4H7HA

Crystal structure of haloalkane dehalogenase linb t135a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVAMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7hA00
4EB0A 1CUHA 4K5QA 3WKBA 1QO9A 1XLUA 1WB5A 2QXTA 5LZ2A 3SC2A 4FBMA 1XQXA 1GGVA 4X00A 1LZLA 3WL5A 1EK1A 3G9ZA 4E11A 3O95A 1XKLA 3P2MA 4Q34A 1A8SA 1WPXA 2OCKA 2RGUA 4WFJA 1BEZA 1F8UA 4H7HA 3VJMA 3KD2A 1CUJA 3QMVA 1UK9A 4U2BA 4DM7A 1THTA 5DNWA 4F60A 4XIIA 5HZGA 3O9VA 5JZ9A 5IVIA 5E4YA 5ISMA 1B41A 3FYTA 1DTEA 1YB7A 1UKBA 4HXEB 5ALTA 4U2CA 3QPDA 1FFEA 1RP1A 1ODTC 4HAIA 4N8SA 3WMRA 4U2EA 1T4MA 3WYNA 4WY5A 3R40A 1N5RA 5FXMA 4KJXA 5AKIA 5ALXA 4ZGBA 3QM1A 1QFMA 4H18A 1TCAA 1VZ2A 1G4HA 3G02A 4YASA 1E3QA 4UFOA 4CI9A 4H7IA 1A7UA 4DGQA 1EVEA 4LXIA 2X8BA 1IUOA 2H7CA 2GBFA 2OQVA 3FYUA 3HLKA 2XMCA 3R3XA 3D4LA 2ES4A 1EK2A 1EB9A 4HZGA 5K3FB 5AOBA 1MNAA 2VJAA 4EY8A 3DNMA 2ORYA 4KE9A 4ROTA 1YS2X 2WG2A 1CPYA 1FFCA 1Y7HA 4KYVA 2B4KA 4L0CA 4EHBA 4HXFB 2WUFA 2NW6A 2J3QA 3OG9A 4BATA 3HC7A 2WHQA 3MVEA 2OCIA 2P8SA 5EIAA 1QIDA 2BCEA 4OB7A 4IH9A 3M83A 1DX4A 3G7NA 5E4JA 1TCBA 5FP0A 1UOQA 1UOOA 5AK4A 3U1TA 3AZQA 2RI6A 1IZ7A 1W52X 5JARA 4CG3A 4N8EA 3I2GA 4B85A 4N5IX 2CB9A 4XX1A 1ZJ5A 3WK8A 4B6GA 1QIJA 1MX1A 1VA5A 5ALSA 4XJVA 5HF9A 2GYVA 4ITVA 3RLIA 5HFAA 1JU3A 3STTA 4OYYA 1TAHA 3H2IA 1EI9A 3F96A 3IUJA 2RHTA 1LPMA 2GBCA 1GKLA 2PL5A 5HKAA 2ZSIA 1QZ3A 3RK4A 4E14A 1D07A 3C43A 1KEZA 2XUGA 3WWCA 4MQMA 1XZMA 4DTCA 4CG2A 1QTIA 4BBZA 4W9RA 5AK6A 3V9AA 4K2AA 2RIPA 1EB8A 4XVCA 3TGLA 4FNGA 2HU8A 2H7XA 1H2YA 3DKRA 3STWA 4V2IA 1HKHA 3QH4A 4QE3A 3GBSA 3TEJA 4H35A 3GROA 3QPCA 5LLSA 1CUWA 4UBLA 3V1MA 3FOBA 3PF9A 1ZIYA 1Z68A 3C6BA 4PSUA 4AX4A 3HACA 4W63A 3BWXA 2Z8XA 5AKYA 1WHTA 1C7JA 1XFDA 4FFVA 1LGYA 3B5EA 5A7HA 2EEPA 2ACEA 1CEXA 2VJBA 3C6ZA 3Q0TA 4BAGA 3X3HA 2DQZA 3WIBA 4B81A 5ALQA 5LZ4A 1LPSA 4QLOA 1ORWA 3RM3A 5D7BA 4H0CA 4N5HX 4QDTA 2X5XA 5JANA 4JH0A 1Y37A 4FOLA 2ZYSA 4BE9A 5DTJA 1QONA 1GQRA 3G0BA 4Q3OA 5CT8A 3IUMA 4U2GA 1MPXA 3JYHA 4Y9SA 2BFNA 2V97A 3D7RA 5IVHA 5AK3A 4I3FA 4X6UA 3PFCA 5DTIA 2VEOA 3C45A 5K5EA 3C8DA 5DWDA 5AI0A 4B80A 3G8YA 2VTVA 3AZPA 3WA7A 2DR0A 1W6RA 3IVMA 1YCDA 2Z5GA 1W76A 4J0IA 3H1AA 4G1FA 5K3CA 3I6MA 3D5EA 1AQLA 4H7KA 2GZSA 2VJDA 1KU0A 1E89A 3KWJA 5T4FA 3DEAA 4G8DA 1XRNA 4Q05A 2IITA 3DL4A 1ZOIA 3TRDA 4AO8A 4BZWA 1NU6A 3BJRA 1HQDA 2XUPA 4PF1A 1VE7A 1XZKA 2PPLA 4Y2QA 5ALLA 1XROA 2BGRA 2O7RA 4BC0A 3MUNA 4N8DA 5CH8A 4DIUA 1J2EA 4C4ZA 2PBLA 1MU0A 5DLPA 3KOOA 7YASA 1H2XA 3V1NA 1DU4A 2ROQA 1CUFA 1SCIA 2XMDA 2BJHA 1XZEA 5EHZA 4LYEA 4LKOA 4FMPA 4L72A 3SX4A 4EY5A 5KWIA 1CV2A 5D6OA 4WJLA 3E3AA 4G9EA 1X2BA 3ANTA 2OAGA 5LKRA 5K3BA 3HXKA 3AIKA 1YSCA 2GBGA 3UUEA 2I3DA 3H2GA 3I6ZA 2HHAA 5CW2A 2OGSA 5A7GA 4CCYA 4EBBA 2WJ6A 2RAUA 1X2EA 1QIEA 4GECA 4QWWA 5KBYA 2XMSA 5A2GA 1XKTA 3YASA 1YAJA 3R3ZA 2HA5A 1QIKA 3VJLA 1I6WA 5JD4A 4L9AA 3A2MA 1TKRA 1A88A 2FJPA 2WU4A 4INZA 4ARAA 4IHAA 4X6XA 1WCYA 5JD6A 2DFPA 2J4FA 3AUKA 4P93A 5AICA 1H2ZA 4BAZA 1NX9A 2R8BA 4OU5A 3WYDA 5T4BA 4WDQA 2WJ4A 4OPMA 1DT3A 2AJ8A 2PSEA 3DKKA 4AQDA 1LPNA 4BP9A 3WL7A 4GW3A 4C4XA 3IDAA 1XLVA 4LHEA 4ARBA 1UWCA 1O6FA 5CMLA 4J0JA 1E66A 5EHXA 1JU4A 4J0DA 5SYNA 5JASA 1ORVA 3WZMA 2JGLA 2AJDA 4GEGA 1HPLA 3ANSA 1RWQA 4HTAA 3QPAA 2VAVA 2QRUA 5FLKA 2XUDA 3FVRA 4PQEA 2HA7A 3AILA 1DWOA 3F8SA 3B12A 4A5SA 1HBJA 4NZZA 5E4TA 4X71A 4QWMA 1CUYA 1CUDA 4CG1A 3BF8A 4AMZA 4OCZA 1YB6A 3HEAA 4RPCA 2PSFA 1PJAA 1CUSA 1MN6A 5SYMA 4TPKA 5KWJA 1JMKC 1CFJA 2E3JA 2HRRA 3OURA 4G8BA 2I78A 3FBWA 4UHEA 2JGJA 2RONA 4Y2UA 4F21A 3A2LA 4MEAA 3ICWA 5AKEA 4NVRA 4K6KA 4KAJA 2C0PA 3ESBA 2R11A 1UXOA 1QGED 4OU4A 2VATA 1AUOA 5ALYA 2QR5A 4KAAA 3BDVA 4EY6A 4DMKA 3R3UA 4I19A 4AN0A 3BL8A 1FFAA 3FLAA 2EDCA 1VXOA 5HKBA 2VQ6A 4MYSA 1XZCA 2VJCA 5HF6A 5AH0A 2H7YA 3ILSA 4BAUA 1LBTA 4AO6A 4X3CA 4U2FA 3ESCA 3A70A 1DQZA 1U8EA 4BVJA 3WWPA 1GXSA 2OPHA 1ZJ4A 2B20A 1ZGBA 3WKAA 4BVKA 1CUGA 1L7RA 5ALPA 2WHPB 4BRZA 1ACLA 2VT6A 3ZI7A 1N5MA 5HQ3B 3EF3A 5ALDA 1LLFA 3VKFA 3D2BA 2W6CX 2DCMA 3OOSA 4UHHA 2PUJA 1XZDA 3HABA 2FUKA 2HL6A 1CRLA 1OCEA 3VXKA 4A16A 3FYUC 1TK3A 1CR6A 2HA2A 1G5FA 4HS9A 3O0DA 3FWHA 3M3DA 4Y2TA 4AO7A 4UHFA 4MWSA 1XZAA 1LZKA 4IQ4A 2IIVA 1ACJA 1MT3A 4EUSA 3I2FA 1XRRA 3W9UA 1Q84A 2XQKA 3FSGD 4U2DA 5AO9A 3ZLUA 3DS8A 2PUHA 3GZJA 5HF5A 1QO7A 3C8HA 4LXHA 4J3JA 2XDWA 2XQJA 3NWOA 3NGMA 1XZFA 5T4HA 5K3FA 2BKLA 1AX9A 5FPQA 2G63A 2C4HA 2CUTA 1AKNA 4JEIA 1IZ8A 4QZVA 4DSZA 3CN7A 5E2IA 4Q82A 2HFJA 1ZICA 2PKYX 1XZJA 2PU5A 2J4CA 5AI4A 1VE6A 3V1LA 5JZSA 2WTMA 2AJLI 2CMFA 2XLBA 4KACA 4E15A 4FWBA 5AM0A 5ALHA 4G4GA 2VAXA 5HCUA 5AOAA 4BCCA 5AIBA 3EBLA 2XQGA 4B82A 3G0GA 2Y6UA 4PV7A 4GI1A 4H7EA 4C89A 2WIGA 4MWTA 4FLMA 1G66A 2ZJ6A 4P08A 1QE3A 2QTBA 1MAAA 5AHXA 1XRMA 5ALEA 1VLQA 3H2KA 5DYWA 3WLAA 1R88A 3D2AA 2G5TA 4AB1A 1ODCA 4HRXA 5ALJA 1W4LA 5CURA 3DCNA 4BE4A 4EY4A 4JNCA 1H22A 2ZYRA 1J1IA 3NUZA 4DMCA 4X95A 2XMBA 3C6YA 4DNOA 4G8CA 5CT6A 4I4CA 4F5ZA 1TCCA 3G0IA 2WUEA 5ALIA 4Q3KA 3WWDA 3ZLTA 2B61A 4WFKA 5C8VA 2GYWA 1K6EA 3W05A 1BROA 1F0NA 5K3DA 2O7VA 2C5FA 3QMMA 2H1IA 