4H7HA

Crystal structure of haloalkane dehalogenase linb t135a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
b'SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVAMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
molecule keywords Haloalkane dehalogenase
source organism Sphingobium
molecule tags Hydrolase
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7hA00
1IUOA 3WJ1A 1NU8A 4H7IA 3K9BA 5K3FB 1CQZA 3AFIA 3IBTA 4JH0A 4LHEA 2H7YA 1AKNA 2CMFA 3OURA 2OXEA 1JU4A 1FFDA 1N8SA 4K6HA 4X6YA 2WU4A 3NOXA 4KE6A 5D3KA 2QZPA 1P0MA 3D2BA 1EK1A 5A62A 4B83A 1HLGA 5I9IA 1LPPA 1QIKA 4KE8A 4UBLA 2XUDA 2PL5A 1GQRA 4C4XA 2WUFA 4X85A 1W76A 1EI9A 4GHWA 1TKRA 5T4EA 3IUNA 4KAFA 2PBLA 3QH4A 2H1IA 3CXUA 4C6HA 1L7QA 3WL6A 2I3DA 3HXKA 3R41A 1R1DA 4X91A 5DNWA 4A23A 3DQZA 4L0CA 2JGIA 3G8YA 4K6KA 4FTWA 1AX9A 2VEOA 1R3DA 4Z49A 3KDAA 2E3JA 2QRUA 3IDAA 1GZ7A 2QUBA 3I2FA 5CT4A 2WFLB 3WK4A 4EY6A 4H7FA 1DU4A 3OTQA 5ESRA 2AJBA 7YASA 2O2GA 3C6BA 1K63A 5C81A 4KE9A 5AIAA 3O9VA 1XQYA 1H2ZA 3FNBA 2C4HA 3PFBA 4FNMA 5DTJA 2VQ6A 1CUCA 1ORWA 1U4NA 4IH1A 1VXRA 2P8SA 3ZLUA 5C7YA 1IUNA 4BB0A 2Y6VA 4J0CA 4DM7A 3I2IA 4BVLA 4BTVA 2OLEA 4QDUA 3AIMA 3U1TA 4U2CA 1LPMA 5CH3A 3QZUA 4UHBA 3WKCA 3O4JA 4G9GA 4ETWA 3X3HA 3R3YA 2GYWA 5FP0A 4C89A 3DYVA 3C5VA 1CRLA 5FOQA 5HKAA 2Z5GA 2AJDA 3BF7A 1CUBA 1HPLA 2QS9A 4BC0A 3GELA 1AC5A 3BJMA 4BYMA 3I6MA 3OOSA 1YCDA 2YYSA 3G9TA 3SX4A 1H2WA 3R3UA 5FLKA 3T52A 5KWIA 2QMQA 3WL7A 5EIEA 4WFKA 1E5TA 3DNMA 2ZYSA 4WFJA 3FYTA 3O9MA 1JJBA 1KU0A 2CBGA 1CV2A 2JGJA 4AZ0A 4Q05A 2LIPA 4Q3KA 1RYYA 3VDXA 1YSCA 5AI9A 2XLBA 4Y2XA 1IMJA 2ECFA 1MJ5A 4WDQA 1Q0RA 3F67A 2XMDA 3BIXA 2PSEA 1QONA 4X92A 4G5XA 1DT3A 4U2BA 5EHZA 5FPQA 5K5EA 4H7EA 5EHNA 4W1QA 1XLUA 2AJLI 4PSCA 1A88A 1DWPA 2FJ0A 1ZGBA 5HKBA 2RIPA 1EB9A 5HFNA 1K4YA 3K2IA 3WWOA 1FSSA 5JAHA 3VXKA 1JI3A 2WSLA 4GDMA 2OAEA 5EHXA 3VJLA 3GROA 4CCYA 2XMGA 2OAGA 4KAJA 1CLEA 2H9YA 4WY8A 4BZWA 4N5IX 4OU5A 4F60A 5T4BA 3W9BA 3WL8A 5DNUA 1PV1A 5AKGA 3C43A 3FSGA 4AMYA 2DFPA 3ICWA 4W1RA 4MWSA 2ROQA 4CG2A 2CB9A 1BU8A 1XZLA 2OGTA 3EF3A 1SC9A 3WL5A 4EBBA 1AZWA 1ISPA 4MYSA 2X8BA 2XMQA 1Y7IA 1QIDA 4DMHA 2JF0A 4LKOA 5D6OA 3VISA 5ALJA 4UFPA 1Q84A 2QKYA 5AM1A 4OB7A 4PSDA 1SCIA 1C7JA 3R40A 2Z8XA 4E14A 2DHCA 3ILSA 3MGAA 1BN7A 1NX9A 4PV7A 4OUKX 4Q1VA 2RGUA 3V9AA 1K5PA 2BGRA 4MJ3A 4BDSA 2OGSA 2Z3WA 2WUGA 5FKJA 2HA4A 3G0IA 1KU6A 1WPRA 5AOAA 5HK8A 4WFIA 3C8DA 2VJDA 2YH2A 6YASA 4X00A 3V1NA 1ZICA 2O2IA 1IVYA 3NGMA 2Q0XA 4EUSA 2PSFA 4U2EA 5DTIA 3ZLTA 1RWQA 1JJFA 2B20A 4QDTA 2ZYIA 4BC1A 1QTRA 4Q82A 4J0HA 3DOHA 5AIBA 5FXMA 2PVSA 4UUQA 4H7JA 5FDFA 4O08A 4MEAA 3G0DA 5AI0A 3I1IA 2JGLA 3IUMA 3EQ8A 4EHBA 3VVLA 1W4LA 2XUJA 5AO9A 2WIKA 1T4MA 1YS2X 2X5XA 1AGYA 4DSAA 3RKSA 1XRMA 1H2YA 2IX9A 2VAVA 1UOPA 3EIOA 3LP5A 5KWJA 3FOBA 5IVKA 4KEAA 3HEAA 3D3NA 2XUFA 1MU0A 2WKWA 3G0GA 4FFVA 5AKEA 3WK8A 4DMKA 5DYTA 4BRSA 4B7ZA 5JAPA 2PM8A 1ZI9A 3QYJA 5I7UA 1SCQA 3AJAA 3H17A 1G42A 2OCLA 4Y2PA 1TCBA 3WK7A 4DNFA 2PPLA 4Q3LA 1F0PA 3ANSA 3L1HA 4G9EA 3ZPXA 3ESAA 5AP9A 5EIAA 2Y2UA 2WU3A 4KACA 1GXSA 4TGLA 1MT3A 3M82A 2PX6A 1NU6A 2ACKA 1CQWA 3HRHA 1X70A 1U65A 4XVCA 5BWBA 1LPAB 4DYHA 2FJPA 1QFMA 2EEPA 5LZ4A 2WUEA 1A8UA 1UK6A 2HA5A 4QA9A 5E4TA 4AN1A 1XRRA 3WK9A 1USWA 4IQ4A 4G4JA 3IURA 2WHRA 3EQ9A 4LXIA 5C8XA 5AKKA 4DMFA 5IKXA 3BDVA 4QWMA 1JT2A 1G5FA 2BUAA 2NW6A 3A2MA 3WJ2A 3G02A 5CTAA 2W6CX 4DGQA 2XMZA 3G0BA 4FWBA 5AM4A 5BV7A 2QR5A 4LYDA 4N8EA 1FFCA 1BN6A 2PSDA 4HS9A 4F21A 1CUDA 2WIGA 5K3AA 2GZRA 2FX5A 1F6WA 4WDRA 3S2ZA 3CCBA 1MN6A 4A16A 2JEYA 2BAGA 2WG0A 4YX9A 2XUKA 2ORYA 2PSHA 5HQ3A 5CMLA 3WLAA 2Y6UA 3KWFA 4UBMA 4CFSA 1QIGA 5IVIA 1LPOA 4DMCA 3AZPA 1J07A 1OCEA 2VT7A 1UK7A 2HU7A 1CIJA 1ZD3A 2YASA 1TAHA 1WM1A 3ICVA 3D59A 4U2FA 2J4FA 1XZHA 3L1IA 5I8PA 4GW3A 3HLKA 1EDBA 5D7BA 3SC2A 3V1LA 3FLBA 5AKJA 2DR0A 2AJ8A 4X95A 3FLEA 4UHDA 3GZJA 2BUBA 1VA5A 5JATA 1GGVA 1E3QA 4UBJA 3STYA 3H2HA 1UZAA 2B61A 4U2DA 4NVRA 1ZJ5A 5K3EA 3STWA 4NMWA 3BDIA 2ZJ6A 1QGED 2VJCA 4B81A 4DLNA 4X6XA 5FUMA 3LLCA 1LPBB 5HF9A 4M0MA 4UFOA 5JZ9A 1UKAA 5BWCA 1ZJ4A 1VKHA 4DNOA 4E46A 2WFLA 5AICA 1R88A 4PSUA 1K8QA 2QOEA 4J0GA 1WPXA 5CT8A 2O2HA 4WY5A 3FSGD 2GBCA 4KRYA 3R3ZA 1QZ3A 5EI5A 3U0VA 1H22A 1CUGA 4QDZA 5H3HA 2WG2A 3PFCA 5ALZA 1N5MA 1YASA 4H0CA 1XKTA 1HKHA 5AKHA 2GBIA 3DD5A 3D5EA 5LZ7A 4J7AA 5AM5A 4AO6A 4X94A 3QMVA 4BCBA 1EDDA 3ESBA 5JARA 3ED1A 5SYMA 5JALA 4QLAA 3WWCA 2XMRA 1RP1A 5CT9A 5CH5A 3F9CA 1E66A 4BZZA 1SCKA 1T2NA 3FYUA 2WUDA 5LLSA 2HDWA 3W05A 5BOVA 3LCRA 3VJMA 4KAAA 5JANA 5ALLA 1EINA 3TGLA 4H35A 4PW0A 5CURA 4W9RA 5LP1A 2D5LA 5ALHA 4MQLA 2CZQA 3YASA 1HBJA 3N0TA 4G4IA 1XLVA 4B84A 3DCNA 3HC7A 4OB6A 3O0DA 1ZGCA 4Y2JA 1CEXA 1FFBA 1CUJA 1QOZA 2OCKA 2JBWA 2XUHA 1QIJA 2QVBA 5LIPA 2HADA 2WJ3A 2WHPA 5HFAA 4ZREA 4Y9SA 3WK5A 1WB4A 4M0EA 2GYVA 2C58A 4MYDA 3STUA 1P0QA 1MPXA 3AINA 4UHCA 3FVRA 2HA6A 1QIEA 4OD0A 4FLFA 2XB6A 3PUHA 3ZV7A 1C4XA 1XQWA 2HFKA 2X76A 3H19A 3E3AA 5ALKA 1EH5A 2HU8A 2HA0A 4B80A 1K6EA 5CH8A 1OILA 4RNCA 1C7IA 1YA8A 3TRDA 3H0CA 2GZSA 1HL7A 2QJWA 1AUOA 4P92A 1THGA 2HM7A 