4H7HA

Crystal structure of haloalkane dehalogenase linb t135a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVAMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7hA00
2WFMA 2WUFA 5D3ZA 2OG1A 4MXDA 3T52A 1F0PA 3P2MA 1R88A 2O7VA 4X6XA 3C43A 2WJ3A 2Y6UA 5DTJA 1YB6A 1DX4A 5FPQA 3WK4A 2AJLI 5T4EA 2JGEA 5BV7A 1BEZA 1WB6A 5A6VA 3K6KA 4PV7A 4H7KA 1ISPA 1QIEA 4XIIA 2OQIA 4W1PA 4OUKX 3WL6A 3VJKA 4OB6A 4DLNA 1MX1A 3S2ZA 4H18A 3F8SA 2HA6A 3WYDA 1XROA 2PSDA 2X5XA 2Y2VA 5LZ8A 5HK9A 3F9CA 4CCYA 3HXKA 1S8OA 4MJ3A 2WIGA 3BWXA 1O6FA 5T4FA 4WDRA 5LYYA 2JF0A 2XUOA 4BC1A 4BRZA 1XZIA 2WTMA 5CXUA 2I3DA 1QIDA 4KRXA 5JIBA 1R9NA 4BCBA 2WSLA 4LXIA 2YYSA 2GBCA 5AJHA 1CEXA 5SYNA 3DCNA 3ANTA 2G4LA 1C4XA 4X90A 2Z8ZA 4BDTA 2JEYA 2RONA 1A7UA 1F6WA 3H1AA 1N8SA 2CZQA 5HF5A 1ZIXA 1CV2A 3E0XA 1UWCA 3G9XA 3FAKA 2H7XA 2PSJA 1BCSA 5FLKA 4JH0A 2C4HA 3C6XA 5JZBA 3WIBA 4QDZA 4AMYA 1SCIA 1Q0ZA 3I2IA 2WUDA 5E4YA 3LLCA 1GGVA 1K63A 3HACA 4K6GA 1QIJA 1EDEA 3FCYA 4HXFB 3ZI7A 2ZYSA 4I4CA 1X2BA 1H22A 3W9BA 3D5EA 3L1HA 1XQVA 2JGIA 1WPXA 4GXNA 3RKSA 1JFRA 4X91A 1DT5A 4UBJA 4Q3LA 2XLBA 1CVLA 3FYUC 5HCUA 1GPLA 3G0CA 5T4HA 3STUA 2YXPX 3C70A 2B61A 2JBWA 2VTVA 4CCYB 2HA2A 1EI9A 1E8MA 2QM0A 1SCQA 1WHTA 1GQSA 1ODCA 2UZ0A 2BJHA 2AJDA 1E5TA 1WPRA 1XQYA 4UPDA 3GA7A 1YR2A 1ODTC 1L7RA 2OCGA 4C4XA 2QVBA 1G42A 3H1BA 5ALQA 4QDOA 3ESDA 1EX9A 4Y2PA 5EHQA 5CXXA 2WG2A 3DEAA 4MYSA 4WFIA 1OXMA 3A2NA 3TGLA 2FX5A 4FBLA 1VE7A 3HC7A 4JYMA 4Z49A 1MNAA 4J03A 3OC0A 1QFSA 3ZV7A 3TJMA 1AQLA 5BWCA 1W1IA 3I2KA 3EQ8A 3G0DA 1BCRA 1BU8A 2EDAA 2XT0A 4M0EA 3B12A 2XUJA 4QLOA 4BE4A 3AIMA 2VT7A 3CCCA 1JU3A 1N5RA 2C5FA 4EHBA 3OOSA 4U2GA 4B85A 4HRYA 4UFPA 4B7ZA 4J0JA 5A2GA 3HEAA 5D6OA 4N5HX 2WHRA 5ALWA 1R9MA 1AX9A 4Y2RA 2WHPB 3H2KA 3R3ZA 3A70A 1DTEA 2PU7A 2Y2UA 1VLQA 4EA6A 1K8QA 1X2EA 3ANSA 4K2AA 5AKZA 3PF8A 5DWDA 1CR6A 1YB7A 1CFJA 2GYUA 5ALYA 4B83A 1G5FA 2Y1KA 1GPNA 1U65A 1VOTA 5EHXA 3FYTA 5YASA 3IUQA 1P0QA 3EIOA 1E3QA 4EY8A 3ICWA 4X7BA 1UOPA 5C8XA 2ZYRA 1P0MA 3O4IA 4LHEA 4DNOA 2VJDA 1ZD3A 5K3CA 1FFAA 1QOZA 4XWGA 3D2AA 4Y2YA 1QGED 3G0BA 