5A62A 3D2CA 4KRXA 5HK8A 3HRHA 3I1YA 5AM2A 2Z3WA 3DOIA 2BUBA 1XZIA 6YASA 3WK4A 5BV7A 1YA4A 3DLTA 3V48A 1P0IA 1KU6A 3CN9A 3DD5A 1P0MA 1U2EA 5JD5A 2BAGA 1K4YA 4ZI5A 4CIBA 1EA5A 3WK7A 1QLWA 1IUPA 4BRSA 4CFSA 1VKHA 4X6YA 3U0VA 1LNSA 4X90A 1QIHA 2XUHA 1WB4A 1B6GA 3STXA 1JT2A 3VISA 4X94A 4ZXFA 2RHWA 2VA9A 3ZLVA 2AXEA 1ZI9A 1ZI6A 3WJ1A 3W9BA 4H7FA 4D9JA 1QFSA 3OTQA 2JGIA 4TVKA 5LZ8A 1UK6A 1CUBA 1IUNA 3R0VA 2I3ZA 4FBLA 4JUIA 4Y2RA 4G5XA 2V9ZA 2QMQA 3E4DA 2XMRA 1HL7A 1MO2A 3BF7A 4DSAA 4MEBA 4Q1VA 2YYSA 1LPPA 2V96A 4E46A 1JFRA 2HA6A 2O2HA 5JAOA 5CBKA 5EFZA 2D0DA 2UZ0A 2XQFA 3ZPXA 3IURA 5ALVA 2PVSA 2FJ0A 2QJRA 4DNQA 1R4ZA 1ZD4A 4W1PA 3AIMA 1S8OA 3R3WA 1QTRA 3PI6A 1MX5A 3AIOA 1ZI8A 3WIOA 2HADA 1BN7A 2HRQA 2XUQA 5DJ5A 3FNBA 1FJ2A 1N8SA 3CCCA 1CUVA 2FX5A 4S0XA 1JJFA 4GDMA 1QIGA 1SOMA 1R9NA 1K8QA 4W1SA 3FLBA 4C01A 4ZRDA 3IUQA 3BXPA 4XWGA 3EQ9A 1EH5A 4RGYA 4FFWA 3QZUA 5DYTA 4KE7A 1FSSA 3SK0A 3WA6A 2OQIA 5AKZA 1VOTA 5H3HA 4EA6A 1ZGCA 4LYDA 1TQHA 5I7UA 2ECFA 2DHDA 2C0QA 1A8UA 4C87A 1AURA 4Y2JA 5AOCA 3W2TA 2ZYIA 3DL7A 3FCXA 1JJBA 3LIIA 2JGKA 4DMHA 4X97A 4UBIA 2BUCA 3QMWA 1WM1A 1H2WA 3F67A 4DNPA 5HK9A 5FUMA 3DYVA 4RE6A 3PICA 1CUZA 2WG0A 4OB8A 2OLEA 3R3VA 2K2QB 3VJKA 3QYJA 1CUIA 4J0GA 2DHCA 5CXXA 4Y2YA 1HDEA 1QIIA 5C8ZA 2WIJA 3WK5A 3VVLA 1DINA 4F0JA 1DT5A 2G5PA 3RARA 1EVQA 4WCVA 1NU8A 3D0KA 2WUDA 5IH7A 4UBKA 1UFOA 2QKYA 4KEAA 4BC1A 4H7JA 3EQ8A 2XUOA 5AM5A 5FRDA 1EINA 2WUGA 2EDAA 1CUCA 3QITA 4B84A 1GKKA 4P9NA 1QJ4A 4X92A 3PUIA 5IVDA 3CCBA 3WQHA 1E8MA 2ZYHA 4DMFA 2QOEA 4PNZA 3WJ2A 1W1IA 1THGA 4NMWA 1ISPA 3D3NA 1OXMA 3AZOA 1GT6A 1C4XA 2JF0A 3HYSA 3I28A 3CXUA 4UBJA 3DJYA 3O4JA 2JGEA 5LZ5A 5JYCA 1JKMA 1Q0ZA 1RYYA 1PV1A 5CH3A 1BEEA 5ALUA 4B0OA 4B9AA 3HSSA 3ZWQA 1XRLA 2XT0A 4HXGA 1PFQA 4BCDA 1USWA 3WL8A 3WZLA 3QVMA 1LBSA 2HU7A 1XRPA 1UKAA 2IX9A 3WKCA 4ZWNA 2CJPA 4B7ZA 3LLCA 1E8NA 1LPOA 4OSEA 2PX6A 1XZGA 1CUXA 4K6HA 1QIMA 3IBTA 5FPPA 1R1DA 1EXWA 1GQSA 5AK5A 2XUJA 4IO0A 2HFKA 2YXPX 2O2IA 2I03A 2PM8A 2XUFA 3I2IA 3K6KA 1JI3A 1K5PA 5DNVA 1O6GA 4H7DA 1SCKA 4J0HA 1MAHA 3L1HA 5AKGA 4FKBA 1JMYA 2CKMA 3W04A 1YR2A 4AMYA 4M0MA 4IH4A 1YASA 3LS2A 4OB6A 5JZBA 2XB6A 2C7BA 3F97A 4UBNA 4K6GA 3N2ZB 2ZSHA 5BOVA 1XRQA 1BCRA 4Y7DA 5AM1A 2X76A 5EHNA 2QUAA 4WY8A 2WFLB 1YS1X 3O4HA 2Y1KA 2C5GA 4NS4A 1L7AA 4Y2VA 4FDMA 3V1KA 5ALFA 4QEKA 2WHPA 5EI5A 5C81A 3DYIA 2Z8ZA 1F6WA 4YX9A 1SFRA 2XE4A 1ZD3A 2BGNA 1E8DA 5HQ3A 5LYYA 5CXUA 4DYHA 1CUAA 4X7BA 1CUUA 1AMNA 1ZIXA 1CQZA 5LZ9A 1GPKA 1WB6A 4BVLA 1BCSA 1GPLA 5JALA 1UT6A 5ALNA 3ICVA 5ALOA 4ZV9A 4BDSA 1BU8A 2Z3ZA 3H2HA 4MXDA 5C8XA 2PSDA 3FSGA 2ACKA 1GZ7A 2J3DA 4X85A 5YASA 4TGLA 3OC0A 4KR0A 1CIJA 3E1GA 3R41A 5JADA 3EIOA 2AJBA 3LP5A 5K3AA 1XQYA 4B9EA 4M0EA 5AIAA 3WWOA 4G9GA 3GA7A 1AC5A 1R9MA 1N1MA 5KREA 3C6XA 3M82A 3C87A 2PSJA 4OYLA 1VXRA 4ZV7A 1EDDA 2HDWA 2WIKA 4UFPA 5D3KA 4YPVA 3LCRA 4BCBA 3LIPA 4B83A 3OPMA 4BTVA 3O9MA 1GPNA 5AKJA 5BWBA 1E5TA 2XUIA 3WK6A 2WG1A 2WFZA 4C4YA 3I2KA 2XMQA 3GUUA 3STYA 3O4GA 4BYMA 3C5VA 2OAEA 1DWQA 3WKDA 5A7FA 1CLEA 3R3YA 1UK7A 5CT9A 3G9UA 1BS9A 4BP8A 5CTAA 4IH1A 3BDIA 2JEZA 3FYUB 5JATA 2C58A 4GWLA 4BDTA 2ZJFA 3QBJA 3OM8A 4UHDA 5AI8A 5JAUA 1MX9A 1Q0RA 2HU5A 4WFIA 3VVMA 3KSRA 5HFNA 2WILA 2OGTA 2PSHA 5AP9A 1XQWA 3IB3A 2XUAA 4FLFA 5AKXA 3T52A 3G9TA 3KXPA 3Q8WA 3WKEA 2XI4A 3AFIA 3L1IA 2CEKA 4Q3LA 1XZBA 1QOZA 3FLEA 4UPDA 4EZIA 4KE6A 3PE6A 1LPBB 2DQYA 1UK8A 3N0TA 3H1BA 3PFBA 2WU3A 1M33A 2Y2VA 2VT7A 1CUEA 5CT5A 1WHSA 3I1IA 1IVYA 3KDAA 2OGZA 3B3QA 3W06A 4BB0A 2Y2UA 4PSDA 5AKKA 2JIDA 2LIPA 2OG1A 3WI7A 4MJ3A 5AM3A 4AN1A 5AI9A 1R3DA 1DWPA 1JJIA 4G4JA 3JWEA 4G4IA 2JGFA 1XQVA 3G0DA 3K2IA 4OD0A 4BZZA 4Y2SA 1TIBA 1BE0A 5CH5A 4UBOA 1MTZA 2B9VA 4M0FA 5ALZA 3A2NA 2QT9A 1P0QA 4KRYA 3H2JA 3BE8A 4AZ0A 2WFMA 4MYDA 3UMJA 3TJMA 5DNUA 5ALKA 4ZREA 2D5LA 3STUA 4GXNA 3AJAA 2H9YA 2W22A 3IULA 2XLCA 1YA8A 3FVTA 2VF2A 1IMJA 1R50A 3STVA 4QDXA 3GELA 1DX6A 4QA9A 1W75A 1ODSA 4J0CA 3GFFA 3L1JA 3D59A 1BN6A 3H04A 2HA3A 4AXBA 1ETHA 4UHCA 2WTNA 4HVTA 4Z49A 2XQIA 3C5WP 4UHBA 3H18A 4X91A 3PF8A 5LIPA 2XUKA 1MNQA 5JIBA 3I6YA 4CCWA 1AZWA 4QNNA 4MQLA 5IVKA 3H0CA 4FNMA 5HF8A 1FFBA 3RKSA 1EDBA 4RE5A 5T4EA 3BIXA 1J06A 1P0PA 2WSLA 5ALRA 5FV4A 3BIWA 2G4LA 1FFDA 4UFNA 2QM0A 2XMGA 5EHQA 1SCQA 2HIHA 1WPRA 5C7YA 5AI6A 2CZQA 1MJ5A 1EDEA 5AKLA 5A71A 2WM2A 5LZ7A 1EX9A 4AZ3A 2O2GA 2HM7A 3AINA 3KWFA 1X70A 2WLSA 1F0PA 1LPAB 4FLEA 1HLGA 4W1RA 5EIHA 4RNCA 2DHEA 2V98A 4FHZA 1K63A 2WIFA 4GBGA 4EY7A 5LKAA 2ZVDA 1XZHA 2QXUA 2CBGA 4QDOA 3I2JA 5BWCA 1Y7IA 2WHRA 3H19A 1A8QA 5EIEA 4UBMA 4DLNA 3DQZA 2OXEA 5LP1A 4BTLA 3I2HA 3EQ7A 4JYMA 4O08A 1Q83A 5JAHA 3S2ZA 1BRTA 5ESRA 3WK9A 4L3WA 3ESDA 2GBIA 4PO3X 4OUKX 3O4IA 4A23A 3M81A 4KE8A 4C6HA 5CT4A 3T4UA 2ZJ7A 2HA0A 5FKJA 3HJUA 2QJWA 3F98A 5ALWA 4J7AA 5F4ZA 3C70A 3FCYA 5FOQA 1UZAA 2VSQA 3ED1A 5AKHA 5EGNA 3PDCA 5IKXA 1H23A 4H77A 4J03A 4CCYB 5K3EA 4WDRA 3JW8A 1G42A 1L7QA 3H17A 4W1QA 4LIPD 3ESAA 4P92A 3F9CA 3MUOA 4JYPA 5FDFA 4UUQA 3VDXA 3UUFA 5A6VA 2QS9A 4HRYA 2WKWA 2Q0XA 1CVLA 2AJCA 5AI5A 3FAKA 2GZRA 4ETWA 2WIDA 4QDZA 2OCLA 1OILA 3DOHA 3IIIA 5DYYA 1TRHA 4DNFA 2BUAA 4FTWA 1DQYA 2PU7A 2DSNA 3E0XA 4CIAA 2YH2A 2OCGA 1C7IA 4Y2PA 4GLBA 1U65A 3DDUA 1YAHA 4PW0A 3A6ZA 3IA2A 1UKCA 2QVBA 5AM4A 1XZLA 4GHWA 3IUNA 5JAPA 4C88A 1XLWA 1AGYA 2Y6VA 4B0PA 4KAFA 4QDUA 3G9XA 5ALGA 3SWWA 1U4NA 3K9BA 2QUBA 2JGMA 2JBWA 1EHYA 4Y2XA 1QIFA 1T2NA 2XMZA 4LXGA 3MGAA 3WL6A 1ZD2P 2WJ3A 1VZ3A 2JEYA 5J3JA 1J07A 2WFLA 3G0CA 5ALMA 1ZD5A 3PUHA 4PSCA 3S8YA 1UOPA 1VJ5A 2HA4A 2GYUA 3WWEA 2ONCA 3ZV7A 5I9IA 4YK7A 1CQWA 2QZPA 3HI4A 5I8PA 1SC9A 4J0KA 4QLAA 1WOMA 3BJMA 3NOXA 5AJHA 4X93A 2YASA 2WQZA 5D3ZA 3HZOA 5CRIA 1VA4A
