4H6HA

Crystal structure of staphylococcal complement inhibitor scin-b(4-85)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
79
structure length
79
Chain Sequence
LTESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen-binding protein
publication title A Structurally Dynamic N-terminal Helix Is a Key Functional Determinant in Staphylococcal Complement Inhibitor (SCIN) Proteins.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 32
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4h6hA00
1DKZA 2WINM 4EZRA 1U00A 3D2EA 3DPPA 4B9QA 3L3OM 2QXLA 4F01A 4JWDA 4E81A 1DKYA 4H6IA 4R5LA 4EZVA 1DKXA 3T48A 4EZOA 5TKYA 3T47A 4JWEA 4H6HA 4R5GA 4JNEA 4R5JA 4JN4A 3DPOA 3T46A 4HYBA 4EZUA 4PO2A 4EZSA 4R5KA 5E84A 3C7NA 3OHXM 4HY9A 4EZNA 4JWCA 4EZZA 3T4AG 4EZPA 4R5IA 3DPQA 3T49A 2KHOA 4EZQA 4F00A 2QFFA 4JWIA 4EZWA 4EZYA 4EZXA 4JNFA 3D2FA 4EZTA 3QNJA
chains in the Genus database with same CATH superfamily
2WINM 2YL9A 3D2EA 3BVWA 4JWEA 3I01A 3KAWA 3EJRA 4EZPA 4AZIA 4UDYX 2EX3B 1I4TA 3BVTA 4JWDA 1DKYA 2C08A 3O3MB 4EZOA 1TQVA 4R5GA 2GF4A 1OA1A 5C5BB 2YIVX 4AZ6A 2OO2A 3UITA 3DX0A 1HXKA 3DX3A 4IWQA 4G6QA 2EFKA 4JLCA 4AKVA 3QNJA 1PS3A 2V0OA 2EWFA 2RAKA 2Z0OA 2YL5A 3CVRA 5E84A 3C7NA 2F7RA 2YI8A 1O7DB 2GA9D 3Q84A 3T49A 4DYLA 3D4YA 3D50A 3D52A 2QXLA 1QWNA 4JN4A 4JL9A 3BVVA 2OZNB 4EZUA 3FD9A 1OAOA 1MJGA 3BUBA 3QWEA 2WYIA 4F00A 2FYVA 3DDGA 1DKXA 3T48A 2YIBA 1URUA 2GAFD 4KIKA 4EZSA 3B52X 2OW7A 1R33A 3CV5A 4R5IA 2X3VA 4IWOA 3SOGA 4NSWA 3KDRA 1I4LA 3L3OM 4R5LA 4WPCA 2YI9A 1SU7A 2RAIA 3CZSA 3ER8C 2ND1A 3DX2A 5FLEX 2PY6A 1GNLA 2QFFA 3EJUA 1HWWA 1WDZA 3I2WA 4AZGA 3F7WA 4B9QA 3ABHA 3DPOA 3T46A 3BVUA 4HYBA 3EJQA 1R34A 2OBMA 3OHXM 4JWCA 3T4AG 3HAJA 4M0MA 4NPHA 2YLAA 3QA8A 4JNFA 4FZOA 3A98A 2JNSA 3EJPA 4IW0A 3QE6A 4UDXX 5TKYA 3BUIA 4DCNC 1OA0A 4R5KA 2YIAA 1TQTA 4AZCB 2OBLA 3D51A 1GN9A 3LMFA 2ALWA 5FIGA 1GNTA 3BLBA 3D2FA 4I1QA 3ERCC 5KBPA 1ZWWA 3DPPA 1JQKA 4AVMA 4WPEA 4IM3A 3BUDA 5C5BA 4AZHA 4AZBA 3RPMA 4PO2A 2RAJA 2X5CA 3B53X 1TQWA 4EZZA 1SU6A 2YKTA 2KHOA 3DX1A 1LQ7A 4JWIA 4AZ7A 3DDFA 2F7PA 3I04A 3L3PA 3O3NB 3SYVA 2X3XA 4EZWA 4BNEA 2Z0VA 4NQIA 4EZVA 4F01A 1UPXA 3HAHA 1DKZA 1U00A 3B51X 1R5EA 2YL8A 2Z0NA 2Q12A 3CZNA 2LXYA 4HR1A 1SUFA 2MI7A 