2QKYA 1EA5A 1CUBA 2DHDA 2XMCA 1A8QA 1KU0A 4A16A 3TRDA 4FOLA 5IVDA 3FNBA 3WWPA 1EDDA 1ACJA 5AM0A 2ZSIA 4C87A 4QDUA 1XZBA 1CUUA 2XUQA 3WK7A 2PVSA 1THTA 2EDCA 1K6EA 4PSCA 3FSGD 2WG0A 2J3QA 3C6BA 2HFJA 4O08A 5JADA 2JEZA 5CW2A 4EY4A 3PUHA 2RI6A 5A7GA 2JIDA 1AC5A 2BCEA 1VE6A 6YASA 3KWFA 4ZV7A 2ZVDA 3Q0TA 1NU6A 1UKAA 1HPLA 4FKBA 5JAUA 3O0DA 1BS9A 1U8EA 5AKXA 2QS9A 2C7BA 5AO9A 3M81A 4BCDA 3B3QA 5FP0A 4C4ZA 4KACA 5HF6A 3C6ZA 2WU4A 2OPHA 4OCZA 2ECFA 3H2JA 5ESRA 2XMQA 1LPPA 3WK5A 3I2HA 4BP8A 2K2QB 1RWQA 2O2GA 1SCKA 5ALEA 1XZAA 5AKKA 2VAXA 3EBLA 2HRQA 2B9VA 1PJAA 3STWA 4Q3KA 4AQDA 1YSCA 3DL4A 2PPLA 2WG1A 3W06A 3GUUA 2PU5A 3WK6A 4J3JA 3FVTA 1XZJA 1UFOA 5ALXA 1GPKA 2BUCA 2Z3ZA 4QWWA 4J0HA 4U2CA 3IB3A 4IHAA 3PI6A 4X92A 1FFDA 2QXTA 1CPYA 4J0IA 2PUJA 2HADA 2C58A 3ZPXA 2IITA 3WK9A 5BWBA 2XMDA 4FBMA 4EY6A 1NX9A 4ZWNA 3S8YA 1AGYA 2WILA 4JYPA 3R3XA 3PDCA 2DSNA 5K5EA 3R3VA 1LBTA 3V48A 2ZJFA 1ODSA 2JGLA 3PUIA 2XQKA 5IVKA 1XZFA 3HI4A 3H2GA 5JALA 3G7NA 4X6YA 1U2EA 4PW0A 4XX1A 4NS4A 1HLGA 5A62A 4MYDA 4H7DA 1W76A 4B0PA 3VISA 4UBKA 4PF1A 4DGQA 3AJAA 1ZGCA 2H9YA 1TRHA 3L1IA 1UOOA 3NGMA 3QPCA 4Y2VA 4ZREA 2HU8A 4QDTA 1TIBA 4DSZA 2XUFA 5ALSA 1QFMA 3IIIA 2ACEA 3FLBA 1HL7A 1Y37A 2BGNA 5HF8A 1AURA 5ALFA 3C8DA 4DYHA 5JAOA 3FLAA 2CB9A 3DKRA 3GZJA 4ETWA 4H35A 4G4GA 1PFQA 3PF9A 3BF8A 1WHSA 1QIKA 5K3EA 1CUXA 5CTAA 1JMYA 1YS2X 2WUEA 3BDVA 5C81A 1LBSA 3VJLA 1EVQA 2XUIA 2OCLA 1VA5A 3WKCA 1SC9A 2ORYA 5EFZA 3VJMA 1Q0RA 3WWEA 3NOXA 2YH2A 4FFVA 1HDEA 2VA9A 1Z68A 4QEKA 2HA0A 4U2BA 4W1RA 1CIJA 1LLFA 1ZICA 3FBWA 2QJWA 3MUNA 2VATA 5CH3A 3M83A 2P8SA 3N2ZB 3D3NA 3OPMA 4V2IA 1VZ2A 3BJRA 2CUTA 4LYDA 2HA7A 4W1QA 3BIXA 1BN7A 1LPAB 2I3ZA 5JANA 4UHHA 4G4IA 4AX4A 3IDAA 4HS9A 1UT6A 4U2EA 1XRQA 5EIHA 3M3DA 1YS1X 2GZSA 2XUDA 3MGAA 1QTRA 2GBFA 3STVA 5AP9A 3VDXA 1ZD2P 4E11A 5EHZA 4H7HA 5FPPA 5AIAA 5JZ9A 4Y7DA 2RAUA 5AKJA 4B9AA 2WIFA 2ACKA 3U0VA 2D0DA 5I9IA 1LPMA 1MNQA 1JKMA 2GYVA 2XB6A 2XLCA 4DTCA 2I03A 1CQWA 2V9ZA 3ZLUA 4HXGA 2XQFA 1LPSA 2C0QA 4Q3OA 5AI6A 5FOQA 1F8UA 3OTQA 3M82A 1WB4A 1J07A 2PSFA 5LZ9A 2WHPA 3F97A 