4PO3X 3WYDA 4L9AA 3QITA 4GWLA 5AM2A 2XI4A 4QNNA 2HFJA 2BGNA 1IZ8A 4HXEB 2WM2A 2OQVA 2PUHA 3RK4A 2HA7A 3H04A 2O7VA 3IB3A 4X71A 3LS2A 5JAOA 1QLWA 1XZEA 3WA7A 4AXBA 4AX4A 4FMPA 1JFRA 2DHDA 5JYCA 4KYVA 1SFRA 4BCDA 4W1SA 5HF5A 3WZLA 1ACLA 1GQSA 2HL6A 4HZGA 4CIBA 1OXMA 5FPPA 1A7UA 4S0XA 1A8SA 1O6GA 3WWDA 3R0VA 5JZBA 3WQHA 3VJKA 3AILA 3P2MA 2Y1KA 1XZMA 2XQIA 5AI8A 1XZGA 3HABA 5ALIA 1X2BA 3I2HA 2XQJA 1F8UA 3W04A 4B85A 1G4HA 2RAUA 1UWCA 4CG1A 5A7HA 2QJRA 1ZD5A 1XRLA 4B6GA 4HXGA 3B12A 3H2GA 4L3WA 5CT6A 2QXUA 3WWPA 3RM3A 1GPLA 1CUZA 4UFNA 3ZLVA 2VTVA 2G5TA 3K6KA 2HA2A 3I6YA 1QO9A 4OSEA 3BF8A 5A6VA 5ALTA 2HA3A 4M0FA 4FLEA 1TCCA 3H1AA 4NZZA 3MUOA 4ARBA 3IA2A 1CUFA 2HU5A 2VA9A 2BJHA 2C5FA 5HCUA 2BKLA 2AXEA 2W22A 3DS8A 3STTA 1LPNA 4DNPA 3PI6A 1X2EA 5CW2A 1CUWA 4PNZA 1LBSA 4CCYB 1CPYA 2YXPX 4AO7A 1XZKA 2ZYHA 1EX9A 3V1MA 3TJMA 3MVEA 4ZI5A 1MX1A 1B6GA 1H2XA 3M81A 3PE6A 1ZIXA 1XZJA 3BE8A 1JMYA 3KXPA 1WB5A 2WLSA 3I2KA 3IIIA 4BTLA 3VVMA 2D0DA 1W1IA 5ALVA 2O7RA 3KD2A 4F0JA 4Y2SA 1ZI8A 4WJLA 1QE3A 2ES4A 2V9ZA 2I78A 4RGYA 2CUTA 2JGKA 3UMJA 3HACA 1XZFA 5K3DA 2JEZA 2BFNA 5ALUA 4EY7A 4ZV7A 2GYUA 3FLAA 4FNGA 5T4FA 1Q0ZA 4UHHA 3BL8A 3H2IA 3QPAA 1U2EA 1CFJA 4Y2RA 4KRXA 2DCMA 4EY4A 3AZQA 5A71A 5AKLA 5KREA 3DOIA 2QM0A 4Y2QA 2XUAA 3Q0TA 5LYYA 3C6ZA 1YB6A 1GKKA 2WIFA 3WI7A 4C4YA 4Y2UA 3L1JA 4XWGA 5DJ5A 1MO2A 2QTBA 4XX1A 1UXOA 2XMSA 5HK9A 3LIIA 5LZ2A 4X3CA 3WMRA 5JASA 4C01A 3EBLA 1BE0A 4IO0A 2FUKA 2WIDA 5KBYA 1QIMA 2AJCA 3C5WP 5JZSA 4Q3OA 5AJHA 1UOOA 4FHZA 4UBIA 1JMKC 1MNAA 2JGFA 3D2AA 4IHAA 1TCAA 2HRQA 4D9JA 1FFAA 5CT5A 4J0JA 1KEZA 4AQDA 1EVQA 3M3DA 4E15A 5ALRA 1BEEA 1GT6A 3KSRA 1MNQA 3STVA 5DNVA 4W63A 3R3VA 1M33A 5CBKA 2DQYA 1MX9A 4X93A 1L7AA 1DX4A 3QMWA 4CCWA 5J3JA 2VF2A 3FCYA 3IUJA 3I28A 1XLWA 3JYHA 3G9XA 2WHQA 1W52X 1F0NA 5DYYA 2XT0A 2CKMA 3Q8WA 4V2IA 4UBOA 2ZSHA 5ALMA 3WIOA 4J0KA 3O4HA 3HYSA 1XKLA 5CXUA 4BDTA 2WQZA 4G1FA 4DNQA 4YK7A 4J3JA 4UPDA 3WK6A 2WILA 4BAGA 1QFSA 3JWEA 3ESCA 5K3FA 5ALGA 3PICA 5E4JA 5T4HA 5EFZA 2DSNA 4N8SA 3H2JA 1JJIA 4B9AA 5AOCA 5AI6A 3PDCA 2OGZA 2VATA 4KJXA 2BUCA 4K6GA 1XZDA 1GPNA 4Y2TA 3T4UA 2XMBA 4INZA 3CN9A 3W2TA 5EIHA 3KOOA 1XRNA 1DQZA 4H7DA 4DSZA 5EHQA 5AH0A 3PF8A 2QXTA 3R3WA 1VA4A 4K2AA 1YB7A 4GECA 1DX6A 3QBJA 3ZWQA 3W9UA 2EDAA 5ALDA 2RHTA 1CUEA 2VJBA 4LIPD 4YPVA 2ZJ7A 1YA4A 2ZJFA 4ZV9A 1DQYA 4AN0A 1QIIA 3DKRA 1W75A 1QO7A 1YR2A 4LXGA 1EHYA 1XZBA 4X90A 3MUNA 1E8MA 3D0KA 3WKDA 3A2NA 3KWJA 4MQMA 2PKYX 4BE4A 4FBLA 5HQ3B 3DL4A 4FBMA 5AHXA 3D7RA 4FFWA 4HRXA 3DJYA 2H7XA 3F96A 3GBSA 4AMZA 1HQDA 1WB6A 3E1GA 5C8ZA 2WFMA 4GBGA 3C6YA 4B9EA 3I2GA 1AMNA 3IULA 3A70A 2XDWA 5AM0A 1VOTA 3FCXA 4TPKA 4LXHA 2H7CA 3BXPA 4HXFB 1G66A 1GKLA 1E89A 1TRHA 3WKBA 3HSSA 5JIBA 5ALWA 4HVTA 5IH7A 4BVKA 1EVEA 1EXWA 1ZD4A 1BEZA 5ISMA 5CRIA 3WKAA 4H77A 4U2GA 1ZIYA 2XUOA 3SWWA 3D2CA 2JGMA 4G8CA 4PF1A 1CUAA 3UUEA 4G4GA 4GEGA 1HDEA 3C6XA 1EA5A 2I03A 1CVLA 5ALFA 4X7BA 1WCYA 4GI1A 4FKBA 4B82A 1WHSA 4FDMA 2OQIA 3M83A 2GBGA 2OG1A 3G9ZA 1DT5A 2CJPA 3HJUA 1H23A 5FRDA 3B5EA 1UK8A 1J1IA 3QVMA 1A8QA 3FYUC 1LZLA 5EGNA 2JIDA 1ZD2P 4K5QA 3DKKA 5AI5A 3AUKA 2B4KA 4RE5A 4E11A 1R9MA 1MAAA 3PF9A 2ONCA 1QIFA 1PFQA 3PUIA 1WHTA 1SOMA 2Y2VA 4Q34A 2XUPA 4CIAA 2PUJA 2HHAA 3BWXA 2C5GA 2WJ4A 3BJRA 4JYPA 1TIBA 4XJVA 4B0OA 3W06A 2WG1A 2OCGA 4F5ZA 2K2QB 4EB0A 4QDOA 2ZYRA 3V48A 2JGEA 4J03A 2XE4A 4P08A 1GPKA 4BVJA 4EY8A 1W6RA 3FYUB 3SK0A 1EDEA 3RLIA 1LPSA 4OU4A 2RI6A 1XZAA 5AI4A 3I6ZA 1UKCA 3HI4A 4OPMA 1Q83A 1XQXA 4AB1A 2DHEA 3G9UA 5DWDA 3G7NA 1BS9A 4Y2YA 5ALXA 4FOLA 3WIBA 1QTIA 4J0IA 1VJ5A 3G0CA 5ALQA 3N2ZB 1R50A 1FFEA 3ESDA 2VSQA 2DQZA 1XZIA 3B3QA 5HF6A 5AKYA 3WZMA 1FJ2A 1CUXA 2ACEA 2WHPB 4J0DA 1ACJA 4JEIA 3IUQA 5AK4A 3V1KA 1BCRA 5AM3A 5C8VA 2G4LA 4ZRDA 2PU7A 5SYNA 1MTZA 4BE9A 2J4CA 3ANTA 4ARAA 3NWOA 1CUIA 1VZ3A 3E0XA 2RHWA 1MAHA 1ODTC 4QWWA 1YAHA 3C8HA 3O95A 4EA6A 1XRQA 2GBFA 2R8BA 3AIKA 3D4LA 4ZXFA 4X97A 1TK3A 4QDXA 4P93A 1ZI6A 4JUIA 4C4ZA 3DLTA 5K3CA 3OPMA 3IVMA 4GXNA 2WIJA 4RE6A 4QZVA 2WJ6A 1XRPA 1Z68A 5LZ9A 4EY5A 3GUUA 1TQHA 1MX5A 4UBNA 4HRYA 4X6UA 5AOBA 4UHEA 4BP9A 4ZGBA 4OYYA 1N5RA 2I3ZA 3OM8A 2XQGA 2B9VA 2V98A 1R9NA 5ALYA 1ODSA 3JW8A 2HIHA 2VJAA 2XLCA 2J3DA 3I2JA 2XUGA 1B41A 1CUSA 2EDCA 3C70A 2HRRA 4FLMA 1THTA 5LZ5A 3NUZA 4BAZA 4MEBA 1O6FA 1J2EA 3DYIA 1LGYA 1BROA 2QT9A 4CI9A 5LZ8A 4OYLA 4TVKA 4RPCA 2IITA 2PSJA 3HZOA 1CUUA 4QEKA 5K3BA 2VT6A 5IVDA 3BIWA 5DLPA 5CXXA 1I6WA 1LLFA 2C0QA 1LZKA 2OPHA 2ZVDA 1P0IA 1WOMA 4Y7DA 5ALOA 5E2IA 1VE6A 3A6ZA 5A7FA 4WCVA 3A2LA 3H1BA 5IVHA 3CCCA 5JD5A 5E4YA 1ORVA 5LKAA 5YASA 4I3FA 3FBWA 3DEAA 1XFDA 3OC0A 1D07A 1E8DA 2WFZA 3O4IA 4BATA 2V97A 3C87A 3TEJA 4KE7A 4OCZA 2G63A 5F4ZA 3UUFA 4XIIA 4I19A 4UBKA 4ZWNA 1JKMA 3AZOA 4NS4A 1J06A 2WTMA 3ZI7A 4MWTA 4G8BA 3F98A 1UFOA 5ALNA 2CEKA 4IH4A 5AKZA 3WWEA 4BBZA 3DDUA 5AKIA 2ZSIA 1BCSA 3WA6A 2WTNA 1LNSA 1VE7A 1ODCA 1E8NA 1IUPA 1VZ2A 1CUVA 4C87A 1YS1X 1YAJA 2VAXA 1LBTA 3GFFA 4ROTA 2OCIA 4JYMA 5JADA 3C45A 4BAUA 3H18A 1QJ4A 4N8DA 3WKEA 3OG9A 1U8EA 2XUQA 4UHFA 3EQ7A 2Z3ZA 1JU3A 3FAKA 5JD4A 4JNCA 3LIPA 5JAUA 