4H67A

Crystal structure of hmp synthase thi5 from s. cerevisiae
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
342
structure length
337
Chain Sequence
DKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDKLCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWSGYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEATRLMAIHQEKCRQEGTFKRLALPAHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrimidine precursor biosynthesis enzyme THI5
publication title The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 120
structure length 337
sequence length 342
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h67A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h67A01
2OBGA 1Y1MA 2O1LA 5H8NB 4GQOA 5K2YA 3QYTA 3VVFA 1B3FA 5H8QB 3TUSA 2DVZA 1M5BA 2WKYA 2HCAA 2DQVA 4PP0A 1B32A 1SW1A 4F3GA 1DMBA 1II5A 1IXCA 4OETA 4G4PA 3JZJA 1DPEA 1FCKA 4EQBA 1WODA 1JEUA 3G3HA 1ZTYA 4QRZA 2Q8JA 3M3KA 4DXBA 3MUQA 1PBQA 1N7XA 1GV8A 5CI5A 3O2AA 4HTGA 3EPEA 1FTOA 5A5XA 3H3GA 4RK9A 3KZGA 5L8DA 3H06B 2XXXA 4G68A 2OZZA 3U93A 4F3PA 2GHAA 1WVJA 3HCQA 5FHOA 2Y7RA 1TWYA 3B6WA 4X1BA 4QFLA 1LCTA 1R6ZA 3RY3A 1QUKA 2REGA 3MC2A 3O29A 1CB6A 2OWSA 4U1ZA 2QL3A 3Q25A 2DVCA 2DXRA 4F22A 3C35A 4GL0A 4YAHX 4H67A 3T9UA 5FTHA 1LLSA 5AA4A 2R9JA 1NH8A 1IXHA 3MWBA 3DM0A 3ILTB 4JWOA 3HO7A 3SEVA 3R26A 3D4GA 4QSDA 2RINA 1MY0A 4O3BA 3K0VA 4NF5A 2XXQA 2H98A 3FATA 4GL8A 5HBCA 2RCBA 3TMGA 3PMWA 4FEDA 3ILUB 1QUJA 2D3IA 4WXJA 1B6HA 3U72A 3LC8A 2H99A 3FUZA 3SEYA 2F78A 4ZECA 1D3KA 4RYAA 5JTYB 5BWJA 1MRPA 2OCUA 3FGSA 5AA4B 4DCYA 4HS7A 4OZ9A 3CG1A 2F35A 1N0TA 2QS4A 3E3KA 4Z7EA 5AA1A 1S50A 3G3FA 2IEEA 1RKMA 1BIYA 2DYXA 4C0RA 1ZJLA 4QHQA 1JW1A 2UVHA 3U92A 3TEPA 3R7XA 3S9LC 3O6IA 2O7UA 3PUYE 3H6UA 1MQGA 3HN0A 1Z7ME 4F3BA 2Y7PA 4WEPA 3HPIA 1TXFA 3SEXA 4GF8A 2DE4A 4YICA 3M3LA 1AIVA 1WDNA 2F8DA 1PB8A 1DTGA 1DOTA 3MZBA 2ANJA 2V3QA 1IQ7A 1EZ9A 4EDPA 1TT1A 2B3BA 5DT6A 1UIVA 4BLAA 4XKPA 1MPBA 4X48A 3FD3A 4OHNA 1IEJA 4MFIA 4TQUQ 3KEIA 3UN6A 4PFWA 1N76A 3SERA 5FHNA 3FVGA 4BDNA 1B52A 3CFZA 1LGBC 3VXBA 1ATGA 3RNNA 4X9TA 5LOMA 1B5IA 2H4IA 1ZIUA 2FNCA 4MLQA 3OD7A 2XXRA 4I1DA 1VR5A 3IOTA 4BDMA 1A40A 1NNKA 2QPQA 4KYEA 4UACA 1MXWA 3U94A 5KDTA 1XT8A 3MP8A 1EZOA 1S7YA 4NEDA 1B1XA 3KGCA 4R6YA 2DWAA 5BUUA 1Y4CA 2Q2CA 4Q0CA 3IAZA 4R73A 4RXLA 1LB8A 4G2ZA 1OQGA 2NVUB 3FJGA 1ELJA 4NF6A 1VFEA 1PDAA 4XKQA 1MQHA 4FORA 5M2VA 4QFKA 1DSNA 2FA7A 2PT2A 1AL3A 1FQDA 4NF8A 4OQOA 4RK2A 4ISUA 3QAXA 4GD5A 1IZ1A 3USDA 1ZBMA 1IXGA 5CRYA 1FQCA 3FXUA 5I2NA 3CRBA 2QJEA 4M1VA 3U1OA 4OESA 4OERA 1LAXA 3GBAA 4U22A 4QFOA 4H1XA 2I58A 2VHAA 1B05A 1NNTA 4K3FA 3TQWA 1P1QA 3OEMA 3VXCA 3PPOA 5KDTB 4H8JA 4DZ1A 4PFUA 3CFXA 5H8HA 3B6QA 1A55A 4G8HA 5H8SA 5DYHA 2F5XA 2DS9A 4F2OA 4XKRA 2Y7KA 4NF6B 2NWJA 3L6GA 2DXYA 3TDJA 1B0LA 4NF8B 2XXHA 4RPOA 5JEIA 3OSRA 3Q27A 4TLMB 3H7MA 5DVJA 5ITOA 5I2NB 4X1DA 3D4CA 3SKPA 3TPAA 3A3CA 3I6VA 1NL5A 1UTBB 3OSQA 4F1UA 3E13X 4LATA 2NUVA 3OOAA 3I3VA 3PMVA 1MPCA 3I5OA 1FQAA 5I58A 5EHMA 3DLNA 3H6VA 1AMFA 3QSLA 3TQLA 1P1NA 2ZYMA 3ZS6A 1USYE 4H6DA 1Y20A 5I84A 4YKJA 1LBCA 4YZZA 3TYHA 3MQ9A 3A09A 5L9OA 4JSDA 4DE8A 4KYSA 1B3LA 1ZMGA 3PPQA 4RNSA 4R75A 1I6BA 1QKBA 1US4A 3SDFA 4DCXA 1VFDA 4IO5A 3KJ7A 4FJPA 1B40A 2ONRA 3UA8A 4OEVA 3EHSA 1EZPA 2Y7WA 1MY2A 2DWIA 1ZU0A 4G77A 4G8NA 4F1YA 3N6UA 4HCWA 5I2KA 2ZNTA 2I4BA 2YJPA 3N6TA 1OMPA 3LSLA 2VD3A 4RY1A 4DXCA 4RPNA 3EHTA 1A54A 3FVNA 2A5TA 1XS5A 1ANFA 5I58B 1Y9UA 1GGGA 1H43A 1LBBA 1TFDA 3RTWB 3ECRA 4C1TA 2RCAA 3K2DA 3TCGA 3CSBA 3DP4A 2XXTA 3LBSA 3VFJA 4H65A 4NE4A 2DE3A 1QUIA 1ZKBA 4U4XA 4I9DA 1B4ZA 2HXWA 1A99A 3M3FA 1S9TA 1P1UA 5J1DA 1FTJA 5AA2A 1FW0A 2ZMBA 2I4CA 3HV1A 3IOUA 4R9FA 4GXSB 1JW5A 2ONKE 4G8MA 4QFPA 1H45A 4F2QA 1NMUA 3O28A 3KN7A 5DEXA 3V5AA 3QXMA 5CBSA 5I2KB 3MVZA 1POTA 3MVXA 1B5JA 1PB9A 4E0WA 1BKAA 3O6GA 4F3SA 3Q26A 3FJ7A 3PGFA 2I6EA 5L9SA 4NMYA 1SVXB 4RJZA 1HSJA 4KHZE 2O68A 2QMWA 2XHDA 1PC3A 2ZYNA 1D9YA 2XXVA 1B5HA 2RC7A 2RC9A 2I3VA 4H8IA 3DP6A 3LSWA 4BDQA 3IB2A 4LA9A 1MDQA 4ZE9A 1CE2A 5HM4B 1B46A 3OELA 1T0KA 2ZYOA 4YB6A 1FQBA 5AA2B 5A5XB 2HEUA 4JB7A 5TPAA 5ELVA 3ODBA 1XHYA 1POY1 1XC1A 2XXWA 5K2XA 4G68B 1MXYA 2THIA 4N13A 4GOTA 3KSJA 4OYVA 2X26A 3DELB 3KJTA 4LQ5A 4IO4A 3SEWA 1JNFA 1OIBA 3FVOA 5ICTA 3T93B 4NF4A 2Q2AA 3IR1A 3PPRA 4ZEBA 1IUDA 3ONMA 1I69A 3VLWA 4WEDA 2GRVA 4EQ7A 3CSGA 5TPAB 2GH9A 1Y1ZA 3TKDA 1DTZA 1MXXA 4ZE8A 3IOVA 3C4MA 1PBPA 1M5FA 2XX8A 5I59A 4H0WA 4NF5B 4IGRA 4E0XA 3U8QA 3IX1A 1MS7A 4PFTA 1A8FA 1Y3NA 1BP5A 1TFAA 4DIGA 3F11A 1LB9A 1O63A 3OO6A 3IO6A 2XD3A 4LZ7A 3ZKKA 4JSOA 4IO2A 2V3UA 2QS1A 1QVSA 2E0SA 3FVKA 1B4HA 5ICQA 3C9HA 4XTCQ 2CMOA 1IITA 4OMBA 2G93A 3ZKLA 2IA4A 2H5YA 3W9WA 4MBPA 4ZS9A 2DSFA 3TCHA 3IJOB 1UIUA 2AL4A 3KBRA 2HAUA 1FTLA 2Z8EA 1B3HA 3C32A 3DP8A 3RT8A 3G3JA 2M8CA 1RYXA 3T22A 4LVQA 3V89B 2Z22A 3S2VA 2W7YA 1H3DA 3PUZE 2DWJA 5H8FA 2O6AA 4OXVA 4ELPA 1URSA 3FJMA 4P0GA 1JETA 5ITPA 2R71A 4MLVA 4ZEIA 1B58A 3THIA 3TAJA 3IO4A 4PFYA 1IXIA 4OFLA 1RYOA 4AB5A 1LAFE 3T9XB 1O7TA 2V25A 4U21A 1Q35A 4ZDMA 1R1NA 4ZEDA 3K00A 2B65A 4OEUA 3TTRA 3KN8A 3EN3A 1YTVA 1OLAA 3AXFA 3MZ9A 4AQ4A 4O3CA 1MDP1 4JBZA 2R6GE 3CIJA 5JK4A 2F36A 3SESA 3LUYA 2UVJA 4DLDA 5AA2D 3K6XA 1YPNA 1NNFA 1MY3A 3VVDA 4KPTA 2YPNA 2Z23A 1SDXA 3RTFB 4FECA 3PD9A 2F6GA 2LAOA 3PUVE 3E9XA 3VDFA 4GXAA 1Y3QA 2QS3A 1EH3A 2D21A 3S9MC 3T9HB 1XVYA 2NOOA 1N7WA 4GWOA 1LSTA 4YKPA 4IGTA 1YAEA 2PT1A 5CMMA 1MG1A 4P0IA 2I0CA 2H9BA 2OJTA 1SBPA 1SD3A 3T96B 3TZAA 2O1MA 4YU0A 3IB0A 2P1SA 1EU8A 2OWTA 5IKBA 1P99A 3IORA 1O64A 4EXLA 5DTBA 5TU0A 5DVIA 4YMAA 2ONSA 3HHGA 3BFTA 1P1WA 2NXOA 3BFUA 4ESWA 3G7WA 3WAFA 1L5TA 1B7ZA 3N94A 3OMBA 3SETA 3IK6B 1MY4A 1VE4A 4R6KA 1URDA 1AH5A 3FV2A 1GR2A 2F34A 1MXUA 5I57A 2F7CA 1SYHA 4NWDA 2PX1A 2I49A 3QUFA 5F7VA 3E4RA 5H8NA 2YLNA 4ECFA 3K4UA 5H8HB 1H76A 3ZSFA 2E1SA 3FIRA 2UYFA 3RPWA 3IOWA 2Q88A 3W15C 1M5DA 2UYEA 1YCJA 4R72A 2ZXTA 1M5CA 3FASA 3JYRA 3TELA 4U4SA 3S4UA 3CR9A 4F1VA 4F19A 1LFGA 1J1NA 3K6WA 2RKMA 4H5FA 1OVBA 2HQ0A 3QIMA 3UGWA 2PMSA 2DE2A 4GIZA 4LQ2A 1GTKA 4N07A 2AIXA 4F29A 3VV5A 2HFBA 4IB2A 3QK6A 1NH7A 5AE4A 1LAGE 1NKXA 4ELOA 3K6UA 4LP2B 4FIMA 1BLFA 2I0BA 3EF7A 3G3IA 4QFNA 3UORA 1GVCA 4YB7A 3O6HA 1KWHA 2O7IA 3OEKA 5CMCA 4M4GA 3BKIB 4WKMA 5I56A 4LONB 4KD5A 3SEUA 3MP1A 3Q29A 5CMKA 1JVYA 1PEBA 4IO7A 1SYIA 1NFTA 5CC2A 3CG3A 4XXUA 1ZLQA 1N3XA 4R6HA 4U23A 4ZEFA 4R74A 1US5A 3RQTA 3MW0A 2XXIA 3OO7A 3FV1A 2A5TB 4MH5A 2Q89A 3H4ZA 3S9NC 3VE1B 3M8UA 4GVOA 3B6TA 4TLLB 3K1NA 4IO6A 4KQPA 1M5EA 1LCFA 2D5WA 4LZ8A 1XVXA 2ZYKA 4FAJA 3C33A 1F9BA 2QS2A 3K1MA 2P0SA 2Z8DA 2VP1A 4Q5TA 2RC8A 2DOJA 4IO3A 3MVWA 1JW4A 4IY5A 5JTYA 2XX7A 5I56B 1N04A 2O51A 2QSXA 1B3EA 3KG2A 3TTMA 4XIGQ 3Q28A 3GZGA 5DEXB 4BDRA 5B70A 4QSEA 1NNPA 2F6PA 2B3FA 2AYSA 4JDFA 2Z8FA 1OQHA 1HSEA 2ESNA 2XX9A 2VGQA 4OVJA 3TODA 3UP9A 4NTLA 3H6TA 2V93A 1H44A 3PPPA 5KCJA 4JXIA 1QJMA 4EUOA 1MQIA 2G29A 4DDDA 4TOZA 2PVUA 4KI0E 3L6HA 4FATA 3OENA 4KYDA 1IIWA 4BDOA 4I8CA 1JEVA 3FXRA 1XOCA 3CFLA 1B0HA 1VSOA 2VD2A 1N84A 3G3GA 2DWHA 2OK2A 3LSXA 5AA3A 3PPNA 1FTMA 2GFEA 3RGYA 2QMXA 4O3AA 4YB5A 1FQEA 4RA1A 3N26A 1LFIA 4OWDA 1SW2A 4DXUA 4Q30B 4OFJA 4FE8A 1I6QA 2HZKA 1MQJA 3GLBA 5FHMA 3PMXA 3PUWE 4YKIA 1OLCA 4OENA 3LR1A 4R2FA 4LZ5A 1B9JA 2OLBA 5FTIA 3FXQA 1FQFA 4NF4B 2DP8A 5KCJB 3TTLA 3IJXB 1B7HA 3WAEA 5EHSA 4ELQA 2XD2A 1MXVA 4I62A 3MAMA 1A8EA 4THIA 3VVEA 3K1PA 3N5LA 1BTJA 1OVTA 2Y7IA 2X7PA 4Z0IA 3H03A 1FTKA 2UXAA 4POXA 3TTNA 3KSXA 3O66A 5I59B 1R9LA 4JWXA 3UIFA 3MJNA 3TFLA 4GRKA 3IL1B 3RLFE 3EHUA 3RUMA 3H6WA 2PYYA 4UA8A 1QW0A 4QF9A 1I6AA 2HAVA 4EQ9A 1B3GA 2A5SA 4IY6A 2ABHA 4OTEA 3R6UA 4NWCA 5HPQA 4XKNA 1LAHE 3PV0E 3KFMA 1B1HA 2ZNUA 4ZZAA 5DVFA 4P11A 4KCCA 3TTKA 3PD8A 4KCDA 3V8XB 3GBBA 2F7AA 3OO8A 1MQDA 4POWA 3KOTA 1QKAA 5IAIA 1Y3PA 2AL5A 2BJJX 4H5GA 4EXKA 2QRYA 3O97A 2UVIA 2ZNSA 4HCYA 5CBRA 3T66A 2XXYA 2FYIA 1MH3A 2I48A 4FEBA 3P7IA 4PE5B 4F39A 2XXPA 3K02A 2XXUA 1JQFA 2F7BA 2RF1A 1MXZA 1MM6A 5H8FB 1USYH 3C31A 5ISUA 3RT6B 4GFRA 2UVGA 5KZTA 4PETA 3IB1A 4U1OA 1UTHA 1D9VA 3HHFA 1JVXA 3HSTA 2CZLA 3MPLA 3G3KA 4HW8A 3UK4A 1UTBA 3OO9A 1URGA 3GXAA 2KLFA 3K6VA 4G68C 1Z7NE 4EF1A 1P1OA 3PUXE 1SI1A 4AB6A 4L17A 3EQ1A 2PBWA 3O9PA 4F18A 3KOSA 1LFHA 3A3UA 4MF3A 5TP9A 3B7DA 2X7QA 4BDLA 1MM7A 2GHBA 4ND9A 3MP6A 3K01A 1SQYA 1AOVA 1R9QA 2F97A 1Q1KA 3MZ1A 2H25A 3S9EA 3C36A 1A7LA 4R2BA 3T9VA 1Y4TA 3PU5A 3C34A 4ONYA 3BBRA 4LUBA 1D4NA 1UTHB 4ZZEA 4R9GA 5CM6A 3LSFB 2O69A 4PQJA 3OXNA 4Q8RA 2Q9TA 4KFQA 3VLVA 1N3WA 4YMBA 2V84A 3MPKA 4C1UA 4JWYA 5H8QA 2ALUA 4U2RA 4QSCA 3CVGA 4KR5A 4ESXA 1SW4A 1PB7A 5CMBA 1MY1A 3FZVA 4ELRA 5TP9B 3CI8A 3MVYA 1DPPA 3W9VA 4GLIA 3QUJA 2V3TA 2O84X 1HSLA 1MPDA 5EYFA 1QULA 5F1QA 4EF2A 2VOZA 2HZLA 1B7UA 3VLUA 1SW5A 2Y84A 1UQWA 1MH4A 1B51A 1B2HA 4YKKA 4F31B 5B7DA 4N6PA 3MBPA 2P2AA 3TCFA 2REJA 3V83A 5L9MA 4ZEKA 3JV9A 3RN8A 2I3WA 5I57B 1SI0A 3KN3A 4OFOA