chains in the Genus database with same CATH superfamily
3DE1X 2O05A 3T7JA 3ZXYA 3QA3E 4ZOQI 4EB0A 3BCSA 2GN6A 1MMFB 1OLXA 1UXJA 1XJ5A 4JOQA 4K5QA 4IHJF 4XDHA 2KYRA 2HR1A 4KSCA 4I9GA 1IU9A 1OY1A 1WMDA 4J7CA 3E3MA 4RVSA 2IYSA 1QF6A 3I9FA 4DLPA 4Y7CA 2H9AA 3B7PA 2HXYA 1FX0A 1J0CA 3LD9A 3VR2D 2ZS8A 5JQGB 5LZ2A 3GPLA 3CVXA 3D6AA 4BO0A 3C6MA 2CCKA 4FBMA 1XQXA 1GGVA 2O3UA 3TVDA 1HR0B 1D2EA 3TX2A 3GMTA 4I1PA 2PX0A 1SM4A 5CXSA 5GZ3A 4LMAA 4C0XA 5GIPE 1JS1X 1YB5A 4Q34A 1A8SA 1XWFA 1Y8RA 1WPXA 2RH9B 4L16A 1SNYA 3V80A 3AW9A 1NVKA 4R2LA 1MJHA 2P3LA 3T5GA 3C3MA 3S7ZA 1ECBA 1GXSB 1YR7A 1G6Q1 4M9CA 4BVEA 5BVHB 1ZMBA 4GX0A 2Z8YM 4U02A 1H6AA 1J1UA 2AKAB 2V7QA 1PJ3A 1CUJA 3QMVA 2UZ3A 4M9XA 5B1EA 5D86A 2ZUFA 1SXPA 3AFNA 5IZCC 4Q03A 3H9UA 3TBHA 3G8AA 2NUAB 2Q7DA 1IG3A 4TS4A 4AKEA 4DM7A 4DLBA 4ZIRA 4D3XA 5TS3A 1THTA 4RD2A 2N47A 1O96A 1Y8QB 4RL6A 2OLKA 1QV7A 1P9OA 5AR1A 4DCGA 2VP9A 4L9WA 2XNDA 5DP2A 3K5WA 3PNQA 4HQOA 4F60A 3QOXA 5JJCA 3IQXA 5J47A 1GTMA 1ADGA 4X7PA 1Z36A 4LTMA 5CFZA 3FZNA 2UYGA 3WAGA 4K8OA 4M0PA 3HFGA 3FZYA 4ZARA 5FFFA 3W9SA 3PNMA 4MVJP 1CJBA 2XXAB 2V8BA 3PFHA 2EX4A 5TPZD 3RS7A 2FPGB 5MHTA 1J9ZA 4YA6A 4PYNA 2CLHB 4FYVA 4R2HA 4U2CA 5T3YA 4P7KA 1UQRA 1WJGA 1WDKA 2ZBRA 5DLQC 5C31A 4GP7A 3DH0A 4PCVA 3NORA 4HAIA 3TZQA 1ODFA 2A3RA 4PPNA 2AIRA 2ZYDA 3E7PA 1JEJA 1KYVA 4FMBB 1XP8A 3MMXA 5F51A 3N70A 3VGPA 1G291 1P4AA 1T4MA 4AYWA 1Q0SA 4BNDA 1VFPA 1J25A 3KQKA 1N5RA 1XCGB 4OLHA 1NR5A 4PANA 1JFFA 2L17A 3FHTA 2JGNA 2PQ6A 5F2OA 4GWKA 1US8B 2TRSB 3ZGYA 2D1FA 2CMGA 1YF3A 1QF7A 1TTTA 3C3AA 1TIPA 4GLJA 1QFMA 4F2HA 5HKKD 5I4BA 3ESYA 3PYXA 4A1FA 2DWUA 2VCHA 4QPDA 3ZIAA 1DBPA 3OCYA 4JZKA 4KXXA 1G4HA 4TUYF 4CIXA 2O8CB 1SPBS 3AI3A 5COQA 4QODA 2JLSA 2NXNA 4GMXA 4UREA 4CI9A 3X1WA 1ZN8A 3LCUA 3VRHA 3ENZA 2PWPA 5LQJA 1A7UA 4B79A 1EVEA 4LXIA 2X8BA 4RHEA 1B16A 1PT7A 4E5PA 4YT8A 3WLLA 4PRYA 2A35A 3D3QA 4KRFA 1E2UA 1P9WA 2RBKA 4MGEA 3A8TA 5IK2A 4F8EA 1C9JA 3A9WA 3T7DA 2BVNA 3G7UA 3FF4A 2XEDA 1DAHA 1M76A 2BZ1A 1WUHS 3AYZB 3DMTC 3D4IA 1M8GA 1OTYA 3G8DA 3QI7A 4NDAA 4HZGA 3O2JA 4S1NA 5K3FB 5ED4A 2Q4BA 3K15A 3EEOA 2Y0PA 4DR3B 1MT0A 3EVCA 3BE5A 3KB2A 5TQJA 4ZC1A 4IDDA 4B75A 3JD1A 4DNXA 4J43A 3DNMA 1ZHOA 2W2QA 4YAWA 3PIIA 5HDBB 1YS6A 1KJNA 3CSUA 3DOEA 4KE9A 2JH8A 4MA4A 1A9YA 4MWOA 3WNBA 3X1ZA 4DXHA 4KMMA 5BSGA 1KOGA 1F9EA 1KP2A 2BFDB 1JLKA 1NRIA 1CPYA 3H2BA 1FFCA 2CVQA 4G5OA 4MR8B 4G6ZA 2FQ1A 2B4KA 2HJ9A 2OXRA 4L0CA 2X4LA 4D3DA 1G5IA 3IPLA 5JV5A 2E4ZA 2HEIA 4FC7A 4HXFB 1CS0A 4TXLA 1MRSA 1U2SA 3OG9A 1YOVA 4BATA 3VR5A 5DFAA 2WHQA 3PPYA 3HFJA 4YFYA 2P8SA 4RULA 4MLDA 1ECGA 3UXEA 3IQFA 1F8XA 2BCEA 4A0HA 2ADOA 1VCOA 5A4KA 3M83A 4RH0A 1NYRA 1DX4A 1S0UA 3AUFA 3I1JA 3D64A 5HIAA 3ELWA 3KFLA 3QWIA 1WUYA 4P53A 5HFJA 4LEIA 3FCSB 1FS6A 1W29A 4D8VA 2IYEA 1UOQA 2PRZA 2J45A 1UOOA 3OQBA 3VVBA 2FK8A 1N3LA 3IDSA 4BO2A 4I99A 4G4SP 4PAWA 1TZCA 2EP8A 4DB4A 3G2KA 2Y68A 3F6YA 1ECFA 1I4WA 5FNVB 5JARA 4QOJA 2MSLA 2X40A 1U9ZA 2IEYA 4N8EA 4O5AA 4YFVA 3EWIA 2Y9MB 4NU0A 3KAQA 4X3OA 4XX1A 2GZ3A 1VLMA 1EWTA 2QP3A 2HCFA 4BQEA 1H8EA 4B6GA 1CXZA 4J29A 2Y99A 4HADA 4N47A 1C29B 3GP8A 2NP7A 1CX9B 1X39A 3S2IA 2RHBA 2Q5OA 1G20B 3LX4A 3TLEA 4D9MA 4IF6A 4XJVA 4MINA 5HF9A 4CKYA 821PA 4JD5A 2JAHA 1Z4PX 1O03A 2QR3A 3CUUA 3GCZA 1JDVA 4HI0E 3IV7A 4CEJA 3RLIA 5I4CA 4GOJA 5K99A 2QNBA 5B53A 4JUFA 4URVR 1L2TA 1TAHA 2C2GA 1EI9A 5G1NA 1M83A 2ZS7A 1N77A 1E58A 1ADBA 5D5QA 3F96A 1I3OA 3FRJA 1L4FA 3IOEA 2VDUE 3D4OA 1LNQA 1SY7A 4HYEA 4V0OA 5TVKA 3FTDA 4CMGA 2ZUWA 3IUJA 1Y42X 2JFZA 4BB9A 2BEWB 1TYBE 3LPMA 1D4FA 1QMPA 5FPSA 1QZ3A 2V0CA 2VA8A 1KI4A 1URPA 3DF9A 1KRWA 2O23A 4PCAA 2HWUA 3F5DA 4IFIA 2EARA 2IYLD 3RANA 3SNHA 3WWCA 1PYGA 2WFAA 1EU1A 2ZIGA 3OJXA 1YS9A 1MO4A 1QPZA 3B6EA 3H2ZA 1SQFA 3R9XA 4W9RA 5AK6A 2NPOA 3GVPA 1NBOA 1PR3A 3E3OA 5FAXA 2RIPA 3CNLA 3FTNA 1V48A 5E8RA 2UU9B 3LO8A 4OA5A 2UZ1B 4WZAB 3G23A 4FFMA 2XKAA 1E3WB 1E3DA 4QU0A 4DZTA 4Z8XA 1YONA 1YQUA 4WUTA 4PXSA 4WESA 1I0ZA 2ODEA 3DYBA 3VTAA 2ZJ3A 2WAAA 5F7ZA 4ALLA 1HKHA 3QH4A 4XM2A 4C0JA 3W5CA 4KXYA 1B23P 3GBSA 4K9LA 4FYWA 3FMIA 1EX1A 1O89A 2J0VA 4MPPA 3TEJA 4BLSA 1C30A 3GROA 4L6IA 5EE3A 5F33A 4YCLA 3JYLA 3G79A 1Z45A 3BXZA 4PVDA 3HWRA 1ENZA 2VXOA 4MKXA 3U62A 2Z2JA 3GLVA 1PYDA 4P35A 3DR5A 3OBBA 2QSZA 3P0HA 1K6IA 1NNSA 2XVZA 2Z2XA 2RBEA 4UM9B 2FR1A 4XUDA 1JKXA 4D98A 2DH6A 4QQKA 4GT1A 4TKMA 5FLXA 3MTBA 2B1GA 4OM8A 1C1DB 5AKYA 1EFAA 1SVWA 1X9GA 1B3RA 1SKYE 1LGYA 