4AO8A 4PQEA 3QPDA 1UOQA 2XMCA 3RARA 1BRTA 3H2KA 1N1MA 5HZGA 3FWHA 3E4DA 3DL7A 3F97A 2Z8ZA 4L72A 4CG3A 1QIHA 2C7BA 2C0PA 4ITVA 1CUHA 2V96A 3O4GA 2G5PA 2J3QA 1ETHA 1ZOIA 1Y7HA 4LYEA 5LKRA 1UK9A 5A2GA 1DWQA 1P0PA 2RONA 4A5SA 1DWOA 4DTCA 5A7GA 4EZIA 5D3ZA 1UKBA 4GLBA 3S8YA 3QM1A 2UZ0A 1XQVA 5FV4A 5DYWA 1L7RA 4H18A 2R11A 5ALSA 1AQLA 4HTAA 4H7HA 4KR0A 3CN7A 1DINA 5AK5A 2IIVA 1CUYA 1IZ7A 4B0PA 2XQKA 1DTEA 1AURA 2PU5A 2XUIA 3VKFA 4MXDA 4C88A 1R4ZA 4G8DA 3R3XA 5HF8A 5JD6A 3WYNA 3QPCA 4BP8A 3QMMA 1PJAA 4BCCA 5ALPA 4W1PA 1EB8A 5AKXA 4H7KA 1XROA 5AK6A 1CR6A 2QUAA 4AZ3A 3STXA 3FVTA 4OB8A 3F8SA 4BRZA 1EK2A 4DIUA 1VLQA 1Y37A 3I1YA 4I4CA 5AK3A 1UT6A 4HAIA 2XQFA 4P9NA 1VXOA 1XZCA 4Y2VA 4IH9A 2BCEA 1S8OA 4N5HX 5ALEA 3AIOA 4QLOA 3GA7A 4QE3A 4YASA
chains in the Genus database with same CATH superfamily
1WWKA 3ZD6A 1ZX1A 4FK8A 5LB2A 2H1HA 4D9KA 3DVQX 1L4LA 1FRVA 4Y6RA 3IBTA 3RUFA 2I7DA 5JPCA 2PH5A 2GJ8A 3PPWA 4BNJA 1OQAA 3GG2A 2FWJA 1T5BA 2C1XA 2ZPTX 2BF4A 3T5PA 1WBBA 1TYBE 3MTBA 5K0CA 4I9UA 4LAFA 1NW4A 3NDBB 1LLQA 1QK4A 3GMDA 4PGMA 4U7FA 3F5DA 1JU4A 1WXDA 2C5SA 5IF3A 2KLBA 4IR7A 1E2NA 1N8SA 2I3BA 4K6HA 2I80A 2VAMA 3MS2A 4NEHB 1P5FA 3H5WA 4X6YA 3UATA 4EDFA 4DGSA 5I3CA 3AWIA 2EQ5A 5K09A 4MMYB 1PAUA 1XAGA 3NHBA 4AECA 1NW5A 4YO8A 1JWLA 3C3PA 3SNHA 4HGOA 1EK1A 2WWVD 2SCUA 2ZRCA 1Z7YA 1HLGA 1TF5A 4S04A 4KE8A 4M53A 5TQ0A 2NP7A 3RIGA 2VNIA 3RTGA 2H1WA 3FWKA 1E6MA 3EXFB 4KQCA 2PL5A 3VKUA 3OFND 3IFSA 1ODKA 2VI5A 1BVRA 3BILA 2QMEA 3DSRA 3DJFA 4MGZR 4RDCA 3TRFA 5BV0A 2YOGA 4WIAA 4X85A 2FN3A 4HT3B 1B7GO 5CA1A 1A9TA 3WLKX 3PD1A 3Q2KA 2YWBA 4ALKA 2Y4OA 3DH0A 3IRVA 4QU0A 1A9SA 3H1GA 3KQMA 1QRAA 4B34A 3AHHA 3FF4A 4YMSA 4LYFA 1ENYA 3GOQA 3PHLA 2GF9A 1H1DA 1H8HD 1M2OB 5BQ5A 4E94A 4IG4A 3KT6A 1OFUX 3L40A 1UC9A 5JSZB 2IDKA 1RAFA 5TQVA 1ZYUA 3W6NA 2XZTA 2BP7B 4PBSA 2WMYA 3IUBA 4NE2A 4GMXA 1JFFB 3HYCA 4YGXB 4KXNA 3ZS8A 5G0VA 2MMCA 3IVCA 1L7QA 1D7AA 3JAWB 4TQAA 2AEMA 4YP1A 1TNDA 4C6HA 1B8OA 3LLVA 5JE8A 1F48A 4XQEA 4E1AA 3EPRA 3I23A 2PH1A 3EEFA 4YN3A 4IF6A 1GGJA 1JYEA 1VIAA 1ESMA 4HYYA 6Q21A 4YJGB 4YCNA 4R3WA 4RPIA 5H5JA 1WR8A 1Y1KE 1Z82A 2O8FA 1ZGHA 2BEVA 3ENKA 1RWBA 3HR7A 3J81A 1Y1RA 4DQ0A 2QYTA 3QXSA 4Z4QA 3DQZA 1N2IA 2NN3C 1ZM7A 3L6UA 5CITA 2JGIA 4ND8A 10MHA 3C74A 2G67A 4IILA 1P39A 1AX9A 4LISA 3EOZA 4XWAA 1YB5A 4C7VA 4F5WA 4KLNA 2DWCA 4CLOB 1UDCA 1ULHA 1R3DA 4PN3A 3H1TA 1CU1A 3MAJA 2OK8A 2Q2NA 4UM8B 1D6SA 3CJTA 2BEWA 2JLAA 4KV7A 4UUMA 1DBQA 1QB7A 2E3JA 3QKSB 1KR2A 4N3AA 2W7TA 4FGSA 1GCIA 2QUBA 2MSDB 1BA2A 1BFDA 3IDAA 2LCIA 4I8IA 4EW2A 1KZ7B 1JEDA 3LT4A 1SNYA 5CT4A 4E5KA 3N0VA 4ADSG 1I2BA 2FMUA 2HJVA 2YFHA 3AQIA 4J6EA 4S1PA 5EZYB 4DLYA 4EY6A 2YS6A 1DU4A 3OTQA 1QC5A 3ZW8A 4ERNA 1J0CA 2PEZA 2E4XA 2FOXA 3EGXB 4MIYA 4DADA 3Q15C 1YGYA 3HXPA 4CEIA 1KJWA 1CZLA 4P98A 4MAFA 3LFHA 3UJ3X 5C3MA 2ZJYA 4IXWA 3Q7IA 3E9QA 1R8YA 1O5IA 3PFBA 4MV3A 4AF8A 2XWBF 4D56A 1IRXA 5K8IA 2WZDA 2EHDA 4FNMA 3PK0A 3ZZTA 5DTJA 1DL5A 2ZRNA 4OHUA 3F5SA 4RMJA 5BPFA 1UKVY 2V7VA 1TZKA 2EGGA 3HZRA 4DRXB 2Y0CA 1VXRA 3EEOA 1KAMA 4P81A 3ZJ5A 4FEEA 3OQJA 3VR4A 1T1GA 2ZRFA 3FXAA 3WP0A 2GN0A 3OQVA 4PLGA 2Q62A 3AIMA 3D7MA 3I5UA 1HE3A 2F1KA 2VP4A 3NT4A 3T5DA 4M0UA 1L5GB 1SXQA 4QFDA 4YIKA 1SG6A 4JVLA 3WKCA 2EV9A 3OZVA 4QXAA 2R96A 1G8FA 2OXTA 2G8NA 4WERA 5E6UB 1VPDA 3R3YA 2GYWA 2Q9UA 4A0SA 3PR1A 2A0KA 4QUGA 5FI5A 5FNZA 1EMDA 3OIVA 1A0OA 1GKIA 1GTJ1 2H4YA 2YW9A 3C5VA 3DYVA 4OSOA 1VCOA 5ECWA 4U8HA 2X22A 2ZIUB 5HGJA 4DUPA 4FYHA 4Z2AA 2QVXX 2CDCA 2O57A 3HGMA 2Z5GA 1NE7A 2AJDA 3BF7A 3HCAA 3WB9A 4Q3AA 5JYDA 1A9PA 3CMMA 3KZ1E 4TTRA 2AMLA 2W4QA 4LJKA 4DR1B 3FTNA 4LCJA 2OWDA 3Q3EA 5H3CA 1PGNA 1D04A 1HUQA 2VC2B 2I87A 1L7MA 3OOSA 3R44A 4L51A 3FZNA 4KPGA 1V8BA 4N0DA 2HXYA 3K1AA 1KYIA 2NQ8A 4NECA 2Z3VA 3G9TA 5BQXA 5A5GA 4X62B 5DTMA 1IY9A 2LV8A 3OPYI 1T1IA 1K8YB 1EQUA 2FEXA 3BGOS 3C7TA 4RF3A 1EAMA 1HE2A 3L0IB 5JJLA 2ZU6A 1G3MA 2OXRA 2QMQA 4LDRA 3PPYA 1JEQA 4Y1RA 1XTSA 5JDCC 3W5HA 5B6JA 1JIUA 1NSYA 1MIOB 2JGJA 2Z5LA 1IY8A 3IX7A 1ZSVA 3O9MA 3VM6A 3WKEA 4QVIA 2IH2A 3INRA 4QU9A 4AZ0A 3PQ4A 1KXZA 2AI2A 6NULA 1OT3A 1T29A 2R0QC 1EU1A 2QW8A 1SZDA 5IK2A 5LM3A 3VDXA 2C29D 3TOCA 1LVHA 3DMGA 3RU3A 3QFFA 2YXLA 3N58A 4LBVA 4JBYA 1IMJA 1UXKA 2FH5B 2WF9A 4Q3CA 4WK4B 3RTAA 5KNBH 2BM1A 2RCNA 3U6KA 3WQQA 1EBUA 5AXDA 4YRBA 2V7WA 2GI4A 4EAQA 3LLUA 5B1HA 4PHHA 4QJBA 4WDQA 4JR2A 2EFCB 4TKUA 1Y5LA 1DDIA 3CINA 1L8XA 2OZEA 1RZVA 4QQKA 5EKXA 2MR5A 2JLXA 5HM6A 2XMDA 1XYYA 1U3CA 1V5FA 3BIXA 4L27A 4YMIA 2FE4A 1BFUA 1MFPA 1QONA 2BTOA 2C1EA 2H4ZA 4X92A 3L1UA 4U3JA 5EG5A 3H3FA 5I9MA 4CV3A 1X39A 4N1AA 4ZMRA 3RRNA 2PRIA 2B3DA 3AERB 4UCFA 2Z6UA 1OB5A 1J99A 1QKJA 3E8MA 3AY3A 3MWDA 5K5EA 4H7EA 1UBEA 1XLUA 2CBZA 2XZPA 4W1QA 4PSCA 4P54A 5F12A 3THWA 1LTKA 1M5TA 1G8GA 2JIOA 3HVUA 5BV8A 4HRVA 4M98A 2FSUA 1KZ9A 2I99A 2ISCA 1WUKS 1WVMA 5A03A 2GZ2A 1B0AA 1HYGA 5GV8A 3B2QA 1P9NA 1S7GA 1SZPA 2PD3A 3FRJA 3KQQA 2C3PA 3GJTA 1DC7A 5HFNA 2QGNA 3MERA 1ESEA 3VXKA 3ZW9A 3GVHA 4BWGA 3IAAA 3CNOA 5JXIA 1LF0A 2O0HA 3AVUA 3M8KA 4HG2A 4KTTE 4NARA 2FSVA 3OHMA 3GROA 1MFZA 3RSGA 