chains in the Genus database with same CATH superfamily
2OBGA 1Y1MA 2O1LA 4X04A 5H8NB 4GQOA 5K2YA 3QYTA 3VVFA 3U65A 1B3FA 5H8QB 3TUSA 2DVZA 1M5BA 2WKYA 2HCAA 2DQVA 4PP0A 1B32A 1SW1A 4F3GA 1DMBA 1II5A 1IXCA 4OETA 4G4PA 3JZJA 1DPEA 2HXRA 4P1EA 4GWSA 1FCKA 4EQBA 1WODA 1JEUA 3G3HA 1ZTYA 2QVRA 4QRZA 2Q8JA 3M3KA 4DXBA 3MUQA 3E78A 1PBQA 1N7XA 1GV8A 5CI5A 3O2AA 4HTGA 3EPEA 1FTOA 5A5XA 4N6DA 3H3GA 4RK9A 3KZGA 5L8DA 4NF0A 3H06B 1FJ9A 2XXXA 4G68A 2OZZA 4P8BA 3U93A 2WYKA 4F3PA 2GHAA 1WVJA 3HCQA 5FHOA 3QMFA 2Y7RA 4NGUA 1TWYA 3B6WA 4X1BA 4QFLA 1LCTA 1R6ZA 3RY3A 1QUKA 3GYYA 2REGA 3MC2A 3B50A 3O29A 1CB6A 5DT6A 2OWSA 4OANA 4U1ZA 2QL3A 3Q25A 2DVCA 2DXRA 4AS4A 4F22A 3C35A 4GL0A 1FPGA 4YAHX 2ZZVA 4H67A 3T9UA 2CZIA 5FTHA 1LLSA 5AA4A 2R9JA 1FBHA 1NH8A 1IXHA 1YYZA 3MWBA 3DM0A 4PAKA 3ILTB 4JWOA 3FBPA 3HO7A 3SEVA 3R26A 3D4GA 4QSDA 2RINA 1MY0A 4O3BA 3K0VA 4NF5A 2XXQA 2H98A 3FATA 4GL8A 2FHYA 5HBCA 2RCBA 3TMGA 1KA1A 3PMWA 4FEDA 3ILUB 2Q8MA 1QUJA 2D3IA 4WXJA 1B6HA 3U72A 3LC8A 2H99A 3FUZA 2WBDA 3SEYA 2F78A 2VT5A 4ZECA 2VPOA 1D3KA 4RYAA 5JTYB 5BWJA 1MRPA 2OCUA 3FGSA 5AA4B 4DCYA 4HS7A 4OZ9A 3CG1A 3T1BA 4PAIA 2F35A 1FBEA 1N0TA 2QS4A 3E3KA 4Z7EA 5AA1A 1BK4A 1S50A 3G3FA 2IEEA 4JVIA 1RKMA 1BIYA 2DYXA 4C0RA 1ZJLA 4QHQA 4O7MA 1JW1A 2UVHA 3U92A 3TEPA 3R7XA 2FIEA 2XWKA 3S9LC 3O6IA 2O7UA 3A29A 3PUYE 3H6UA 1MQGA 3HN0A 1Z7ME 4F3BA 2KR0A 2Y7PA 4WEPA 3HPIA 1TXFA 3SEXA 4GF8A 2DE4A 4YICA 3M3LA 1AIVA 1WDNA 4OA4A 2F8DA 1PB8A 1DTGA 1FJ6A 1DOTA 3MZBA 2XA5A 2ANJA 2V3QA 1IQ7A 1EZ9A 4EDPA 1TT1A 2B3BA 3FXBA 1UIVA 4GWXA 4XKPA 1MPBA 4X48A 3FD3A 4OHNA 1IEJA 4MFIA 4BLAA 5I3SA 4TQUQ 3KEIA 3UN6A 4PC9A 4PFWA 2XWOA 1N76A 3SERA 5FHNA 2FBPA 3FVGA 4BDNA 1B52A 4PF8A 3CFZA 1LGBC 3VXBA 1ATGA 3RNNA 4X9TA 4HE1A 1B5IA 5LOMA 2H4IA 2QVVA 1ZIUA 4PAFA 5IZZA 2FNCA 4MLQA 3OD7A 2XXRA 4I1DA 3ROJA 1VR5A 1QGXA 3IOTA 4BDMA 1A40A 1NNKA 2QPQA 4KYEA 4UACA 1MXWA 3U94A 4PTKA 3E79A 5KDTA 1XT8A 3MP8A 1RDYA 1EZOA 1NUZA 1S7YA 4MNIA 4NEDA 1B1XA 3KGCA 5ESYA 4R6YA 1IMFA 2DWAA 4JVDA 5BUUA 4Q0CA 1Y4CA 2Q2CA 3IAZA 4R73A 1NV6A 4RXLA 1LB8A 4G2ZA 1OQGA 2NVUB 3LUZA 3FJGA 2WX9A 1IMDA 1ELJA 4NF6A 1VFEA 1PDAA 4XKQA 1MQHA 4FORA 3KC1A 5M2VA 4QFKA 1DSNA 2FA7A 2PT2A 1AL3A 1FQDA 4NF8A 4OQOA 4RK2A 4ISUA 4GD5A 3QAXA 1IZ1A 3USDA 1ZBMA 1IXGA 5CRYA 1FQCA 3FXUA 5I2NA 3CRBA 2QJEA 4M1VA 3U1OA 4OESA 4OERA 1LAXA 1DK4A 3GBAA 1NV1A 4U22A 4QFOA 3CHGA 4H1XA 2I58A 2VHAA 1B05A 1NNTA 4O94A 4K3FA 3TQWA 1P1QA 1XI6A 1LBXA 3OEMA 3VXCA 3PPOA 5KDTB 4H8JA 4HE0A 4DZ1A 4PFUA 3SZPA 3CFXA 4NQ8A 5H8HA 3B6QA 4NHBA 1A55A 4G8HA 3T0JA 5H8SA 5DYHA 2F5XA 2DS9A 4F2OA 4XKRA 2Y7KA 4NF6B 3PTYA 2NWJA 3L6GA 2DXYA 3TDJA 1B0LA 4NF8B 2XXHA 2KQZA 4RPOA 5JEIA 3OSRA 3Q27A 4TLMB 3H7MA 1AWBA 5DVJA 5ITOA 5I2NB 4X1DA 3D4CA 3NOHA 4FBPA 4OVQA 3SKPA 3TPAA 3A3CA 3I6VA 1NL5A 1UTBB 3OSQA 4F1UA 3E13X 4LATA 2NUVA 3OOAA 4N4UA 3I3VA 3PMVA 1MPCA 3I5OA 1FQAA 5I58A 5EHMA 3DLNA 3H6VA 1AMFA 3QSLA 3TQLA 1P1NA 4X8RA 2ZYMA 3ZS6A 3EKIA 1USYE 4H6DA 1Y20A 5I84A 4YKJA 1LBCA 4YZZA 3TYHA 3MQ9A 3A09A 5L9OA 4JSDA 4DE8A 1KZ8A 4KYSA 5IZ1A 1B3LA 1ZMGA 4MIJA 3PPQA 4RNSA 4R75A 1I6BA 1QKBA 1US4A 3SDFA 2WBBA 4DCXA 1VFDA 4IO5A 3KJ7A 4FJPA 1B40A 2ONRA 4GWWA 1YZ0A 3UA8A 2ZZWA 4OEVA 3EHSA 1EZPA 2Y7WA 1MY2A 4N17A 1LBYA 2DWIA 1ZU0A 4G77A 4G8NA 4F1YA 3N6UA 4HCWA 5I2KA 2ZNTA 2I4BA 1FTAA 2YJPA 3N6TA 1OMPA 3LSLA 5EYGA 2VD3A 4RY1A 4DXCA 4RPNA 3EHTA 1A54A 3FVNA 2A5TA 1XS5A 1ANFA 5I58B 5LDZA 1Y9UA 1GGGA 3BIHA 1H43A 1LBBA 1TFDA 3RTWB 3ECRA 4P47A 2RCAA 4GWYA 4C1TA 1YXIA 3K2DA 3TCGA 3CSBA 3DP4A 2XXTA 3LBSA 3VFJA 4H65A 4NE4A 2DE3A 1QUIA 1ZKBA 4U4XA 4I9DA 1B4ZA 2HXWA 1A99A 3M3FA 5IZ3B 1S9TA 1P1UA 5J1DA 5F24A 1FTJA 5AA2A 1FW0A 2ZMBA 3IFAA 2I4CA 3HV1A 3IOUA 4R9FA 4GXSB 1JW5A 2ONKE 4G8MA 4QFPA 1H45A 4F2QA 1NMUA 3RYDA 3O28A 3KN7A 5DEXA 3V5AA 3QXMA 5CBSA 5I2KB 3MVZA 1POTA 1IMAA 3MVXA 1B5JA 1PB9A 1NUXA 1BKAA 3O6GA 4E0WA 4F3SA 3Q26A 3FJ7A 3PGFA 4P56A 2I6EA 5L9SA 2MKZA 4NMYA 4XEQA 1SVXB 4RJZA 4MCOA 4MNPA 1HSJA 4KHZE 2O68A 2QMWA 2XHDA 1PC3A 2ZYNA 1D9YA 2XXVA 1B5HA 2RC7A 2RC9A 2I3VA 4H8IA 3DP6A 3LSWA 4BDQA 3IB2A 4LA9A 1MDQA 4ZE9A 1CE2A 5HM4B 1B46A 3OELA 1T0KA 2ZYOA 4YB6A 1FQBA 5AA2B 5A5XB 2XWIA 5FBPA 2HEUA 4JB7A 5TPAA 5ELVA 3ODBA 1XHYA 1EYKA 1POY1 1XC1A 2XXWA 5K2XA 4G68B 4MX6A 1MXYA 2THIA 4N13A 4GOTA 3KSJA 1KA0A 4OYVA 4OVTA 1LEVA 2X26A 3DELB 1JP4A 1FPJA 3KJTA 4LQ5A 4IO4A 3SEWA 1DCUA 1JNFA 1OIBA 3FVOA 4GWZA 5ICTA 3T93B 4N6KA 4NF4A 2Q2AA 3IR1A 2PCRA 3PPRA 4ZEBA 1IUDA 1EYIA 3ONMA 1I69A 3VLWA 1FPLA 4WEDA 2GRVA 4EQ7A 3CSGA 5TPAB 2GH9A 1Y1ZA 3TKDA 1DTZA 1MXXA 4ZE8A 3IOVA 4GWUA 3C4MA 1PBPA 1M5FA 2XX8A 4GBVA 2Q74A 5I59A 4H0WA 4NF5B 4IGRA 4E0XA 3U8QA 3IX1A 5ET6A 1MS7A 4PFTA 2Y5KA 4OVSA 1A8FA 1Y3NA 1BP5A 1TFAA 4DIGA 3F11A 1NV7A 4UABA 1LB9A 1O63A 3OO6A 3IO6A 2XD3A 4LZ7A 3ZKKA 4JSOA 4IO2A 2V3UA 2QS1A 1QVSA 2E0SA 3FVKA 1B4HA 2P3NA 4MHFA 5ICQA 3C9HA 4XTCQ 1CNQA 2WYPA 2CMOA 1IITA 4OMBA 2G93A 3ZKLA 2IA4A 4NX1A 2FIXA 2H5YA 3W9WA 1FPEA 4MBPA 4ZS9A 2DSFA 3TCHA 3IJOB 1UIUA 2AL4A 3KBRA 2HAUA 1FTLA 5T3JA 2Z8EA 1B3HA 4LN5A 3C32A 4PE3A 3DP8A 3RT8A 4QBAA 2B4MA 3G3JA 4NG7A 2M8CA 1RYXA 3T22A 4LVQA 3V89B 2Z22A 3BIGA 3S2VA 2W7YA 1IMCA 1H3DA 3PUZE 2DWJA 5H8FA 2O6AA 4OXVA 4ELPA 1URSA 1NUYA 3FJMA 4G61A 4P0GA 1JETA 5ITPA 1LBVA 2R71A 2OX3A 4MLVA 4I40A 4ZEIA 1B58A 3THIA 2VPNA 3TAJA 3IO4A 4PFYA 1IXIA 4QXDA 4OFLA 1RYOA 4AB5A 1LAFE 3T9XB 1O7TA 2V25A 3LV0A 4U21A 4PFRA 1Q35A 4ZDMA 1R1NA 4ZEDA 3K00A 2B65A 4OEUA 3TTRA 3KN8A 3EN3A 1YTVA 1OLAA 3D1RA 3KBZA 3AXFA 3MZ9A 4AQ4A 4GX6A 4O3CA 1MDP1 4JBZA 2R6GE 2P3VA 3RPLA 3CIJA 5JK4A 4GX3A 2F36A 3SESA 4MNCA 4XF5A 3LUYA 2UVJA 4DLDA 5AA2D 3K6XA 1YPNA 1NNFA 1MY3A 3VVDA 4KPTA 2HHMA 2YPNA 2Z23A 1SDXA 3RTFB 1FPFA 4FECA 3PD9A 2F6GA 2LAOA 3PUVE 3E9XA 3VDFA 4GXAA 1Y3QA 2QS3A 1EH3A 2D21A 3S9MC 3T9HB 1XVYA 2F3DA 2FVZA 4PGNA 2NOOA 1N7WA 4GWOA 1LSTA 2Y5LA 4YKPA 4IGTA 1YAEA 2PT1A 5CMMA 4OVRA 1MG1A 4P0IA 2I0CA 2H9BA 2OJTA 1SBPA 1SD3A 3T96B 3TZAA 2O1MA 4YU0A 3IB0A 1EYJA 2P1SA 1EU8A 2OWTA 5IKBA 1P99A 3IORA 1O64A 4EXLA 5I7IA 3RPLB 5DTBA 5TU0A 5DVIA 4YMAA 2ONSA 1FPBA 3HHGA 3BFTA 4MMPA 1P1WA 2NXOA 3BFUA 1IMBA 4ESWA 3G7WA 3WAFA 1L5TA 1B7ZA 3N94A 3OMBA 3SETA 3IK6B 1MY4A 1VE4A 4R6KA 1URDA 1AH5A 3IFCA 3B8BA 3FV2A 1GR2A 1FBFA 2F34A 1MXUA 5I57A 2F7CA 4PFIA 1SYHA 4NWDA 2PX1A 2I49A 3QUFA 4O8MA 5F7VA 3E4RA 5H8NA 4P1LA 2YLNA 4ECFA 3K4UA 2GQ1A 5H8HB 1H76A 3ZSFA 2E1SA 4NN3A 3FIRA 2UYFA 3RPWA 3IOWA 2Q88A 3W15C 1M5DA 2UYEA 1YCJA 4R72A 2ZXTA 1M5CA 3FASA 3JYRA 3TELA 4U4SA 3S4UA 3CR9A 4F1VA 4F19A 1LFGA 4PBHA 1J1NA 3K6WA 4H46A 2RKMA 4H5FA 1OVBA 1RDZA 2HQ0A 4KXPA 3QIMA 4PBQA 3UGWA 1NV3A 2PMSA 2DE2A 4GIZA 4LQ2A 1GTKA 4I3EA 4N07A 2AIXA 4F29A 2DDKA 4AS5A 3VV5A 2HFBA 4IB2A 3QK6A 1NH7A 5AE4A 1LAGE 1NKXA 4ELOA 5EQ8A 3K6UA 4LP2B 4FIMA 4N15A 1BLFA 2I0BA 3EF7A 3G3IA 4QFNA 3UORA 1GVCA 4YB7A 3O6HA 1KWHA 2O7IA 3HFUA 3OEKA 4PGPA 5CMCA 2JJKA 4M4GA 5ET7A 3BKIB 4WKMA 3MSTA 5I56A 4LONB 2V4CA 4KD5A 3SEUA 3MP1A 3Q29A 5CMKA 1JVYA 1PEBA 4IO7A 1SYIA 4N81A 1NFTA 5CC2A 3CG3A 2F3BA 5IGAA 4XXUA 1ZLQA 2CZKA 2OWZA 1N3XA 4R6HA 4U23A 4ZEFA 4R74A 1US5A 3RQTA 3MW0A 2XXIA 3OO7A 1IMEA 3FV1A 2A5TB 4MH5A 2Q89A 3H4ZA 3S9NC 3VE1B 3M8UA 4GVOA 3B6TA 4HXVA 4TLLB 3K1NA 5J16A 4KQPA 4IO6A 1M5EA 1LCFA 2D5WA 2XXKA 4GBWA 4LZ8A 1XVXA 4PCDA 2ZYKA 4FAJA 2XWVA 3C33A 1F9BA 1D9QA 1G0IA 2QS2A 1NV2A 3K1MA 2BJIA 2P0SA 2Z8DA 2VP1A 4Q5TA 2RC8A 2DOJA 4IO3A 3MVWA 1JW4A 4IY5A 5JTYA 2XX7A 5I56B 2WEFA 1N04A 2O51A 2QSXA 4P3LA 1B3EA 3KG2A 5EQ7A 3TTMA 4XIGQ 3Q28A 3GZGA 5DEXB 4BDRA 5B70A 1NV0A 4QSEA 1FPIA 5I5PA 1NNPA 2F6PA 5IM2A 2B3FA 2AYSA 4JDFA 2Z8FA 1OQHA 1HSEA 1FSAA 2ESNA 2XX9A 2VGQA 4OVJA 3TODA 3UP9A 4NTLA 3H6TA 1NI9A 2V93A 1H44A 3PPPA 5KCJA 4JXIA 1QJMA 4EUOA 1MQIA 2G29A 4DDDA 4TOZA 2PVUA 4KI0E 3L6HA 4FATA 3OENA 4PFBA 4KYDA 1IIWA 4BDOA 4I8CA 1JEVA 3FXRA 1XOCA 3CFLA 1B0HA 1VSOA 2VD2A 1N84A 3G3GA 2DWHA 2OK2A 