3I9JA 4IIHA 4Q00A 4UU7A 2XODA 3G68A 2AVDA 2EEPA 4L27A 4IIJA 5HTOA 1RRCA 3ACCA 1ODJA 3NALA 4B7XA 3C6QA 5EKTA 2AL7A 4ZEVA 1TJYA 3CSSA 1F06A 2OYRA 1Y4ZA 3E03A 4CT5A 5B6JA 3TLZA 4H15A 3B9PA 3KB1A 1JTVA 1RXCA 4B81A 5ALQA 3VSDA 3P19A 1RJFA 3U60B 4IYJA 1X14A 1A9XA 2ONKA 3OFNA 3T3MB 3ZXUB 5A3JA 4QLOA 1ORWA 4KPYA 3G9QA 1J0XO 2W6ID 2BC9A 2BMAA 1L5ZA 1WMSA 1LXCA 1TQ2A 1L5KA 1VI5A 3OP1A 2BFOA 3O5AA 4C9BA 4DCVA 1A9ZA 3U7GA 3D6NB 2VRCA 4IOKA 5GV7A 1LWOA 2YOFA 3PT5A 1HUQA 4BLPA 2CLMB 3D3WA 1ORTA 1W35A 2J9FA 5DTJA 3G1UA 1E63A 1P4HA 2DUWA 1WEKA 2R84A 4BASA 5CFQA 5CT8A 1V6SA 5EZ5A 3NVMB 1RMYA 3ONFA 5GPBA 4DA6A 4U2GA 1PU2A 2PCLA 4LMPA 3FUXA 4UOEA 4WXEA 3RBVA 1T6XA 4WACA 1ND5A 3JYHA 2W93A 4DY4A 1Z4IA 2MINB 1WY5A 1IHPA 2BFNA 2O8DB 1ISRA 1FQJA 5AWFC 3M6FA 2IP2A 5HOEA 1BEUB 2ODPA 4R2WA 4RFVA 1EP1B 4U7JA 4MH0R 2CYCA 4WA7A 4XTRA 1L7MA 3EXHC 5CYFA 5J1SB 1VKNA 3J7AC 3W6ZA 2O8FA 5DTIA 3KR2A 3GU3A 3N8IA 3C45A 3WSVA 4ESEA 1WCIB 3C8DA 3BB4A 3TTXA 2FMIA 3D8UA 4JWTA 3EHEA 1YL6A 1YKFA 2PWBA 2C4TA 3QVXA 1XTUA 1ZC3A 2EJVA 4U4AA 4FM9A 2VTVA 3OZVA 5TT0A 4BRUA 3HXMA 1GZUA 2ZR9A 4H59A 1DKMA 5K4HA 4URWR 4NXNB 2XGMA 4R1UA 2D00A 3PDHA 1AKQA 4PIMA 4MQBA 1EGMB 1PJQA 1YCDA 2PZEA 1LK7A 5TNXA 4CG0A 2XZLA 2QGNA 1EX6A 4G1FA 1VG8A 3D0QA 3FPHA 4JL6A 2PLRA 5K3CA 1NUPA 1CSEE 3U9TA 3ABRB 4DM4A 1NP6A 3RU2A 2EFDB 1BDHA 4H7KA 3ZKAA 3IEIA 2GZSA 4RGBA 3BOSA 1DJLA 2QP9X 3ZVKA 4K6FA 1QXSA 2AC4A 2WOJA 2CZGA 2FUCA 1ZL2A 3HG7A 3TR5A 4G8DA 1R8SA 1Z22A 2IY7A 1K6JA 4PQRA 3CEMA 4H08A 1FOEB 5JSZA 1V2HE 2FWAA 3M5WA 3VU8A 1L5LA 2ZSFA 3TRDA 3X1MA 1QP7A 4G1EB 4NCNA 4NV1A 3C3DA 1G16A 3MC1A 2ZUVA 3ZDEA 1N5IA 1YZNA 2XXBA 5DASA 1CQJA 2BFBA 3PQCA 1G0NA 2XADA 3OA0A 3RJTA 3C24A 2C7RA 4D1YA 3EULA 5TPWA 1PW7A 4UM7A 2KW5A 2JLYA 1GR1A 4NZ9A 2C3OA 1E1QA 1VQ1A 4MITA 3GEGA 3GUCA 3BIJA 5EAIA 1XROA 1ECLA 1IPHA 2PLFA 4JVLA 4L7VA 3KAJA 2LD4A 5FR1A 2V03A 3UGQA 2D06A 1U94A 2O7RA 1W4RA 3CH7A 4CLHA 3KPUA 1ENYA 3NT5A 4G84A 4N40A 2JCSA 4B3IA 5AVWA 1CE8A 4N8DA 3OMWA 1BNCA 3EZ9A 2FLKA 3AKDA 1CDEA 2PANA 3ZDCA 4DIUA 1J2EA 1DGQA 3COZA 3G5AA 1Z6ZA 4UC0A 2LRHA 1C7EA 2WJJA 2PBLA 5DLPA 4JI3B 3ZK9A 1V8BA 2SKCA 5HIMA 3X2FA 3DAHA 3LVBA 1NIJA 3P9RA 5JPDA 1UKYA 4F6RA 4XYLA 1IOLA 2XMDA 4YJ3A 1DHRA 4M4SA 3QVTA 4Z4CA 3EW7A 2Y1LA 2Y92A 4XB1A 1HE5A 4LYEA 1VDZA 3VR4A 4L72A 1H8HD 4UU8A 3KKPA 2HMUA 3E3NA 4LDQA 4UMVA 1NKVA 1O6BA 3ND8A 1MOSA 3C5EA 4GL4A 2WZBA 1LX7A 3FFAA 1Z47A 3TDMA 5LOVA 4N03A 3ILVA 2XYGA 5BN3B 5KWIA 1Q77A 2M2IA 3RSCA 4WJLA 1PD1A 4DR7B 4EAAA 1M66A 1UPFA 2D2EA 5LKRA 5K3BA 3LTNC 4BNHA 1QP8A 3UAVA 1NVDA 3HXKA 4DILA 2DE0X 4CLDA 2UZ4A 1ICEA 2I3DA 1IEWA 3H2GA 3IX7A 2HHAA 3W6NA 1TO6A 3DZGA 3BMNB 4M8LA 4MMYB 3TLCA 2HJHA 3K0CA 1V41E 3KUCA 4AJIA 5TRTA 2OGSA 1JHMA 1DUIA 4YV1A 1WG8A 2RGYA 3L8CA 1PS0A 1VP9A 1YHYA 4HX2A 2XRYA 1NNUA 3RK1A 4PZZA 4ZO7A 4CCYA 1PCXA 4KPGA 3PYMA 2D2XA 2F90A 2C9DA 1ZX1A 2J3IA 1RPNA 3PWSA 2F4VB 4HQ6A 2JS7A 1V3TA 1M6WA 2W2TA 1W4CA 1UP7A 4M1EA 4QWWA 2C2YA 2X7JA 1T4GA 3OZAA 2X9VA 2XMSA 5IT4A 2YY6A 5A2GA 4JT2A 1XKTA 5F73A 2VUUA 1S2LA 2QLFA 3DZKA 1QKKA 4GKBA 5F7JA 1QZTA 1EUQA 4XLTA 3KOXA 2FZVA 3R3ZA 3MLBA 2NXWA 1QIKA 2O7NA 3NUQA 3EODA 3MEQA 3THSA 3T41A 2BMVA 4YP6A 4K9RA 1GAEO 3JQFA 3T9CA 4TWZA 4Y9RA 5KAMA 3UMYA 5CIYA 3Q2KA 1E60A 1DC8A 1NM5A 3B7GA 4Z4QA 4OSPA 5DHPA 4BVHA 2JGRA 4UU0A 1NXPA 4GRAA 4GLFA 4B2PA 4ARSA 1FDUA 5JFOA 2PD6A 4FFNA 4HJRA 3CF4G 3H42B 3RU3A 3JVIA 1AUQA 1R9GA 1DRVA 2EERA 2F43B 4YECA 1KKMA 3EBOA 1L4BA 3QBEA 4JSTA 1H2BA 1NG1A 4KGDA 1FDOA 3GD7A 3LLSA 3IO3A 3AR9A 3DDHA 1Y3BE 1NX9A 2IS1A 4TT3A 1IM2A 3C1AA 1O08A 5FFNA 3WYDA 3HKDB 4DTIA 4GU5A 4LSWA 2KBFA 1OYWA 1A4RA 2FLWA 3QENA 3L4BA 1DT3A 3FPBA 5TQ2A 4D8YA 1SBTA 1SUBA 3I0ZA 2C7OA 5CDTA 2OMEA 5EGSA 4BV2A 2FK7A 2UAGA 3Q11A 4RA9A 1Z56C 4PIVA 4RORA 5EWMA 3IDAA 3EGCA 1W85B 4GE3A 1XLVA 4BKPA 1GCUA 4FB5A 1YBFA 1UR5A 1Z5UA 1NQXA 1FYEA 4DIDA 3OX4A 3PR2B 2MR6A 3BMCA 3NBQA 3OETA 4QNRA 5CMLA 3VNQA 4EHDA 5ICFA 3M6AA 2J9XB 4UTXA 2AG1A 2OLJA 2PGJA 3N8NA 4IZ6A 1SHJA 2PLWA 4PC1A 5EHXA 2CZCA 1P2TA 4PLPA 3WRYA 4KUEA 1FTGA 2NUPB 3FI9A 4CM9A 3UMVA 4DLLA 4Z51A 3HYCA 1B8UA 5LQDA 3UGKA 3UFBA 3K8OE 1HK7A 3VI4B 2ZUUA 3IPYA 4AZWA 1WWKA 2QTVB 1IY1A 4GEGA 1SR8A 1YJAA 1WU8A 4F3KA 4PCUA 5EVJA 2IS4A 2BE9A 1QGAA 1AU9A 2C00A 2HSGA 2F7SA 2YYYA 3MB8A 2XUDA 4JUBA 3TUJC 4ZOLA 3U7QB 3W3AH 4R7GA 3F6EX 2TMDA 4B7AA 2E7ZA 1XUOA 2LTAA 4HG2A 4ICIA 3FG9A 4DMGA 2GILA 1SA0A 4A5SA 1RXEA 1PDVA 5E4TA 2DULA 2JAQA 1ZK4A 4JA0A 5IJWA 3T61A 3PGLA 4QM6A 3O8DA 4XAQA 4CG1A 3LVFO 3BD7A 1L8LA 1PT9A 2XAAA 1FBTA 3ZHYA 2Q6OA 1YQ9A 2REQB 4OCZA 3T34A 4WCFA 3QSYA 5JNRA 3MNFA 4JNKA 2HQSA 4NRDA 3TJZA 2AMLA 1UFQA 4NBRA 2NTJA 2Q28A 3DVSX 4IHQA 3KTFA 3CPEA 1U0OC 3MJHA 1YBAA 4CDMA 4E5NA 1Y4DE 5KWJA 2ZSKA 2O8NA 4ZT6A 1M5RA 1JMKC 2DTDA 2E3JA 4D02A 1FUIA 1BTOA 1NUTA 3FN4A 3L6EA 4G37A 4JP3A 2A94A 4MUHA 4UHEA 4YRJA 4MEAA 5EIFA 3W0LB 5B3LA 3ICWA 5AKEA 4EQ6A 2O0MA 1ZL0A 1DAIA 4NVRA 4DLKA 1MZVA 4KVZA 1KHHA 3JWPA 3SVZA 1T6ZA 3K0HA 3F5FA 4YCDA 1V95A 2Q0SA 2VATA 1C3XA 1IZ0A 1ODKA 1FTSA 2VK2A 2YHIA 