2PX6A 2OGSA 5K3AA 1UK8A 5EIEA 1YCDA 1W6RA 4AB1A 3WKAA 4AN1A 1ZOIA 1GZ7A 3V9AA 2XMSA 1IMJA 2EEPA 1LPBB 4JEIA 3UUEA 3N0TA 3K9BA 3I6ZA 4B9EA 5JARA 4Y2UA 1ZD5A 1JJIA 4KJXA 5KREA 5E2IA 2XQGA 3LIIA 3AILA 1P0PA 4C01A 4AZ3A 2Y6VA 3C6YA 3L1JA 3DLTA 3FWHA 3V1NA 4HAIA 3DOHA 1VXRA 3WJ2A 3D2CA 3STXA 4I19A 4E14A 4EY5A 1CUAA 3R0VA 1XLVA 4UBNA 1MTZA 4BDSA 2DR0A 2RHTA 4RNCA 2XMRA 4DMKA 1PV1A 4UFNA 1ZI8A 4DMFA 4G4JA 3QITA 4G8DA 4OB7A 4MWTA 3G9UA 4RPCA 5IVHA 1XRLA 4AZ0A 1DT3A 3WKDA 5LLSA 3QBJA 1IUPA 4X3CA 4BZZA 5AM1A 1WM1A 2JGFA 4Q05A 4WY5A 3C5WP 4U2DA 5HKBA 2RHWA 3V1KA 3C8HA 3R40A 2XMZA 3QZUA 3QPDA 5HKAA 1CUIA 3JYHA 5ALMA 5JASA 4KE7A 4B84A 2H7CA 1CUHA 4FDMA 3PICA 1OCEA 4P08A 3BL8A 2AJ8A 4LIPD 1JJFA 3SX4A 3WK8A 4PO3X 1CUDA 4U2FA 5ALHA 4AXBA 3SK0A 1X70A 1MU0A 5LZ7A 3WKEA 2C0PA 2R8BA 2NW6A 4P93A 4HTAA 4OYYA 1JMKC 2XUKA 1HKHA 2WQZA 2H1IA 1N1MA 4N8EA 5AK3A 2WU3A 1CUEA 3C45A 2XUGA 4X71A 1T4MA 1WCYA 4BE9A 5EIAA 3E4DA 3OM8A 3W9UA 3D7RA 1LPOA 3QVMA 2AJBA 2XMGA 4FLMA 3H04A 3BXPA 4H0CA 4A23A 5CH5A 1FJ2A 3H17A 2XDWA 1XZGA 4BTLA 1E8DA 3K2IA 4CIBA 4OU5A 1MPXA 3QH4A 4UBMA 3DJYA 3AIOA 4L72A 2AXEA 3AFIA 4YX9A 1G66A 1UK6A 2GZRA 5LKRA 1XZCA 1XQXA 1JU4A 4N8SA 3WZMA 3QPAA 4M0MA 5CURA 1DU4A 2Q0XA 5H3HA 4EZIA 5AI4A 5AOCA 3G02A 4NVRA 3WL7A 5AI0A 5IVIA 1C7JA 2WTNA 2WLSA 2V98A 3CN7A 3QMMA 4Y2TA 4Y2JA 5AKGA 2QUAA 1C7IA 3WWDA 1G4HA 3PE6A 3FOBA 1AKNA 4EBBA 1DX6A 5K3BA 1XZDA 4ROTA 4K6HA 5ALTA 3WWCA 1CUGA 1QIFA 4RE5A 5AK6A 4BB0A 3QMWA 4L0CA 3WMRA 3D0KA 2R11A 2HA3A 4H7IA 1THGA 2VEOA 4S0XA 2OAEA 3DYIA 3ESBA 3ZLVA 3VXKA 2W22A 5AK4A 2OGZA 1XZKA 1XRNA 3W05A 3T4UA 4LKOA 3MUOA 4FLFA 1EB9A 5F4ZA 3FVRA 5CMLA 4GEGA 2Z5GA 1R50A 5JD6A 4CG1A 3I2GA 1DINA 4A5SA 4GLBA 4WDQA 4GW3A 3FSGA 3I2JA 1BN6A 4I3FA 1QO9A 3I28A 3BJMA 2OQVA 1ORVA 4D9JA 4ZXFA 3WWOA 4MWSA 1XLUA 1ZD4A 5LZ5A 3IUJA 2GBGA 3WL8A 4W1SA 1W52X 4EUSA 4W63A 2HA4A 4UHCA 1CUWA 2VQ6A 1H2WA 4B82A 1A88A 2BAGA 4X6UA 4G9GA 1MAHA 4BTVA 4N5IX 1YAJA 5KBYA 1DQZA 3NUZA 1H2ZA 3DKKA 3SC2A 3F96A 4QLAA 2OCIA 4FMPA 5AHXA 4J0GA 2BUBA 1TQHA 4MEAA 2VT6A 1XZMA 5D3KA 5CT4A 4PQEA 