3LSXA 5AA3A 3PPNA 1FTMA 2GFEA 3RGYA 2QMXA 4O3AA 4YB5A 4RA1A 1FQEA 3N26A 1LFIA 4OWDA 1SW2A 4DXUA 4Q30B 4OFJA 4FE8A 1I6QA 2HZKA 1FBGA 5A5LA 1MQJA 3GLBA 4N91A 5FHMA 3PMXA 3PUWE 4YKIA 1OLCA 4OENA 3LR1A 4R2FA 1RDXA 4LZ5A 4GX4A 1B9JA 1K9YA 2OLBA 5FTIA 3FXQA 1NV5A 1FQFA 4NF4B 2DP8A 5KCJB 3TTLA 3IJXB 1B7HA 3WAEA 5EHSA 1FBCA 4ELQA 2XD2A 1MXVA 4I62A 5DW8A 2B4LA 3MAMA 1A8EA 4THIA 3VVEA 3K1PA 3N5LA 1BTJA 1OVTA 2Y7IA 2X7PA 4Z0IA 3H03A 1FTKA 2UXAA 4POXA 3TTNA 3KSXA 3O66A 4MAGA 5I59B 1R9LA 4JWXA 3UIFA 3MJNA 3TFLA 4GRKA 3IL1B 3RLFE 3EHUA 1NUWA 3RUMA 5LTCA 1VDWA 3H6WA 4P9KA 2PYYA 4UA8A 1QW0A 2PFZA 4QF9A 1I6AA 2HAVA 4EQ9A 2ZZXA 4MJOA 5ET5A 1B3GA 2A5SA 4IY6A 2ABHA 4OTEA 3R6UA 4NWCA 5HPQA 4XKNA 1LAHE 3PV0E 3KFMA 1B1HA 2ZNUA 4ZZAA 4H45A 5DVFA 4P11A 4KCCA 3TTKA 3PD8A 4KCDA 3V8XB 3GBBA 2F7AA 3OO8A 5ET8A 1MQDA 4POWA 3KOTA 4HE2A 1K9ZA 1QKAA 5IAIA 1Y3PA 2AL5A 2BJJX 4H5GA 4EXKA 2QRYA 3O97A 2UVIA 2ZNSA 4HCYA 5CBRA 2QFLA 2XXYA 2FYIA 3T66A 1FPDA 1MH3A 2I48A 4FEBA 4O7IA 3P7IA 4PE5B 5EQ9A 2CEYA 4F39A 2XXPA 3K02A 1FBPA 2XXUA 1JQFA 2F7BA 2RF1A 1MXZA 1MM6A 5H8FB 1FPKA 1USYH 3C31A 5ISUA 1SPIA 3RT6B 4GFRA 2UVGA 5KZTA 4PETA 4DI3D 3IB1A 4PDDA 4U1OA 1UTHA 1D9VA 3HHFA 1JVXA 3HSTA 2L5VA 2CZLA 3MPLA 4JVCA 4MEVA 3G3KA 4N8GA 4HW8A 3UK4A 2CEXA 1UTBA 3OO9A 1URGA 3GXAA 2KLFA 3K6VA 5EQAA 4G68C 1Z7NE 4XFEA 4EF1A 1P1OA 3PUXE 1SI1A 4AB6A 4L17A 3EQ1A 2PBWA 3O9PA 4F18A 3KOSA 1LFHA 3MYUA 3A3UA 4MF3A 5TP9A 3B7DA 2X7QA 4BDLA 1MM7A 2CZHA 2GHBA 4ND9A 3MP6A 3K01A 1SQYA 1AOVA 1R9QA 2F97A 1Q1KA 3MZ1A 2H25A 3S9EA 3C36A 1A7LA 4R2BA 3T9VA 1Y4TA 3PU5A 3C34A 4ONYA 3BBRA 4LUBA 1D4NA 1UTHB 4ZZEA 4R9GA 5CM6A 3LSFB 2O69A 4N8YA 4PQJA 3OXNA 4Q8RA 2Q9TA 4KFQA 4OVPA 3VLVA 1N3WA 1NV4A 3KC0A 4YMBA 1DBZA 2V84A 3MPKA 4IR8A 4C1UA 4JWYA 5H8QA 2R8TA 2ALUA 4U2RA 1LBZA 1INPA 4QSCA 3CVGA 4KR5A 4ESXA 1SW4A 1PB7A 5CMBA 1MY1A 3FZVA 2QVUA 2PFYA 4ELRA 2HPGA 5TP9B 1Q9DA 3CI8A 3MVYA 1DPPA 3W9VA 4GLIA 3QUJA 2V3TA 2O84X 1FBDA 4DI4B 1HSLA 1MPDA 5EYFA 1QULA 5F1QA 1LBWA 4EF2A 2VOZA 2HZLA 1B7UA 5IZ3A 3VLUA 4PF6A 1SW5A 2Y84A 1UQWA 1MH4A 1B51A 1B2HA 5EYHA 4YKKA 4I3YA 4F31B 4NAPA 5B7DA 4N6PA 3MBPA 4PDHA 2P2AA 3TCFA 2REJA 3ISPA 3V83A 1FRPA 5L9MA 4ZEKA 3JV9A 3RN8A 2I3WA 5I57B 1SI0A 3KN3A 1G0HA 4OFOA
chains in the Genus database with same CATH topology
2OBGA 1Y1MA 2O1LA 5H8NB 4GQOA 5K2YA 3QYTA 3VVFA 1B3FA 5H8QB 3TUSA 2DVZA 1M5BA 2WKYA 2HCAA 2DQVA 4PP0A 1B32A 1SW1A 4F3GA 1DMBA 1II5A 1IXCA 4OETA 4G4PA 3JZJA 1DPEA 1FCKA 4EQBA 1WODA 1JEUA 3G3HA 1ZTYA 4QRZA 2Q8JA 3M3KA 4DXBA 3MUQA 1PBQA 1N7XA 1GV8A 5CI5A 3O2AA 4HTGA 3EPEA 1FTOA 5A5XA 3H3GA 4RK9A 3KZGA 5L8DA 3H06B 2XXXA 4G68A 2OZZA 3U93A 4F3PA 2GHAA 1WVJA 3HCQA 5FHOA 2Y7RA 1TWYA 3B6WA 4X1BA 4QFLA 1LCTA 1R6ZA 3RY3A 1QUKA 2REGA 3MC2A 3O29A 1CB6A 2OWSA 4U1ZA 2QL3A 3Q25A 2DVCA 2DXRA 4F22A 3C35A 4GL0A 4YAHX 4H67A 3T9UA 5FTHA 1LLSA 5AA4A 2R9JA 1NH8A 1IXHA 3MWBA 3DM0A 3ILTB 4JWOA 3HO7A 3SEVA 3R26A 3D4GA 4QSDA 2RINA 1MY0A 4O3BA 3K0VA 4NF5A 2XXQA 2H98A 3FATA 4GL8A 5HBCA 2RCBA 3TMGA 3PMWA 4FEDA 3ILUB 1QUJA 2D3IA 4WXJA 1B6HA 3U72A 3LC8A 2H99A 3FUZA 3SEYA 2F78A 4ZECA 1D3KA 4RYAA 5JTYB 5BWJA 1MRPA 2OCUA 3FGSA 5AA4B 4DCYA 4HS7A 4OZ9A 3CG1A 2F35A 1N0TA 2QS4A 3E3KA 4Z7EA 5AA1A 1S50A 3G3FA 2IEEA 1RKMA 1BIYA 2DYXA 4C0RA 1ZJLA 4QHQA 1JW1A 2UVHA 3U92A 3TEPA 3R7XA 3S9LC 3O6IA 2O7UA 3PUYE 3H6UA 1MQGA 3HN0A 1Z7ME 4F3BA 2Y7PA 4WEPA 3HPIA 1TXFA 3SEXA 4GF8A 2DE4A 4YICA 3M3LA 1AIVA 1WDNA 2F8DA 1PB8A 1DTGA 1DOTA 3MZBA 2ANJA 2V3QA 1IQ7A 1EZ9A 4EDPA 1TT1A 2B3BA 5DT6A 1UIVA 4BLAA 4XKPA 1MPBA 4X48A 3FD3A 4OHNA 1IEJA 4MFIA 4TQUQ 3KEIA 3UN6A 4PFWA 1N76A 3SERA 5FHNA 3FVGA 4BDNA 1B52A 3CFZA 1LGBC 3VXBA 1ATGA 3RNNA 4X9TA 5LOMA 1B5IA 2H4IA 1ZIUA 2FNCA 4MLQA 3OD7A 2XXRA 4I1DA 1VR5A 3IOTA 4BDMA 1A40A 1NNKA 2QPQA 4KYEA 4UACA 1MXWA 3U94A 5KDTA 1XT8A 3MP8A 1EZOA 1S7YA 4NEDA 1B1XA 3KGCA 4R6YA 2DWAA 5BUUA 1Y4CA 2Q2CA 4Q0CA 3IAZA 4R73A 4RXLA 1LB8A 4G2ZA 1OQGA 2NVUB 3FJGA 1ELJA 4NF6A 1VFEA 1PDAA 4XKQA 1MQHA 4FORA 5M2VA 4QFKA 1DSNA 2FA7A 2PT2A 1AL3A 1FQDA 4NF8A 4OQOA 4RK2A 4ISUA 3QAXA 4GD5A 1IZ1A 3USDA 1ZBMA 1IXGA 5CRYA 1FQCA 3FXUA 5I2NA 3CRBA 2QJEA 4M1VA 3U1OA 4OESA 4OERA 1LAXA 3GBAA 4U22A 4QFOA 4H1XA 2I58A 2VHAA 1B05A 1NNTA 4K3FA 3TQWA 1P1QA 3OEMA 3VXCA 3PPOA 5KDTB 4H8JA 4DZ1A 4PFUA 3CFXA 5H8HA 3B6QA 1A55A 4G8HA 5H8SA 5DYHA 2F5XA 2DS9A 4F2OA 4XKRA 2Y7KA 4NF6B 2NWJA 3L6GA 2DXYA 3TDJA 1B0LA 4NF8B 2XXHA 4RPOA 5JEIA 3OSRA 3Q27A 4TLMB 3H7MA 5DVJA 5ITOA 5I2NB 4X1DA 3D4CA 3SKPA 3TPAA 3A3CA 3I6VA 1NL5A 1UTBB 3OSQA 4F1UA 3E13X 4LATA 2NUVA 3OOAA 3I3VA 3PMVA 1MPCA 3I5OA 1FQAA 5I58A 5EHMA 3DLNA 3H6VA 1AMFA 3QSLA 3TQLA 1P1NA 2ZYMA 3ZS6A 1USYE 4H6DA 1Y20A 5I84A 4YKJA 1LBCA 4YZZA 3TYHA 3MQ9A 3A09A 5L9OA 4JSDA 4DE8A 4KYSA 1B3LA 1ZMGA 3PPQA 4RNSA 4R75A 1I6BA 1QKBA 1US4A 3SDFA 4DCXA 1VFDA 4IO5A 3KJ7A 4FJPA 1B40A 2ONRA 3UA8A 4OEVA 3EHSA 1EZPA 2Y7WA 1MY2A 2DWIA 1ZU0A 4G77A 4G8NA 4F1YA 3N6UA 4HCWA 5I2KA 2ZNTA 2I4BA 2YJPA 3N6TA 1OMPA 3LSLA 2VD3A 4RY1A 4DXCA 4RPNA 3EHTA 1A54A 3FVNA 2A5TA 1XS5A 1ANFA 5I58B 1Y9UA 1GGGA 1H43A 1LBBA 1TFDA 3RTWB 3ECRA 4C1TA 2RCAA 3K2DA 3TCGA 3CSBA 3DP4A 2XXTA 3LBSA 3VFJA 4H65A 4NE4A 2DE3A 1QUIA 1ZKBA 4U4XA 4I9DA 1B4ZA 2HXWA 1A99A 3M3FA 1S9TA 1P1UA 5J1DA 1FTJA 5AA2A 1FW0A 2ZMBA 2I4CA 3HV1A 3IOUA 4R9FA 4GXSB 1JW5A 2ONKE 4G8MA 4QFPA 1H45A 4F2QA 1NMUA 3O28A 3KN7A 5DEXA 3V5AA 3QXMA 5CBSA 5I2KB 3MVZA 1POTA 3MVXA 1B5JA 1PB9A 4E0WA 1BKAA 3O6GA 4F3SA 3Q26A 3FJ7A 3PGFA 2I6EA 5L9SA 4NMYA 1SVXB 4RJZA 1HSJA 4KHZE 2O68A 2QMWA 2XHDA 1PC3A 2ZYNA 1D9YA 2XXVA 1B5HA 2RC7A 2RC9A 2I3VA 4H8IA 3DP6A 3LSWA 4BDQA 3IB2A 4LA9A 1MDQA 4ZE9A 1CE2A 5HM4B 1B46A 3OELA 1T0KA 2ZYOA 4YB6A 1FQBA 5AA2B 5A5XB 2HEUA 4JB7A 5TPAA 5ELVA 3ODBA 1XHYA 1POY1 1XC1A 2XXWA 5K2XA 4G68B 1MXYA 2THIA 4N13A 4GOTA 3KSJA 4OYVA 2X26A 3DELB 3KJTA 4LQ5A 4IO4A 3SEWA 1JNFA 1OIBA 3FVOA 5ICTA 3T93B 4NF4A 2Q2AA 3IR1A 3PPRA 4ZEBA 1IUDA 3ONMA 1I69A 3VLWA 4WEDA 2GRVA 4EQ7A 3CSGA 5TPAB 2GH9A 1Y1ZA 3TKDA 1DTZA 1MXXA 4ZE8A 3IOVA 3C4MA 1PBPA 1M5FA 2XX8A 5I59A 4H0WA 4NF5B 4IGRA 4E0XA 3U8QA 3IX1A 1MS7A 4PFTA 1A8FA 1Y3NA 1BP5A 1TFAA 4DIGA 3F11A 1LB9A 1O63A 3OO6A 3IO6A 2XD3A 4LZ7A 3ZKKA 4JSOA 4IO2A 2V3UA 2QS1A 1QVSA 2E0SA 3FVKA 1B4HA 5ICQA 3C9HA 4XTCQ 2CMOA 1IITA 4OMBA 2G93A 3ZKLA 2IA4A 2H5YA 3W9WA 4MBPA 4ZS9A 2DSFA 3TCHA 3IJOB 1UIUA 2AL4A 3KBRA 2HAUA 1FTLA 2Z8EA 1B3HA 3C32A 3DP8A 3RT8A 3G3JA 2M8CA 1RYXA 3T22A 4LVQA 3V89B 2Z22A 3S2VA 2W7YA 1H3DA 3PUZE 2DWJA 5H8FA 2O6AA 4OXVA 4ELPA 1URSA 3FJMA 4P0GA 1JETA 5ITPA 2R71A 4MLVA 4ZEIA 1B58A 3THIA 3TAJA 3IO4A 4PFYA 1IXIA 4OFLA 1RYOA 4AB5A 1LAFE 3T9XB 1O7TA 2V25A 4U21A 1Q35A 4ZDMA 1R1NA 4ZEDA 3K00A 2B65A 4OEUA 3TTRA 3KN8A 3EN3A 1YTVA 1OLAA 3AXFA 3MZ9A 4AQ4A 4O3CA 1MDP1 4JBZA 2R6GE 3CIJA 5JK4A 2F36A 3SESA 3LUYA 2UVJA 4DLDA 5AA2D 3K6XA 1YPNA 1NNFA 1MY3A 3VVDA 4KPTA 2YPNA 2Z23A 1SDXA 3RTFB 4FECA 3PD9A 2F6GA 2LAOA 3PUVE 3E9XA 3VDFA 4GXAA 1Y3QA 2QS3A 1EH3A 2D21A 3S9MC 3T9HB 1XVYA 2NOOA 1N7WA 4GWOA 1LSTA 4YKPA 4IGTA 1YAEA 2PT1A 5CMMA 1MG1A 4P0IA 2I0CA 2H9BA 2OJTA 1SBPA 1SD3A 3T96B 3TZAA 2O1MA 4YU0A 3IB0A 2P1SA 1EU8A 2OWTA 5IKBA 1P99A 3IORA 1O64A 4EXLA 5DTBA 5TU0A 5DVIA 4YMAA 2ONSA 3HHGA 3BFTA 1P1WA 2NXOA 3BFUA 4ESWA 3G7WA 3WAFA 1L5TA 1B7ZA 3N94A 3OMBA 3SETA 3IK6B 1MY4A 1VE4A 4R6KA 1URDA 1AH5A 3FV2A 1GR2A 2F34A 1MXUA 5I57A 2F7CA 1SYHA 4NWDA 2PX1A 2I49A 3QUFA 5F7VA 3E4RA 5H8NA 2YLNA 4ECFA 3K4UA 5H8HB 1H76A 3ZSFA 2E1SA 3FIRA 2UYFA 3RPWA 3IOWA 2Q88A 3W15C 1M5DA 2UYEA 1YCJA 4R72A 2ZXTA 1M5CA 3FASA 3JYRA 3TELA 4U4SA 3S4UA 3CR9A 4F1VA 4F19A 1LFGA 1J1NA 3K6WA 2RKMA 4H5FA 1OVBA 2HQ0A 3QIMA 3UGWA 2PMSA 2DE2A 4GIZA 4LQ2A 1GTKA 4N07A 2AIXA 4F29A 3VV5A 2HFBA 4IB2A 3QK6A 1NH7A 5AE4A 1LAGE 1NKXA 4ELOA 3K6UA 4LP2B 4FIMA 1BLFA 2I0BA 3EF7A 3G3IA 4QFNA 3UORA 1GVCA 4YB7A 3O6HA 1KWHA 2O7IA 3OEKA 5CMCA 4M4GA 3BKIB 4WKMA 5I56A 4LONB 4KD5A 3SEUA 3MP1A 3Q29A 5CMKA 1JVYA 1PEBA 4IO7A 1SYIA 1NFTA 5CC2A 3CG3A 4XXUA 1ZLQA 1N3XA 4R6HA 4U23A 4ZEFA 4R74A 1US5A 3RQTA 3MW0A 2XXIA 3OO7A 3FV1A 2A5TB 4MH5A 2Q89A 3H4ZA 3S9NC 3VE1B 3M8UA 4GVOA 3B6TA 4TLLB 3K1NA 4IO6A 4KQPA 1M5EA 1LCFA 2D5WA 4LZ8A 1XVXA 2ZYKA 4FAJA 3C33A 1F9BA 2QS2A 3K1MA 2P0SA 2Z8DA 2VP1A 4Q5TA 2RC8A 2DOJA 4IO3A 3MVWA 1JW4A 4IY5A 5JTYA 2XX7A 5I56B 1N04A 2O51A 2QSXA 1B3EA 3KG2A 3TTMA 4XIGQ 3Q28A 3GZGA 5DEXB 4BDRA 5B70A 4QSEA 1NNPA 2F6PA 2B3FA 2AYSA 4JDFA 2Z8FA 1OQHA 