1APBA 1E4EB 2I7XA 2OFPA 5DV9A 2DY1A 3A1FA 3KL2A 1KSHA 4IIGA 4Q19A 1RAAA 3M3HA 4FGZA 3R3UA 3IIKA 3QUTA 4RWZA 5DOZA 3KEQA 5GTDA 5ERGB 1SVOA 1X1TA 4PSAA 1L1RA 1ULHA 4EKIA 3A3KA 3CUTA 2FRDA 4V0NA 4Y6PA 5LWQA 1WXXA 4CETA 2EDCA 4NBVA 4AS2A 4JLSA 5HKBA 3NYRA 2VQ6A 1FY2A 2ATXA 4H6VA 5KZMB 4R2XA 4IGEA 5EE1A 3OLVA 3DMDA 3OCVA 3J81k 3FPCA 1XAJA 3AL2A 3E84A 4MYSA 1E1DA 2NZXA 3BORA 2AW5A 2XRFA 5AH0A 3KQUA 1IWPB 1CZUA 1GKYA 1SUWA 1AHHA 2X5OA 2XAUA 1C7ZA 1OXXK 1R4AA 4U2FA 4X3CA 3HZHA 3LT1A 3L0SA 3I3OA 4C5AA 4JCOA 5C1OA 4P3KA 1OZFA 2LDXA 3B6MA 1W73A 1QVAA 3CX8A 4P0TA 1U99A 3RLFA 3WWPA 1V25A 4GL2A 3FUVA 1GXSA 3IBYA 5BVHA 4BFUA 1T0JB 1ZGBA 3DO5A 5IANA 1L7RA 4JROA 3A1NA 4MLCA 1QHEA 3O9ZA 2WHPB 2QRLA 3NNSA 1RFGE 4HKTA 5IAJA 3RYIB 4BRZA 3RIMA 1OAAA 4UJ5A 4YQZA 2FP3A 2NUAA 1J5PA 1L7VC 1CRZA 4JJ7A 2ZIFA 1U2PA 1W2HA 3I39X 4IDHA 3AUJB 5HQ3B 2XPCA 2ZWMA 3GNTA 4L9SA 1TEZA 1KPGA 1NI5A 4AAYA 1NTOA 5ALDA 4G0XA 3P97A 4MP8A 1LLFA 2QTWB 1MQ9A 2YVKA 1Y3CE 3H5LA 1SKMA 1WBBA 3CIOA 2A1IA 1WE2A 1RJ9B 2O6HA 5FHRA 1GSAA 1LC0A 2GUWA 3EY4A 3ZZ1A 1V7PC 2ODWA 3HABA 2FUKA 4P8RA 2JBAB 1YUNA 3EGXB 5DHFA 3BYZA 4IVRA 3SNKA 4A16A 2Z57A 5BY2A 4RKRA 1BCSB 2FPGA 4YRGA 4TRRA 3N2KB 1K7EB 3UV7A 3L0BA 3R9IA 1NBEA 2H3EA 4G85A 4I2VA 4OHYA 1N36B 4P0QB 2B98A 3P2JA 3PDJA 2YN0A 5AXDA 4JP1A 5TVGA 3V4ZA 1XHEA 3O0DA 5BSKA 3DMPA 1SK9A 4Y2TA 5K0FA 5IF9A 2BYTA 4YAJA 3RC7A 2IPMA 2BGIA 2OD7A 4AO7A 4F38A 6GPBA 2Q3MA 3VAAA 1L5FA 3ORSA 4BJ3A 4RD0A 2C3MA 1US8A 4IHJB 4URFA 2Y0EA 1WF6A 3HVUA 4R51A 3UMSA 1T0IA 3Q7TA 4IQ4A 2IIVA 4MCHA 4UTOA 5I9SA 2PMCA 1QVRA 4HDSB 3R4CA 2CHUA 3R5HA 3SICE 4HV4A 3L8GA 4I1OA 4IIYA 3SBOA 1S96A 4NZPA 4KLRA 1E94E 1SOVA 3UUGA 2ODNA 5BQPA 3HHPA 2O8CA 3VHQA 4U2DA 5AO9A 3ZLUA 1KWGA 2Q99A 2X3YA 4HPWA 1XT6A 2XVXA 2E4XA 2H51A 3GZJA 3E9NA 2XA1A 4RVUA 1S4MA 3GLSA 1TTHA 1YQXA 1KVRA 2ZJ5A 4LXHA 4KRGA 2JI6A 4IYRA 4PFQA 3ZU2A 5JSQA 5K45A 3KK0A 1M34B 1WW3A 1TVKB 4PICA 3VV2A 2XCRB 1G20E 4N3NA 3JQBA 9GPBA 2P4HX 3B36A 5T4HA 2D2IA 3OEWA 5K3FA 3ADBA 2ETVA 5JXHA 2ZCVA 4C4SA 5L6MB 2O2XA 3G2HA 5EZYB 2PS1A 4RKEA 2B4YA 2X6QA 4TX1A 5J4KA 3IHWA 2QNIA 1ZISA 1NW9B 2CY0A 2G63A 4GOKA 2C4HA 4D56A 4DEXA 4JYAB 3DONA 2W6MA 3IDQA 3MT0A 3UIEA 1VRVA 1GAWA 1GO2A 2O7QA 5BWMA 3IP1A 2P9HA 1F4PA 3GT3A 4D3YA 1AS0A 2IZZA 1SXHA 2BFDA 4JEIA 1N78A 4DRXB 1HFEL 2V4UA 4MR8A 5JS2A 1CZKA 2YJTD 7AT1A 3DFFA 1PWXA 2I6GA 2FN3A 1TVEA 3BRQA 3FCOA 3JQAB 3OE7A 2ZULA 1CW2B 2Y05A 3OZTA 3RAEC 1U7PA 4Q82A 5ESDA 2CUZA 4HN9A 1W46A 4NBSA 5DM0A 1Z16A 2C9BA 2PU5A 1KDTA 3GJYA 3UOGA 1YCGA 2NO0A 4Q4HB 3PXXA 1VE6A 3V1LA 1QSGA 1C2TA 2QYOA 1RM5A 3UCFA 5ELXA 2CMFA 2EBUA 1S3GA 2XLBA 4LJKA 5CDHA 3PGJA 3R9KA 4AJHA 5LPNA 2AEJA 2VJQA 1YZKA 3NU1A 4GOLD 3WDMA 3HVRA 1SG0A 4RJ2A 5BT8A 5AM0A 2UYHA 5ALHA 4P4TA 1QGUB 3R1IA 4G4GA 3O83A 4K81B 3RT7A 5B7QA 2C29D 4F1KA 5HCUA 5AOAA 3WNZA 4P4NA 4X1KB 4BCCA 1C0LA 4UE2A 1P7PA 3DWFA 1CRPA 1GPJA 4XVHA 3EBLA 3LT0A 3LC2O 1E3SA 1AXRA 3V00A 1YJBA 3PC8C 3QELB 4TUYB 1AN9A 1EBFA 2HHCA 2Y6UA 3D4NA 3F4BA 4KO4S 4L8WB 4LDAA 1C1YA 1FFXB 1JYEA 2WC1A 3BSYA 4RC9A 3SN6A 1VSBA 2WIGA 3PA8A 5K51A 1VHJA 1Q7GA 2OHXA 1J1ZA 1G20A 2HRBA 4BNJA 3WYAA 2JCBA 1P2GA 3FMOB 4MV6A 1MFZA 1QCCA 2ZJBA 3TD9A 2OEPA 3CURA 4UUBA 1O97D 1VLQA 3WLAA 1R88A 4GKKB 4KH0A 3R7DA 4DDMA 2G5TA 1DKUA 1ODCA 4HRXA 1P5ZB 2FMUA 2YVUA 3B13B 1KWKA 4TT8A 1V5WA 1ONBA 3HB5X 4ZCLA 4B71A 2QMUA 3NIBA 4BLOA 5JCZA 2HI0A 4KKXB 1ZH6A 4L85A 4P5EA 3B48A 4XVRA 2P3OA 1XEFA 2BEWA 4M0KA 1VJDA 1EFKA 1L1FA 1J1IA 2O2SA 2WWFA 4NY1A 5KPJA 2H4WA 2JFNA 3LKDA 3JTEA 1YQEA 2BM0A 3AI2A 3SM3A 4UEWA 1VLLA 1GVNB 2RKBA 2YWGA 4DMCA 4XVUA 1UDWA 3RPEA 5H82A 5CT6A 2RHLA 1JDUA 2OESA 2OUKA 3QFSA 1TMGE 2QPAA 3T3GA 4F5ZA 1K66A 4HC4A 3QVJA 5G0UA 1QG0A 2WUEA 3G0IA 5KYGA 2ZYUX 4YJFB 1C0IA 2FW0A 3A9RA 3NT4A 3VUEA 1PRYA 2R7LA 3Q8LA 4F06A 4NV3A 2YOGA 3KQSA 4B5KA 3ZLTA 1DMRA 4HDQB 1WULS 1ZSYA 4EPRA 4TL6A 2R6ZA 3W4KA 3VVCA 5EXTA 2C95A 2UZ1A 4J3NA 4Z7OB 3W5SA 2GYWA 2ACVA 2XNJA 1E3WA 4EEKA 4LF8B 5KX5A 3UKDA 1UJBA 4FVTA 4Q18A 1Y4AE 4TRJA 2PA0A 3BGOS 3H5OA 2W70A 2YZKA 3BZWA 1XI2A 3QEOA 1QE5A 1WDLA 3N53A 3ECAA 5TJ9A 6LDHA 3B89A 5K3DA 2JAPA 4UM5A 1GGEA 3ZJYA 3BFVA 1X1RA 2I7VA 2MWMA 3IBSA 4NCIA 1XB2A 5A62A 2WZQA 4Z4EA 1CJVC 1CJKC 5HK8A 2R7NA 1DAPA 3HRHA 1OAOC 4CV3A 2P40A 2ZK7A 2PUGA 1Q22A 3AQIA 4YO7A 3KAPA 3DLTA 4NPCA 1ZKDA 3RFCA 1Y5RA 2P41A 3TW6A 3QKWA 1U0NA 3UMBA 5DBIA 3ESQA 3G5TA 4JT9A 3SXJA 2IA5A 3RF7A 4A2QA 3JS5A 1J23A 1C1DA 4TVOA 1FMTA 2A5DA 2GNAA 5SICE 2YWHA 1JG6A 1RXYA 1LSUA 3MW8A 1ZCZA 5C5CA 4Z3OA 1G3IA 3T3NA 1Z34A 4H3VA 4QUHA 4BMDA 1NJSA 1YKSA 4XWOA 2ZSBA 1EA5A 4DB2A 2H5IA 4M1OA 3WNCA 1IUPA 2HJVA 3ROXA 3S4YA 2CW5A 4BRSA 5JNWA 3E22B 1DTWB 1ZEMA 4RELA 3TJRA 4F4CA 2A78A 2BF4A 2VDRB 3EXAA 1ZXLA 2PXCA 4JK3A 2VPIA 3NI2A 2DFLA 4H1HA 4EYQA 1RRVA 3IP7A 5HR5A 1B6GA 4LOAA 3LF2A 4EL5A 3JZAA 1NI4A 3OHSX 3UA4A 4JQSA 3STXA 1XTTA 4DZZA 3LWDA 4KLZA 4KQWA 1S9DA 2HLNA 3O8CA 3LUAA 1DMSA 3BGWA 4KAXA 4CMHA 3P9IA 1JIVA 1EUZA 1NXXA 1ZI6A 3PWZA 3H1PA 4INPA 2Q1YA 2Q9CA 3MT7A 1JL3A 2QMEA 3RFFA 4D9JA 1JG1A 1ZW1A 