5KYXB 2V6JA 3OE1A 1KJQA 4MV4A 1KHHA 1RAGA 2Z43A 1BWPA 3D7SA 3O26A 3UYLA 4CCYA 1DZIA 2OB1A 3KQOA 3SHOA 5BV2P 1V9LA 1AGNA 2OAGA 2YFYA 2DPGA 5HOEA 4KAJA 2O8DA 4UNNA 1VRCA 3WQRA 1RCTE 3RIYA 5KCMA 1OX4A 4WY8A 1Q7TA 4BZWA 1E60A 3M6XA 4ZOLF 4F60A 3V7YA 1YRYE 4HDRA 1HDZA 2JAHA 3CR8A 5T4BA 3EARA 1G9TA 2GSWA 5JCJD 2ESRA 2G08A 2H4XA 3DB1A 4YR9A 1NBME 1RHJA 2XVXA 2FV8A 3QYFA 4QYIB 4F8EA 2FKNA 3N2KB 5TV2A 9GPBA 3D8RA 8MHTA 3T0IA 3F8WA 1SRQA 1I7NA 1WTCA 3AHCA 5HDQA 5C1BA 3KUXA 4B3GA 2Q0SA 5F51A 3C43A 2FCAA 2IP2A 1E9DA 2E21A 4O4LF 4O4IA 3K20A 3KTAA 1TGVA 2FSVC 1VKOA 3BQMB 2QG9A 1TMOA 4OFZA 3ICWA 4RZ3A 4ZRNA 1TF2A 2ROQA 3E84A 3A9SA 3P0IA 2CB9A 4HYQA 4MYTA 2Z57A 4ZOLB 3IODA 1BU8A 2W11A 4GE0A 3SEZA 1RXYA 2B1QA 3CIOA 1H0HA 4NU5A 1XZLA 2IPAB 2UV8A 3OIUA 2VZ0A 4D98A 1SC9A 1M9NA 3EHDA 1R4MB 4JLSA 5CJ2A 3WL5A 1IY2A 4Y9TA 3P9KA 2WZCA 5IEJA 4IOLA 1V9SA 3RTDA 3SKXA 4MYSA 1J1ZA 3UF0A 2X8BA 2W2MA 3T9EA 3INNA 1BJKA 4JGGA 5DCLA 4AJEA 3MC1A 1MHTA 4Y6SA 5UKDA 2B94A 2X7XA 1QIDA 4OQ4A 1PT8A 2KE5A 4A1FA 3F74A 5MGBA 1U7ZA 4AUKA 1M1YA 2B92A 2OV8A 3V1UA 2C5LA 5K0EA 4CKBA 3V55A 5H0IA 4FYWA 5B1SA 4BNDA 1Q84A 2QKYA 5DX1A 5AM1A 3DLHA 1FPQA 1SCIA 5KB3A 2QTCA 3WY9A 1UPFA 2AGVA 4RXTA 2IS2A 2QW0X 1Z62A 2D5BA 1BN7A 3AU8A 2ZRKA 1GGNA 3S29A 3S5JA 1WETA 4NONA 5LQNA 7MHTA 1G4UR 1XXLA 2RGUA 3P9QA 1K5PA 1SKUA 1CS0A 1XXHE 1E58A 5IN4A 3DT8A 3GGOA 3JAMA 4LZOA 1TW2A 1VECA 2P6MA 2Z3WA 3F6RA 2WUGA 1T4DA 3IPRA 5HW0A 1KEPA 4R41A 2G9RA 4J49A 3RD5A 4C06A 4KI0A 5HJEA 4KQEA 2FWAA 3R0XA 1BFKA 3CRZA 4RZQA 2HWWA 4B32A 3KJFA 2QTWB 5IMSA 2PQ2A 3KTOA 5BMVF 1U7UA 3GP3A 4O4IF 1VIYA 2XTJA 4UEQA 1E2IA 2MYPA 1H8EA 2IPNA 3OZBA 4GE3A 5K0SA 5HQJA 3HB7A 1YUBA 4E30A 5D87A 3OU6A 3JQFC 4EX7A 1ZICA 2O2IA 3M6AA 4GQIA 3AFNA 5D00A 4C78A 4HPWA 3CH4B 4EM6A 1GPJA 1MG5A 3IEXA 4JA2A 3NGMA 2Q0XA 2Z9CA 4F96A 3ZHCA 1EM8A 4NV1A 5KOIA 1DDOA 3PDUA 4JLJA 3VR2A 3M33A 1GD1O 3MTDA 4WV3A 2W37A 2Z58A 1F6BA 5K0FA 1TJ5A 2V6FA 3DMTC 3E3NA 3ONEA 3EZFA 2R9VA 1W88B 3BXXA 5BW8A 3L7LA 5K4AA 4XUGB 1RHQA 4AJIA 4BB6A 5BQFA 4JJ8A 1L7VC 2MYTA 4BEVA 2VYVD 3P97A 4PINA 3SYKA 1H2EA 3EY4A 2EP7A 3EFOB 1K97A 4YRDA 4Z53A 2WMOB 3OKAA 1XZNA 5FXMA 1S2NA 1R0LA 2PVSA 3EBOA 1V11B 3D6FA 1K7EB 3OT1A 2PQ0A 4Q93A 3DCJA 4GI7A 2GB4A 2BGKA 3RVQA 1F2TA 1X3SA 2ZRHA 1Q3KA 3QVJA 4RA6A 4C0LA 1PP4A 3K09A 3DKIA 3G0DA 4JELA 4MEAA 4XEHA 5AI0A 1C80A 3EJ6A 2VG8A 3KQPA 4PO1A 1I3KA 3CW2A 4HEJA 2A14A 4D9GA 2GA9A 2HTEA 3L6DA 1RXCA 2XA2A 1E2HA 1YS2X 2VR1A 4MR7B 5LOVB 1KZ1A 4CCAA 4CQMD 2HF8A 3OKCA 1IXZA 1RYZA 4CTMA 1V48A 4XIGS 2V5UA 2R751 1SC1A 4BO1A 5T67A 2QD3A 4Z7NB 2VAVA 1EQAA 3EIOA 1OLOA 1YULA 2WTBA 4KGXA 1NYLA 3H6KA 1QR6A 4EGCB 2G06A 2P1ZA 3W2EA 1MU0A 5DNAA 4UD2A 2WKWA 1Y9JA 4M1WA 4OHCA 4MI1A 3TW6A 3W90A 3HMKA 2GEFA 1AA9A 5TGZA 3HKCB 5IHXA 1E7MA 4HAWA 4BRSA 3BMOA 3F6YA 3HL4A 2JI7A 2I4NA 4URVR 1F60A 4TRJA 5THXA 4G07A 3WBJA 5TT0A 2BHNA 2F43A 5HKLA 3UGTA 2VVTA 4TXLA 1JTVA 3F1KA 4HB2A 4KC0A 5DULA 5HVNA 1RRFA 1SCQA 3IBSA 4PYKA 1OV4A 2GLTA 2PMKA 1E9SA 1VG0B 3H17A 2OKCA 3C98A 4E0BA 4Y2PA 1TCBA 1H3FA 4DNFA 2QRLA 1FDRA 2EVWX 4Q3LA 1F0PA 1B6RA 2AOTB 1VL0A 3CIFA 3M6VA 1NJSA 1ZGAA 3PGA1 4YBRA 3UYKA 2PL3A 3COZA 4WL0A 5EIAA 2HJWA 1JEEA 1NXVA 2CLSA 2L19A 3K0AB 2WU3A 3QSGA 4L15A 4MO2A 3UGQA 1TDJA 4EK9A 4MLCA 2K6GA 4TGLA 3AG6A 3GVPA 4GL4A 4XA8A 4EB0A 5CCBA 2X8AA 2B1IA 1GHTA 4R5HA 3TIGA 1PEDA 3IBGA 2PX6A 2OE2A 1M7HA 1QQ5A 3S6JA 3ZTTA 3ZDXB 4DVJA 4F2WA 2EFGA 2ACKA 3GJYA 3U3KA 3WLHA 3AETA 1Y0BA 2H2IA 4QREA 5BWBA 5I7HA 3R7DA 3UXMA 1KQ3A 1LPAB 3SZLA 3HKBA 4HQLA 3PVSA 1GQYA 1XXHB 4KIFA 5CVEA 1Y3IA 1JAYA 2WUEA 3EXIA 1Y7LA 5AW3A 3FPEA 4RACA 4Y9UA 4ZAYA 4TSRA 2WSMA 4BL5A 3WGIA 1W34A 2L17A 1KP3A 4M86A 4EX6A 1MV8A 1OA1A 4PCUA 3WLTA 1U0HC 3T1NA 4PHTA 1KEEA 4PY2A 3TXXA 1RLMA 3GZNA 1OJLA 4PQRA 1F0KA 5TRTA 3S55A 2JIMA 3SF8A 1VMAA 1UCFA 2PG3A 3O82A 4LSZA 4A2PA 4I2NA 4G4JA 1D1QA 2W2OA 2AG6A 2OV6A 1N7JA 2WHRA 1FFXA 4TMKA 1X1BA 1D4OA 5E0KB 1OU0A 4JT2A 4MUFA 5BN5B 2F7SA 2CUKA 4KQGA 3WRYC 4D45A 5IKMA 1JT2A 1LK5A 1UDRA 3EULA 1CCWA 1PFYA 2BDUA 3ELUA 4PS0A 2CFCA 4V0OA 3WAKA 3OCZA 4RM2A 2QTNA 6CHYA 3PSAA 1QHEA 3T3PB 1M73E 2W6CX 1E4EB 1K7SN 1T8RA 2JZOA 1Z3IX 4BNVA 3EFEA 4R01A 2JLWA 1CZNA 4OBWA 4RVHA 2LKDA 4O2BB 4OX9B 1CWUA 2WF7A 3K16A 1GZ6A 3PDHA 4L4SA 2EC5A 4MVJM 4WFQA 2J08A 2Y9MB 1GFSA 3HKDB 3QU4A 4BFSA 1SVMA 3AK4A 4BQPA 3NASA 3NNSA 3EDRA 3UJBA 5C5CA 1N3LA 3FCSB 5CLGA 2ZR9A 2WIGA 5K3AA 2R5NA 4DV5B 4MKHA 4MZDA 5CDFE 4JXZA 2GZRA 1OC2A 4BGVA 3JYOA 1KAOA 4O4HF 1DKOA 4ESEA 5COAA 1ZHOA 3HB9A 1OI7A 4EJ2A 1F6WA 3EXAA 5JS1A 3S2ZA 5DHQA 3CCBA 1MN6A 3N8NA 3MJDA 3ETDA 2W2NA 4IVNA 3KE9A 2Q4RA 4YX9A 4RLSA 1TF7A 2PSHA 1MENA 1NUSA 1Z35A 3CUEF 3WLAA 2C4MA 2DLCX 1CDZA 1GTMA 1THZA 3KSDO 4IKEA 2QPTA 4DV3B 1E7QA 5KOHA 4M7PA 1T25A 1NVWQ 4AWXA 1JQ5A 3GAMA 3EZ7A 2W8BA 3IDOA 4UBMA 4J3NA 3EC7A 2HDHA 4KVZA 2YYAA 4O4HB 3W5BA 1U90A 4DR2B 3OTGA 5EJIA 1H05A 1YZVA 2XZDA 4I9HA 2BFFB 4FB4A 2IY9A 3UXEA 2B83A 3BSYA 4B3MB 4H6WA 2JVJA 4F1WA 4MP6A 3KU1A 4B6EA 1W581 2V9CA 1WMFA 4YCMA 4DMCA 4UAJA 2XCUA 2IPLA 3DGEC 4Z4GA 4X44A 1IQPA 