4ATMA 4FZPA 4EZTA 2F18A 2WYHA 1TQUA 1E1DA 2D4CA 1ZYLA 4D8JA 4FZSA 1Y2OA 4R5JA 3D4ZA 3ACOA 3O3OB 3VEAA 3DX4A 1TQSA 1X04A 4IM0A 2D1LA 4IWPA 1E9VA 3M3WA 1QWUA 3HAIA 4H6IA 2QKWA 2Z8YA 2F1BA 3EJTA 2YLLA 2FICA 1I49A 1YWMA 4AZ5A 1E2UA 2RT6A 2O0I1 2ELBA 3I39X 4EZQA 3PLTA 3DYTA 4IM2A 3ZEDA 3CKDA 4EZRA 2YL6A 3VEBA 2N3KA 3G9GA 2NCZA 1SU8A 1O7DC 4KIKB 4E3CA 3QNIA 4EZNA 1X03A 2ZXQA 2JNKA 1HTYA 3KAVA 3GI7A 3T47A 4H6HA 2F1AA 3LVTA 2F7QA 3VKHA 3BVXA 1I4DA 2PMRA 3BUPA 4HR1B 4HY9A 4AZCA 2Q13A 3OK8A 4EZYA 3EJSA 3ER9B 1W9MA 2LM0A 2X3WA 3BUQA 4E81A 2EFLA 3LLLA 4JNEA 3CAZA 3OWGA 2ND0A 1QX1A 3RV0A 2OW6A 4FM3A 3DPQA 3Q0KA 4H8SA 2F7OA 4EZXA 3RV1A
chains in the Genus database with same CATH topology
2WINM 3D2EA 3DPPA 1JQKA 4H6IA 1DKXA 3T48A 4JWEA 4IM3A 2YIBA 2Z8YA 2GAFD 3I01A 4PO2A 4KIKA 3KAWA 2X5CA 4EZSA 3B53X 3B52X 1E2UA 2RT6A 4EZZA 4EZPA 1SU6A 3I39X 4R5IA 4IWOA 2KHOA 4EZQA 4JWIA 3KDRA 4IM2A 3ZEDA 4UDYX 4EZRA 2EX3B 3L3OM 3I04A 4JWDA 3VEBA 1DKYA 4R5LA 3O3MB 4EZOA 2N3KA 2YI9A 4R5GA 1SU7A 2NCZA 1OA1A 2YIVX 3UITA 3O3NB 1SU8A 3ER8C 4KIKB 4E3CA 2ND1A 4IWQA 4EZNA 5FLEX 4G6QA 2PY6A 1GNLA 2QFFA 4EZWA 4JLCA 4F01A 4EZVA 3QNJA 1UPXA 1DKZA 1U00A 3F7WA 3KAVA 3B51X 4B9QA 3GI7A 3T47A 4H6HA 3DPOA 3T46A 4HYBA 2EWFA 3VKHA 2OBMA 5E84A 3C7NA 4HR1B 3OHXM 4HR1A 4HY9A 4JWCA 1SUFA 3T4AG 2YI8A 2GA9D 4M0MA 3T49A 4NPHA 4EZYA 3QA8A 4JNFA 4EZTA 3ER9B 1W9MA 2LM0A 3A98A 2QXLA 2JNSA 4E81A 1E1DA 4IW0A 4UDXX 5TKYA 1ZYLA 4D8JA 4JNEA 4R5JA 4JN4A 4JL9A 3OWGA 4EZUA 3FD9A 1OAOA 2ND0A 3O3OB 3VEAA 1OA0A 3RV0A 4R5KA 1MJGA 2YIAA 2OBLA 4FM3A 3DPQA 1GN9A 3LMFA 4IM0A 4F00A 4IWPA 1E9VA 1GNTA 5FIGA 3RV1A 4EZXA 3D2FA 3ERCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKZ A;  2WIN M;  4EZR A;  1U00 A;  3D2E A;  3DPP A;  4B9Q A;  3L3O M;  2QXL A;  4F01 A;  4JWD A;  4E81 A;  1DKY A;  4H6I A;  4R5L A;  4EZV A;  1DKX A;  3T48 A;  4EZO A;  5TKY A;  3T47 A;  4JWE A;  4H6H A;  4R5G A;  4JNE A;  4R5J A;  4JN4 A;  3DPO A;  3T46 A;  4HYB A;  4EZU A;  4PO2 A;  4EZS A;  4R5K A;  5E84 A;  3C7N A;  3OHX M;  4HY9 A;  4EZN A;  4JWC A;  4EZZ A;  3T4A G;  4EZP A;  4R5I A;  3DPQ A;  3T49 A;  2KHO A;  4EZQ A;  4F00 A;  2QFF A;  4JWI A;  4EZW A;  4EZY A;  4EZX A;  4JNF A;  3D2F A;  4EZT A;  3QNJ A; 
