGA 3OE5A 1PTJA 3Q7IA 4OHWA 3IFSA 1UKYA 4G24A 3I9FA 4YCDA 5FBWB 2EJVA 3HI6A 4E21A 1DTWA 1P44A 3TNYA 3GAFA 2XQKA 1T8SA 3SZGA 3M5CA 3WLEA 1DRUA 2H0QA 2WOOA 4UEQA 2OHJA 3DE0X 2H1SA 3O3OB 3D7KA 1GKLA 1X1DA 2BBSA 4LRUA 4RZXA 5FYQA 4AU1A 5C46F 5CAEA 4RADA 1NXTA 2QD5A 5A3SA 4QHSA 3M3DA 2ZSBA 2GTIA 1XVTA 2YWGA 2M6LA 3TTVA 3W78A 3MJDA 5CRIA 4DF3A 3C6YA 3C7TA 2Z4RA 1R6BX 2IF2A 1MFZA 4M53A 2IOYA 2H51A 4TL8A 2WDPA 1Z0JA 2C95A 2OY0A 4GR4A 3HBFA 1B8OA 1HTTA 1AC5A 1XZAA 3EIHA 3Q3JB 2CV0A 1CR4A 2ZREA 1DOAA 2WKWA 3L8GA 5LDHA 1G8KA 1GQFA 3GLQA 4DEXA 1XZFA 3NBZC 4HYTA 1FJ2A 4IDBA 1TF7A 4BN5A 4YRKA 2DGDA 2Q2OA 2X42A 2ZT6A 3N59A 4W99A 1U1GA 1DU4A 3M5PA 4TTQA 5K20A 5DM70 3O31A 5E7QA 2BRUA 3LXRA 1MEJA 1E59A 1LW6E 1KFBB 1W76A 2P8SA 3B2QA 1JDBC 3IAS1 3S2UA 4NABA 1MO2A 4BB0A 2PU5A 1PNRA 1JDUA 2CBGA 2HI0A 2PFKA 1FS5A 1XNJA 2FETA 2VF8A 3C3JA 4LF9B 1FX0A 1T2VA 1XAGA 4D8VA 5TNXA 2D7CA 1B14A 3A6FA 2FU5C 2N42A 1KY5A 3QVVA 3SF0A 5BSEA 3ICOA 1GZDA 3HJNA 4G5GA 2ZWAA 3MHPA 4Z4EA 2FG7C 3V32A 4ECEA 4G1CA 5H82A 2YFQA 1E94E 2VH2A 2WUGA 3NQ41 1CQJA 4HH1A 4Q1CA 3WLTA 4KO3S 4C7XA 4CM1A 3UKDA 1ST3A 5P8WA 1N8TA 1QP7A 3NHBA 1ZGBA 3NWOA 4PPYA 1D2RA 4MVJD 3JASA 1LPNA 4M54A 1QYVA 2HU5A 2QT0A 1VPVA 2FN8A 4ZI3A 3VAAA 5EIFA 4AECA 5I7VA 1H3FA 3RU9A 1VL0A 2CXSA 2XSZA 2X7JA 4BLWA 3O94A 5E9AA 2GXQA 4V3CA 4AAYA 2J32A 1T34A 4MJLA 3I9V6 4R3UC 4M0EA 5KNDA 2JLXA 2NM0A 4TVSA 1LU9A 4COKA 1OGIA 2VPTA 3Q3GE 3KOYA 1N3YA 1RMYA 1UADA 1K4KA 3GUVA 3V1NA 2DZDA 2WF6A 1GILA 3UBTA 2ATIA 3ZKWA 1ZLXA 2JIPA 3B9QA 2P4UA 1NJ1A 4I1UA 1IK6A 2H8GA 2DQZA 2WJWA 1DC8A 3CE6A 3EH1A 2D2XA 2GD2A 3FMPB 1CUSA 4JA0A 4L0QA 4OMUA 1MO4A 3RTEA 3TFWA 3E82A 2H1VA 5DSXA 5J5AA 1RAGA 5FF9A 2QMZA 1BN6A 3F71A 1CRPA 1EFCA 4NS1A 1PVVA 3CLUC 3NAQA 4Q48A 3T54A 2WUVA 3TAHA 3UWPA 4BCBA 1HDRA 4FBGA 5G53C 1P4RA 2ZR9A 2B8EA 2KJQA 2A7XA 5DRTA 3PUIA 4IXTA 3K92A 1A82A 3JQFC 4OQQA 2YIDA 1BU5A 3TN7A 3CWQA 2PWZA 4CKYA 2QTAA 2JFFA 4UARA 3QG1A 3VVLA 4NZZA 4LE0A 2QQ5A 3BFPA 3GP5A 2XB2A 1ZMBA 2CB9A 1Q0QA 