1HSEA 2ESNA 2XX9A 2VGQA 4OVJA 3TODA 3UP9A 4NTLA 3H6TA 2V93A 1H44A 3PPPA 5KCJA 4JXIA 1QJMA 4EUOA 1MQIA 2G29A 4DDDA 4TOZA 2PVUA 4KI0E 3L6HA 4FATA 3OENA 4KYDA 1IIWA 4BDOA 4I8CA 1JEVA 3FXRA 1XOCA 3CFLA 1B0HA 1VSOA 2VD2A 1N84A 3G3GA 2DWHA 2OK2A 3LSXA 5AA3A 3PPNA 1FTMA 2GFEA 3RGYA 2QMXA 4O3AA 4YB5A 1FQEA 4RA1A 3N26A 1LFIA 4OWDA 1SW2A 4DXUA 4Q30B 4OFJA 4FE8A 1I6QA 2HZKA 1MQJA 3GLBA 5FHMA 3PMXA 3PUWE 4YKIA 1OLCA 4OENA 3LR1A 4R2FA 4LZ5A 1B9JA 2OLBA 5FTIA 3FXQA 1FQFA 4NF4B 2DP8A 5KCJB 3TTLA 3IJXB 1B7HA 3WAEA 5EHSA 4ELQA 2XD2A 1MXVA 4I62A 3MAMA 1A8EA 4THIA 3VVEA 3K1PA 3N5LA 1BTJA 1OVTA 2Y7IA 2X7PA 4Z0IA 3H03A 1FTKA 2UXAA 4POXA 3TTNA 3KSXA 3O66A 5I59B 1R9LA 4JWXA 3UIFA 3MJNA 3TFLA 4GRKA 3IL1B 3RLFE 3EHUA 3RUMA 3H6WA 2PYYA 4UA8A 1QW0A 4QF9A 1I6AA 2HAVA 4EQ9A 1B3GA 2A5SA 4IY6A 2ABHA 4OTEA 3R6UA 4NWCA 5HPQA 4XKNA 1LAHE 3PV0E 3KFMA 1B1HA 2ZNUA 4ZZAA 5DVFA 4P11A 4KCCA 3TTKA 3PD8A 4KCDA 3V8XB 3GBBA 2F7AA 3OO8A 1MQDA 4POWA 3KOTA 1QKAA 5IAIA 1Y3PA 2AL5A 2BJJX 4H5GA 4EXKA 2QRYA 3O97A 2UVIA 2ZNSA 4HCYA 5CBRA 3T66A 2XXYA 2FYIA 1MH3A 2I48A 4FEBA 3P7IA 4PE5B 4F39A 2XXPA 3K02A 2XXUA 1JQFA 2F7BA 2RF1A 1MXZA 1MM6A 5H8FB 1USYH 3C31A 5ISUA 3RT6B 4GFRA 2UVGA 5KZTA 4PETA 3IB1A 4U1OA 1UTHA 1D9VA 3HHFA 1JVXA 3HSTA 2CZLA 3MPLA 3G3KA 4HW8A 3UK4A 1UTBA 3OO9A 1URGA 3GXAA 2KLFA 3K6VA 4G68C 1Z7NE 4EF1A 1P1OA 3PUXE 1SI1A 4AB6A 4L17A 3EQ1A 2PBWA 3O9PA 4F18A 3KOSA 1LFHA 3A3UA 4MF3A 5TP9A 3B7DA 2X7QA 4BDLA 1MM7A 2GHBA 4ND9A 3MP6A 3K01A 1SQYA 1AOVA 1R9QA 2F97A 1Q1KA 3MZ1A 2H25A 3S9EA 3C36A 1A7LA 4R2BA 3T9VA 1Y4TA 3PU5A 3C34A 4ONYA 3BBRA 4LUBA 1D4NA 1UTHB 4ZZEA 4R9GA 5CM6A 3LSFB 2O69A 4PQJA 3OXNA 4Q8RA 2Q9TA 4KFQA 3VLVA 1N3WA 4YMBA 2V84A 3MPKA 4C1UA 4JWYA 5H8QA 2ALUA 4U2RA 4QSCA 3CVGA 4KR5A 4ESXA 1SW4A 1PB7A 5CMBA 1MY1A 3FZVA 4ELRA 5TP9B 3CI8A 3MVYA 1DPPA 3W9VA 4GLIA 3QUJA 2V3TA 2O84X 1HSLA 1MPDA 5EYFA 1QULA 5F1QA 4EF2A 2VOZA 2HZLA 1B7UA 3VLUA 1SW5A 2Y84A 1UQWA 1MH4A 1B51A 1B2HA 4YKKA 4F31B 5B7DA 4N6PA 3MBPA 2P2AA 3TCFA 2REJA 3V83A 5L9MA 4ZEKA 3JV9A 3RN8A 2I3WA 5I57B 1SI0A 3KN3A 4OFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBG A;  1Y1M A;  2O1L A;  5H8N B;  4GQO A;  5K2Y A;  3QYT A;  3VVF A;  1B3F A;  5H8Q B;  3TUS A;  2DVZ A;  1M5B A;  2WKY A;  2HCA A;  2DQV A;  4PP0 A;  1B32 A;  1SW1 A;  4F3G A;  1DMB A;  1II5 A;  1IXC A;  4OET A;  4G4P A;  3JZJ A;  1DPE A;  1FCK A;  4EQB A;  1WOD A;  1JEU A;  3G3H A;  1ZTY A;  4QRZ A;  2Q8J A;  3M3K A;  4DXB A;  3MUQ A;  1PBQ A;  1N7X A;  1GV8 A;  5CI5 A;  3O2A A;  4HTG A;  3EPE A;  1FTO A;  5A5X A;  3H3G A;  4RK9 A;  3KZG A;  5L8D A;  3H06 B;  2XXX A;  4G68 A;  2OZZ A;  3U93 A;  4F3P A;  2GHA A;  1WVJ A;  3HCQ A;  5FHO A;  2Y7R A;  1TWY A;  3B6W A;  4X1B A;  4QFL A;  1LCT A;  1R6Z A;  3RY3 A;  1QUK A;  2REG A;  3MC2 A;  3O29 A;  1CB6 A;  2OWS A;  4U1Z A;  2QL3 A;  3Q25 A;  2DVC A;  2DXR A;  4F22 A;  3C35 A;  4GL0 A;  4YAH X;  4H67 A;  3T9U A;  5FTH A;  1LLS A;  5AA4 A;  2R9J A;  1NH8 A;  1IXH A;  3MWB A;  3DM0 A;  3ILT B;  4JWO A;  3HO7 A;  3SEV A;  3R26 A;  3D4G A;  4QSD A;  2RIN A;  1MY0 A;  4O3B A;  3K0V A;  4NF5 A;  2XXQ A;  2H98 A;  3FAT A;  4GL8 A;  5HBC A;  2RCB A;  3TMG A;  3PMW A;  4FED A;  3ILU B;  1QUJ A;  2D3I A;  4WXJ A;  1B6H A;  3U72 A;  3LC8 A;  2H99 A;  3FUZ A;  3SEY A;  2F78 A;  4ZEC A;  1D3K A;  4RYA A;  5JTY B;  5BWJ A;  1MRP A;  2OCU A;  3FGS A;  5AA4 B;  4DCY A;  4HS7 A;  4OZ9 A;  3CG1 A;  2F35 A;  1N0T A;  2QS4 A;  3E3K A;  4Z7E A;  5AA1 A;  1S50 A;  3G3F A;  2IEE A;  1RKM A;  1BIY A;  2DYX A;  4C0R A;  1ZJL A;  4QHQ A;  1JW1 A;  2UVH A;  3U92 A;  3TEP A;  3R7X A;  3S9L C;  3O6I A;  2O7U A;  3PUY E;  3H6U A;  1MQG A;  3HN0 A;  1Z7M E;  4F3B A;  2Y7P A;  4WEP A;  3HPI A;  1TXF A;  3SEX A;  4GF8 A;  2DE4 A;  4YIC A;  3M3L A;  1AIV A;  1WDN A;  2F8D A;  1PB8 A;  1DTG A;  1DOT A;  3MZB A;  2ANJ A;  2V3Q A;  1IQ7 A;  1EZ9 A;  4EDP A;  1TT1 A;  2B3B A;  5DT6 A;  1UIV A;  4BLA A;  4XKP A;  1MPB A;  4X48 A;  3FD3 A;  4OHN A;  1IEJ A;  4MFI A;  4TQU Q;  3KEI A;  3UN6 A;  4PFW A;  1N76 A;  3SER A;  5FHN A;  3FVG A;  4BDN A;  1B52 A;  3CFZ A;  1LGB C;  3VXB A;  1ATG A;  3RNN A;  4X9T A;  5LOM A;  1B5I A;  2H4I A;  1ZIU A;  2FNC A;  4MLQ A;  3OD7 A;  2XXR A;  4I1D A;  1VR5 A;  3IOT A;  4BDM A;  1A40 A;  1NNK A;  2QPQ A;  4KYE A;  4UAC A;  1MXW A;  3U94 A;  5KDT A;  1XT8 A;  3MP8 A;  1EZO A;  1S7Y A;  4NED A;  1B1X A;  3KGC A;  4R6Y A;  2DWA A;  5BUU A;  1Y4C A;  2Q2C A;  4Q0C A;  3IAZ A;  4R73 A;  4RXL A;  1LB8 A;  4G2Z A;  1OQG A;  2NVU B;  3FJG A;  1ELJ A;  4NF6 A;  1VFE A;  1PDA A;  4XKQ A;  1MQH A;  4FOR A;  5M2V A;  4QFK A;  1DSN A;  2FA7 A;  2PT2 A;  1AL3 A;  1FQD A;  4NF8 A;  4OQO A;  4RK2 A;  4ISU A;  3QAX A;  4GD5 A;  1IZ1 A;  3USD A;  1ZBM A;  1IXG A;  5CRY A;  1FQC A;  3FXU A;  5I2N A;  3CRB A;  2QJE A;  4M1V A;  3U1O A;  4OES A;  4OER A;  1LAX A;  3GBA A;  4U22 A;  4QFO A;  4H1X A;  2I58 A;  2VHA A;  1B05 A;  1NNT A;  4K3F A;  3TQW A;  1P1Q A;  3OEM A;  3VXC A;  3PPO A;  5KDT B;  4H8J A;  4DZ1 A;  4PFU A;  3CFX A;  5H8H A;  3B6Q A;  1A55 A;  4G8H A;  5H8S A;  5DYH A;  2F5X A;  2DS9 A;  4F2O A;  4XKR A;  2Y7K A;  4NF6 B;  2NWJ A;  3L6G A;  2DXY A;  3TDJ A;  1B0L A;  4NF8 B;  2XXH A;  4RPO A;  5JEI A;  3OSR A;  3Q27 A;  4TLM B;  3H7M A;  5DVJ A;  5ITO A;  5I2N B;  4X1D A;  3D4C A;  3SKP A;  3TPA A;  3A3C A;  3I6V A;  1NL5 A;  1UTB B;  3OSQ A;  4F1U A;  3E13 X;  4LAT A;  2NUV A;  3OOA A;  3I3V A;  3PMV A;  1MPC A;  3I5O A;  1FQA A;  5I58 A;  5EHM A;  3DLN A;  3H6V A;  1AMF A;  3QSL A;  3TQL A;  1P1N A;  2ZYM A;  3ZS6 A;  1USY E;  4H6D A;  1Y20 A;  5I84 A;  4YKJ A;  1LBC A;  4YZZ A;  3TYH A;  3MQ9 A;  3A09 A;  5L9O A;  4JSD A;  4DE8 A;  4KYS A;  1B3L A;  1ZMG A;  3PPQ A;  4RNS A;  4R75 A;  1I6B A;  1QKB A;  1US4 A;  3SDF A;  4DCX A;  1VFD A;  4IO5 A;  3KJ7 A;  4FJP A;  1B40 A;  2ONR A;  3UA8 A;  4OEV A;  3EHS A;  1EZP A;  2Y7W A;  1MY2 A;  2DWI A;  1ZU0 A;  4G77 A;  4G8N A;  4F1Y A;  3N6U A;  4HCW A;  5I2K A;  2ZNT A;  2I4B A;  2YJP A;  3N6T A;  1OMP A;  3LSL A;  2VD3 A;  4RY1 A;  4DXC A;  4RPN A;  3EHT A;  1A54 A;  3FVN A;  2A5T A;  1XS5 A;  1ANF A;  5I58 B;  1Y9U A;  1GGG A;  1H43 A;  1LBB A;  1TFD A;  3RTW B;  3ECR A;  4C1T A;  2RCA A;  3K2D A;  3TCG A;  3CSB A;  3DP4 A;  2XXT A;  3LBS A;  3VFJ A;  4H65 A;  4NE4 A;  2DE3 A;  1QUI A;  1ZKB A;  4U4X A;  4I9D A;  1B4Z A;  2HXW A;  1A99 A;  3M3F A;  1S9T A;  1P1U A;  5J1D A;  1FTJ A;  5AA2 A;  1FW0 A;  2ZMB A;  2I4C A;  3HV1 A;  3IOU A;  4R9F A;  4GXS B;  1JW5 A;  2ONK E;  4G8M A;  4QFP A;  1H45 A;  4F2Q A;  1NMU A;  3O28 A;  3KN7 A;  5DEX A;  3V5A A;  3QXM A;  5CBS A;  5I2K B;  3MVZ A;  1POT A;  3MVX A;  1B5J A;  1PB9 A;  4E0W A;  1BKA A;  3O6G A;  4F3S A;  3Q26 A;  3FJ7 A;  3PGF A;  2I6E A;  5L9S A;  4NMY A;  1SVX B;  4RJZ A;  1HSJ A;  4KHZ E;  2O68 A;  2QMW A;  2XHD A;  1PC3 A;  2ZYN A;  1D9Y A;  2XXV A;  1B5H A;  2RC7 A;  2RC9 A;  2I3V A;  4H8I A;  3DP6 A;  3LSW A;  4BDQ A;  3IB2 A;  4LA9 A;  1MDQ A;  4ZE9 A;  1CE2 A;  5HM4 B;  1B46 A;  3OEL A;  1T0K A;  2ZYO A;  4YB6 A;  1FQB A;  5AA2 B;  5A5X B;  2HEU A;  4JB7 A;  5TPA A;  5ELV A;  3ODB A;  1XHY A;  1POY 1;  1XC1 A;  2XXW A;  5K2X A;  4G68 B;  1MXY A;  2THI A;  4N13 A;  4GOT A;  3KSJ A;  4OYV A;  2X26 A;  3DEL B;  3KJT A;  4LQ5 A;  4IO4 A;  3SEW A;  1JNF A;  1OIB A;  3FVO A;  5ICT A;  3T93 B;  4NF4 A;  2Q2A A;  3IR1 A;  3PPR A;  4ZEB A;  1IUD A;  3ONM A;  1I69 A;  3VLW A;  4WED A;  2GRV A;  4EQ7 A;  3CSG A;  5TPA B;  2GH9 A;  1Y1Z A;  3TKD A;  1DTZ A;  1MXX A;  4ZE8 A;  3IOV A;  3C4M A;  1PBP A;  1M5F A;  2XX8 A;  5I59 A;  4H0W A;  4NF5 B;  4IGR A;  4E0X A;  3U8Q A;  3IX1 A;  1MS7 A;  4PFT A;  1A8F A;  1Y3N A;  1BP5 A;  1TFA A;  4DIG A;  3F11 A;  1LB9 A;  1O63 A;  3OO6 A;  3IO6 A;  2XD3 A;  4LZ7 A;  3ZKK A;  4JSO A;  4IO2 A;  2V3U A;  2QS1 A;  1QVS A;  2E0S A;  3FVK A;  1B4H A;  5ICQ A;  3C9H A;  4XTC Q;  2CMO A;  1IIT A;  4OMB A;  2G93 A;  3ZKL A;  2IA4 A;  2H5Y A;  3W9W A;  4MBP A;  4ZS9 A;  2DSF A;  3TCH A;  3IJO B;  1UIU A;  2AL4 A;  3KBR A;  2HAU A;  1FTL A;  2Z8E A;  1B3H A;  3C32 A;  3DP8 A;  3RT8 A;  3G3J A;  2M8C A;  1RYX A;  3T22 A;  4LVQ A;  3V89 B;  2Z22 A;  3S2V A;  2W7Y A;  1H3D A;  3PUZ E;  2DWJ A;  5H8F A;  2O6A