2D1SA 3K1AB 4XR9A 2O2ZA 2JGIA 2OGWA 4EITA 3EDYA 4QGFA 3CWCA 3LWNA 3QUCA 1QH1B 4MP6A 2RGBA 2V5AA 3HJNA 1NFFA 1Z2NX 4NI5A 4KBFA 3M4NA 4R5MA 4ARZB 1IUNA 3R0VA 2QPTA 4A2CA 3MINB 1AHIA 1U04A 2QYTA 2VHVA 4FYJA 4FZVA 4BMOB 3WV4A 1FU7A 2WSIA 2V9ZA 5HM6A 2C98A 2ZW9A 1O94A 4C20A 1H4SA 3S8EA 4CLXA 4HB4A 2GN9A 4F85A 3BF7A 4QBKA 2MINA 3GN2A 4ZHQF 4DSAA 2HBRA 4O2LA 1A3CA 5I7WA 1SXQA 2O8DA 4MEBA 1P72A 2KI5A 4AMUA 1E0JA 1C3OB 2GJAA 2OBLA 3V2GA 2BT4A 3CRZA 3IQGX 4FZJA 3PRJA 4E46A 4X61A 4C43A 1HT2E 2HA6A 2IDMA 2PTGA 5CBKA 3R6LA 4OLBA 2XB9A 3WAJA 1U4SA 1WCIA 1V4NA 2EKLA 3SBXA 2XQFA 3ZPXA 1VSUA 1IRXA 3MUFA 4OP3A 1C4OA 3PTZA 2GD1O 3MYRA 4OFBA 4LF4B 2PVSA 3AR3A 1D1SA 5K4AA 3COWA 3EIXA 4HDMB 1TJ5A 4RHTA 4X44A 1SG6A 4MCAA 1H4TA 1OAKA 4MUKA 1VL0A 1TYDE 4LX0A 2TS1A 3ROGA 1S8OA 5C3MA 5FORA 1MC5A 3PI6A 1MX5A 5C4IA 1O5TA 3SM9A 1GG8A 1ZI8A 4WLUA 2IUEA 3WIOA 2IC5A 2WWTA 3TSWA 1KJ8A 1T1RA 3DBIA 5JTTA 3C7KA 3GAAA 3IEKA 1WL8A 2HADA 3GLFB 1KVQA 4XOUA 3B5IA 3RVQA 3SZOA 3KSAC 5GAJA 2J5BA 4XKJA 3R0XA 3NEYA 5DJ5A 1N8SA 3LX5A 2UVDA 4FI3F 2FX5A 3M6LA 4S0XA 2GPWA 5CU7A 3VNUA 1YZQA 2B4AA 5E3JA 4EFNA 4V0QA 2IBTA 2IYYA 1LQ2A 1ESEA 1MGPA 4GDMA 4Z1MA 4OF4A 1R9NA 4KB5A 4W1SA 1KRXA 4LWPA 2R8XA 4ZCMA 4PWZA 4RJKA 1A9TA 3V4RA 1G19A 4XWGA 3JQ7B 1H65A 3TQOA 4RGYA 4O4HA 4EHKA 5BYKA 3A04A 1C4KA 2IOFK 4TSFA 2R62A 3QZUA 4MWBA 3SSNA 5EMMA 1Q16A 3BWEA 2RGGA 3A1VA 3ZE2B 1EWYA 3U4CA 2OQIA 3QXJA 5EJ5A 2V54A 2DKFA 1VOTA 1ORHA 4IINA 3K0CC 5H3HA 1R6BX 4MB0A 2V5UA 2IPNA 5CVTA 2GWRA 4LVNA 2BTQB 1VIDA 4NCKA 3VUFA 4DV5B 2Q9BA 1G59A 4LJ6A 4FOPA 3DJFA 4BN0A 4IDPA 3TOVA 3K2BA 5CDFE 2QN7A 4FSDA 1WP4A 2ECFA 3N6VA 4MMZB 2JD1A 3U7IA 5DP1A 5KHLB 2DCUA 2WF8A 4DR6B 2C4MA 3B2QA 8ADHA 4JYZA 3AVPA 1T6YA 4PWYA 2JFBA 1AURA 3DAYA 4QO7A 4C06A 3WTBA 4AN4A 2DPHA 3X44A 1TW3A 1YMQA 2ZYIA 3FCXA 1M6NA 1JJBA 3LIIA 1JFSA 1V39A 3OQPA 3PPWA 1ULSA 1WVGA 1X1DA 4ENWA 5JSFA 4BQQA 4DRYA 4F45A 3QVOA 1XDBA 3PFKA 2C82A 1H2WA 5HK9A 3GC6A 5FUMA 4CUKA 5BN3A 1K8YB 4Q93A 3DE6X 5ETJA 2NU9B 3DDZX 1CUZA 2OA0A 4P0PB 2WG0A 2YUTA 1N2XA 4Z6KA 3VJKA 1WS6A 4YDSA 5J2TB 2COKA 3OEHA 4J7XA 4CV0A 4GDFA 2P6PA 2O52A 3DLPX 2FPRA 3OPYB 3FR8A 4KQIA 2IEDA 2JFFA 2D7JA 3BMNA 3JQGB 4G56A 4J0GA 5BO5A 1E1LA 2IHVA 2Y9PB 1NC1A 5LIRA 3MN1A 5A5VA 4LDJA 4M37A 2E5FA 1SD1A 5ESXA 1HDEA 3EVEA 1QIIA 3RTGA 5AVRA 5C8ZA 2PAFA 1M1XB 3CLTD 3RSOA 2WIJA 3DDNA 3VTKA 4QFCA 2FN4A 3NVAA 4RZ2A 1T8UA 4YRTA 1OWOA 3O3OB 2Q3HA 3RARA 1LVHA 5KYXB 1NRWA 1OASA 4WCVA 2JIZD 4U9UA 1ORDA 1O1YA 1G3UA 5CLHA 2WUDA 5DGXA 5T7BA 2ZREA 4PG7A 2AUNA 4B4DA 2IE0A 3QYFA 1JRLA 4OK5A 4J16C 4EMBA 3CRVA 1K6XA 4KEAA 5EIOA 3WYGA 4BC1A 5BWNA 4US1R 2FH5B 3QLUC 1SRRA 5BR8B 2VT2A 5AM5A 1SG9A 4G63A 4E12A 1KAHA 1DS6A 5J5CA 4W5RA 4I14A 1BE8A 1GT91 1M8PA 2EDAA 4IJUA 4R3UC 5HMLA 5CDFA 2I6TA 1GKKA 5JY1A 4QDKA 1WV1A 1JXOA 4X92A 5BN1A 2Q1WA 1P81A 2CXTA 3IVAA 3M89A 4XI9A 2R1VB 3BG5A 2DBYA 2VOEA 2LDBA 5D5PA 2LCFA 5IAEA 4BNLA 5TQVA 3BTUA 2HDOA 2RKWA 2FEWB 1W2WB 3C85A 5IVDA 1OLUB 3ZK7A 3T35A 1UAGA 5LDDC 2YDYA 3FNGA 3TYXA 5LB2A 4EKDA 5TF0A 1E8MA 1FLVA 5B58C 3AVUA 4GMHA 4UCXA 5K8TA 4BZXA 2F43A 1I5RA 1EVZA 2G82A 2CXSA 3KQHA 2G67A 4R3NA 4YJDA 4FNAA 1W1IA 2IYVA 5JISA 1MQAA 1SHZA 4D5EA 1RRFA 3ROEA 4YP9A 1GT6A 1C4XA 5ED0A 4KQEA 4EAQA 3IMKA 4ZVVA 2B3DA 2FHPA 4OXRA 1Z4QA 3IAUA 3O4JA 3TE7A 5JNUA 4WOJA 1JHAA 5EMKA 1IG0A 3KUUA 1EE2A 1TL7C 5EERA 3T1OA 1L1QA 1DCTA 5LFAA 4OJNA 4Q9KA 1L3CA 1E9EA 3PUVA 1JKMA 5CIWA 5FYDA 1C14A 3AV0B 1KNXA 1E9VA 3EYAA 1ZMOA 3PRHA 4HDOB 3ZXXA 1G7RA 4E0BA 1M2KA 1V37A 4P6VF 5CH3A 3SZ3A 4BVBA 1JAHA 1BX1A 1Z07A 3K4HA 2WVJA 4YAGA 5EIXA 5CCEA 4G81A 3SOPA 1VHTA 4E2WA 2H00A 2X13A 1JFLA 1TU0A 2NUPA 4HXGA 4NFLA 4Z9BA 5KYVA 3SCZA 5KB3A 3T0FA 4AF7A 2VFAA 2NYVA 1C3LA 1L4UA 1R5NA 4IKEA 2QTVA 2QTRA 2WYIA 5DBHX 3WL8A 2WINI 2HSDA 3QVLA 1LBSA 3H1TA 1OI4A 2GFQA 2I33A 4NC9A 2CGEA 1ZN9A 2H2FA 3IO5A 5DYGA 5TF4A 4RZIA 1P62B 2QQ5A 2XTNA 3PHCA 4BKUA 1OYYA 1B2LA 1E2DA 1QM5A 2AEFA 2F64A 4QYXA 1LPOA 2Q2QA 4OSEA 1ULUA 2FSVA 4ZCPA 4LQDA 3DM5A 3IALA 4DHEA 3AEKB 4RJJA 4E7PA 1V8FA 3I6QA 3WLQA 1KOJA 4NULA 1CR2A 2R8EA 3EDOA 1NY6A 3IEPA 1JUDA 3ADOA 2OHOA 1R1DA 2REQA 1EFRA 1CS4C 2F4NA 5ENDA 5F5XA 1JKJB 2G9RA 2AT1A 4L3OA 2ZAYA 4R68A 5D6NA 1BWSA 3UHAA 5A9SB 2FGKA 2MIIA 2PH7A 3U3XA 2FVYA 1KC1A 2PIDA 3HU3A 4URHA 2Q5QA 3TAHA 2KE5A 2INGX 3U49A 5TX7A 2R8RA 1HEUA 4D8WA 4EGQA 2UUCB 4WH0A 4TMWA 2DX7A 2J9ZB 2XTMA 1WQ4A 2J6CA 5DW0A 1JQJC 4M9SA 2HF7A 2H1CA 2PM8A 2XUFA 5IUJC 1BMFD 2ZRHA 2IYWA 3CZCA 3OE1A 4QD3A 5JWOA 3ONWA 1BGVA 1YVDA 4RPLA 4D4MA 5LYJA 1YC2A 3CXRA 5KKAA 3R7LA 2N3ZA 5AXAA 4EG0A 3Q3GE 2JA1A 1JI3A 1IBSA 1SBHA 5DNVA 4H7DA 1W44A 3BRSA 3I76A 3GIDA 4KCGA 4QFMA 4RXTA 5COAA 6ABPA 4FGSA 5JCJD 1F1BA 2VZEA 1H5QA 1SOUA 1N2SA 3DKVA 3GP5A 3T5MA 4KHPB 3FJOA 2HJWA 3VC2A 3NHMA 4FKBA 3PT9A 3OPYI 4KXUA 1T1SA 2FKAA 2HCTA 2OG2A 1UFVA 3UWPA 3W04A 1T34A 3Q9UA 3UGTA 1J0BA 1IWBB 2GZHA 5KCZA 4J9VA 3PHBE 3T3OA 1DCFA 1NONA 2ZXEA 3HMQA 3LS2A 1YU9A 1Z35A 4RIHA 1V1MB 3F78A 2C7BA 1JE0A 1R8QA 5AXCA 1TFUA 4K6GA 2CXHA 3LBHA 4MP3A 4WLEA 3H99A 