1YZGA 1JA0A 1UP6A 2FZVA 2PJZA 4V0NA 3UAXA 4D9HA 6GPBA 5KQSA 2NIPA 1SCQA 2Q0HA 3EGXA 4O4HF 1P60A 3D8RA 4MUBA 3AHJA 2BELA 4RH0A 4R51A 4BMZA 5JNVA 3UYLA 621PA 2LD4A 4TV8F 4F5DA 2QT9A 2XUIA 1G41A 4MLPA 4CCAA 3NVAA 4YJ3B 1KH3A 4G23A 3CZ5A 1GKYA 2FVXA 5KTKA 1KTVA 4IILA 1GTRA 4WZZA 2QROA 2PUTA 4RFVA 1QK3A 3GYGA 1W36C 3H9BA 1O6GA 1VMKA 1VLVA 1V7ZA 2EKZA 2EX1A 2O2SA 3IQFA 3N2KB 4J0QA 4ZTBA 2FUCA 5B57C 4KRYA 3B3AA 4HB3A 3KQLA 3CY6A 1UMDB 4YR9A 2YIJA 3LQQA 3NHUA 3LRPA 3HXOA 3O8OB 4BX0A 2WIAA 2E55A 4WWHA 2CV2A 1I0LA 1K9SA 2OCLA 1UMBB 4Q34A 5JRJA 1QWSA 4UUQA 1B26A 1QG6A 2B6NA 3GLTA 1XAJA 4WOBA 4MI6A 3K6KA 5GIOE 3A6PC 3EVDA 4RPHA 1AZWA 1MVLA 1Q16A 5K3DA 2QRZA 4LMAA 4AIIA 2XMDA 3NIDB 1NZFA 5E8RA 4PCUA 3C98A 4KAJA 1E9DA 3VDQA 4NZOA 1T29A 2ZYVX 2JAUA 2WLTA 3BE5A 3C0KA 1DIGA 2AJTA 1CNEA 4R5HA 1NF9A 5CVCA 3AERA 1U31A 3EC7A 3MTAA 2QJWA 1FFCA 1Z25A 2CJWA 3BL6A 3OO1A 5FWXB 1EM6A 1PJZA 2WV7A 1NBIA 2EGGA 4PR0A 4G8CA 2Q3EA 4LZPA 5LBUA 5ITZB 3V4VB 2CFOA 3JQPA 1X7GA 4ALKA 4RPLA 4KMRA 2R68A 3O90A 5CA0B 3OFSA 4KDEA 4CEHA 2FMIA 4IVQA 1G2PA 4DTCA 5DI3A 2WJ3A 3T5BA 3GJ7A 4ZJPA 4EKGA 1TTTA 1XTJA 3ZVMA 1DB3A 2A33A 2DHQA 2XJ9A 3HKEB 3WJ7A 3KT8A 1P4HA 2JH9A 4IXNA 5F1PA 3OQIA 3B8HA 1SCUB 2CJXA 1E69A 3Q3CA 2Q5EA 3BIWA 4JB0A 4NY1A 2XVXA 3EUWA 4M36A 2JPDA 4XR4A 2OB1A 1TA4A 2RHHA 1QKJA 4LWPA 3TOVA 4J75A 5BSWA 3D6TB 4JFAA 2C9CA 1X39A 3IVMA 2QE6A 3NDJA 1E3WB 1BOOA 4RDCA 1PK9A 3HBJA 1CY0A 1JVBA 4U0JA 2GN6A 4UNRA 4EG0A 1N5JA 2IPLA 2XMZA 3L0SA 4D82A 2J6BA 1P6QA 1HZZC 3DAGA 2QD1A 3NTXA 2VDOB 3ANXA 1KNQA 2XYPA 3L46A 4UTZA 4LXGA 2QM8A 4ZMSA 3TLBA 4XDZA 3T9FA 5KU7A 1OX6A 1SBQA 5K6TA 1CE8A 3EMKA 3FN4A 4LJ7A 1PFUA 4MEAA 2DQKA 4UULA 4M1EA 2W00A 4MB0A 1OWLA 3UQYS 4HJXA 1GNTA 1M75A 3LM8A 1O9BA 3PEVA 4UCXA 4KZPA 5TJHA 3WNQA 4D9MA 5KSOA 1Z7BA 3I0MA 1Y1SA 4GMGA 4QGBA 5A4JA 2CLDX 4YONB 3D3NA 5TMDA 1S96A 4DUZB 1L7VC 5IT4A 4MWOA 1D6SA 3WBKA 1EUQA 1N0VC 3HKCB 4ANFA 3TQIA 4F5ZA 5FTJA 4GVPA 3ENVA 3PFNA 5A02A 2EGHA 3ZW8A 2FV8A 3KJHA 3H8JA 4I55A 