A;  4OXV A;  4ELP A;  1URS A;  3FJM A;  4P0G A;  1JET A;  5ITP A;  2R71 A;  4MLV A;  4ZEI A;  1B58 A;  3THI A;  3TAJ A;  3IO4 A;  4PFY A;  1IXI A;  4OFL A;  1RYO A;  4AB5 A;  1LAF E;  3T9X B;  1O7T A;  2V25 A;  4U21 A;  1Q35 A;  4ZDM A;  1R1N A;  4ZED A;  3K00 A;  2B65 A;  4OEU A;  3TTR A;  3KN8 A;  3EN3 A;  1YTV A;  1OLA A;  3AXF A;  3MZ9 A;  4AQ4 A;  4O3C A;  1MDP 1;  4JBZ A;  2R6G E;  3CIJ A;  5JK4 A;  2F36 A;  3SES A;  3LUY A;  2UVJ A;  4DLD A;  5AA2 D;  3K6X A;  1YPN A;  1NNF A;  1MY3 A;  3VVD A;  4KPT A;  2YPN A;  2Z23 A;  1SDX A;  3RTF B;  4FEC A;  3PD9 A;  2F6G A;  2LAO A;  3PUV E;  3E9X A;  3VDF A;  4GXA A;  1Y3Q A;  2QS3 A;  1EH3 A;  2D21 A;  3S9M C;  3T9H B;  1XVY A;  2NOO A;  1N7W A;  4GWO A;  1LST A;  4YKP A;  4IGT A;  1YAE A;  2PT1 A;  5CMM A;  1MG1 A;  4P0I A;  2I0C A;  2H9B A;  2OJT A;  1SBP A;  1SD3 A;  3T96 B;  3TZA A;  2O1M A;  4YU0 A;  3IB0 A;  2P1S A;  1EU8 A;  2OWT A;  5IKB A;  1P99 A;  3IOR A;  1O64 A;  4EXL A;  5DTB A;  5TU0 A;  5DVI A;  4YMA A;  2ONS A;  3HHG A;  3BFT A;  1P1W A;  2NXO A;  3BFU A;  4ESW A;  3G7W A;  3WAF A;  1L5T A;  1B7Z A;  3N94 A;  3OMB A;  3SET A;  3IK6 B;  1MY4 A;  1VE4 A;  4R6K A;  1URD A;  1AH5 A;  3FV2 A;  1GR2 A;  2F34 A;  1MXU A;  5I57 A;  2F7C A;  1SYH A;  4NWD A;  2PX1 A;  2I49 A;  3QUF A;  5F7V A;  3E4R A;  5H8N A;  2YLN A;  4ECF A;  3K4U A;  5H8H B;  1H76 A;  3ZSF A;  2E1S A;  3FIR A;  2UYF A;  3RPW A;  3IOW A;  2Q88 A;  3W15 C;  1M5D A;  2UYE A;  1YCJ A;  4R72 A;  2ZXT A;  1M5C A;  3FAS A;  3JYR A;  3TEL A;  4U4S A;  3S4U A;  3CR9 A;  4F1V A;  4F19 A;  1LFG A;  1J1N A;  3K6W A;  2RKM A;  4H5F A;  1OVB A;  2HQ0 A;  3QIM A;  3UGW A;  2PMS A;  2DE2 A;  4GIZ A;  4LQ2 A;  1GTK A;  4N07 A;  2AIX A;  4F29 A;  3VV5 A;  2HFB A;  4IB2 A;  3QK6 A;  1NH7 A;  5AE4 A;  1LAG E;  1NKX A;  4ELO A;  3K6U A;  4LP2 B;  4FIM A;  1BLF A;  2I0B A;  3EF7 A;  3G3I A;  4QFN A;  3UOR A;  1GVC A;  4YB7 A;  3O6H A;  1KWH A;  2O7I A;  3OEK A;  5CMC A;  4M4G A;  3BKI B;  4WKM A;  5I56 A;  4LON B;  4KD5 A;  3SEU A;  3MP1 A;  3Q29 A;  5CMK A;  1JVY A;  1PEB A;  4IO7 A;  1SYI A;  1NFT A;  5CC2 A;  3CG3 A;  4XXU A;  1ZLQ A;  1N3X A;  4R6H A;  4U23 A;  4ZEF A;  4R74 A;  1US5 A;  3RQT A;  3MW0 A;  2XXI A;  3OO7 A;  3FV1 A;  2A5T B;  4MH5 A;  2Q89 A;  3H4Z A;  3S9N C;  3VE1 B;  3M8U A;  4GVO A;  3B6T A;  4TLL B;  3K1N A;  4IO6 A;  4KQP A;  1M5E A;  1LCF A;  2D5W A;  4LZ8 A;  1XVX A;  2ZYK A;  4FAJ A;  3C33 A;  1F9B A;  2QS2 A;  3K1M A;  2P0S A;  2Z8D A;  2VP1 A;  4Q5T A;  2RC8 A;  2DOJ A;  4IO3 A;  3MVW A;  1JW4 A;  4IY5 A;  5JTY A;  2XX7 A;  5I56 B;  1N04 A;  2O51 A;  2QSX A;  1B3E A;  3KG2 A;  3TTM A;  4XIG Q;  3Q28 A;  3GZG A;  5DEX B;  4BDR A;  5B70 A;  4QSE A;  1NNP A;  2F6P A;  2B3F A;  2AYS A;  4JDF A;  2Z8F A;  1OQH A;  1HSE A;  2ESN A;  2XX9 A;  2VGQ A;  4OVJ A;  3TOD A;  3UP9 A;  4NTL A;  3H6T A;  2V93 A;  1H44 A;  3PPP A;  5KCJ A;  4JXI A;  1QJM A;  4EUO A;  1MQI A;  2G29 A;  4DDD A;  4TOZ A;  2PVU A;  4KI0 E;  3L6H A;  4FAT A;  3OEN A;  4KYD A;  1IIW A;  4BDO A;  4I8C A;  1JEV A;  3FXR A;  1XOC A;  3CFL A;  1B0H A;  1VSO A;  2VD2 A;  1N84 A;  3G3G A;  2DWH A;  2OK2 A;  3LSX A;  5AA3 A;  3PPN A;  1FTM A;  2GFE A;  3RGY A;  2QMX A;  4O3A A;  4YB5 A;  1FQE A;  4RA1 A;  3N26 A;  1LFI A;  4OWD A;  1SW2 A;  4DXU A;  4Q30 B;  4OFJ A;  4FE8 A;  1I6Q A;  2HZK A;  1MQJ A;  3GLB A;  5FHM A;  3PMX A;  3PUW E;  4YKI A;  1OLC A;  4OEN A;  3LR1 A;  4R2F A;  4LZ5 A;  1B9J A;  2OLB A;  5FTI A;  3FXQ A;  1FQF A;  4NF4 B;  2DP8 A;  5KCJ B;  3TTL A;  3IJX B;  1B7H A;  3WAE A;  5EHS A;  4ELQ A;  2XD2 A;  1MXV A;  4I62 A;  3MAM A;  1A8E A;  4THI A;  3VVE A;  3K1P A;  3N5L A;  1BTJ A;  1OVT A;  2Y7I A;  2X7P A;  4Z0I A;  3H03 A;  1FTK A;  2UXA A;  4POX A;  3TTN A;  3KSX A;  3O66 A;  5I59 B;  1R9L A;  4JWX A;  3UIF A;  3MJN A;  3TFL A;  4GRK A;  3IL1 B;  3RLF E;  3EHU A;  3RUM A;  3H6W A;  2PYY A;  4UA8 A;  1QW0 A;  4QF9 A;  1I6A A;  2HAV A;  4EQ9 A;  1B3G A;  2A5S A;  4IY6 A;  2ABH A;  4OTE A;  3R6U A;  4NWC A;  5HPQ A;  4XKN A;  1LAH E;  3PV0 E;  3KFM A;  1B1H A;  2ZNU A;  4ZZA A;  5DVF A;  4P11 A;  4KCC A;  3TTK A;  3PD8 A;  4KCD A;  3V8X B;  3GBB A;  2F7A A;  3OO8 A;  1MQD A;  4POW A;  3KOT A;  1QKA A;  5IAI A;  1Y3P A;  2AL5 A;  2BJJ X;  4H5G A;  4EXK A;  2QRY A;  3O97 A;  2UVI A;  2ZNS A;  4HCY A;  5CBR A;  3T66 A;  2XXY A;  2FYI A;  1MH3 A;  2I48 A;  4FEB A;  3P7I A;  4PE5 B;  4F39 A;  2XXP A;  3K02 A;  2XXU A;  1JQF A;  2F7B A;  2RF1 A;  1MXZ A;  1MM6 A;  5H8F B;  1USY H;  3C31 A;  5ISU A;  3RT6 B;  4GFR A;  2UVG A;  5KZT A;  4PET A;  3IB1 A;  4U1O A;  1UTH A;  1D9V A;  3HHF A;  1JVX A;  3HST A;  2CZL A;  3MPL A;  3G3K A;  4HW8 A;  3UK4 A;  1UTB A;  3OO9 A;  1URG A;  3GXA A;  2KLF A;  3K6V A;  4G68 C;  1Z7N E;  4EF1 A;  1P1O A;  3PUX E;  1SI1 A;  4AB6 A;  4L17 A;  3EQ1 A;  2PBW A;  3O9P A;  4F18 A;  3KOS A;  1LFH A;  3A3U A;  4MF3 A;  5TP9 A;  3B7D A;  2X7Q A;  4BDL A;  1MM7 A;  2GHB A;  4ND9 A;  3MP6 A;  3K01 A;  1SQY A;  1AOV A;  1R9Q A;  2F97 A;  1Q1K A;  3MZ1 A;  2H25 A;  3S9E A;  3C36 A;  1A7L A;  4R2B A;  3T9V A;  1Y4T A;  3PU5 A;  3C34 A;  4ONY A;  3BBR A;  4LUB A;  1D4N A;  1UTH B;  4ZZE A;  4R9G A;  5CM6 A;  3LSF B;  2O69 A;  4PQJ A;  3OXN A;  4Q8R A;  2Q9T A;  4KFQ A;  3VLV A;  1N3W A;  4YMB A;  2V84 A;  3MPK A;  4C1U A;  4JWY A;  5H8Q A;  2ALU A;  4U2R A;  4QSC A;  3CVG A;  4KR5 A;  4ESX A;  1SW4 A;  1PB7 A;  5CMB A;  1MY1 A;  3FZV A;  4ELR A;  5TP9 B;  3CI8 A;  3MVY A;  1DPP A;  3W9V A;  4GLI A;  3QUJ A;  2V3T A;  2O84 X;  1HSL A;  1MPD A;  5EYF A;  1QUL A;  5F1Q A;  4EF2 A;  2VOZ A;  2HZL A;  1B7U A;  3VLU A;  1SW5 A;  2Y84 A;  1UQW A;  1MH4 A;  1B51 A;  1B2H A;  4YKK A;  4F31 B;  5B7D A;  4N6P A;  3MBP A;  2P2A A;  3TCF A;  2REJ A;  3V83 A;  5L9M A;  4ZEK A;  3JV9 A;  3RN8 A;  2I3W A;  5I57 B;  1SI0 A;  3KN3 A;  4OFO A; 
#chains in the Genus database with same CATH topology
 2OBG A;  1Y1M A;  2O1L A;  4X04 A;  5H8N B;  4GQO A;  5K2Y A;  3QYT A;  3VVF A;  3U65 A;  1B3F A;  5H8Q B;  3TUS A;  2DVZ A;  1M5B A;  2WKY A;  2HCA A;  2DQV A;  4PP0 A;  1B32 A;  1SW1 A;  4F3G A;  1DMB A;  1II5 A;  1IXC A;  4OET A;  4G4P A;  3JZJ A;  1DPE A;  2HXR A;  4P1E A;  4GWS A;  1FCK A;  4EQB A;  1WOD A;  1JEU A;  3G3H A;  1ZTY A;  2QVR A;  4QRZ A;  2Q8J A;  3M3K A;  4DXB A;  3MUQ A;  3E78 A;  1PBQ A;  1N7X A;  1GV8 A;  5CI5 A;  3O2A A;  4HTG A;  3EPE A;  1FTO A;  5A5X A;  4N6D A;  3H3G A;  4RK9 A;  3KZG A;  5L8D A;  4NF0 A;  3H06 B;  1FJ9 A;  2XXX A;  4G68 A;  2OZZ A;  4P8B A;  3U93 A;  2WYK A;  4F3P A;  2GHA A;  1WVJ A;  3HCQ A;  5FHO A;  3QMF A;  2Y7R A;  4NGU A;  1TWY A;  3B6W A;  4X1B A;  4QFL A;  1LCT A;  1R6Z A;  3RY3 A;  1QUK A;  3GYY A;  2REG A;  3MC2 A;  3B50 A;  3O29 A;  1CB6 A;  5DT6 A;  2OWS A;  4OAN A;  4U1Z A;  2QL3 A;  3Q25 A;  2DVC A;  2DXR A;  4AS4 A;  4F22 A;  3C35 A;  4GL0 A;  1FPG A;  4YAH X;  2ZZV A;  4H67 A;  3T9U A;  2CZI A;  5FTH A;  1LLS A;  5AA4 A;  2R9J A;  1FBH A;  1NH8 A;  1IXH A;  1YYZ A;  3MWB A;  3DM0 A;  4PAK A;  3ILT B;  4JWO A;  3FBP A;  3HO7 A;  3SEV A;  3R26 A;  3D4G A;  4QSD A;  2RIN A;  1MY0 A;  4O3B A;  3K0V A;  4NF5 A;  2XXQ A;  2H98 A;  3FAT A;  4GL8 A;  2FHY A;  5HBC A;  2RCB A;  3TMG A;  1KA1 A;  3PMW A;  4FED A;  3ILU B;  2Q8M A;  1QUJ A;  2D3I A;  4WXJ A;  1B6H A;  3U72 A;  3LC8 A;  2H99 A;  3FUZ A;  2WBD A;  3SEY A;  2F78 A;  2VT5 A;  4ZEC A;  2VPO A;  1D3K A;  4RYA A;  5JTY B;  5BWJ A;  1MRP A;  2OCU A;  3FGS A;  5AA4 B;  4DCY A;  4HS7 A;  4OZ9 A;  3CG1 A;  3T1B A;  4PAI A;  2F35 A;  1FBE A;  1N0T A;  2QS4 A;  3E3K A;  4Z7E A;  5AA1 A;  1BK4 A;  1S50 A;  3G3F A;  2IEE A;  4JVI A;  1RKM A;  1BIY A;  2DYX A;  4C0R A;  1ZJL A;  4QHQ A;  4O7M A;  1JW1 A;  2UVH A;  3U92 A;  3TEP A;  3R7X A;  2FIE A;  2XWK A;  3S9L C;  3O6I A;  2O7U A;  3A29 A;  3PUY E;  3H6U A;  1MQG A;  3HN0 A;  1Z7M E;  4F3B A;  2KR0 A;  2Y7P A;  4WEP A;  3HPI A;  1TXF A;  3SEX A;  4GF8 A;  2DE4 A;  4YIC A;  3M3L A;  1AIV A;  1WDN A;  4OA4 A;  2F8D A;  1PB8 A;  1DTG A;  1FJ6 A;  1DOT A;  3MZB A;  2XA5 A;  2ANJ A;  2V3Q A;  1IQ7 A;  1EZ9 A;  4EDP A;  1TT1 A;  2B3B A;  3FXB A;  1UIV A;  4GWX A;  4XKP A;  1MPB A;  4X48 A;  3FD3 A;  4OHN