#chains in the Genus database with same CATH topology
 2WIN M;  2YL9 A;  3D2E A;  3BVW A;  4JWE A;  3I01 A;  3KAW A;  3EJR A;  4EZP A;  4AZI A;  4UDY X;  2EX3 B;  1I4T A;  3BVT A;  4JWD A;  1DKY A;  2C08 A;  3O3M B;  4EZO A;  1TQV A;  4R5G A;  2GF4 A;  1OA1 A;  5C5B B;  2YIV X;  4AZ6 A;  2OO2 A;  3UIT A;  3DX0 A;  1HXK A;  3DX3 A;  4IWQ A;  4G6Q A;  2EFK A;  4JLC A;  4AKV A;  3QNJ A;  1PS3 A;  2V0O A;  2EWF A;  2RAK A;  2Z0O A;  2YL5 A;  3CVR A;  5E84 A;  3C7N A;  2F7R A;  2YI8 A;  1O7D B;  2GA9 D;  3Q84 A;  3T49 A;  4DYL A;  3D4Y A;  3D50 A;  3D52 A;  2QXL A;  1QWN A;  4JN4 A;  4JL9 A;  3BVV A;  2OZN B;  4EZU A;  3FD9 A;  1OAO A;  1MJG A;  3BUB A;  3QWE A;  2WYI A;  4F00 A;  2FYV A;  3DDG A;  1DKX A;  3T48 A;  2YIB A;  1URU A;  2GAF D;  4KIK A;  4EZS A;  3B52 X;  2OW7 A;  1R33 A;  3CV5 A;  4R5I A;  2X3V A;  4IWO A;  3SOG A;  4NSW A;  3KDR A;  1I4L A;  3L3O M;  4R5L A;  4WPC A;  2YI9 A;  1SU7 A;  2RAI A;  3CZS A;  3ER8 C;  2ND1 A;  3DX2 A;  5FLE X;  2PY6 A;  1GNL A;  2QFF A;  3EJU A;  1HWW A;  1WDZ A;  3I2W A;  4AZG A;  3F7W A;  4B9Q A;  3ABH A;  3DPO A;  3T46 A;  3BVU A;  4HYB A;  3EJQ A;  1R34 A;  2OBM A;  3OHX M;  4JWC A;  3T4A G;  3HAJ A;  4M0M A;  4NPH A;  2YLA A;  3QA8 A;  4JNF A;  4FZO A;  3A98 A;  2JNS A;  3EJP A;  4IW0 A;  3QE6 A;  4UDX X;  5TKY A;  3BUI A;  4DCN C;  1OA0 A;  4R5K A;  2YIA A;  1TQT A;  4AZC B;  2OBL A;  3D51 A;  1GN9 A;  3LMF A;  2ALW A;  5FIG A;  1GNT A;  3BLB A;  3D2F A;  4I1Q A;  3ERC C;  5KBP A;  1ZWW A;  3DPP A;  1JQK A;  4AVM A;  4WPE A;  4IM3 A;  3BUD A;  5C5B A;  4AZH A;  4AZB A;  3RPM A;  4PO2 A;  2RAJ A;  2X5C A;  3B53 X;  1TQW A;  4EZZ A;  1SU6 A;  2YKT A;  2KHO A;  3DX1 A;  1LQ7 A;  4JWI A;  4AZ7 A;  3DDF A;  2F7P A;  3I04 A;  3L3P A;  3O3N B;  3SYV A;  2X3X A;  4EZW A;  4BNE A;  2Z0V A;  4NQI A;  4EZV A;  4F01 A;  1UPX A;  3HAH A;  1DKZ A;  1U00 A;  3B51 X;  1R5E A;  2YL8 A;  2Z0N A;  2Q12 A;  3CZN A;  2LXY A;  4HR1 A;  1SUF A;  2MI7 A;  4ATM A;  4FZP A;  4EZT A;  2F18 A;  2WYH A;  1TQU A;  1E1D A;  2D4C A;  1ZYL A;  4D8J A;  4FZS A;  1Y2O A;  4R5J A;  3D4Z A;  3ACO A;  3O3O B;  3VEA A;  3DX4 A;  1TQS A;  1X04 A;  4IM0 A;  2D1L A;  4IWP A;  1E9V A;  3M3W A;  1QWU A;  3HAI A;  