4JJIA 2CN1A 3GMDA 3HB7A 1N7IA 3BE6A 3O4IA 5K9ZA 1Z4QA 2OCGA 2WU0A 2C78A 2WIJA 2ATXA 1VMIA 2GZSA 3TJMA 1QIGA 5LU8A 5BMVB 1X7WA 3MJHA 4RKYA 1CUUA 2OBBA 1F1BA 3LLCA 3TZ6A 3B82A 3C3AA 4MR7A 1GU7A 1P72A 4PZLA 3ZV4A 3WGVA 3HWWA 3K1AB 5IKPA 1US8A 5T6MA 3MCTA 1L5SA 2V7QA 5JADA 1ONSA 4F1JA 3EC2A 4PGAA 3E9CA 4ZIRA 4DDUA 4OL0A 2BKEA 2YJGA 4UQOA 4YRDA 3RS8A 5F7OA 1KQPA 3DR3A 2JLCA 4FE7A 5EZYA 2PY6A 3LO5A 2QJRA 3LQRA 4JLDA 1TTQB 3O95A 3ZWBA 3KM0A 4O8CA 3PEUA 4MUKA 3IOEA 5EL0A 3GBPA 3P4UA 5DBIA 1E66A 3WYAA 4LIPD 3QE2A 5B58C 3SYMA 1EZ4A 2BKLA 4MVJE 3VOSA 3KQNA 4ZQIA 1UBLS 5JMPA 2D8MA 4ZCLA 4MCAA 2IBSA 2BGJA 4LF6B 3HLKA 1ZUNB 3EZ2A 4HFMA 4P2BA 2GPTA 4D92A 1F8XA 1QNLA 4B73A 1LPBB 3L7NA 4RGVA 3NORA 4NPAA 1R0YA 2R8YA 2Y27A 4IKPA 2I5PO 4LYYA 1ENZA 4M1WA 1EUZA 3MMZA 4MWGA 2O3RA 2J9FB 3EOZA 5ALFA 1QH8B 1I2MA 5E1OA 1Q15A 3QHQA 4ZOLA 3CW9A 2BEWB 3D3QA 4Q9JA 1B0PA 1F0YA 4OJQA 4EELA 4ZYZA 4RTNA 2P9HA 3B6ZA 3FSJX 4O4LF 4YAFA 1D0VA 5CH3A 4GP9A 3RVBA 2BKXA 3M2PA 2IU4A 3R40A 2GN9A 3BXOA 3LG2A 3FCCA 3GQBB 4OHCA 3CLTD 1E7WA 1GNQA 3NHMA 4L27A 4Y98A 4RETA 2BUAA 4OQFA 4XZ3A 3HJUA 5JANA 1Y8QB 4AKIA 3H9CA 1IRXA 5JD4A 5IZCC 1IEWA 5IABA 4MW7A 3A05A 4JH0A 1O9HA 3JQRA 2OORA 3V1KA 2E4UA 3UMCA 3ZWMA 2X4LA 4AKEA 4MW6A 3T5AA 4QYMA 4G0XA 521PA 3AHGA 3OUTA 1WXDA 1BHSA 1B93A 3IEKA 3C39A 2ZE6A 3IDQA 4FQ5A 2B82A 2CLMB 2QIPA 5B1SA 1QONA 2FX2A 2H18A 1OASA 3EVNA 2IDZA 4GKBA 1XRPA 1G17A 3Q98A 3K5WA 3RV4A 3MINB 3SX2A 2JDIA 2QG6A 2YZMA 3K0BA 4A8TA 1YS2X 1C0EA 1NUPA 3CNOA 3NETA 3R6DA 1FRVA 3FROA 3DBRB 3HA3A 4FC7A 4EVQA 3EEBA 3LK6A 3LZ6A 4LJ4A 5JAHA 1ULAA 2OD9A 2PWAA 3H87A 3E03A 4M9XA 3S1SA 4EJ6A 3MMPA 4XWYA 4EVSA 2O2IA 4BRWA 4BVKA 3EG9B 4BAZA 2XUAA 5HRCA 2Z3ZA 4DQKA 3ORRA 4Q1FA 2X9NA 3O8QA 5KOJA 2FY8A 3VYUB 4IHJA 2CNKA 3IR5A 3MWEB 4R16A 5E7IA 3TTUA 3BEOA 3BGWA 3AH8A 2O8CA 5TARA 2X1HA 3QQPA 4HBZA 1I4EB 3ZDFA 1ESZA 1IG0A 1W88B 4QOEA 1IXYA 5HYVA 3BAFA 3C15C 1R2QA 2P9EA 2W5UA 4FR0A 4JVLA 3UFXA 4F71A 1ZESA 2D74A 1JHPA 4WZBB 2OWEA 4LG1A 1OKKA