1R3DA 2WKWA 4F60A 5ALKA 4F5ZA 1UZAA 1IZ7A 2XUHA 4BCCA 2GBIA 4GWLA 2DHCA 4GECA 2HA5A 3D4LA 1QLWA 4RGYA 3OG9A 4KAFA 1AUOA 4OU4A 4DNQA 5AKIA 1XKLA 5AICA 1DWPA 2PBLA 1SOMA 4Q1VA 1GQRA 1EB8A 4X97A 1FFCA 3IBTA 3GELA 3JWEA 2VJBA 3R41A 4FNMA 4BATA 2HHAA 3O9MA 2OAGA 2VSQA 3HSSA 2CKMA 3AIKA 2V96A 2VJCA 3AINA 2IX9A 4UBOA 3G8YA 3PFBA 4OYLA 1BE0A 2JGJA 3AZOA 1RP1A 1K5PA 2RGUA 3QM1A 4QWMA 4CFSA 2XQIA 5AKHA 5CRIA 5E4JA 3TEJA 5A71A 4BZWA 5ALJA 5ALVA 5A7HA 5AM3A 3EF3A 3HABA 4QZVA 1UK9A 1IVYA 1B6GA 4J7AA 3DOIA 2HU5A 3Q8WA 5IKXA 3ICVA 1H2YA 2WFLA 4BVKA 5DNVA 1E89A 1IZ8A 2PL5A 4AO6A 1HBJA 2WUGA 5HK8A 3ESCA 3KD2A 5D7BA 5FKJA 4GDMA 4XVCA 4F21A 5IH7A 3C5VA 1WOMA 3ZLTA 3ESAA 1W75A 3EQ9A 4BAUA 3WL5A 5T4BA 4UFOA 4H77A 4K5QA 4LXGA 1YASA 2PSEA 5ALDA 3GROA 1VA4A 3DL7A 1EVEA 3WIOA 4DMHA 1UKBA 2XUAA 4FLEA 3AZPA 3A2MA 2I78A 3HRHA 5J3JA 5LIPA 1EHYA 1UKCA 4KEAA 3G9TA 3FLEA 5AOBA 3NWOA 1WB5A 4EY7A 4FNGA 4FWBA 2ONCA 2XI4A 4NZZA 5AKEA 2QJRA 1GXSA 4RE6A 5AM4A 2CBGA 5DNUA 2HM7A 4DSAA 5HFAA 4Q82A 1QE3A 5FXMA 3C87A 2B20A 1UK7A 2JGMA 4HVTA 3WZLA 1IUNA 5ALPA 3KXPA 3DQZA 3QMVA 4Y2SA 4BAZA 4KYVA 3ED1A 3RLIA 4NMWA 4BP9A 5AI8A 2LIPA 5DYTA 4B80A 4IH1A 3WQHA 5C8VA 1AMNA 1UXOA 3KSRA 5AM5A 2ZJ7A 5LZ4A 4M0FA 2WIJA 3HLKA 1E8NA 2G63A 3ZWQA 1J2EA 4F0JA 2PUHA 4UBLA 3VKFA 1J06A 4UHBA 5K3DA 4TVKA 1MN6A 4WFJA 3WYNA 4X94A 5I8PA 4TGLA 4N8DA 1LZLA 2OGTA 3SWWA 2CMFA 2VAVA 5BOVA 1LNSA 3DS8A 3BF7A 4OSEA 5AK5A 1R1DA 4YK7A 2J4CA 5A7FA 1GKKA 4DM7A 4J0KA 1E66A 5HF9A 2DFPA 3RM3A 3FYUA 5CT5A 4PNZA 2QOEA 3VVLA 4KE8A 4L9AA 2C5GA 4CG2A 1QJ4A 4HZGA 1XQWA 2HL6A 5FUMA 5AI9A 4UBIA 1D07A 1VJ5A 3VVMA 4BRSA 1EK2A 1CUFA 3IUMA 4IH9A 5ALUA 2WJ6A 3IURA 4E15A 4P92A 3GBSA 3D2BA 3DNMA 4G5XA 1I6WA 5CT9A 4ARBA 3RK4A 3G0IA 1ACLA 3KDAA 4DMCA 3CCBA 2O2HA 2ZJ6A 2G5TA 1LPNA 4FHZA 2OXEA 3I6MA 4DIUA 2HRRA 3O4HA 1EDBA 5ALIA 2WFLB 5DNWA 2OLEA 3BE8A 2XUPA 1FSSA 1JI3A 2Z3WA 3A2LA 2IIVA 2O7RA 1Y7IA 2QR5A 4ITVA 4KAJA 4CI9A 2BFNA 3LP5A 1CUJA 4LXHA 2HFKA 1R4ZA 5CBKA 5HQ3B 2OCKA 1M33A 5CT8A 2CJPA 4GBGA 2QZPA 4QNNA 1Q83A 2D5LA 3O4JA 3W04A 5HZGA 4OD0A 2HDWA 