4UAJA 1EDZA 3O92A 3G5UA 3BGSA 4Y7DA 1SXJD 4XQ9A 2F1OA 4N6OA 5KQLA 4TMVA 2IBMA 4I66A 2JJ8A 3V8EA 1VGVA 1FQWA 1FNDA 3IV9A 4JOBA 4CKZA 1QC5B 4Y6SA 1MB3A 4DAOA 2EKQA 2VYVD 1YDMA 1M6HA 1PT6A 1COWA 4IX9A 1YS1X 4LQLA 3IP5A 1P80A 4RAOA 2Y1KA 4LTNA 2H5LA 5FOXA 5FTWA 1PUIA 4KPEC 2FNAA 2FMFA 5EJEA 5JCOA 3HCCA 5ITSA 2OENG 4E4YA 2C5GA 3EOZA 3K0EA 1LD3A 3C98A 1L7AA 2MOKA 3LDUA 2H2DA 3V1KA 1KIAA 2WHPA 4BJ1A 5C81A 2PX2A 3DYIA 4H6PA 4KBGA 1D1TA 4LX8A 2Z8ZA 4OK6A 2W6PA 3T7KA 2Q2VA 2XE4A 1U5CA 1I3MA 3K30A 1U6JA 1ZK0A 1A72A 5HQ3A 3N59A 4DDTA 1J22A 5LYJF 1NLFA 5DK4A 3AEYA 3BXEA 5BQOA 2X1VA 3CGWA 5CXUA 3FW1A 4CTKA 4D45A 3USCS 1CUAA 1LTQA 3GMIA 1DKPA 4ZKDA 4BMCA 3IE0A 1HWYA 5CFNA 3PEYA 1E1RD 1U5BB 4RMIA 2C0CA 3SC3A 4ZJUA 3TNFA 2FSHA 1K5HA 1RJ9A 1RYEA 1FU4A 1CQZA 1Z3CA 5F77A 4GR5A 1RQGA 4X5OA 5D5HA 3BQ9A 2EVWX 2JBAA 3EGXA 2GD6A 4CMBA 5L3ZA 4BVLA 3ROTA 1BCSA 2GEFA 1XAIA 1OYVA 3GR6A 3N2KA 4LK3A 1B1CA 3HUTA 5K8CA 4OX9Y 4F2WA 3ICEA 4JA2A 1C3EA 4BX2A 4N6GA 1RWKA 4P2BA 1P8JA 3IHKA 3UJ6A 2EP7A 3ONVA 3GLIB 2GTIA 4J0QA 3BKXA 3H2HA 2B4QA 2ZAIA 2I5PO 3TZEA 2ERYA 3NTUA 1W5BA 4ISCA 3SDSA 5JS8A 1HYHA 2J3DA 4OI2A 4X85A 2OCDA 2IY8A 4UVHA 3UT0A 2P9JA 3ZZUA 1RE0A 3FBTA 4NS1A 1GZ6A 4B8WA 3I5YA 1Z33A 3A32A 1IHXA 4IHJA 2BDTA 2C3YA 1CIJA 4EGAA 1SKQA 3HCNA 4Q21A 4ZC8A 2R751 3TCXB 1ZYUA 3MJEA 4AY5A 4O5OA 5JWRA 5HWSA 3NAGA 4HAWA 1K7CA 4HDSA 3I5MA 3EIOA 5ELLA 3D4BA 5D84A 4NJMB 2COEA 2GVNA 1IC6A 4WVLA 4F3CA 2M1ZA 1G8KA 2W4IA 4FT2A 4PX2A 2B34A 1NHGA 5K3AA 1XQYA 3JZDA 4F93B 1NVGA 5DHRA 1H4QA 3II6X 1BE1A 4B6JA 2FJUA 3VKGA 2Z9DA 2DH5A 3H6KA 4RXUA 3GA7A 5D1NA 3PE4A 4DV1B 1AC5A 4LQ4A 1R9MA 1MG0A 1Y81A 1XC7A 3DBLB 4OI0A 1ML4A 5AHOA 1RT9A 1KXJA 1M34A 2AWNA 3WFZA 4WBSA 5KREA 1TVKA 3KLPX 4HLCA 2H52A 3O0TA 1G21E 3C87A 3C3EA 2GAAA 4WJZA 1D8AA 2R85A 3KKKA 2PKCA 1NUSA 1YRQA 1P2VA 4I08A 1T2CA 1V5GA 3HB4X 2VDOB 3IERA 4P3PA 4UFPA 3ETEA 2ZYGA 3NNNA 3PV0A 5EZYA 5B6PA 4IQ0A 3UFXA 2PH5A 5L6LB 2ECOA 4LS3A 3BERA 4ZAVA 3RHZA 2G80A 4ACBA 4OMDA 2GPAA 3D43A 1QV9A 1T8SA 2B2XA 1IONA 2VL7A 3E9MA 4IIBA 3AUYA 4X3PA 1Y8ZA 1E0AA 3N07A 2Q21A 4X64B 4I1RA 4MW4A 5HUQA 2BN4A 4G5QA 4E1AA 1GPNA 2YDXA 5A3SA 1E5TA 4DRXA 5KJCA 4JKYA 1B15A 3EF0A 1N3IA 4A8PA 3NGLA 4B3BA 2DRIA 2P9ZA 2FZLA 3JQAA 4IUDS 4KOAA 4MRAA 2O19A 4QPNA 4IM7A 3W3ZB 4IDEA 1MW8X 2F67A 3SIRA 4E2ZA 4CDGA 3B1VA 5LJIA 1EUDB 4RH1A 1KDOA 3C5VA 4G0QA 4RPGA 3V4LA 3GP3A 5EQTA 4E5VA 4A10A 4Q4HA 4CF6A 2YJ6A 4E7OA 2ERCA 2OTCA 1CRQA 3PP8A 1JQDA 4DADA 5ELMA 2XQVA 1EBBA 5CT9A 1IFXA 1HETA 1NXTA 2G88A 5I5GA 1IHOA 1NZJA 2LIVA 3CTMA 3JYQA 4HEA6 4LXUA 2PQMA 4Q3NA 3CBGA 4TZKA 4I55F 1RXUA 5ITZA 4HATA 1G1AA 3TW0A 1NN3A 1YJXA 5CTAA 4UNNA 4YMGA 2DY0A 1BHQ1 2JEZA 1QGUA 4K28A 4UDOA 3FYUB 3SC4A 1K5GA 5JATA 5KC8A 4X1KA 4AT1A 5G0WA 4AG3A 2C58A 2XF2A 3GVXA 4RU1A 3H4IA 3ZWAA 2RCNA 1G7TA 3QBJA 3OM8A 3EWNA 4M86A 1K92A 4QUAA 4ZALA 5F5NA 5AUOB 5JFTA 3EEFA 2C61A 1ZNYA 4TUYA 4YUYA 2AR9A 2H54A 4M87A 2AN9A 1TRKA 1XCMA 3MJ4A 3Q1LA 4ZT7A 1KI8A 4ZHSA 2LKCA 2BSQA 1RLMA 2F9LA 3OLCX 5DGDA 2XW6A 1EMDA 1G21A 3BL5A 5BXQC 2NAFA 1ZCAA 4PHFA 4CHTA 1NVMB 3KJHA 3PJFA 3VH4A 3S1SA 5E1BA 2XUAA 4HYYA 2AKYA 4FLFA 4TTJA 4WXPA 3CZ9A 3KXPA 1JEQB 5DMXA 3K9LA 3QLVC 4WSOA 5CFOA 4MQFA 5BWOA 1UFKA 3NDPA 2CNDA 4DLZA 1GD1O 2QBYB 2V3VA 4PPFA 3LK7A 1DEAA 1N8TA 3KE8A 1Y5NA 3IFSA 3LC0A 4RZUA 4I0WB 4XLZA 2QBYA 1ZD8A 2PLAA 4HQKA 3OLWA 4UPDA 5DCYA 4YCSA 3U7FB 2VJMB 1LUAA 4DV7B 1W48A 2OWDA 4QUBA 4DKJA 1ZUD1 3VR6A 4D8UA 3WLSA 5KQMA 4HRAA 5BN5B 1UM8A 3FOFC 3QWBA 2X2PA 1UK8A 1FNBA 3C7TA 3K09C 3N0TA 4GR9A 4AECA 4ZJYA 1RSZA 2QPLA 3NYWA 3PFBA 1C0EA 1M33A 1PX0A 3A6DA 4X1YB 4LF7B 4J7UA 4D41A 4TKLA 4MRPA 3SQMA 4DR1B 5IVPA 3VZSA 4LZOA 4LZLA 3Q7EA 4Y2GA 5FBVB 2I4IA 3FWNA 4NBNA 1ODLA 4RZHA 3UM9A 2ZUBA 3KQOA 5T6BA 4JIMA 1CJTC 2Q5IA 3F4KA 1Z4NA 4EGJA 3I1IA 3O8RA 2WTAA 3OO1A 1N6OA 5EJMA 4PC2A 5JPIA 4YR9A 3JWIA 5FUBA 1BKSB 4IUCS 1OGJA 2Z4SA 4YLGA 3E7FA 2B0CA 1KFCB 1NJGA 2WUVA 1J9EA 1R16A 2ZI3A 4ZVSA 4R9NA 1UPBA 1Z5GA 1E7MA 2SBTA 3CWQA 5K0CA 3PUJA 4Q37A 5DRTA 3VZDA 3DTVB 3W06A 2XYPA 3JD4A 2W58A 3MOIA 1EWKA 2J87A 3C4VA 5T5QA 5EVCA 2Y2UA 4LOIA 2AX4A 2BMDA 3QTTA 3GCDA 1KVUA 3LOQA 3B1XA 4DEVA 5BMVB 3GJZA 4TMXA 4RVNA 4JI8B 5GONF 1Q1BA 2C5AA 2R8PA 2WHEA 3AUSA 2IXTA 5AM3A 2JIRA 1DOAA 3AR7A 4YNBA 3TD2A 4F4JA 4JLBA 1EXVA 1R64A 2PV7A 4LJRA 1R3DA 3JWGA 4W5WA 2BHSA 2B35A 4DBLE 1P19A 3KPJA 1GQ2A 5JS7A 1QGYA 4QTYA 4IVPA 1QO0A 2OCAA 1O94C 1VPVA 3G0DA 1KY2A 1ONSA 4GMFA 4KMRA 3V7FA 5GY7A 5IXSA 4TXHA 4BZZA 3K1TA 1NX6A 4R2KA 1P6QA 4MR7B 1M2HA 1I94B 3DLIA 1DTWA 1HEIA 3D1JA 3E22A 2A30A 2B21A 4Y67A 3N8GA 4ZZ1A 4TN1A 1JG3A 3GG2A 3TN7A 4XEUA 4ZQEA 5HXAA 5HVNA 4PTZA 3D0RA 4XJTA 3A6GA 1JECA 3L6DA 1NVEA 3HGQA 5ALZA 3AI7A 5BRAA 2I4LA 3NAQA 4AUMA 1P0QA 3EN0A 5J59A 3MTGA 4HWGA 2MSDB 1N0WA 2BCJQ 3LHDA 4KRYA 3BIFA 3L8YA 1DQRA 1E1YA 4U7PB 5ENZA 3VNRA 3WBKA 3G0OA 3WYEA 2PL1A 2X14A 2WFMA 3RAGA 3W3AD 2P79A 4WECA 1K4KA 1R8JA 1SCUA 3E53A 3K1AA 3QK7A 4DMLA 3NASA 4N3AA 3WWZA 4RV5A 3QFFA 3IOYA 3EPHA 3F3KA 2NZYA 3A4TA 4FYKA 3UMJA 2OV6A 3BWCA 