3A6EA 2DJIA 1X0XA 3S1AA 5FADA 6AT1A 2AX3A 4N3CA 1T4CA 1HR0B 2YNMC 1H42A 3IUEA 1Z6ZA 2C07A 3MPOA 3UOAB 4D8UA 3TLGB 1VL5A 5KDOA 4JCOA 3FPGA 1M54A 1WM1A 3MQFA 3OPQA 4UCQA 5DEOA 3ASVA 1QYWA 3D8HA 3DBRB 3H97A 1CRZA 2X3UA 4KXUA 4QEZA 3TDMA 2YY6A 2N46A 1PT6A 4DQLA 4PO9A 3REGA 3ROKA 5G0SA 3RC1A 2ZJ2A 1X7ZA 3DO8A 3L1IA 3LX5A 3UFXB 1XN1A 5EUCA 5I8PA 4H7PA 3O7WA 1OA0A 5KHOC 4CXMA 2YBDA 1NYRA 4HFJA 3IOBA 4GW3A 2Q50A 3HLKA 2AHOA 5DYNA 4FZRA 5EKDA 1YOBA 4BN4A 5B1YA 1PJ4A 4FC6A 1S1CA 1EZ1A 2Z8YA 4PRZA 3FMVA 3FD8A 3K9HA 2I8LA 1S6YA 3FLEA 5FD8A 3HUFA 4AROA 4DQUA 2K7FA 3EOBI 3GLIB 3DVLA 2VPIA 5HP4A 1R8JA 1VA5A 3G7UA 2VTBA 4MDEA 4J2OA 1NM5A 1JDPA 4ZVOA 1QAOA 3WE7A 1DCKA 1T24A 1RYBA 2FJUA 1ZLYA 1T9GS 4P3XA 3TZEA 4D0SA 3U7GA 4XRGA 4PLHA 4FYIA 3BD6A 1TVEA 4AUEA 3E3LA 4KN9S 2EARA 5CGZA 3H2HA 3GJ4A 3SX0A 1UZAA 2XOKA 3G1TA 4GVLA 4WZ6A 5LQKA 1VPTA 5F1OA 3PNMA 3O31A 2TS1A 3PD0A 1XQ1A 3KR0A 2IEZA 1E3WB 2NSYA 2WWFA 3B2NA 2YIDA 3BD9A 3NOOA 3AEUA 1ZJ5A 2PT7A 4MVXA 1I1OA 1P7CA 1JJ7A 1UZLA 2ODWA 3LQ4A 3NTLA 1C9MA 1FS6A 4NIMA 4YCDA 3BHJA 1M1ZA 1QGYA 3VR6D 5JTUA 1QGED 3S2YA 3T5MA 1GGFA 1SUWA 4R6XA 3U60B 2VDRB 3PLAE 3A0RB 3HYNA 2XDYA 3T7CA 2P3OA 1SU4A 2ZTUA 3LLCA 4RV4A 1WQ4A 1LPBB 2A9QA 2R4UA 3J80A 4NJEB 3IV9A 4GXQA 3ETEA 2D2VA 3KKPA 2JCXA 2UZAA 4V0KA 4KAXA 3EVZA 5JZ9A 4RHYA 4G09A 2GN8A 2DTDA 5E38A 3TSYA 1M8FA 4JDPA 2NU8B 5BRAA 1HL3A 2LKCA 2WD8A 3NJRA 4HMPA 1NG9A 4UD6A 3K9WA 4DV1B 2WFLA 1EEXB 1ML3A 1Z4IA 4JI1B 3W6PA 1TTTA 4B3RB 4J7UA 4PSUA 2KMLA 1T34A 2C95A 4EA7A 2VJOA 2TECE 1ZD8A 2VJPA 1OTYA 4QU5A 1VGRA 4Q4AB 1WPXA 5EWJA 4NSNA 1VJTA 4LKRA 5CT8A 1QV6A 2O2HA 2NO1A 2MTBA 4IQGA 4AJ4A 2QGZA 1N32B 4ZZ3A 2HLHA 4TVOA 4DJEC 5THKA 3H87A 3U0VA 1K6JA 4Z9YA 4YAJA 1H22A 3EDCA 3QLVA 4EO4A 3I05A 3K0KA 3M3HA 3NGLA 4G2TA 5JSQA 1KTIA 3GJSA 2VP0A 5ALZA 1U8AA 2JZCA 1MKYA 2GA8A 3UCEA 3FMIA 2X7HA 1AXEA 3IBFA 2W70A 1HETA 1XO1A 2J32A 1T6NA 3OCXA 4WK0B 1ZP6A 1PW7A 1SBIA 3VR3D 5AUNB 2GCEA 3S0JA 1FB5A 1SZJG 2ZIXB 5L3SA 4UMVA 1ZXBA 1OH8A 3QUTA 3DBIA 1RLJA 5LZ7A 1WW2A 4KQFA 2ISQA 1PX0A 3SIXA 2RCYA 2HBZA 1YDWA 4AO6A 1PFWA 1XI2A 1N6KA 1KH2A 1C1HA 1ZL2A 4UE6A 2CJWB 4H27A 1OI3A 1KDOA 3K6JA 4QTYA 3I42A 1IU9A 3ED1A 2IYSA 2HO4A 1XQ6A 2QRGA 1HK7A 4KXXA 4QLAA 5SYMA 2ENUA 4YRJA 3TDNA 2XMRA 3WWCA 4ZCRA 2X2EA 3KV1A 1VBFA 2DKOA 3RJMA 3VU9B 4CEJB 5B3JA 3L41A 2VSYA 3F9CA 4LJSA 1E66A 1YOVA 1DB3A 1QVRA 2O06A 3I39X 4ZICA 3CLKA 2JJ2D 1XR3A 1SR8A 5BXYA 2O5RA 3NRJA 4YV0A 2VUHB 1JP7A 3RROA 1T91A 3WGYA 4D0LB 2WUDA 4PG7A 5JSKA 1JHUA 3PEFA 4P31A 1JZQA 2PS1A 2Q21A 3A9VA 2XTNA 4PGFA 1Q7BA 4LYJA 2GILA 4RSGA 2AQIA 4TXJA 5B7QA 3ZE8A 2HHLA 4N0MA 5J1SB 4QATA 2B0CA 3DHEA 2XSZA 3WO0A 4KAAA 2OHIA 5JANA 4HQOA 1DIBA 5ALLA 4GGMX 4OHXA 3IXQA 2G5GX 1NLYA 1M66A 3UHJA 4I1YA 1TZCA 1G6HA 3JZAA 2EATA 3PGJA 3GEGA 4W9RA 2ZBUA 1KO1A 5KYTA 1VPVA 1R0KA 1PNOA 1V37A 2P7IA 1D4FA 2ZIAA 3MWEA 3P26A 5C4MA 2BEKA 3EQZA 5LP1A 1XA3A 2FQXA 3BE4A 3LW7A 4HAZA 5DN6A 5EXDA 5B3JC 4MQLA 1E20A 4MWBA 3YASA 3SFVA 3MGBA 4KHZA 5C7OO 1N57A 5E4YA 2P1RA 1PV4A 1JB1A 4ZVQA 1FUEA 4YRPA 2AFHE 4S12A 2Q3DA 4GD3Q 3WSVA 3IQIX 3JQBC 1ZMOA 1JMVA 2Q6OA 4Y2JA 3DBLB 2G5CA 2GZ1A 5AJTA 3K4PA 2FMKA 2MIIA 2J85A 3B9RA 3E7DA 3DBOB 3OT4A 3WAJA 1QGAA 1W35A 2ZATA 1PHPA 1N8KA 3PIDA 3A6DA 1Z6PA 4JVSB 1O0SA 4L76A 4J94A 1URPA 1Y1TA 5DHPA 4Z0HO 4ZDWA 4UEWA 4BNNA 5K6TA 2UZ4A 5HFAA 2P6RA 4FX2A 1T35A 3T99A 5A06A 4HL6A 2M1XA 3C2QA 1UFVA 5IJ9B 2WRZA 4L74A 1A5ZA 4ZMBA 3GF4A 4MYDA 1N6OA 4E7OA 1T0UA 3PGVA 4PPNA 2OAP1 4MROA 2O8BA 3F7MA 3A0UA 5DI3A 4QD3A 4RH1A 2OBFA 4H3VA 4Y8VA 4TKVB 2REQA 4V0RA 4B6SA 5L40A 2GFHA 1XAHA 3WDKA 1P9OA 4D42A 1F2VA 3QKIA 1QIEA 1KTVA 2Y0BA 4QKQA 4X64B 5A4IS 4ND1A 1T2UA 2YQ4A 4IF4A 4TQUS 3QX9A 1XBTA 4YAUA 1VE9A 5LP6C 3WV5A 5K0ZA 3JQEA 3CVJA 2NYRA 1C1XB 4NNJA 1U6JA 1WZIA 4AJ2A 2EW1A 2ZR7A 4F4HA 5K8VA 1L8AA 3H19A 1WCIA 3KJQA 3E3AA 3M49A 1JG7A 4HHEA 5ALKA 5F2KA 3ZI4A 3NV9A 3U6BA 3U44B 1DPFA 2FPKA 2HU8A 2HA0A 3VR5A 1SBHA 1K6EA 4ECEA 1V41E 2JGDB 5C1IA 5T5QA 4F97A 1IPFA 2EZUA 3F4KA 4GPZA 1PDWA 3L0PA 2GZSA 4N82A 4RS4A 1ESCA 1X7WB 3AR7A 3IHLA 3CNQS 2C9MA 3MILA 1DFIA 2J9ZB 3NBXX 2IHTA 1XDBA 1AUOA 4NYJR 1THGA 2J0EA 1LXCA 2HM7A 4PO3X 2PUVA 4BJ6A 1AOXA 3S1LA 3LZCA 2QU7A 5A04A 4DV0B 3CSDA 3SZUA 1H5UA 2HV9A 5JUWA 1IBSA 1UIMA 1KAEA 3DV0B 1IQ0A 4L9AA 2DQ4A 1QE5A 2ZI7A 3FPAA 3BWEA 4GWLA 5JS7A 4TUYA 3CLTC 4QQNA 1W8DA 2EW2A 4Y67A 5LP6F 1K6IA 1PGOA 4AF6A 2B21A 4QOGA 4X7MA 4DSTA 3GMTA 2D2XA 2JB9A 2VQFB 1NY6A 4QUAA 4M0KA 1VLMA 2EFHB 2WM2A 5DNEA 2JBHA 3RK4A 3RT1A 3C39A 3TTWA 4OQMA 2GESA 3H04A 2VWGA 5SY6A 5JAOA 3F49S 4Q4LA 2OBMA 4OQDA 1ZH6A 1USVA 3QBDA 1TE2A 3BOSA 3TS1A 4AX4A 1UBCA 3GFOA 5J2TB 1NLMA 4FIZA 3HPRA 4JHLA 1HLDA 1PWEA 4HEA6 3C3YA 2NUTA 2R66A 5B4TA 4LNUA 1Q1AA 3QHAA 4ZK6A 1XNHA 3O1IC 2ORED 4HGRA 3N8GA 1SCNE 4ZVMA 1SQSA 1UPAA 2AZTA 2P3SA 2ZWIA 1GTVA 2A78A 3LC7O 4KYVA 4D9NA 2G0AA 2HTFA 4LNAA 4QGGA 1AGPA 2C3OA 2NVBA 5HF5A 3WZLA 1A72A 2EU8A 2H5EA 2ZUEA 1ORHA 4LYGA 5KEIA 1QDEA 1KI3A 3SDZA 1O95A 4C4SA 2B2NA 4CIBA 1XEXB 1OXMA 2VF7A 3B1YA 3P71T 4YMHA 4FZJA 1GTSA 4DE5A 2C2GA 3N07A 