4W9RA 2BGRA 1ZJ4A 4G8BA 3O4GA 4AO8A 3BIWA 2H7YA 3V1MA 1BRTA 5JATA 5K3FB 5C7YA 4C4YA 1EK1A 4WJLA 5CT6A 2XMBA 3WA7A 2PM8A 1T2NA 1JJBA 1XRRA 3FYUB 3HYSA 1USWA 1ZIYA 5AH0A 2QUBA 3A6ZA 4QE3A 3V1LA 5AKYA 3WI7A 1L7AA 2FJPA 3STTA 3JW8A 3RARA 1CLEA 3YASA 3LCRA 3STYA 1TCCA 3O9VA 5ALNA 4TPKA 5LP1A 2WFZA 3CN9A 5SYMA 4BBZA 3DD5A 5DTIA 4OB8A 1DQYA 4INZA 5AIBA 1VXOA 1YA4A 4JUIA 3I6YA 4IQ4A 1GT6A 5JAPA 1BROA 4EB0A 3IVMA 1FFEA 3H18A 5JZSA 1EINA 4AMZA 4MQMA 4X00A 4K6KA 2HU7A 2WIDA 5KWIA 4G9EA 4ZGBA 1CRLA 4X93A 1QO7A 4QA9A 5FV4A 4IH4A 3UUFA 1ORWA 4B81A 4KRYA 1XRMA 1HQDA 4B6GA 3HJUA 3EQ7A 4BVLA 3I1YA 1L7QA 7YASA 4G8CA 1XZLA 2ZYIA 1N5MA 3B5EA 4ZRDA 5JAHA 3BDIA 3H0CA 5DJ5A 4E46A 4BVJA 1LZKA 5AKLA 3AUKA 2W6CX 2ZSHA 1CUCA 4LYEA 2BKLA 4B0OA 1ZI9A 3KOOA 2ROQA 5EI5A 1XZEA 1TCAA 1IUOA 2J3DA 5ALGA 1QIHA 2ES4A 1QTIA 4GHWA 4AO7A 1NU8A 1XFDA 4WFKA 5I7UA 1VKHA 3IUNA 1FFBA 5KWJA 4UHDA 1MAAA 2J4FA 1ZJ5A 2WJ4A 4P9NA 3ILSA 5FDFA 5E4TA 4H7JA 2B4KA 2GYWA 3H19A 4CCWA 4AN0A 3E3AA 4X85A 1KU6A 5JD5A 3AZQA 5DYWA 1MX9A 5LZ2A 4BC0A 4Q34A 1CUSA 1H23A 1P0IA 3H2IA 1QIIA 2QRUA 1UOQA 1TKRA 3QYJA 3W2TA 1W4LA 1MJ5A 1QZ3A 1JT2A 5HFNA 1VZ3A 4H7FA 4DNPA 4QDXA 3O95A 1K4YA 4C89A 2FUKA 2VF2A 4C88A 1EXWA 1MX5A 1SFRA 1QIMA 3E1GA 4X95A 3G0GA 4GI1A 3KWJA 5JD4A 3I2FA 4FTWA 5FRDA 3G9ZA 1Q84A 3DYVA 4OPMA 3DDUA 3R3UA 5ALZA 3I1IA 1LGYA 2CEKA 3F98A 2G5PA 5EHNA 4WY8A 4HRXA 3D59A 1XRPA 2AJCA 1QONA 4XJVA 1ETHA 5AI5A 4UHFA 1YA8A 5DLPA 3U1TA 5AM2A 4CIAA 2XQJA 1U4NA 1CUYA 2DCMA 4KAAA 3LIPA 5C8ZA 3WLAA 4HXEB 2YASA 1YAHA 3IA2A 1J1IA 2XE4A 2Z8XA 2WHQA 4JNCA 2VJAA 3FCXA 2O2IA 1GKLA 4ZI5A 2HIHA 2E3JA 3PFCA 2BUAA 2QXUA 4KE6A 2FJ0A 1XKTA 1XLWA 1XZHA 1O6GA 4YPVA 1A8UA 2PSHA 1CUVA 1Y7HA 4J0DA 2QMQA 3LS2A 2ZYHA 2DQZA 4L3WA 5HQ3A 1ZI6A 4DNFA 4WCVA 3OURA 1DWQA 2DHEA 4FFWA 4KE9A 1EH5A 4IO0A 4ARAA 2WM2A 1BEEA 2RIPA 5CH8A 3F67A 3IULA 3WKBA 1QIGA 2QT9A 3GFFA 5K3FA 1B41A 3H2HA 2X76A 3UMJA 1DWOA 1H2XA 5ISMA 4BAGA 1MT3A 3X3HA 2JGKA 3R3YA 1A8SA 3WA6A 4PSDA 1MO2A 3CXUA 2V97A 4YASA 1CQZA 2DQYA 5AOAA 4C6HA 2WIKA 4J0CA 4Y2XA 3R3WA 1TCBA 4G1FA 5ALOA 5ALRA 1KEZA 5EGNA 1CUZA 4UHEA 4PSUA 5JYCA 4UUQA 5LKAA 1AZWA 1TK3A 1RYYA 4Y2QA 1OILA 1TAHA 1F0NA 5ALLA 4BYMA 4MEBA 2PKYX 4KR0A 4ZV9A 2QTBA 1ZGBA 5DYYA 4MQLA 4H7EA 3WJ1A 3MVEA 2X8BA 4Y9SA 3HZOA 4CG3A