A;  1IEJ A;  4MFI A;  4BLA A;  5I3S A;  4TQU Q;  3KEI A;  3UN6 A;  4PC9 A;  4PFW A;  2XWO A;  1N76 A;  3SER A;  5FHN A;  2FBP A;  3FVG A;  4BDN A;  1B52 A;  4PF8 A;  3CFZ A;  1LGB C;  3VXB A;  1ATG A;  3RNN A;  4X9T A;  4HE1 A;  1B5I A;  5LOM A;  2H4I A;  2QVV A;  1ZIU A;  4PAF A;  5IZZ A;  2FNC A;  4MLQ A;  3OD7 A;  2XXR A;  4I1D A;  3ROJ A;  1VR5 A;  1QGX A;  3IOT A;  4BDM A;  1A40 A;  1NNK A;  2QPQ A;  4KYE A;  4UAC A;  1MXW A;  3U94 A;  4PTK A;  3E79 A;  5KDT A;  1XT8 A;  3MP8 A;  1RDY A;  1EZO A;  1NUZ A;  1S7Y A;  4MNI A;  4NED A;  1B1X A;  3KGC A;  5ESY A;  4R6Y A;  1IMF A;  2DWA A;  4JVD A;  5BUU A;  4Q0C A;  1Y4C A;  2Q2C A;  3IAZ A;  4R73 A;  1NV6 A;  4RXL A;  1LB8 A;  4G2Z A;  1OQG A;  2NVU B;  3LUZ A;  3FJG A;  2WX9 A;  1IMD A;  1ELJ A;  4NF6 A;  1VFE A;  1PDA A;  4XKQ A;  1MQH A;  4FOR A;  3KC1 A;  5M2V A;  4QFK A;  1DSN A;  2FA7 A;  2PT2 A;  1AL3 A;  1FQD A;  4NF8 A;  4OQO A;  4RK2 A;  4ISU A;  4GD5 A;  3QAX A;  1IZ1 A;  3USD A;  1ZBM A;  1IXG A;  5CRY A;  1FQC A;  3FXU A;  5I2N A;  3CRB A;  2QJE A;  4M1V A;  3U1O A;  4OES A;  4OER A;  1LAX A;  1DK4 A;  3GBA A;  1NV1 A;  4U22 A;  4QFO A;  3CHG A;  4H1X A;  2I58 A;  2VHA A;  1B05 A;  1NNT A;  4O94 A;  4K3F A;  3TQW A;  1P1Q A;  1XI6 A;  1LBX A;  3OEM A;  3VXC A;  3PPO A;  5KDT B;  4H8J A;  4HE0 A;  4DZ1 A;  4PFU A;  3SZP A;  3CFX A;  4NQ8 A;  5H8H A;  3B6Q A;  4NHB A;  1A55 A;  4G8H A;  3T0J A;  5H8S A;  5DYH A;  2F5X A;  2DS9 A;  4F2O A;  4XKR A;  2Y7K A;  4NF6 B;  3PTY A;  2NWJ A;  3L6G A;  2DXY A;  3TDJ A;  1B0L A;  4NF8 B;  2XXH A;  2KQZ A;  4RPO A;  5JEI A;  3OSR A;  3Q27 A;  4TLM B;  3H7M A;  1AWB A;  5DVJ A;  5ITO A;  5I2N B;  4X1D A;  3D4C A;  3NOH A;  4FBP A;  4OVQ A;  3SKP A;  3TPA A;  3A3C A;  3I6V A;  1NL5 A;  1UTB B;  3OSQ A;  4F1U A;  3E13 X;  4LAT A;  2NUV A;  3OOA A;  4N4U A;  3I3V A;  3PMV A;  1MPC A;  3I5O A;  1FQA A;  5I58 A;  5EHM A;  3DLN A;  3H6V A;  1AMF A;  3QSL A;  3TQL A;  1P1N A;  4X8R A;  2ZYM A;  3ZS6 A;  3EKI A;  1USY E;  4H6D A;  1Y20 A;  5I84 A;  4YKJ A;  1LBC A;  4YZZ A;  3TYH A;  3MQ9 A;  3A09 A;  5L9O A;  4JSD A;  4DE8 A;  1KZ8 A;  4KYS A;  5IZ1 A;  1B3L A;  1ZMG A;  4MIJ A;  3PPQ A;  4RNS A;  4R75 A;  1I6B A;  1QKB A;  1US4 A;  3SDF A;  2WBB A;  4DCX A;  1VFD A;  4IO5 A;  3KJ7 A;  4FJP A;  1B40 A;  2ONR A;  4GWW A;  1YZ0 A;  3UA8 A;  2ZZW A;  4OEV A;  3EHS A;  1EZP A;  2Y7W A;  1MY2 A;  4N17 A;  1LBY A;  2DWI A;  1ZU0 A;  4G77 A;  4G8N A;  4F1Y A;  3N6U A;  4HCW A;  5I2K A;  2ZNT A;  2I4B A;  1FTA A;  2YJP A;  3N6T A;  1OMP A;  3LSL A;  5EYG A;  2VD3 A;  4RY1 A;  4DXC A;  4RPN A;  3EHT A;  1A54 A;  3FVN A;  2A5T A;  1XS5 A;  1ANF A;  5I58 B;  5LDZ A;  1Y9U A;  1GGG A;  3BIH A;  1H43 A;  1LBB A;  1TFD A;  3RTW B;  3ECR A;  4P47 A;  2RCA A;  4GWY A;  4C1T A;  1YXI A;  3K2D A;  3TCG A;  3CSB A;  3DP4 A;  2XXT A;  3LBS A;  3VFJ A;  4H65 A;  4NE4 A;  2DE3 A;  1QUI A;  1ZKB A;  4U4X A;  4I9D A;  1B4Z A;  2HXW A;  1A99 A;  3M3F A;  5IZ3 B;  1S9T A;  1P1U A;  5J1D A;  5F24 A;  1FTJ A;  5AA2 A;  1FW0 A;  2ZMB A;  3IFA A;  2I4C A;  3HV1 A;  3IOU A;  4R9F A;  4GXS B;  1JW5 A;  2ONK E;  4G8M A;  4QFP A;  1H45 A;  4F2Q A;  1NMU A;  3RYD A;  3O28 A;  3KN7 A;  5DEX A;  3V5A A;  3QXM A;  5CBS A;  5I2K B;  3MVZ A;  1POT A;  1IMA A;  3MVX A;  1B5J A;  1PB9 A;  1NUX A;  1BKA A;  3O6G A;  4E0W A;  4F3S A;  3Q26 A;  3FJ7 A;  3PGF A;  4P56 A;  2I6E A;  5L9S A;  2MKZ A;  4NMY A;  4XEQ A;  1SVX B;  4RJZ A;  4MCO A;  4MNP A;  1HSJ A;  4KHZ E;  2O68 A;  2QMW A;  2XHD A;  1PC3 A;  2ZYN A;  1D9Y A;  2XXV A;  1B5H A;  2RC7 A;  2RC9 A;  2I3V A;  4H8I A;  3DP6 A;  3LSW A;  4BDQ A;  3IB2 A;  4LA9 A;  1MDQ A;  4ZE9 A;  1CE2 A;  5HM4 B;  1B46 A;  3OEL A;  1T0K A;  2ZYO A;  4YB6 A;  1FQB A;  5AA2 B;  5A5X B;  2XWI A;  5FBP A;  2HEU A;  4JB7 A;  5TPA A;  5ELV A;  3ODB A;  1XHY A;  1EYK A;  1POY 1;  1XC1 A;  2XXW A;  5K2X A;  4G68 B;  4MX6 A;  1MXY A;  2THI A;  4N13 A;  4GOT A;  3KSJ A;  1KA0 A;  4OYV A;  4OVT A;  1LEV A;  2X26 A;  3DEL B;  1JP4 A;  1FPJ A;  3KJT A;  4LQ5 A;  4IO4 A;  3SEW A;  1DCU A;  1JNF A;  1OIB A;  3FVO A;  4GWZ A;  5ICT A;  3T93 B;  4N6K A;  4NF4 A;  2Q2A A;  3IR1 A;  2PCR A;  3PPR A;  4ZEB A;  1IUD A;  1EYI A;  3ONM A;  1I69 A;  3VLW A;  1FPL A;  4WED A;  2GRV A;  4EQ7 A;  3CSG A;  5TPA B;  2GH9 A;  1Y1Z A;  3TKD A;  1DTZ A;  1MXX A;  4ZE8 A;  3IOV A;  4GWU A;  3C4M A;  1PBP A;  1M5F A;  2XX8 A;  4GBV A;  2Q74 A;  5I59 A;  4H0W A;  4NF5 B;  4IGR A;  4E0X A;  3U8Q A;  3IX1 A;  5ET6 A;  1MS7 A;  4PFT A;  2Y5K A;  4OVS A;  1A8F A;  1Y3N A;  1BP5 A;  1TFA A;  4DIG A;  3F11 A;  1NV7 A;  4UAB A;  1LB9 A;  1O63 A;  3OO6 A;  3IO6 A;  2XD3 A;  4LZ7 A;  3ZKK A;  4JSO A;  4IO2 A;  2V3U A;  2QS1 A;  1QVS A;  2E0S A;  3FVK A;  1B4H A;  2P3N A;  4MHF A;  5ICQ A;  3C9H A;  4XTC Q;  1CNQ A;  2WYP A;  2CMO A;  1IIT A;  4OMB A;  2G93 A;  3ZKL A;  2IA4 A;  4NX1 A;  2FIX A;  2H5Y A;  3W9W A;  1FPE A;  4MBP A;  4ZS9 A;  2DSF A;  3TCH A;  3IJO B;  1UIU A;  2AL4 A;  3KBR A;  2HAU A;  1FTL A;  5T3J A;  2Z8E A;  1B3H A;  4LN5 A;  3C32 A;  4PE3 A;  3DP8 A;  3RT8 A;  4QBA A;  2B4M A;  3G3J A;  4NG7 A;  2M8C A;  1RYX A;  3T22 A;  4LVQ A;  3V89 B;  2Z22 A;  3BIG A;  3S2V A;  2W7Y A;  1IMC A;  1H3D A;  3PUZ E;  2DWJ A;  5H8F A;  2O6A A;  4OXV A;  4ELP A;  1URS A;  1NUY A;  3FJM A;  4G61 A;  4P0G A;  1JET A;  5ITP A;  1LBV A;  2R71 A;  2OX3 A;  4MLV A;  4I40 A;  4ZEI A;  1B58 A;  3THI A;  2VPN A;  3TAJ A;  3IO4 A;  4PFY A;  1IXI A;  4QXD A;  4OFL A;  1RYO A;  4AB5 A;  1LAF E;  3T9X B;  1O7T A;  2V25 A;  3LV0 A;  4U21 A;  4PFR A;  1Q35 A;  4ZDM A;  1R1N A;  4ZED A;  3K00 A;  2B65 A;  4OEU A;  3TTR A;  3KN8 A;  3EN3 A;  1YTV A;  1OLA A;  3D1R A;  3KBZ A;  3AXF A;  3MZ9 A;  4AQ4 A;  4GX6 A;  4O3C A;  1MDP 1;  4JBZ A;  2R6G E;  2P3V A;  3RPL A;  3CIJ A;  5JK4 A;  4GX3 A;  2F36 A;  3SES A;  4MNC A;  4XF5 A;  3LUY A;  2UVJ A;  4DLD A;  5AA2 D;  3K6X A;  1YPN A;  1NNF A;  1MY3 A;  3VVD A;  4KPT A;  2HHM A;  2YPN A;  2Z23 A;  1SDX A;  3RTF B;  1FPF A;  4FEC A;  3PD9 A;  2F6G A;  2LAO A;  3PUV E;  3E9X A;  3VDF A;  4GXA A;  1Y3Q A;  2QS3 A;  1EH3 A;  2D21 A;  3S9M C;  3T9H B;  1XVY A;  2F3D A;  2FVZ A;  4PGN A;  2NOO A;  1N7W A;  4GWO A;  1LST A;  2Y5L A;  4YKP A;  4IGT A;  1YAE A;  2PT1 A;  5CMM A;  4OVR A;  1MG1 A;  4P0I A;  2I0C A;  2H9B A;  2OJT A;  1SBP A;  1SD3 A;  3T96 B;  3TZA A;  2O1M A;  4YU0 A;  3IB0 A;  1EYJ A;  2P1S A;  1EU8 A;  2OWT A;  5IKB A;  1P99 A;  3IOR A;  1O64 A;  4EXL A;  5I7I A;  3RPL B;  5DTB A;  5TU0 A;  5DVI A;  4YMA A;  2ONS A;  1FPB A;  3HHG A;  3BFT A;  4MMP A;  1P1W A;  2NXO A;  3BFU A;  1IMB A;  4ESW A;  3G7W A;  3WAF A;  1L5T A;  1B7Z A;  3N94 A;  3OMB A;  3SET A;  3IK6 B;  1MY4 A;  1VE4 A;  4R6K A;  1URD A;  1AH5 A;  3IFC A;  3B8B A;  3FV2 A;  1GR2 A;  1FBF A;  2F34 A;  1MXU A;  5I57 A;  2F7C A;  4PFI A;  1SYH A;  4NWD A;  2PX1 A;  2I49 A;  3QUF A;  4O8M A;  5F7V A;  3E4R A;  5H8N A;  4P1L A;  2YLN A;  4ECF A;  3K4U A;  2GQ1 A;  5H8H B;  1H76 A;  3ZSF A;  2E1S A;  4NN3 A;  3FIR A;  2UYF A;  3RPW A;  3IOW A;  2Q88 A;  3W15 C;  1M5D A;  2UYE A;  1YCJ A;  4R72 A;  2ZXT A;  1M5C A;  3FAS A;  3JYR A;  3TEL A;  4U4S A;  3S4U A;  3CR9 A;  4F1V A;  4F19 A;  1LFG A;  4PBH A;  1J1N A;  3K6W A;  4H46 A;  2RKM A;  4H5F A;  1OVB A;  1RDZ A;  2HQ0 A;  4KXP A;  3QIM A;  4PBQ A;  3UGW A;  1NV3 A;  2PMS A;  2DE2 A;  4GIZ A;  4LQ2 A;  1GTK A;  4I3E A;  4N07 A;  2AIX A;  4F29 A;  2DDK A;  4AS5 A;  3VV5 A;  2HFB A;  4IB2 A;  3QK6 A;  1NH7 A;  5AE4 A;  1LAG E;  1NKX A;  4ELO A;  5EQ8 A;  3K6U A;  4LP2 B;  4FIM A;  4N15 A;  1BLF A;  2I0B A;  3EF7 A;  3G3I A;  4QFN A;  3UOR A;  1GVC A;  4YB7 A;  3O6H A;  1KWH A;  2O7I A;  3HFU A;  3OEK A;  4PGP A;  5CMC A;  2JJK A;  4M4G A;  5ET7 A;  3BKI B;  4WKM A;  3MST A;  5I56 A;  4LON B;  2V4C A;  4KD5 A;  3SEU A;  3MP1 A;  3Q29 A;  5CMK A;  1JVY A;  1PEB A;  4IO7 A;  1SYI A;  4N81 A;  1NFT A;  5CC2 A;  3CG3 A;  2F3B A;  5IGA A;  4XXU A;  1ZLQ A;  2CZK A;  2OWZ A;  1N3X A;  4R6H A;  4U23 A;  4ZEF A;  4R74 A;  1US5 A;  3RQT A;  3MW0 A;  2XXI A;  3OO7 A;  1IME A;  3FV1 A;  2A5T B;  4MH5 A;  2Q89 A;  3H4Z A;  3S9N C;  3VE1 B;  3M8U A;  4GVO A;  3B6T A;  4HXV A;  