4JXXA 3LL7A 3ETJA 2VPWA 3PGMA 3T9BA 3WWDA 3D6UA 3R0VA 3W9YA 3WQHA 2NVUB 3A6GA 1QOQB 4DA6A 5K6RA 2XIJA 3TMYA 1WMBA 2M9MA 2WAYA 1KKMA 2H9AA 2Y1KA 3AM3A 4QASA 4XSVA 1K88A 1TYDE 1SC3A 3AHFA 3SYMA 4BQIA 4JSTA 1P7VA 4E3ZA 4YXWA 2AFHB 2WQ7A 1BEUB 4FR5A 4HMQA 5AI8A 3G9QA 4ZTZB 3GNLA 1KOLA 2D3TA 3HABA 1Q2XA 2I33A 5ALIA 9LDBA 1ID8A 4BO4A 3TTTA 3U4AA 1GAWA 2WJJA 4JD5A 5FBWB 2JLYA 4K6MA 4PC1A 3RSLA 1F8UA 3CCFA 1I0LA 1W85B 1QDLB 2AB0A 5F2OA 1UQRA 1UWCA 5JW6A 2JGNA 2YZ2A 5G2OA 4WCFB 4HUQA 2J31A 2QJRA 1O95C 3IR6A 3WOVA 3QFTA 4IVRA 4H1HA 1A4UA 5CYOA 1M8KA 2QUKA 3TM5A 1IPEA 3E8XA 4E12A 5LR6A 1FYEA 1YFKA 2R8PA 4E07A 3V97A 3AM1A 3K5IA 2P2SA 1AT1A 4LJLA 4UFNA 4JI4B 3ZLVA 2CVFA 4LRTB 3SZMA 2QQFA 1O5OA 1SQ5A 5CDYA 1NMEA 4ER6A 3K6KA 2ATEA 4O4JB 1ULTA 4M22A 1VE3A 2AE2A 1RRVA 1QO9A 4FSHA 3T12A 3VSAA 3I32A 3R8XA 3LY5A 3WLMA 4C4RA 1WZ2A 5DGIA 3EH1A 5E7QA 1V95A 3Q7SA 4P4NA 2XT9A 1PVDA 4ANFA 4B46A 1T5HX 2PLAA 2EJCA 2J0SA 5ALTA 3OMXA 4WA8A 3T38A 4M99A 1UAGA 5A6SB 2PKCA 3RYIA 1R6VA 5G1OA 1TFRA 1BXZA 2W9XA 4G63A 3ADOA 4OP1A 4KKXB 1IUKA 5F9MA 2VH1A 2WWTA 3FHLA 4NZZA 5JC1A 4EY3A 3FZYA 3UT0A 2X1MA 4UVIA 2HU5A 1M72A 5H4GA 2QRJA 2BJHA 5HCUA 1ID1A 1ILWA 2PZEA 1BW9A 4MKFA 3C48A 1MH9A 1CNFA 3EGIA 1W0KA 3I6BA 1JHAA 3OP1A 3LKBA 3MD9A 4GI3A 5C51B 1CEEA 2JLUA 4YCSA 4I14A 4XASA 2X86A 4DNPA 4XQCA 1X2EA 3E27A 4PO8A 1XEFA 3GRAA 3Q7QA 4MHOA 1UL1X 2I6QA 2H4HA 3O03A 4XIFA 1LBSA 2O20A 5AJYA 3U7FB 4N5DA 3KCNA 4AO7A 3UGKA 2I62A 4JNKA 2WICA 5FORA 2ZYHA 1PBNA 1WXGA 3Q3IA 4UUBA 5DZSA 3QLUA 1JG6A 2GPAA 3BS4A 4XYBA 2P2YA 1KDTA 2QRZA 4PXYA 2FPPB 1GQFA 4ALJA 2WC1A 1H1TA 5ICSA 4CKEA 1ITZA 5CJJA 1PE0A 1RLTA 2PLRA 1C7EA 4LPSA 1FYDA 5LYJB 5FV7A 4JYZA 4EQ6A 1KVSA 2XWSA 3LZ6A 4JITA 4MKIA 3MVEA 1P74A 3GVXA 1ULBA 2QY9A 4DLUA 4BVHA 5FOSA 4PAOA 3PIRA 1H2XA 3CUTA 3FNQA 2UYGA 4Y98A 3CV3A 5KVQA 1DLIA 2J07A 4RESA 1RQ7A 1WZEA 5KTTA 1R15A 3KELA 1RIIA 1W5TA 3PNQA 1WB5A 2EX1A 3AQ4A 1TFUA 4LS3A 3C7AA 2UVPA 1Y6GA 2WTEA 4R3UC 1G20A 1TEHA 5HBRA 2OBYA 2V5VA 4WLFA 2D0DA 1W1IA 3BCUA 4RQBA 3CLSC 4HAYA 5HRAA 2R44A 3O8QA 3WL4A 1MEOA 3HDTA 1OPRA 2ZQYA 3G2KA 1ZM2A 4F0JA 5JVDA 3M6IA 3QLUC 4FYVA 5DX8A 4N01A 3REFA 3LQRA 1PL8A 1NW9B 5BN4B 1R9GA 4MW1A 3SDSA 4C6TA 1MO5A 5FWYA 1SVKA 3FOEC 1S0UA 2V7GA 4LJ8A 4N41A 4MSUA 1HDYA 2J5XA 2O2ZA 3P9SA 1TQ8A 5EZ6B 4ZU1X 1QV9A 1XWIA 5CVCA 3BTOA 3IP7A 3HM2A 3QF4B 1A5TA 2JEZA 5BSRA 1GZ3A 3PFWO 3EHEA 4G0QA 1IONA 3OHSX 4HF7A 2X0KA 3T3IA 2IXFA 3Q41A 3K0FB 2GYUA 1KDPA 3IAM1 3L6CA 1UIRA 1E63A 1DEXA 2HQSA 4JEUA 3G6WA 2PX8A 3HRKA 4NAVA 3TTSA 3Q8MA 1EXMA 3S1SA 2P9JA 5FCDA 4CM4A 2BDTA 1ETUA 2ZJAA 5G41A 5EMKA 1Z7WA 3BL8A 3SXUB 4HWRA 2OZVA 3QPAA 1UMCA 2O2DA 1U2EA 2ZT8A 4G2NA 1CFJA 1PL0A 1ZZEA 3LHFA 2DG2A 1EEHA 5DNCA 1MGPA 5T3UA 3AZQA 3E9RA 4R2HA 1RJGA 2P2LA 3KAPA 4JI2B 2CV0A 1NV9A 2YJ5A 2IBMA 2X14A 3MLBA 4JP3A 2GJ4A 1MJFA 5EKTA 2XUAA 4I6JA 3ZU6A 3I4FA 4F93B 2HGSA 1F51E 1W1WA 1QHNA 3MK31 1WG8A 4FQ5A 1TPYA 5LYYA 4US2R 4HFMA 1N4DA 3A9TA 4IAOA 4X1YA 1NQXA 3BGVA 2PPVA 3D6JA 4B3BA 3EMKA 3VRHA 5KNLA 1DJNA 1DAIA 4WW0A 4MA0A 1IULA 3ZQJA 3MHTA 1OLUA 2RHOA 1OZAA 3FI0A 4H9GA 3UK7A 3W77A 2ILTA 4CDMA 4OMDA 4LGYA 5JYEA 1USIA 2XITA 3AEKA 3FAZA 4HQRA 1XK7A 3T1QA 1XK6A 3WLOA 1U8FO 1KSHA 3LIIA 5HK9A 3PE4A 3OOEA 4PHCA 3RSCA 3C3BA 1JEYB 3T6KA 2FUCA 3WMRA 2XCTB 4LDJA 4IIGA 4BECA 2JH9A 5JVDF 4CM8A 3CLUD 5HA5A 1LTHR 4DC1A 2RG7A 1AMUA 2FPLA 4I4TA 4HNAB 4YFYA 2WIDA 4QFBA 2FKAA 4INAA 5GONF 5EESA 1J2UA 1USGA 2QVYX 2WSSD 3HBNA 5BSKA 2VHYA 2P4QA 3NJ4A 1P5RA 4G5OA 4NBLA 3X2FA 1QB8A 1QNLA 5E7MA 2QV7A 1PW5A 4NZ9A 5K8UA 4DBZA 2X2PA 3EVBA 2P69A 2PJDA 4Q6BA 5CVUA 1JPNA 4ITUA 4EELA 2HRQA 1BYIA 2QL9A 3HADA 4PLPA 4UARA 4I5FA 1PK7A 3TZKA 2YBEA 3A4MA 2IEAA 2YWRA 3ORFA 1RMTA 4XE5A 1WCXA 1ZMRA 1QF6A 3M3DA 4O6VA 4E15A 1P81A 1XC7A 3FMOB 3FPHA 3VTAA 4L22A 4W5OA 4DQKA 4KIUA 4CTJA 2BEUA 3OECA 4MR8A 1BEEA 1GT6A 4CMBA 4YQFA 2EHJA 1FX0A 4A0RA 2WYHA 4MQEB 3STVA 3AR2A 1DKNA 4RVUA 3FJYA 4X60A 1JECA 2P65A 1U7OA 1UANA 3BVPA 3P52A 3IKLA 4PHGA 3SJZA 4AUNA 2DQYA 1QZZA 3GBPA 4IZHA 1E6EA 3ZQ4A 5CPBA 3DV9A 4HDCA 1H1LA 1AQ6A 4G81A 3UW1A 2AN1A 3CY6A 4C0HA 2QBYA 3TIFA 1XLWA 4S1TA 4MV5A 5EUQB 4HDKB 3T35A 1G9XA 2ZCVA 5BYAA 2OV3A 2DY0A 3ZOKA 3BRQA 5A2QA 4CIYA 1DTWA 2H7VA 1L5OA 2ZWOA 2ZSDA 1YMUA 3PCRB 4FBGA 4FOTA 2FOLA 2J9GA 3I5XA 1ACMA 4V2IA 1F3LA 3CX4A 4NABA 2H17A 4G24A 4TMXA 3HJAA 3C1UA 4J0KA 2EZTA 5EXTA 3K7EA 4LE2A 4WBNA 4TX1A 4XWTA 5DEIA 5A02A 1N2ZA 5JNRA 5CXUA 3NHPA 4BDTA 2XB9A 4G1FA 1CDEA 3VU3A 1OV6A 4QX6A 1IEVA 1Z5NA 2WMDA 4I4TF 2FUG6 4DNQA 1K9SA 4RQTA 5B58T 1Z2DA 3H2YA 4FINA 4G0UA 3LYLA 5TQ2B 1ZNZA 2VAPA 5A4AA 1XP8A 5K3FA 1W5FA 1JIVA 5A4DA 5E6RA 2YL2A 2H06A 1Y3BE 4C08A 4EYOA 4LF9B 4ZDKA 1EGAA 2HXSA 4N8SA 1XKXA 1QCDA 1HYBA 4YALA 4DDUA 3L7MA 5J2UA 2FK8A 1KRHA 4GF5A 2AN5A 4L5CA 1NC3A 2PZKA 1KOFA 2Q5IA 4YRMA 1LBEA 1VHDA 4DEXA 1ZJJA 2YQZA 3MOSA 2GJSA 1P45A 4GX0A 1EFLA 1Q57A 3KZKA 3VZSA 4OL0A 1DRKA 3CKLA 4YRAA 3ETLA 1I8TA 4QQRA 1I4TD 3MS4A 4L78A 3O8DA 5AFSA 2A5LA 1J0EA 2YMMA 4FU0A 2VCEA 4MVJA 1YE5A 4I50B 1BGVA 4WKCA 3BGIA 3LP8A 3ZZ1A 5I9NA 4DCUA 