1SUAA 2IPXA 4F97A 5CEEA 5IM4F 3LK6A 1YV9A 4ARZA 5DNUA 4GVLA 5ALKA 3LV8A 1H9CA 1Y3IA 3CWZA 1AA9A 2IHYA 3MINA 3NJ4A 2FUNB 2XGSA 1SQ0A 2VSXA 3MWJA 1AHPA 2D5LA 1NMEA 4PO9A 3STUA 4GXNA 1IZYA 4NICA 2XKJE 3Q8KA 5JBNA 1ZESA 2QZ4A 2CLEB 2XLCA 2HTFA 3N6RA 2GNPA 4LISA 4RVGA 1CJSA 2JLVA 1WCXA 3T7SA 1DEKA 1C3OA 1RQ2A 4QDXA 2X6TA 2DKNA 3PNPA 1YD7A 3DOUA 1GHTA 2Q4DA 2XECA 2E55A 2RKOA 3M1YA 4KDEA 3EZYA 5FCDA 1M6YA 4DG8A 3DXFA 4J0CA 2F9FA 4XEHA 5IWCA 3A05A 3IR5A 1JF8A 4MO9A 3VH1A 2CCJA 3O4VA 1Y63A 4DLRA 4NU8X 3Q7SA 4FGUA 2IHKA 5HJEA 3L02A 3Q3HA 2J3JA 4UHCA 4P36A 1Y7TA 1FP7A 4Z49A 4IGAA 3C5WP 3UNXA 2PZMA 3TMKA 1E3LA 3H18A 1XTKA 4ND1A 1FTNA 1HDOA 1Z74A 2ZBEA 1QS0B 5IMBA 3UHJA 4LMBA 3KQTA 3PF8A 4HFJA 5DN6A 5FBRB 4Z1OA 1EIZA 3MBKA 2QGFA 1Z9BA 2YHAA 3P2EA 5JC8A 2EGUA 2EX0A 2ZTLA 3WJ7A 2F3QA 3DB1A 1ZNWA 3H0CA 4OGFA 1YS7A 2NT3A 5BSFA 4HDKB 2C5SA 2QL9A 2C94A 3OOJA 4QELA 3UJ3X 3VPHA 4N0PA 3RKSA 5IJ9B 2I1WA 1SQ6A 2K7ZA 5BRNA 1OHHD 5T4EA 3CLTC 1AB6A 3EVAA 1EFCA 3SVTA 4W7HA 4ZCRA 5FBLB 3PQDA 1E98A 4N39A 1EHCA 1NLUA 3CEJA 2FE4A 2PS3A 3R0IA 5ALRA 5B7PA 2PJZA 1DRUA 1QAMA 1UINA 1FFDA 2ODAA 4NNPA 1S7GA 2PAAA 4ROSA 2AMYA 3GFSA 5AVXA 3CEPB 1WXFA 4QHSA 1TKCA 1U6IA 3L7IA 3JQ7A 2FE1A 3PNSA 2AS0A 4FI3C 4ZAXA 3WIUA 3HYTA 3MGKA 2WF6A 4X9XA 3REQB 1SCQA 5KTMA 3PWKA 4QXOA 1DO2A 4WLFA 5DHSA 1V8ZA 2HIHA 4TM7A 3LUFA 3UVEA 4OBWA 5FUYA 4AJLA 2DFKB 5E0KB 2OSVA 5ARDA 2VDNB 1JDPA 3UB2A 2CZQA 1LSJA 5EKXA 5DNCA 3U4QA 1JQEA 4D9IA 5EJ9A 2RHGB 1VLZA 3ZE7A 2BTQA 1HI9A 1SWWA 2GBLA 2HLPA 5IKMA 3ZTWA 3KOUA 1T2EA 4FC6A 4L0QA 2P78A 4ZHQB 1X70A 1F0PA 1XJ0A 4EX7A 2AYXA 1XL0A 4BX8A 1GN8A 3KHUA 1OR8A 1H8HA 4UNSA 3WAKA 3TK1A 4AKTA 2D62A 3HPQA 4AQ7A 3AG5A 4CCAA 4AXXA 4TQAA 1WABA 2WSBA 4BP1A 1DC6A 4EHNA 3WMWA 1NYLA 1SURA 4MRSA 1JG4A 1S3SA 3GEEA 3M9XA 3OLXA 1KF0A 3OSZA 4RNCA 5CCBA 3EZNA 2B69A 1MC1A 1UBUS 2H0QA 1K8XB 2JI7A 1K68A 4RX1A 3RIGA 1CY1A 3OKFA 3HBNA 4CLOB 5AHWA 3GF4A 4O2BF 2H2WA 3OKPA 3HL0A 2EJCA 3SOZA 2NU9A 2PGXA 4AJ9A 4CF3A 1RPAA 3QYPA 3O8OB 4MAFA 2ZB7A 3DHNA 1ICIA 1QG2A 1YQGA 3H4MA 1LRJA 1N6HA 5J2TA 3T5CA 4N5LA 3SZGA 2CBZA 1M75A 2HF9A 2YW9A 3OPYA 5LB4A 2E6UX 1OBFO 3JQGA 8ABPA 2WHRA 4LZNA 2I87A 1IEXA 4LNUB 1Z2PX 5HDQA 3N2LA 1DO0A 1HEYA 1EPUA 3E2MA 4UBMA 4BNTA 3HJBA 4D7AA 5KTYA 2Q3DA 1XALA 3A3OA 1F2UB 3DQZA 3MS7A 4DLAA 3CO5A 3AVXA 1NUQA 2VWHA 3CF4A 3FDJA 3I01M 5LC1A 1DKRA 1VB3A 2PZGA 5KYXA 3U56A 4W9MC 3L1UA 1JHVA 4R16A 3RREA 3PXCX 2FU5C 1U8TA 2DYKA 3PL5A 4KYUA 2OHVA 3KR0A 4OXYA 3T9EA 1BRTA 2G4CA 3NTXA 2AZTA 2YZNA 4WJKB 2WMDA 3R76A 2O5EA 3G2NA 2FEAA 4OUDB 2YQ4A 1BJKA 2YFYA 3ESDA 4OHOA 4JGGA 2OOKA 2XCLA 3SYTA 1U7XA 3OC6A 1U3FA 2ID7A 3FTPA 4MGZR 1KVSA 4NBLA 4A23A 4ZRMA 3A1UA 1JIQA 1VGRA 2YTZA 3KS9A 2R1VA 3B3JA 4P22A 4BGDA 1XD2B 4IDFA 2QJWA 4D57A 5KSWB 1CHDA 2VP0A 2KPOA 3ICOA 3PC7A 4CMIB 3V55A 2LV8A 1JYFA 5A0VA 4PSKA 5K09A 2BTEA 2GK7A 3NVDA 1NJ8A 1TKAA 3GQVA 4MUEA 4LUCA 1KTIA 2P35A 2XVYA 3FCYA 3VR3A 4Y1FA 4AWBA 4YS6A 1K0UA 4CLRB 1G9SA 3PDCA 5FWYA 2BI7A 1U7HA 4QXAA 2CDBA 3CNQS 4KKVA 2J5QA 3GBVA 3C3CA 3H87A 3D54D 5C7LO 1N4AA 4HNUA 5IKXA 2X8JB 1H23A 3LKZA 4GICA 1O4WA 4CR8A 1P75A 1E6CA 1SUPA 4E88A 9LDTA 4O2AF 4MS4B 1KMQA 2O5CA 4AS3A 2CVOA 2SKDA 4FDVA 4WDRA 4Q7QA 1OFGA 1L7QA 1R3UA 3H17A 4QOIA 2WJIA 3GJ3A 2Q1XA 3NZEA 2ATCA 1VBNA 4I3GA 1SIBE 3PNYA 2QQFA 2Z95A 3VSEA 1Z6QA 2H48A 3PR1A 1HTWA 1P44A 3EFOA 5A6VA 5LP6F 3FDXA 1O6ZA 2WKWA 2PX4A 1PLKA 4OQMA 4P32A 4WNCA 4AY4A 2I7TA 2ZGVA 3K71B 5KJFA 2OUIA 1DVRA 4GI2A 4NE7A 2AJCA 2BFWA 1R0ZA 2QD2A 3FAKA 4KNVA 5HBRA 4MIKA 2IHJA 1F38A 1KH2A 4ZANA 2VR1A 3KJFA 1BOOA 4G26A 4IRMA 1WPGA 3KSDO 4WTOA 3VX3A 1TIKA 2OCLA 1NW7A 2QDKA 4IQ8A 1S2GA 3DOHA 1E3JA 3D3KA 2GAJA 4ZDIA 1SXJC 2APJA 3H05A 2AI3A 2ZZKA 3W2HA 1M1ZA 1P1RA 2JFQA 1UBCA 4KTVE 5DNAA 2BR5A 1G41A 3HB9A 4DV4B 1VMIA 2DSNA 3RJMA 4Z7QB 3KQVA 5L45A 2O59A 2ZWPA 4N4AA 3EXIB 3LHKA 4ENPA 1O9BA 1CF2O 2F00A 2IKSA 2FFBA 2QRQA 3AEKA 3QIAA 3P26A 4RDHA 1JR3E 1U3TA 4TQGA 3WBBA 5LDHA 3OZCA 1K27A 4HMQA 1C7IA 1KI1A 5CBPB 1QQ5A 3AB7A 2HHJA 3HJCA 3IKMB 4GLBA 1R0SA 3L1KA 3L7DA 3M7IA 5A9SA 4J2HA 4F91B 2Y76A 1U65A 2CLFB 3DDUA 3IGFA 1V4VA 2FWNA 4YRSA 5L40A 3RTBA 1Y9ZA 1UKCA 2VYQA 4J9UE 4MA0A 3WRWA 2QVBA 2A9QA 2QAGB 4EI8A 5B37A 3DHYA 2OD2A 4GHWA 3W1VA 4AKHA 5B58T 5AYVA 3HSKA 1HORA 5KYYA 1HX7A 5HP4A 2E49A 3H0EA 1AGYA 4XM1A 3NFRA 3E61A 5F2NA 1XTZA 2E1PA 2IOFA 1KQ3A 2TYSB 2GKSA 3CF0A 3KOWA 5ECYA 3TWOA 5K05A 3N28A 2L82A 1ONPA 3O82A 1AKTA 1WMAA 3HPRA 3LOPA 4I4TF 1N25A 1UBTS 2W2MA 4KAFA 1VCHA 5B3KA 1IQ0A 1D9XA 1AT1A 3U9LA 4KN9S 5LQNA 5SY9A 3U61B 2W6OA 2D5BA 2JIBA 2Z2KA 3EAGA 4ETIA 3WG9A 4EHHA 3KALA 5M04A 4BNKA 4YPOA 1XAGA 1XDUA 1JDBC 3BDAA 3CW9A 2QUBA 4AJKA 2NO9A 1XWWA 1J4AA 1KJIA 3JATB 4LECA 4M1WA 2BZGA 3K94A 1QIFA 1V1MA 2FSIA 3LGAA 4LGVA 2XCSB 2BJVA 5CLGA 1VZ3A 4COKA 4EUKA 1UBSB 1NMQA 4RSMA 3GJ8A 3T6KA 2XB2A 4I81A 3AHGA 4ZJPA 4Q7LA 1TQ4A 2R86A 5I7RA 5JECA 2QRMA 1NPYA 1ZIDA 3L82B 4N0MA 3RG2A 1MORA 4RPIA 3TKYA 4B6QA 1SXIA 3THOA 3ZU5A 4F4FA 5I48A 1QC5A 3GGDA 1OIVA 1RRMA 3G0CA 3NIFB 4Y18A 2A4KA 5LLTA 5ALMA