4TLL B;  3K1N A;  5J16 A;  4KQP A;  4IO6 A;  1M5E A;  1LCF A;  2D5W A;  2XXK A;  4GBW A;  4LZ8 A;  1XVX A;  4PCD A;  2ZYK A;  4FAJ A;  2XWV A;  3C33 A;  1F9B A;  1D9Q A;  1G0I A;  2QS2 A;  1NV2 A;  3K1M A;  2BJI A;  2P0S A;  2Z8D A;  2VP1 A;  4Q5T A;  2RC8 A;  2DOJ A;  4IO3 A;  3MVW A;  1JW4 A;  4IY5 A;  5JTY A;  2XX7 A;  5I56 B;  2WEF A;  1N04 A;  2O51 A;  2QSX A;  4P3L A;  1B3E A;  3KG2 A;  5EQ7 A;  3TTM A;  4XIG Q;  3Q28 A;  3GZG A;  5DEX B;  4BDR A;  5B70 A;  1NV0 A;  4QSE A;  1FPI A;  5I5P A;  1NNP A;  2F6P A;  5IM2 A;  2B3F A;  2AYS A;  4JDF A;  2Z8F A;  1OQH A;  1HSE A;  1FSA A;  2ESN A;  2XX9 A;  2VGQ A;  4OVJ A;  3TOD A;  3UP9 A;  4NTL A;  3H6T A;  1NI9 A;  2V93 A;  1H44 A;  3PPP A;  5KCJ A;  4JXI A;  1QJM A;  4EUO A;  1MQI A;  2G29 A;  4DDD A;  4TOZ A;  2PVU A;  4KI0 E;  3L6H A;  4FAT A;  3OEN A;  4PFB A;  4KYD A;  1IIW A;  4BDO A;  4I8C A;  1JEV A;  3FXR A;  1XOC A;  3CFL A;  1B0H A;  1VSO A;  2VD2 A;  1N84 A;  3G3G A;  2DWH A;  2OK2 A;  3LSX A;  5AA3 A;  3PPN A;  1FTM A;  2GFE A;  3RGY A;  2QMX A;  4O3A A;  4YB5 A;  4RA1 A;  1FQE A;  3N26 A;  1LFI A;  4OWD A;  1SW2 A;  4DXU A;  4Q30 B;  4OFJ A;  4FE8 A;  1I6Q A;  2HZK A;  1FBG A;  5A5L A;  1MQJ A;  3GLB A;  4N91 A;  5FHM A;  3PMX A;  3PUW E;  4YKI A;  1OLC A;  4OEN A;  3LR1 A;  4R2F A;  1RDX A;  4LZ5 A;  4GX4 A;  1B9J A;  1K9Y A;  2OLB A;  5FTI A;  3FXQ A;  1NV5 A;  1FQF A;  4NF4 B;  2DP8 A;  5KCJ B;  3TTL A;  3IJX B;  1B7H A;  3WAE A;  5EHS A;  1FBC A;  4ELQ A;  2XD2 A;  1MXV A;  4I62 A;  5DW8 A;  2B4L A;  3MAM A;  1A8E A;  4THI A;  3VVE A;  3K1P A;  3N5L A;  1BTJ A;  1OVT A;  2Y7I A;  2X7P A;  4Z0I A;  3H03 A;  1FTK A;  2UXA A;  4POX A;  3TTN A;  3KSX A;  3O66 A;  4MAG A;  5I59 B;  1R9L A;  4JWX A;  3UIF A;  3MJN A;  3TFL A;  4GRK A;  3IL1 B;  3RLF E;  3EHU A;  1NUW A;  3RUM A;  5LTC A;  1VDW A;  3H6W A;  4P9K A;  2PYY A;  4UA8 A;  1QW0 A;  2PFZ A;  4QF9 A;  1I6A A;  2HAV A;  4EQ9 A;  2ZZX A;  4MJO A;  5ET5 A;  1B3G A;  2A5S A;  4IY6 A;  2ABH A;  4OTE A;  3R6U A;  4NWC A;  5HPQ A;  4XKN A;  1LAH E;  3PV0 E;  3KFM A;  1B1H A;  2ZNU A;  4ZZA A;  4H45 A;  5DVF A;  4P11 A;  4KCC A;  3TTK A;  3PD8 A;  4KCD A;  3V8X B;  3GBB A;  2F7A A;  3OO8 A;  5ET8 A;  1MQD A;  4POW A;  3KOT A;  4HE2 A;  1K9Z A;  1QKA A;  5IAI A;  1Y3P A;  2AL5 A;  2BJJ X;  4H5G A;  4EXK A;  2QRY A;  3O97 A;  2UVI A;  2ZNS A;  4HCY A;  5CBR A;  2QFL A;  2XXY A;  2FYI A;  3T66 A;  1FPD A;  1MH3 A;  2I48 A;  4FEB A;  4O7I A;  3P7I A;  4PE5 B;  5EQ9 A;  2CEY A;  4F39 A;  2XXP A;  3K02 A;  1FBP A;  2XXU A;  1JQF A;  2F7B A;  2RF1 A;  1MXZ A;  1MM6 A;  5H8F B;  1FPK A;  1USY H;  3C31 A;  5ISU A;  1SPI A;  3RT6 B;  4GFR A;  2UVG A;  5KZT A;  4PET A;  4DI3 D;  3IB1 A;  4PDD A;  4U1O A;  1UTH A;  1D9V A;  3HHF A;  1JVX A;  3HST A;  2L5V A;  2CZL A;  3MPL A;  4JVC A;  4MEV A;  3G3K A;  4N8G A;  4HW8 A;  3UK4 A;  2CEX A;  1UTB A;  3OO9 A;  1URG A;  3GXA A;  2KLF A;  3K6V A;  5EQA A;  4G68 C;  1Z7N E;  4XFE A;  4EF1 A;  1P1O A;  3PUX E;  1SI1 A;  4AB6 A;  4L17 A;  3EQ1 A;  2PBW A;  3O9P A;  4F18 A;  3KOS A;  1LFH A;  3MYU A;  3A3U A;  4MF3 A;  5TP9 A;  3B7D A;  2X7Q A;  4BDL A;  1MM7 A;  2CZH A;  2GHB A;  4ND9 A;  3MP6 A;  3K01 A;  1SQY A;  1AOV A;  1R9Q A;  2F97 A;  1Q1K A;  3MZ1 A;  2H25 A;  3S9E A;  3C36 A;  1A7L A;  4R2B A;  3T9V A;  1Y4T A;  3PU5 A;  3C34 A;  4ONY A;  3BBR A;  4LUB A;  1D4N A;  1UTH B;  4ZZE A;  4R9G A;  5CM6 A;  3LSF B;  2O69 A;  4N8Y A;  4PQJ A;  3OXN A;  4Q8R A;  2Q9T A;  4KFQ A;  4OVP A;  3VLV A;  1N3W A;  1NV4 A;  3KC0 A;  4YMB A;  1DBZ A;  2V84 A;  3MPK A;  4IR8 A;  4C1U A;  4JWY A;  5H8Q A;  2R8T A;  2ALU A;  4U2R A;  1LBZ A;  1INP A;  4QSC A;  3CVG A;  4KR5 A;  4ESX A;  1SW4 A;  1PB7 A;  5CMB A;  1MY1 A;  3FZV A;  2QVU A;  2PFY A;  4ELR A;  2HPG A;  5TP9 B;  1Q9D A;  3CI8 A;  3MVY A;  1DPP A;  3W9V A;  4GLI A;  3QUJ A;  2V3T A;  2O84 X;  1FBD A;  4DI4 B;  1HSL A;  1MPD A;  5EYF A;  1QUL A;  5F1Q A;  1LBW A;  4EF2 A;  2VOZ A;  2HZL A;  1B7U A;  5IZ3 A;  3VLU A;  4PF6 A;  1SW5 A;  2Y84 A;  1UQW A;  1MH4 A;  1B51 A;  1B2H A;  5EYH A;  4YKK A;  4I3Y A;  4F31 B;  4NAP A;  5B7D A;  4N6P A;  3MBP A;  4PDH A;  2P2A A;  3TCF A;  2REJ A;  3ISP A;  3V83 A;  1FRP A;  5L9M A;  4ZEK A;  3JV9 A;  3RN8 A;  2I3W A;  5I57 B;  1SI0 A;  3KN3 A;  1G0H A;  4OFO A; 
#chains in the Genus database with same CATH homology
 2OBG A;  1Y1M A;  2O1L A;  5H8N B;  4GQO A;  5K2Y A;  3QYT A;  3VVF A;  1B3F A;  5H8Q B;  3TUS A;  2DVZ A;  1M5B A;  2WKY A;  2HCA A;  2DQV A;  4PP0 A;  1B32 A;  1SW1 A;  4F3G A;  1DMB A;  1II5 A;  1IXC A;  4OET A;  4G4P A;  3JZJ A;  1DPE A;  1FCK A;  4EQB A;  1WOD A;  1JEU A;  3G3H A;  1ZTY A;  4QRZ A;  2Q8J A;  3M3K A;  4DXB A;  3MUQ A;  1PBQ A;  1N7X A;  1GV8 A;  5CI5 A;  3O2A A;  4HTG A;  3EPE A;  1FTO A;  5A5X A;  3H3G A;  4RK9 A;  3KZG A;  5L8D A;  3H06 B;  2XXX A;  4G68 A;  2OZZ A;  3U93 A;  4F3P A;  2GHA A;  1WVJ A;  3HCQ A;  5FHO A;  2Y7R A;  1TWY A;  3B6W A;  4X1B A;  4QFL A;  1LCT A;  1R6Z A;  3RY3 A;  1QUK A;  2REG A;  3MC2 A;  3O29 A;  1CB6 A;  2OWS A;  4U1Z A;  2QL3 A;  3Q25 A;  2DVC A;  2DXR A;  4F22 A;  3C35 A;  4GL0 A;  4YAH X;  4H67 A;  3T9U A;  5FTH A;  1LLS A;  5AA4 A;  2R9J A;  1NH8 A;  1IXH A;  3MWB A;  3DM0 A;  3ILT B;  4JWO A;  3HO7 A;  3SEV A;  3R26 A;  3D4G A;  4QSD A;  2RIN A;  1MY0 A;  4O3B A;  3K0V A;  4NF5 A;  2XXQ A;  2H98 A;  3FAT A;  4GL8 A;  5HBC A;  2RCB A;  3TMG A;  3PMW A;  4FED A;  3ILU B;  1QUJ A;  2D3I A;  4WXJ A;  1B6H A;  3U72 A;  3LC8 A;  2H99 A;  3FUZ A;  3SEY A;  2F78 A;  4ZEC A;  1D3K A;  4RYA A;  5JTY B;  5BWJ A;  1MRP A;  2OCU A;  3FGS A;  5AA4 B;  4DCY A;  4HS7 A;  4OZ9 A;  3CG1 A;  2F35 A;  1N0T A;  2QS4 A;  3E3K A;  4Z7E A;  5AA1 A;  1S50 A;  3G3F A;  2IEE A;  1RKM A;  1BIY A;  2DYX A;  4C0R A;  1ZJL A;  4QHQ A;  1JW1 A;  2UVH A;  3U92 A;  3TEP A;  3R7X A;  3S9L C;  3O6I A;  2O7U A;  3PUY E;  3H6U A;  1MQG A;  3HN0 A;  1Z7M E;  4F3B A;  2Y7P A;  4WEP A;  3HPI A;  1TXF A;  3SEX A;  4GF8 A;  2DE4 A;  4YIC A;  3M3L A;  1AIV A;  1WDN A;  2F8D A;  1PB8 A;  1DTG A;  1DOT A;  3MZB A;  2ANJ A;  2V3Q A;  1IQ7 A;  1EZ9 A;  4EDP A;  1TT1 A;  2B3B A;  5DT6 A;  1UIV A;  4BLA A;  4XKP A;  1MPB A;  4X48 A;  3FD3 A;  4OHN A;  1IEJ A;  4MFI A;  4TQU Q;  3KEI A;  3UN6 A;  4PFW A;  1N76 A;  3SER A;  5FHN A;  3FVG A;  4BDN A;  1B52 A;  3CFZ A;  1LGB C;  3VXB A;  1ATG A;  3RNN A;  4X9T A;  5LOM A;  1B5I A;  2H4I A;  1ZIU A;  2FNC A;  4MLQ A;  3OD7 A;  2XXR A;  4I1D A;  1VR5 A;  3IOT A;  4BDM A;  1A40 A;  1NNK A;  2QPQ A;  4KYE A;  4UAC A;  1MXW A;  3U94 A;  5KDT A;  1XT8 A;  3MP8 A;  1EZO A;  1S7Y A;  4NED A;  1B1X A;  3KGC A;  4R6Y A;  2DWA A;  5BUU A;  1Y4C A;  2Q2C A;  4Q0C A;  3IAZ A;  4R73 A;  4RXL A;  1LB8 A;  4G2Z A;  1OQG A;  2NVU B;  3FJG A;  1ELJ A;  4NF6 A;  1VFE A;  1PDA A;  4XKQ A;  1MQH A;  4FOR A;  5M2V A;  4QFK A;  1DSN A;  2FA7 A;  2PT2 A;  1AL3 A;  1FQD A;  4NF8 A;  4OQO A;  4RK2 A;  4ISU A;  3QAX A;  4GD5 A;  1IZ1 A;  3USD A;  1ZBM A;  1IXG A;  5CRY A;  1FQC A;  3FXU A;  5I2N A;  3CRB A;  2QJE A;  4M1V A;  3U1O A;  4OES A;  4OER A;  1LAX A;  3GBA A;  4U22 A;  4QFO A;  4H1X A;  2I58 A;  2VHA A;  1B05 A;  1NNT A;  4K3F A;  3TQW A;  1P1Q A;  3OEM A;  3VXC A;  3PPO A;  5KDT B;  4H8J A;  4DZ1 A;  4PFU A;  3CFX A;  5H8H A;  3B6Q A;  1A55 A;  4G8H A;  5H8S A;  5DYH A;  2F5X A;  2DS9 A;  4F2O A;  4XKR A;  2Y7K A;  4NF6 B;  2NWJ A;  3L6G A;  2DXY A;  3TDJ A;  1B0L A;  4NF8 B;  2XXH A;  4RPO A;  5JEI A;  3OSR A;  3Q27 A;  4TLM B;  3H7M A;  5DVJ A;  5ITO A;  5I2N B;  4X1D A;  3D4C A;  3SKP A;  3TPA A;  3A3C A;  3I6V A;  1NL5 A;  1UTB B;  3OSQ A;  4F1U A;  3E13 X;  4LAT A;  2NUV A;  3OOA A;  3I3V A;  3PMV A;  1MPC A;  3I5O A;  1FQA A;  5I58 A;  5EHM A;  3DLN A;  3H6V A;  1AMF A;  3QSL A;  3TQL A;  1P1N A;  2ZYM A;  3ZS6 A;  1USY E;  4H6D A;  1Y20 A;  5I84 A;  4YKJ A;  1LBC A;  4YZZ A;  3TYH A;  3MQ9 A;  3A09 A;  5L9O A;  4JSD A;  4DE8 A;  4KYS A;  1B3L A;  1ZMG A;  3PPQ A;  4RNS A;  4R75 A;  1I6B A;  1QKB A;  1US4 A;  3SDF A;  4DCX A;  1VFD A;  4IO5 A;  3KJ7 A;  4FJP A;  1B40 A;  2ONR A;  3UA8 A;  4OEV A;  3EHS A;  1EZP A;  2Y7W A;  1MY2 A;  2DWI A;  1ZU0 A;  4G77 A;  4G8N A;  