5EIHA 4OF4A 2PFSA 4BMZA 2PBRA 1XRNA 4AS3A 3IXLA 4J0EA 2ZAOA 1KYYA 5EQJB 4EQZA 4F45A 2BGUA 2FZ5A 3H9GA 3QJ5A 3HCOA 1A4RA 3AI2A 3BQNB 5I8ZA 4DDWA 4D26A 3H9UA 1WUYA 3PFKA 4OQEA 3B7PA 4G37A 2AQKA 2QRPA 2OV1A 3PF8A 2QXTA 3EVDA 1RTKA 1FU4A 2QIOA 3O91A 3QXHA 1WPGA 1U28C 3T4PA 4JYBA 4AWAA 3H2ZA 4O0MA 2ZCJA 4II2A 1E2EA 2DTEA 3N3AC 4GECA 4EJ6A 4F2HA 5H9WA 2HRBA 1X8LA 2WFAA 2IEIA 4G97A 3P9PA 4JI8B 1ZU5A 4WBNF 4X84A 5JSUA 2B7LA 4XWYA 1T1JA 2EDAA 3U7QB 5F52A 3IVRA 2RHTA 3HJGA 1L5LA 4ENUA 4XCVA 2WDZA 1X7DA 3GL9A 4LY0A 4U02A 4DW8A 4DM4A 1EUQA 2ZBFA 3D2LA 4ZV9A 4OFBA 5BNZA 1UINA 2BVNA 2DBZA 3GYBA 3ZHQA 3WGVA 3DKRA 4ABTA 2N1BA 3FB1A 4FNAA 2PVPA 1LTQA 4M7OA 4OXRA 1ZG3A 5COBA 1A82A 3RNLA 4OHMA 3WWYA 3AJEA 2BH9A 4PXSA 4KDFA 1K4KA 4GZ5A 1GP2A 1JBQA 4HDSB 5JISA 1YR3A 3ZX4A 4CMKA 4LDPA 3EW9A 5J2UF 4CGZA 1P1RA 2WT8A 4BNLA 1KYZA 1MAVA 2JIZD 4LA4A 1X7XA 5D3QA 2JPDA 3HFGA 3HG7A 3KU4A 4O8ZA 3K9QO 2Q1UA 1EHCA 2PKYX 4LJ6A 1QYRA 1XWWA 3DL4A 2LVBA 2O8CA 2HH9A 2P41A 4TT3A 1ADGA 1V8ZA 1XNJA 3GJZA 4MRSA 2N9UA 3M3PA 3SS7X 1W25A 4QBGB 1IXRC 5AHXA 5AYVA 3S5UA 2WI8A 3NIFB 3KP1A 2A59A 4TKMA 3KHUA 1LY1A 2BD0A 3IMKA 2A86A 3JSXA 1U3DA 2PGAA 5CEFA 3BT7A 3GBSA 4QVGA 3AR5A 3JWHA 2O8EB 1A1SA 4W5NA 4FFPA 4XQGA 1LWNA 3EZNA 4U2DA 5COQA 3RFTA 1HQDA 2N47A 2Q2QA 1KAGA 2C61A 3QLEA 1WB6A 4K9MA 4D9CA 3HS3A 5KJEA 5C8ZA 1M1XB 4PCAA 3W4JA 1NYTA 4UOEA 4EBFA 3PP8A 2OFOA 4PR0A 4MUBA 4YUZA 4Q6WA 4RD1A 4B9EA 4ZEMA 5TY0A 3VHXA 5E1OA 1LI7A 2CF5A 4M0PA 2J9XB 4WN9A 4BYGA 3HXQA 4L28A 2HJGA 4PWZA 2ZW9A 1UC8A 4ZT3A 3ILYA 1UDWA 3FCXA 1CR1A 4XWOA 2IOYA 1GG5A 4LXHA 1TIKA 4RFLA 2ZUWA 3IDZA 2ZPAA 2GYYA 2W6JD 1F4VA 3B7WA 2QSYA 5KYUA 4I9FA 1Q0SA 4FCVA 1SUFA 3LCCA 3PRKE 1E89A 2QN2A 1TRHA 1ENOA 4R7TA 3HSSA 5JZMA 1BMFA 4H6VA 4MRMB 4F9FA 5A3QA 2I6SA 4HOYA 4MS4A 2IV7A 4BFCA 4DV7B 2CB0A 4BVKA 2QUIA 4ZVLA 2APJA 3KT0A 2EBUA 2L2QA 1C7QA 4P86A 1V5WA 2IHKA 4UVHA 5E2AA 5LQJA 4OXYA 4RAOA 2FZVA 1SXHA 4YJFB 1TRKA 3WKAA 1A7KA 3E22B 1ZIYA 4RVSA 2O6LA 4GKVA 1V45E 4X20B 2XUOA 3KUDA 3ASUA 3DZGA 2HUNA 2R1VA 3E5MA 3RYHA 4EUKA 1H2RS 2V7TA 1D6MA 3BXOA 3IR5A 3OZUA 3Q3HA 3VBEA 4YMTA 2XKBA 1HX7A 4RVGA 2JFUA 3TECE 1CUAA 3TL3A 4TQGA 1IIRA 1R8SA 1Y6ZA 1IPHA 2OHFA 2I7CA 1M10A 2W6OA 5JJ5A 1EDOA 3C6XA 3V4FA 3QBVA 2HT1A 1NBMD 1CVLA 2XBLA 2LDBA 3COYA 4URYR 4X7BA 4YECA 4IOJA 3MMSA 1NPDA 5SY4A 2LW7A 1KK1A 5TC4A 1B0PA 4ED9A 2FPWA 1VJCA 3AY0A 3VNUA 2ZEJA 1WHSA 5BVHA 4BV9A 1GR1A 4IEIA 3FW1A 3IJRA 2EG9A 3M83A 2OV4A 4KDEA 4NOJA 2QROA 1UZNA 4C0KA 1JAXA 1X1AA 3HB5X 4P8RA 4B79A 2OG1A 3TDKA 4R8SA 2DPHA 2CJPA 3GLKA 3OZEA 3PEEA 4WPGA 2VNSA 2C2HA 1OFVA 1W5AA 2W4IA 4TVSA 1H23A 4JYAB 4PC2A 3VYSB 3M2TA 4BLWA 3KSUA 1PR6A 4GX5A 3JQ8B 5CM2Z 5FRDA 4DAEA 5JS2A 3DZIA 4NOLA 1GZSA 3UJ7A 3DGFC 4PRYA 1JE1A 4QG7A 2CUNA 4NJOA 3LZDA 2RI0A 4MLPA 5LQSA 2QP3A 4K9LA 1OD6A 4TLLB 4EO9A 4GBED 1HORA 2XNDA 1H0KA 5CA1B 2XZLA 5CVTA 1EFHA 2PKQO 3NANA 3SY8A 3DUFB 5EEGA 2XTZA 3R6LA 2EYQA 2QQ5A 1YIOA 2PD6A 3L07A 1ZS9A 5E8RA 3O3NB 2VYFA 3PF9A 4EB3A 3TQCA 5KAMA 2X15A 1QIFA 1U2QA 3IE0A 3T9AA 4BB5A 2BMEA 2C04A 1KI6A 5BY2A 3VZPA 4R0MA 3INGA 2BDEA 3RBXA 3S70A 3C1TA 4J76A 5B12A 4KO1S 2IHUA 3ZY3A 1WHTA 4EYGA 1SOMA 5JWOA 4AQYB 1JB9A 3FYDA 1XD2A 1U5BA 2Y2VA 3THOA 4TTJA 2XUPA 5JAZA 3LG2A 2XKAA 4L9RA 1A9QA 5ADHA 2C5GA 3G49A 3D7NA 1QZXA 1K8RA 2YS7A 4HLDA 4DMRA 4JYPA 1YDMA 1LBHA 2E6KA 3PVZA 3SQMA 3LPDA 3TSCA 4XJVA 4BU0A 2PNFA 3W06A 3SVLA 4Q7MB 4X1KB 1ENPA 5JD3A 2GJ9A 5JBQA 2O8FB 3ADPA 2H07A 3RAJA 2K2QB 1C4WA 2FQQA 1N0VC 1NYQA 3KB8A 3CX7A 4YROA 4ND8B 1YL7A 1B0ZA 2ZSEA 4RJJA 4W6QA 3W5CA 4XQ0A 1SC4A 3VSBA 1CF9A 4XPIB 1T2CA 4ZAZA 4WXPA 2JGEA 4Q48A 3V48A 2DLNA 4KQ6A 1A8HA 3FCAA 1CULC 3MJFA 1FP2A 3LCJA 3OLVA 4HNHA 4EY8A 1WXXA 4UTXA 4D8VA 4KQ1A 1IK6A 4PX3A 4X54A 1PYOA 1Z63A 1X38A 2NXJA 1ECPA 5TEWA 5KTRA 4OU4A 1OLSA 3PGXA 1JQ3A 2CLFB 2OHXA 4COOA 5HR5A 4K6OA 1ZA1A 2GT1A 2BI4A 2H1RA 1UKCA 4O33A 3BA6A 5CIWA 1QP4A 1Z5GA 4CLRB 3SPXA 3RS8A 3LC2O 4ZQCB 3U7EB 1L2TA 4FDAA 4ER5A 1VYTA 5BOSA 3FROA 4H1WA 3W3AA 1RPZA 5K2OA 2IS4A 1GA1A 1KI8A 1JYSA 2FE1A 3G7NA 4DHWA 1BS9A 3GNTA 1P1IA 4IMJB 1Y4UA 1BG6A 1LX6A 3SR3A 3EZXA 4OJYA 3GUHA 4LWPA 1VJ5A 3L7AA 4PR3A 4ZZIA 3KG2A 3PYMA 4KO4S 1H69A 1V7ZA 3BXZA 4FC7A 2DOKA 4ZQEA 5KYVA 2O4CA 2VDUE 2QHXA 1XZIA 1ZMBA 4CODB 5TPWB 5AKYA 2R7MA 5E8JA 1E3JA 3WZMA 1FEZA 1M2WA 3BFVA 3NRBA 4MPTA 5K0NA 3UG7A 4A8TA 4DDMA 1KQPA 4NZYA 5LD2C 1JFTA 1U02A 2HRDA 3K9LA 4YCJA 5BP7A 3S2EA 2H1OA 2PT9A 1O97D 2QD5A 5FNVA 3NBUA 3KNZA 4MWEA 4J0DA 1KQNA 1NKSA 1SUDA 3AV3A 5EZ5A 4AX8A 3W5IA 4RHXA 4P3KA 1AVTA 1KPIA 1X80B 2R7KA 4TRMA 3CG4A 4C04A 2R6FA 2YZNA 2IWHA 2J3KA 1KMMA 1EXNA 1RAIA 1ISHA 2FK7A 2BE9A 4IIVA 1NR5A 5GM1A 2GO7A 2IUUA 3A32A 3TPCA 1WUIS 4ZRDA 1AQUA 2PU7A 3EAQA 3R5TA 3AP3A 3IQDB 5B2FA 5BUSA 1MTZA 5I5EA 5JSYA 2ISSD 2LNDA 4KWHA 3UCXA 1C3LA 1L7DA 2AA3A 3AR4A 3PB3A 4X3OA 2J9FA 3TSOA 2BHSA 2L18A 5AMXA 4OJNA 3LPCA 5JPIA 4EJSC 1OASA 1RWOA 3CZRA 3PC8A 3KKQA 1NVKA 3G68A 3K8QA 4MCAA 3E0XA 4L6AA 3SBEA 2RHWA 1R00A 3VVCA 1O0CA 3WGNA 1VG9B 1FTGA 2SECE 1M2NA 1EX1A 3IL2A 1TAUA 1NBHA 2QD2A 5K01A 4YRFA 