4H6I A;  2QKW A;  2Z8Y A;  2F1B A;  3EJT A;  2YLL A;  2FIC A;  1I49 A;  1YWM A;  4AZ5 A;  1E2U A;  2RT6 A;  2O0I 1;  2ELB A;  3I39 X;  4EZQ A;  3PLT A;  3DYT A;  4IM2 A;  3ZED A;  3CKD A;  4EZR A;  2YL6 A;  3VEB A;  2N3K A;  3G9G A;  2NCZ A;  1SU8 A;  1O7D C;  4KIK B;  4E3C A;  3QNI A;  4EZN A;  1X03 A;  2ZXQ A;  2JNK A;  1HTY A;  3KAV A;  3GI7 A;  3T47 A;  4H6H A;  2F1A A;  3LVT A;  2F7Q A;  3VKH A;  3BVX A;  1I4D A;  2PMR A;  3BUP A;  4HR1 B;  4HY9 A;  4AZC A;  2Q13 A;  3OK8 A;  4EZY A;  3EJS A;  3ER9 B;  1W9M A;  2LM0 A;  2X3W A;  3BUQ A;  4E81 A;  2EFL A;  3LLL A;  4JNE A;  3CAZ A;  3OWG A;  2ND0 A;  1QX1 A;  3RV0 A;  2OW6 A;  4FM3 A;  3DPQ A;  3Q0K A;  4H8S A;  2F7O A;  4EZX A;  3RV1 A; 
#chains in the Genus database with same CATH homology
 2WIN M;  3D2E A;  3DPP A;  1JQK A;  4H6I A;  1DKX A;  3T48 A;  4JWE A;  4IM3 A;  2YIB A;  2Z8Y A;  2GAF D;  3I01 A;  4PO2 A;  4KIK A;  3KAW A;  2X5C A;  4EZS A;  3B53 X;  3B52 X;  1E2U A;  2RT6 A;  4EZZ A;  4EZP A;  1SU6 A;  3I39 X;  4R5I A;  4IWO A;  2KHO A;  4EZQ A;  4JWI A;  3KDR A;  4IM2 A;  3ZED A;  4UDY X;  4EZR A;  2EX3 B;  3L3O M;  3I04 A;  4JWD A;  3VEB A;  1DKY A;  4R5L A;  3O3M B;  4EZO A;  2N3K A;  2YI9 A;  4R5G A;  1SU7 A;  2NCZ A;  1OA1 A;  2YIV X;  3UIT A;  3O3N B;  1SU8 A;  3ER8 C;  4KIK B;  4E3C A;  2ND1 A;  4IWQ A;  4EZN A;  5FLE X;  4G6Q A;  2PY6 A;  1GNL A;  2QFF A;  4EZW A;  4JLC A;  4F01 A;  4EZV A;  3QNJ A;  1UPX A;  1DKZ A;  1U00 A;  3F7W A;  3KAV A;  3B51 X;  4B9Q A;  3GI7 A;  3T47 A;  4H6H A;  3DPO A;  3T46 A;  4HYB A;  2EWF A;  3VKH A;  2OBM A;  5E84 A;  3C7N A;  4HR1 B;  3OHX M;  4HR1 A;  4HY9 A;  4JWC A;  1SUF A;  3T4A G;  2YI8 A;  2GA9 D;  4M0M A;  3T49 A;  4NPH A;  4EZY A;  3QA8 A;  4JNF A;  4EZT A;  3ER9 B;  1W9M A;  2LM0 A;  3A98 A;  2QXL A;  2JNS A;  4E81 A;  1E1D A;  4IW0 A;  4UDX X;  5TKY A;  1ZYL A;  4D8J A;  4JNE A;  4R5J A;  4JN4 A;  4JL9 A;  3OWG A;  4EZU A;  3FD9 A;  1OAO A;  2ND0 A;  3O3O B;  3VEA A;  1OA0 A;  3RV0 A;  4R5K A;  1MJG A;  2YIA A;  2OBL A;  4FM3 A;  3DPQ A;  1GN9 A;  3LMF A;  4IM0 A;  4F00 A;  4IWP A;  1E9V A;  1GNT A;  5FIG A;  3RV1 A;  4EZX A;  3D2F A;  3ERC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...