4F1Y A;  3N6U A;  4HCW A;  5I2K A;  2ZNT A;  2I4B A;  2YJP A;  3N6T A;  1OMP A;  3LSL A;  2VD3 A;  4RY1 A;  4DXC A;  4RPN A;  3EHT A;  1A54 A;  3FVN A;  2A5T A;  1XS5 A;  1ANF A;  5I58 B;  1Y9U A;  1GGG A;  1H43 A;  1LBB A;  1TFD A;  3RTW B;  3ECR A;  4C1T A;  2RCA A;  3K2D A;  3TCG A;  3CSB A;  3DP4 A;  2XXT A;  3LBS A;  3VFJ A;  4H65 A;  4NE4 A;  2DE3 A;  1QUI A;  1ZKB A;  4U4X A;  4I9D A;  1B4Z A;  2HXW A;  1A99 A;  3M3F A;  1S9T A;  1P1U A;  5J1D A;  1FTJ A;  5AA2 A;  1FW0 A;  2ZMB A;  2I4C A;  3HV1 A;  3IOU A;  4R9F A;  4GXS B;  1JW5 A;  2ONK E;  4G8M A;  4QFP A;  1H45 A;  4F2Q A;  1NMU A;  3O28 A;  3KN7 A;  5DEX A;  3V5A A;  3QXM A;  5CBS A;  5I2K B;  3MVZ A;  1POT A;  3MVX A;  1B5J A;  1PB9 A;  4E0W A;  1BKA A;  3O6G A;  4F3S A;  3Q26 A;  3FJ7 A;  3PGF A;  2I6E A;  5L9S A;  4NMY A;  1SVX B;  4RJZ A;  1HSJ A;  4KHZ E;  2O68 A;  2QMW A;  2XHD A;  1PC3 A;  2ZYN A;  1D9Y A;  2XXV A;  1B5H A;  2RC7 A;  2RC9 A;  2I3V A;  4H8I A;  3DP6 A;  3LSW A;  4BDQ A;  3IB2 A;  4LA9 A;  1MDQ A;  4ZE9 A;  1CE2 A;  5HM4 B;  1B46 A;  3OEL A;  1T0K A;  2ZYO A;  4YB6 A;  1FQB A;  5AA2 B;  5A5X B;  2HEU A;  4JB7 A;  5TPA A;  5ELV A;  3ODB A;  1XHY A;  1POY 1;  1XC1 A;  2XXW A;  5K2X A;  4G68 B;  1MXY A;  2THI A;  4N13 A;  4GOT A;  3KSJ A;  4OYV A;  2X26 A;  3DEL B;  3KJT A;  4LQ5 A;  4IO4 A;  3SEW A;  1JNF A;  1OIB A;  3FVO A;  5ICT A;  3T93 B;  4NF4 A;  2Q2A A;  3IR1 A;  3PPR A;  4ZEB A;  1IUD A;  3ONM A;  1I69 A;  3VLW A;  4WED A;  2GRV A;  4EQ7 A;  3CSG A;  5TPA B;  2GH9 A;  1Y1Z A;  3TKD A;  1DTZ A;  1MXX A;  4ZE8 A;  3IOV A;  3C4M A;  1PBP A;  1M5F A;  2XX8 A;  5I59 A;  4H0W A;  4NF5 B;  4IGR A;  4E0X A;  3U8Q A;  3IX1 A;  1MS7 A;  4PFT A;  1A8F A;  1Y3N A;  1BP5 A;  1TFA A;  4DIG A;  3F11 A;  1LB9 A;  1O63 A;  3OO6 A;  3IO6 A;  2XD3 A;  4LZ7 A;  3ZKK A;  4JSO A;  4IO2 A;  2V3U A;  2QS1 A;  1QVS A;  2E0S A;  3FVK A;  1B4H A;  5ICQ A;  3C9H A;  4XTC Q;  2CMO A;  1IIT A;  4OMB A;  2G93 A;  3ZKL A;  2IA4 A;  2H5Y A;  3W9W A;  4MBP A;  4ZS9 A;  2DSF A;  3TCH A;  3IJO B;  1UIU A;  2AL4 A;  3KBR A;  2HAU A;  1FTL A;  2Z8E A;  1B3H A;  3C32 A;  3DP8 A;  3RT8 A;  3G3J A;  2M8C A;  1RYX A;  3T22 A;  4LVQ A;  3V89 B;  2Z22 A;  3S2V A;  2W7Y A;  1H3D A;  3PUZ E;  2DWJ A;  5H8F A;  2O6A A;  4OXV A;  4ELP A;  1URS A;  3FJM A;  4P0G A;  1JET A;  5ITP A;  2R71 A;  4MLV A;  4ZEI A;  1B58 A;  3THI A;  3TAJ A;  3IO4 A;  4PFY A;  1IXI A;  4OFL A;  1RYO A;  4AB5 A;  1LAF E;  3T9X B;  1O7T A;  2V25 A;  4U21 A;  1Q35 A;  4ZDM A;  1R1N A;  4ZED A;  3K00 A;  2B65 A;  4OEU A;  3TTR A;  3KN8 A;  3EN3 A;  1YTV A;  1OLA A;  3AXF A;  3MZ9 A;  4AQ4 A;  4O3C A;  1MDP 1;  4JBZ A;  2R6G E;  3CIJ A;  5JK4 A;  2F36 A;  3SES A;  3LUY A;  2UVJ A;  4DLD A;  5AA2 D;  3K6X A;  1YPN A;  1NNF A;  1MY3 A;  3VVD A;  4KPT A;  2YPN A;  2Z23 A;  1SDX A;  3RTF B;  4FEC A;  3PD9 A;  2F6G A;  2LAO A;  3PUV E;  3E9X A;  3VDF A;  4GXA A;  1Y3Q A;  2QS3 A;  1EH3 A;  2D21 A;  3S9M C;  3T9H B;  1XVY A;  2NOO A;  1N7W A;  4GWO A;  1LST A;  4YKP A;  4IGT A;  1YAE A;  2PT1 A;  5CMM A;  1MG1 A;  4P0I A;  2I0C A;  2H9B A;  2OJT A;  1SBP A;  1SD3 A;  3T96 B;  3TZA A;  2O1M A;  4YU0 A;  3IB0 A;  2P1S A;  1EU8 A;  2OWT A;  5IKB A;  1P99 A;  3IOR A;  1O64 A;  4EXL A;  5DTB A;  5TU0 A;  5DVI A;  4YMA A;  2ONS A;  3HHG A;  3BFT A;  1P1W A;  2NXO A;  3BFU A;  4ESW A;  3G7W A;  3WAF A;  1L5T A;  1B7Z A;  3N94 A;  3OMB A;  3SET A;  3IK6 B;  1MY4 A;  1VE4 A;  4R6K A;  1URD A;  1AH5 A;  3FV2 A;  1GR2 A;  2F34 A;  1MXU A;  5I57 A;  2F7C A;  1SYH A;  4NWD A;  2PX1 A;  2I49 A;  3QUF A;  5F7V A;  3E4R A;  5H8N A;  2YLN A;  4ECF A;  3K4U A;  5H8H B;  1H76 A;  3ZSF A;  2E1S A;  3FIR A;  2UYF A;  3RPW A;  3IOW A;  2Q88 A;  3W15 C;  1M5D A;  2UYE A;  1YCJ A;  4R72 A;  2ZXT A;  1M5C A;  3FAS A;  3JYR A;  3TEL A;  4U4S A;  3S4U A;  3CR9 A;  4F1V A;  4F19 A;  1LFG A;  1J1N A;  3K6W A;  2RKM A;  4H5F A;  1OVB A;  2HQ0 A;  3QIM A;  3UGW A;  2PMS A;  2DE2 A;  4GIZ A;  4LQ2 A;  1GTK A;  4N07 A;  2AIX A;  4F29 A;  3VV5 A;  2HFB A;  4IB2 A;  3QK6 A;  1NH7 A;  5AE4 A;  1LAG E;  1NKX A;  4ELO A;  3K6U A;  4LP2 B;  4FIM A;  1BLF A;  2I0B A;  3EF7 A;  3G3I A;  4QFN A;  3UOR A;  1GVC A;  4YB7 A;  3O6H A;  1KWH A;  2O7I A;  3OEK A;  5CMC A;  4M4G A;  3BKI B;  4WKM A;  5I56 A;  4LON B;  4KD5 A;  3SEU A;  3MP1 A;  3Q29 A;  5CMK A;  1JVY A;  1PEB A;  4IO7 A;  1SYI A;  1NFT A;  5CC2 A;  3CG3 A;  4XXU A;  1ZLQ A;  1N3X A;  4R6H A;  4U23 A;  4ZEF A;  4R74 A;  1US5 A;  3RQT A;  3MW0 A;  2XXI A;  3OO7 A;  3FV1 A;  2A5T B;  4MH5 A;  2Q89 A;  3H4Z A;  3S9N C;  3VE1 B;  3M8U A;  4GVO A;  3B6T A;  4TLL B;  3K1N A;  4IO6 A;  4KQP A;  1M5E A;  1LCF A;  2D5W A;  4LZ8 A;  1XVX A;  2ZYK A;  4FAJ A;  3C33 A;  1F9B A;  2QS2 A;  3K1M A;  2P0S A;  2Z8D A;  2VP1 A;  4Q5T A;  2RC8 A;  2DOJ A;  4IO3 A;  3MVW A;  1JW4 A;  4IY5 A;  5JTY A;  2XX7 A;  5I56 B;  1N04 A;  2O51 A;  2QSX A;  1B3E A;  3KG2 A;  3TTM A;  4XIG Q;  3Q28 A;  3GZG A;  5DEX B;  4BDR A;  5B70 A;  4QSE A;  1NNP A;  2F6P A;  2B3F A;  2AYS A;  4JDF A;  2Z8F A;  1OQH A;  1HSE A;  2ESN A;  2XX9 A;  2VGQ A;  4OVJ A;  3TOD A;  3UP9 A;  4NTL A;  3H6T A;  2V93 A;  1H44 A;  3PPP A;  5KCJ A;  4JXI A;  1QJM A;  4EUO A;  1MQI A;  2G29 A;  4DDD A;  4TOZ A;  2PVU A;  4KI0 E;  3L6H A;  4FAT A;  3OEN A;  4KYD A;  1IIW A;  4BDO A;  4I8C A;  1JEV A;  3FXR A;  1XOC A;  3CFL A;  1B0H A;  1VSO A;  2VD2 A;  1N84 A;  3G3G A;  2DWH A;  2OK2 A;  3LSX A;  5AA3 A;  3PPN A;  1FTM A;  2GFE A;  3RGY A;  2QMX A;  4O3A A;  4YB5 A;  1FQE A;  4RA1 A;  3N26 A;  1LFI A;  4OWD A;  1SW2 A;  4DXU A;  4Q30 B;  4OFJ A;  4FE8 A;  1I6Q A;  2HZK A;  1MQJ A;  3GLB A;  5FHM A;  3PMX A;  3PUW E;  4YKI A;  1OLC A;  4OEN A;  3LR1 A;  4R2F A;  4LZ5 A;  1B9J A;  2OLB A;  5FTI A;  3FXQ A;  1FQF A;  4NF4 B;  2DP8 A;  5KCJ B;  3TTL A;  3IJX B;  1B7H A;  3WAE A;  5EHS A;  4ELQ A;  2XD2 A;  1MXV A;  4I62 A;  3MAM A;  1A8E A;  4THI A;  3VVE A;  3K1P A;  3N5L A;  1BTJ A;  1OVT A;  2Y7I A;  2X7P A;  4Z0I A;  3H03 A;  1FTK A;  2UXA A;  4POX A;  3TTN A;  3KSX A;  3O66 A;  5I59 B;  1R9L A;  4JWX A;  3UIF A;  3MJN A;  3TFL A;  4GRK A;  3IL1 B;  3RLF E;  3EHU A;  3RUM A;  3H6W A;  2PYY A;  4UA8 A;  1QW0 A;  4QF9 A;  1I6A A;  2HAV A;  4EQ9 A;  1B3G A;  2A5S A;  4IY6 A;  2ABH A;  4OTE A;  3R6U A;  4NWC A;  5HPQ A;  4XKN A;  1LAH E;  3PV0 E;  3KFM A;  1B1H A;  2ZNU A;  4ZZA A;  5DVF A;  4P11 A;  4KCC A;  3TTK A;  3PD8 A;  4KCD A;  3V8X B;  3GBB A;  2F7A A;  3OO8 A;  1MQD A;  4POW A;  3KOT A;  1QKA A;  5IAI A;  1Y3P A;  2AL5 A;  2BJJ X;  4H5G A;  4EXK A;  2QRY A;  3O97 A;  2UVI A;  2ZNS A;  4HCY A;  5CBR A;  3T66 A;  2XXY A;  2FYI A;  1MH3 A;  2I48 A;  4FEB A;  3P7I A;  4PE5 B;  4F39 A;  2XXP A;  3K02 A;  2XXU A;  1JQF A;  2F7B A;  2RF1 A;  1MXZ A;  1MM6 A;  5H8F B;  1USY H;  3C31 A;  5ISU A;  3RT6 B;  4GFR A;  2UVG A;  5KZT A;  4PET A;  3IB1 A;  4U1O A;  1UTH A;  1D9V A;  3HHF A;  1JVX A;  3HST A;  2CZL A;  3MPL A;  3G3K A;  4HW8 A;  3UK4 A;  1UTB A;  3OO9 A;  1URG A;  3GXA A;  2KLF A;  3K6V A;  4G68 C;  1Z7N E;  4EF1 A;  1P1O A;  3PUX E;  1SI1 A;  4AB6 A;  4L17 A;  3EQ1 A;  2PBW A;  3O9P A;  4F18 A;  3KOS A;  1LFH A;  3A3U A;  4MF3 A;  5TP9 A;  3B7D A;  2X7Q A;  4BDL A;  1MM7 A;  2GHB A;  4ND9 A;  3MP6 A;  3K01 A;  1SQY A;  1AOV A;  1R9Q A;  2F97 A;  1Q1K A;  3MZ1 A;  2H25 A;  3S9E A;  3C36 A;  1A7L A;  4R2B A;  3T9V A;  1Y4T A;  3PU5 A;  3C34 A;  4ONY A;  3BBR A;  4LUB A;  1D4N A;  1UTH B;  4ZZE A;  4R9G A;  5CM6 A;  3LSF B;  2O69 A;  4PQJ A;  3OXN A;  4Q8R A;  2Q9T A;  4KFQ A;  3VLV A;  1N3W A;  4YMB A;  2V84 A;  3MPK A;  4C1U A;  4JWY A;  5H8Q A;  2ALU A;  4U2R A;  4QSC A;  3CVG A;  4KR5 A;  4ESX A;  1SW4 A;  1PB7 A;  5CMB A;  1MY1 A;  3FZV A;  4ELR A;  5TP9 B;  3CI8 A;  3MVY A;  1DPP A;  3W9V A;  4GLI A;  3QUJ A;  2V3T A;  2O84 X;  1HSL A;  1MPD A;  5EYF A;  1QUL A;  5F1Q A;  4EF2 A;  2VOZ A;  2HZL A;  1B7U A;  3VLU A;  1SW5 A;  2Y84 A;  1UQW A;  1MH4 A;  1B51 A;  1B2H A;  4YKK A;  4F31 B;  5B7D A;  4N6P A;  3MBP A;  2P2A A;  3TCF A;  2REJ A;  3V83 A;  5L9M A;  4ZEK A;  3JV9 A;  3RN8 A;  2I3W A;  5I57 B;  1SI0 A;  3KN3 A;  4OFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...