3QE0A 2WUWE 1NI3A 1YAHA 1JEQB 3W4IA 4AN4A 4EHFA 5JR3A 4IWNA 1NW3A 2WHXA 5I5GA 2GK4A 3EXEA 1N2CE 4ND6A 4DC9A 1BA3A 2NPFA 4AZ0B 2HZ7A 1E1KA 4MWCA 3N9IA 5IW8A 4EHJA 1P0FA 4PRKA 4F8JA 4Q3BA 4Z99A 1ZCAA 5BSVA 2O7SA 2NO7A 1TK3A 4DARA 3D8SA 1NV8A 1LW7A 4J2HA 3UAGA 3LOPA 2GWHA 1REQB 3E35A 3VC2A 4P58A 4UMEA 2HQRA 4A5OA 4UM9B 1T1RA 4AYTA 2E85A 2F8LA 4MKRA 4PIPA 3FB4A 4I8XA 4IPTA 4RE6A 3PC8C 3FWZA 2Y9PB 2Y1XA 2VYQA 4FMDB 2WJ6A 4Q01A 5EIFA 2UUPA 5LZ9A 5ECGC 2H5LA 5FNVF 4EY5A 1TQHA 1N6RA 1X9GA 2C9DA 3I5YA 1VM6A 4X6UA 2UXDB 3MMNA 4QAJA 4UHEA 5JLJA 1TQ4A 2VLIA 1KAQA 2PXHA 4N3BA 4DIEA 3RUCA 2XQGA 4LOIA 1NUTA 3COVA 1BX1A 1QCYA 3LJKA 1R9NA 1I7DA 5FFMA 2Z6QA 1GG8A 3EJWA 2HIHA 4F4IA 3NWEA 4HZUA 4KFSA 3TF5A 3E03A 2AG8A 4R51A 4EJSB 1YNOA 3IH5A 4D3YA 2ERXA 2C96A 3K2EA 3GY0A 3ZHBA 1DHTA 1TYEB 1II0A 4GC5A 1JLSA 3OOWA 4OUDB 2UYQA 1PKXA 2WU8A 3EH2A 1QH8A 2BBTA 5HHTA 1XMIA 3NTRA 1UF9A 1IC6A 3PPVA 3SS8A 1E5DA 4OP3A 3RWOA 4FLMA 5F3WB 2V6BA 3HXTA 1JH9A 1VPLA 5CFNA 1KERA 2FHSA 1K5GA 3HCBA 1ZXLA 4M1MA 5I7RA 1FFSA 1THTA 3G7SA 4QTXA 5DIZA 4A26A 5LZ5A 5KX5B 2CNNA 1V0JA 1JWAB 1NXPA 2YV1A 4BAZA 3P0RA 1FRZA 1TT7A 5F5NA 4HDAA 4LN1A 1PR0A 3OAAD 1ISGA 4LTNA 4AYXA 4HFRA 4YRRA 3VKGA 3HM9A 1WVGA 2XECA 2QWXA 3A3PA 3LFUA 3DYIA 3LVFO 3R5XA 1QJCA 2OV2A 1OX4B 2CW5A 4CI9A 1MBZA 3A10A 1G3QA 5FUWA 5IJZA 2XYGA 3ET5A 4G8JA 1MAUA 4EG1A 1HNXB 3QOFA 3O5AA 4N12A 3DXYA 3HY6A 2ZZNA 4CN8A 1GZ4A 1R6TA 1TPZA 4HWGA 5EA2A 3TVDA 3ZDRA 4EPYA 5IAJA 1TZ2A 2HQBA 1C9NA 2DPXA 3BIWA 3L6RA 5C1DA 1ZIDA 2NQTA 1RI4A 5CXXA 3VBCA 3QIAA 4YR7A 2G1PA 1ZOLA 3PNVA 1PSZA 2DFNA 3PQ7A 3AW8A 3NKVA 5JNWA 3D81A 2N42A 2QLMA 1ZR2A 2E89A 3QTBA 1XDWA 1IAQA 2ZKIA 5CAEA 5AUOB 5BW6B 3NBFA 2IUSA 4RM3A 3WLIA 3AUJB 4Y7DA 3V7UA 1DG3A 1F8YA 1X9IA 4YLYA 5E2IA 4ABYA 3KDPA 1M1UA 4M1YA 1IDOA 1RI5A 3ZE7A 4Z5XA 2QZ4A 1W4RA 1JR6A 4PZ0A 1XU7A 1FDIA 1GZ5A 3RRXA 5FUYA 1U94A 2W8ZA 4WCVA 2C4WA 1MZVA 4HLNA 1FVXA 3OESA 3PDIA 3PNYA 4JU8A 4LUCA 3MB5A 2NTVA 4QO8A 1TTHA 1BVHA 3EY9A 1FYFA 2ZB8A 3CCCA 2YV3A 4JT4A 1YJBA 5JD5A 1U80A 4PSVA 1Z38A 2YJ6A 3IT2A 2ZBPA 1E1QA 1A4XA 4JLOA 1A76A 2SNIE 2WNIA 3Q1KA 4UATA 3B8EA 2JFYA 4I3FA 5CNMA 2F8SA 2YWDA 1XTPA 4KQHA 4AMGA 1PUXA 1R5NA 1YE8A 1QKKA 2Z1DA 2FEPA 2ZAYA 4ZOBA 1YI0A 3BH6A 4OK6A 4RENA 1WUHS 2QLBA 3GEPA 4O29A 1MG0A 2ORVA 4BATA 1ZSYA 2V97A 4H0FA 4LOLA 1VYUA 5AVXA 3ZK9A 4ZOEA 1N4AA 2ZB3A 2C5AA 4LY6A 3D6MA 3I64A 4E6EA 2G63A 2QDXA 4XIIA 1M6HA 1ADJA 1N2CB 1P4RA 4MS3A 2JEOA 2V6MA 1G6Q1 1OVMA 1J06A 4V3CA 2WTMA 4XOUA 4G1UC 3ZI7A 4G8BA 2Q2OA 1JDSA 3T7RA 1YA6A 2IS1A 1UFOA 5K0TA 3WWEA 1E0AA 1V7QA 5AKZA 5ENZA 3IE1A 2AFIE 2GJAA 2HYDA 2QPLA 5G3ZA 3IMCA 2XYQA 4UNRA 4J1QA 4P7FA 4RFSB 1L5RA 4TM8A 2CLHB 4Y6QA 1Y8QA 3R1IA 3VPXA 5AW0A 1I4WA 5BXQC 1VE7A 4BMXA 4QBHA 1J9GA 1NLZA 3T41A 5JNUA 3L1VA 2OCXA 3LWNA 4Z3DA 2CHUA 3IPCA 2GR9A 1AXGA 3GIDA 3EGCA 1CJVC 4G5YA 1PVVA 2QX7A 4MRAA 4GIBA 2Q7DA 5MF6A 3C45A 1SKYE 1X19A 3STHA 3ZVMA 1QP8A 1OX5A 2LWIA 1ONSA 3OWXA 1N0UA 3B6KA 4MLDA 4N8DA 4UOQA 2ZYVX 4GT1A 2P2NA 2PYIA 4QUEA 5JI3E 5HOQA 1PLJA 1SD2A 3BXGA 2XW6A 3WIUA 3L7BA 3N2NA 5DGDA 2YOFA 3B3JA 1VBMA 4ACAA 1P72A 2ZVJA 4POOA 3U4IA 4TQ9A 4Z1MD 2DUJA 1EM8B 2ZFUA 1SVNA 2ODAA 4NK5A 2PX2A 3LNCA 2CLMB 3HP1A 1YJ5A 1Z12A 2QTLA 1T0JB 1SEPA 3ZE2B 4C3VA 3KE8A 1ZKDA 5DGTA 1XU4A 3VU1A 1GA4A 5AXCA 1JG3A 1U04A 1JR4A 3ECCA 1WMSA 1T36B 4N40A 1N33B 4QJ5A 3ZCPA 1QVAA 3VZRA 1OW3B 4UE2A 1UOQA 1F4LA 1GU7A 4QYXA 5JCOC 4JR0A 5A0TA 3AB7A 3PWTA 3OFSA 1T5IA 1VB5A 3P9XA 3EXHC 3BSFA 3O8NA 5LXTF 4D3SA 5JCPA 5KNDD 5FPTA 1PEAA 1F2TB 2DX7A 3H2KA 3H4IA 4WKGA 4BZPA 1Y7TA 4S24A 2YY7A 3DL7A 3K92A 2VPXA 3I8OA 1UMBA 3JATA 1GAQA 4L72A 2ZWVA 4DQVA 1QIHA 2IA5A 3MWFA 1A9XB 1UPCA 2C7BA 2IJGX 2PKWA 3NW9A 2CE2X 4B6PA 1DIRA 2QJTA 3VNAA 2V96A 1IFXA 3DPIA 4PGHA 3ZJ4A 4I55F 3E3MA 1GVHA 4X1IA 3KAKA 1SUSA 2J3QA 3BKXA 5KKAA 3DFUA 2FR1A 5CA0A 3K9FC 4P35A 3VJRA 3N7UA 3HRIA 3ZH2A 3O8CA 3B7GA 1IZ9A 5G02A 2A4MA 1ISFA 4BO0A 2GH1A 4LJ9A 4F2PA 1R5BA 1XYVA 2X2OA 3TIXB 5BWCA 2DBVO 1DWQA 4G1EB 1B42A 3GEHA 1ZUD1 2RONA 4YCAA 2TSYB 4LYHA 5DBIA 2ILVA 1IN6A 2OHHA 3DCYA 1W47A 2W2TA 5BV1A 5A7GA 1L5WA 1FUKA 1R8QA 1E79A 3KUKA 1JA9A 1ZHHA 4M89A 5K1ZA 1R0ZA 1T9GR 1Q91A 2BCJQ 3KEGA 1E0SA 2R6HA 4Q3DA 4GLBA 4Y6GB 3VFDA 2D5CA 4CMGA 2G36A 1U9JA 1KPHA 3EVCA 3EUAA 4FT4A 4KH1A 1N8TA 1WXIA 3BMNB 1Q0QA 3L7DA 4NE9A 1H6AA 3OT5A 3R6WA 1UADA 1SKAA 4AWBA 1GPAA 4HX9A 3EXHB 2C82A 2MSCB 3D64A 1NN3A 4M9CA 1YR6A 3HHEA 2WJWA 1OU4A 3HR4A 4DY6A 2QI9C 2DQKA 3QTTA 4JOSA 5FAKA 4E5MA 2D7CA 3O7MA 2UKDA 1I2MA 2DRIA 2P9EA 3M5PA 3NHFA 4KBYA 4DAOA 5HUQA 5FTKA 5KTMA 1G60A 4CF7A 1CUYA 3PNSA 2F3QA 3ZLJA 3JZDA 2IE0A 2R25B 4RTSA 1TK9A 3SE0A 2GM5A 4EPRA 2NTNA 3IEVA 3QWBA 1PR1A 1DTEA 5KWSA 2AFIB 1P31A 2AMVA 1TCVA 1BRMA 3HKBB 1L7OA 3IP1A 3SHTA 2RGEA 3DAHA 3I0MA 2XUIA 1J70A 1LQUA 2GAIA 3MCZA 3V8BA 2LR0A 3N70A 4MXDA 1D2GA 2FXVA 3TX2A 5EWLB 2XRFA 3V4SA 4FR2A 4JOBA 4C88A 2B8JA 4A8JB 4CV0A 2K87A 3OQIA 4CLEA 1UBJS 1X13A 4CF5A 5CA0F 2BFCA 5JD6A 3RS4A 1I9GA 5JMOA 3QPCA 4CDGA 3DZJA 2BY4A 2QQ0A 5KDLA 3D6HA 1CG6A 4RAQA 1CERA 1PDVA 2RH4A 1SKYB