chains in the Genus database with same CATH superfamily
1KZ6A 2MINB 2WUFA 2E4VA 4JC4A 4ZVSA 4E5DA 5J4LA 3R23A 5EERA 1F0PA 1VKRA 3P2MA 1BCSB 1YRAA 3SJZA 1R88A 1ZOPA 2MR6A 2Q2OA 3OQ6A 4GPBA 4KK3A 1QAOA 2DUUA 1VJCA 2O7VA 3C43A 4M1SA 5CGZA 3U1VA 5CXQA 5AVTA 5L6MB 3MXOA 2EBUA 4CMIA 1E2DA 4FGZA 2ODEA 4WOCA 4UQPA 1DC3A 3FZGA 3EZ9A 2QK4A 4MS4A 1SNYA 1FY2A 2DFKB 2F1KA 3AETB 4I99A 3ZXSA 1WCIB 1Q44A 5FPQA 4LCBA 5C3UA 1EJBA 3QI2A 5E9WA 4FN4A 1JLLA 2HU2A 1L4MA 4HZIA 2YFKA 3JQBC 2XEDA 1CERA 2YHAA 3ORYA 4L7VA 4EARA 4WBNA 1KEPA 5ICEA 5IT4A 2OHGA 1Z83A 1A5BB 1BEZA 1PWEA 3CE6A 4IPTA 1OX5A 4BY9E 1VBNA 1Z3CA 2JI4A 3Q12A 4G01B 3T3HA 2N0SA 3OFJA 4F4DA 3AI1A 1ZJJA 2VF4X 2GZ2A 4UU7A 5BW6B 3VC3A 3AM1A 5LXTF 1MRZA 1T8RA 1E1YA 4OUKX 2WWVD 1NYLA 3VJKA 3S27A 2PBZA 2CLEB 2KWIA 3D4IA 1MX1A 3S2ZA 1PV4A 4CM3A 3TEMA 4P3KA 1YF3A 2B8WA 4BUZA 1P3DA 1U0HC 4OK5A 1DO8A 1T6NA 1XJWA 2VDJA 3NDJA 4K9NA 4FMCB 4HPXB 4XE5A 3UFXA 3VSDA 3W5AA 2WNHA 4AW9A 3BMNA 4U5QA 3AHJA 1KJ8A 5BT8A 1PAUA 1UBOS 3ESXA 4CCYA 4G0PA 2HNKA 4NTZA 5C8YF 1U0JA 5COAA 5CDUA 3JVUA 3F3SA 3LKDA 5HIKA 2XBMA 1L5KA 5C5EA 1PQWA 1XCGB 4L4RA 2WWTA 3GLUA 3UCFA 3GUZA 1IRXA 1HLDA 1AKEA 1O6FA 2FX2A 3BWXA 1GLGA 3RWOA 3ZIUA 4DIEA 1JEEA 2DZDA 1ZL0A 2XVMA 1O03A 5T4FA 1S1MA 1NUTA 2A0FA 3ANYB 3F7OA 4FYYA 1T34A 2H06A 4IO1A 4QYTA 2P4UA 4RPIA 5KX5A 3CEMA 4A8HA 2MT9A 1OU0A 2FZKA 1KS2A 4CMEA 3A4IA 3A6DA 4ZKEA 5CXUA 2OSBA 1JZSA 2I3DA 3HPQA 4BCBA 5JIBA 5J63A 3Q3VA 3U7GA 3U0BA 1CIPA 2YYSA 1GCIA 3SLKA 4O4IB 4CGYA 5AJHA 2G25A 2HQOA 1XPRA 5SYNA 3DCNA 1BW9B 1SK8A 3W5HA 4EQ6A 1L7XA 3I5AA 3OKPA 1KTIA 1P0CA 1VL6A 1RJDA 2OTCA 1Y9JA 3AFOA 4X90A 3HNRA 4Z3DA 2JGAA 3OH8A 2HPZA 1Z22A 1T3LA 3MTIA 1E1CA 1VSUA 4UVDA 5ECGC 3EWIA 3B82A 2JVIA 4IM7A 2V6IA 3GFGA 4ERXA 4JA2A 3H1AA 1MOZA 1VKOA 1N8SA 2CZQA 4CETA 1CY6A 1V1RB 1ZIXA 1E9DA 1JG6A 3B3JA 1GTZA 3COPA 4GL4A 2O3RA 3AP2A 4JR1A 4QPCA 2G6TA 1DQRA 2AIRA 1EFLA 2NWQA 2JGDB 3JYLA 2PMEA 1EUZA 3RLFA 3W8EA 3IDQA 1DMSA 1RLMA 3EVTA 4JS0A 4OXRA 2OO5C 4RLHA 3UGQA 2PSJA 4EEXA 1R6VA 1KOLA 5B1YA 2PAAA 2MSLA 2O3JA 2ZDHA 3BCUA 3DE0X 3CEAA 4BKQA 3C6XA 3K73O 4JMLA 4MRSA 3IIJA 2B7BA 4R1MA 3ESYA 5DNYB 2J9FA 1FNMA 1K6MA 2CJYA 3D7NA 3MTBA 4QDZA 4AMYA 3IIEA 5ITVA 1H8EA 1QSGA 2QRGA 1MEJA 3I2IA 3NETA 3D1VA 3HJCA 2AOXA 4ZRMA 3E7XA 3LLCA 4BJ1A 3L0BA 4EAQA 1LDYA 5KOYA 5HG0A 1X77A 2JCGA 4ZQHA 2ZT8A 4CNQA 2IS2A 1M67A 1K63A 1PDVA 3ZD8A 1YR7A 4K6GA 1KP9A 1M2FA 2WYHA 1G3MA 4GFDA 4IDEA 1L5SA 2E37A 5M34A 1XCPA 1AMOA 4BXOA 2A9QA 2PZBA 3FTFA 4LJKA 1WJGA 3KYDA 1SB9A 2JC3A 4QUEA 1DRJA 4TLMB 1JAZA 4D5GA 3RKSA 1JFRA 1ZVKA 3IC5A 1QBKC 2E9SA 2FFJA 2WAMA 3MW8A 4UBJA 1UWVA 2OV6A 2V7TA 3AJ9A 5JVDF 1CVLA 1NQ5A 1W88B 3ELYA 2IIBA 1UXGA 2GD1O 4N6OA 5DOZA 5FOSA 1GPLA 2QP4A 4ENPA 3QEOA 4CW7A 1WUKS 3ZI0A 2QRLA 2OV1A 4IICA 4F2PA 5C35A 4E03A 5JNRA 2GZ3A 4MDYA 2R84A 4GSYA 1WCXA 2H0AA 3CF6R 5JV5A 3OETA 4XPIA 5K0LA 4QDJA 2PCLA 2CVQA 4JQYA 4P3OA 4E5NA 1LDGA 2VTVA 2GERA 5FQNA 2C8JA 1EI9A 4GYKA 1ZC4A 1ZOLA 4PR3A 5FFFA 3VYVA 3P19A 4E1BA 2Q3HA 1BWPA 2QM0A 4GMGA 4WN3A 1GQSA 4JCOA 4P98A 4UVHA 1XDSA 4OM7A 3QX3A 5B1DA 4UU0A 1HXHA 3GMDA 2AJDA 4R1NA 5JJBA 1E3LA 4GP6A 4OBWA 5EUMA 3KKPA 4YQFA 5G0VA 4D8VA 4CMCA 4FC7A 5D6NA 1YR2A 3K32A 3ND9A 1A4IA 3MPOA 1SZDA 2RK4A 3UPDA 1C30A 2RHHA 3ZGXA 4BHTA 5DLYA 4C4XA 3THXB 2BFBB 1UKZA 2IEGA 3LY9A 3MG9A 3TL2A 2OECA 5KHLB 5ALQA 4C3VA 5FNVF 3UBMA 5JOQA 1RC0A 3KL2A 3VU3A 2WAAA 1AZLA 2FSSA 3CGWA 1OFIA 3NBFA 3CLRC 5JXHA 1IN1A 3WGZA 2WINI 5EL0A 3KQVA 2WMOB 3MBIA 2C77A 3CRW1 4JYCA 4LVCA 4ENUA 2FX5A 3ENNA 4K9KA 4KODA 3VZSA 4JDUA 4AJIA 4BPRA 3W5CA 3AKCA 4B4OA 3BBPA 3P9QA 4JROA 2WMNB 1NBME 2OO3A 3QUBA 2ZWAA 1Q11A 1A9QA 4J2HA 4KV7A 3WGVA 3C41J 1JTFA 4DQ0A 5K0ZA 1KI6B 3HXLA 3U7JA 3EZXA 5I45A 2P1ZA 4J03A 5K2MA 1QHYA 2VYVA 1AV6A 3HB0A 1MDFA 4Q4AB 4FFMA 3AOEC 4U7HA 5IWCA 3VMMA 3PHJA 4JI3B 4NNOA 4ZO8A 3ZR4B 3UH1A 5BWCA 1ESEA 1Z0AA 5BVGA 5A3QA 3PBKA 3G85A 4PINA 2JFGA 4MVJE 1BCRA 1BU8A 2EDAA 4MJLA 1IMOA 4MPTA 4PX5A 5AW5A 4BQSA 1PJQA 5FAKA 4BE4A 2QNBA 2GLXA 1CY8A 1I1OA 3DG9A 2E87A 4YA6A 3TKLA 3H2ZA 3IT3A 3QEMA 3KUCA 3RSQA 4Q9DA 3D5TA 4Z3KA 2NUAA 3ODGA 1HZZC 2SNIE 3LECA 4HRYA 5CNJA 4DANA 5KEIA 1XMPA 4QUDA 4KQFA 1E4OA 4BMCA 2E2WA 3KKQA 4J0JA 4PZLA 5A2GA 4MMZB 1R4MA 2B2CA 1MTOA 2W4IA 3HEAA 4HH1A 2AZTA 1TAQA 1NFQA 4HWRA 4WKGA 5EJMA 4EKIA 4QUKA 5DOVA 4YRIA 2IOFK 5EIOA 4OHYA 2C5HA 4EG5A 4XFKA 3RREA 5E3JA 3UA4A 3M1LA 1H6DA 2QX9A 1B0UA 2ZWOA 3UWDA 1AX9A 2BTQA 1HNWB 2IEYA 1TF5A 2PL3A 3H2KA 3A70A 5CITA 1L4LA 3O7MA 3VV2A 1V8FA 1X13A 2QEQA 3V8PA 4HAYA 2X3YA 1XXHA 1XSEA 3ANSA 2XA1A 3C3AA 1UIMA 3L6OO 4F7WA 3VPDA 2ZXEA 1CF9A 2PGDA 3QI7A 4D81A 3SDZA 1CR6A 3IAHA 3LPAA 1E6KA 4YJ2A 3KQKA 3ZG6A 4M37A 2RBGA 1YZHA 1Y6JA 4OI4A 1KMQA 1VDMA 1TEZA 3KSMA 1N2EA 1ADFA 3OQ1A 1XA0A 4JHLA 3ZWCA 2X5NA 1QV6A 4B87A 5EHXA 4C14A 2SKEA 1KERA 3FYTA 3NC1C 3TL3A 4PZAA 4BLUA 3GVIA 2IA5A 3KV3O 5SZKB 3NW9A 3RFXA 2P0YA 4RLFA 5K0CA 2X4IA 2Z2KA 4CMIB 4S1OA 4LMAA 1QQBA 3TPCA 3QEMB 1G3UA 4FYHA 4X7BA 4D74A 4ZOLA 5DLEA 2JRLA 3WGHA 5EJ7A 4ZP1A 2ZYRA 1P0MA 4MPPA 5FWYA 3JZDA 2NLOA 3MMZA 2VF8A 4Q7KA 5CCDA 4CVNA 4HQ0A 4DNOA 1ZD3A 1RXUA 3IE0A 2JNWA 421PA 5AJWA 1FFAA 5ARBA 5JFOA 3ZCTA 3ZDCA 2MYPA 4B6JA 1YA6A 1IDOA 3R4CA 5TMDA 5I8WA 4CF6A 2D8MA 3EH1A 4EDFA 1FJXA 3B13B 3O0TA 3I09A 3B48A 1HG0A 1ZUHA 4KKXB 1FMCA 2MSDB 4E32A 2GILA 3IESA 1XMVA 1WG8A 4WW0A 3SQMA 4DDWA 2B25A 2O7SA 3VZCA 1N9KA 2NM0A 1ZN2A 4XTRA 3FNBA 3WWPA 4GLOA 4YYEA 3ZCVA 1PZGA 4JEHA 4LHSA 5AM0A 1IZZA 2AA3A 2HMVA 3IQDB 4HCJA 1D1PA 1V5IA 2FW1A 1DQNA 1X1QA 2A86A 1F5NA 2ZSIA 2EF0A 2PTHA 3M3PA 5B1SA 3E3OA 3K6SA 2GHRA 2WWRA 1K5GA 3AF5A 1THTA 4P8RA 2OFFA 1OFGA 4LWZA 5C37A 2CE2X 3BGDA 3DDNA 5E6RA 3ZIAD 3QP9A 2C31A 4EI2A 3FCAA 3UAXA 2RB4A 4DMUB 3G2IA 1L7DA 2V7VA 3ILHA 1RRMA 4TQ9A 3C6BA 1EGAA 4L4UA 4KMSA 4Q7MB 1E69A 1E9EA 3RVSA 1NBOA 2FR1A 3FCUB 4MB2A 5CW2A 2ZFUA 4Q1EA 3WOVA 1JHOA 1GOTA 5A7GA 3RVMA 1G63A 3NDBB 4TYNA 1IBLB 4IUBS 5DX1A 4G5OA 1JLRA 4JIMA 4DM3A 3HRIA 5FPHA 2V7GA 5DZSA 4ZV7A 3NIGB 1JBEA 1UPCA 1B8OA 1NVXQ 2JIRA 2W6JD 3Q0TA 4PZYA 3UT5B 3LOQA 4EUNA 3ICQB 3C7TA 5J2UB 2PRJA 1WSDA 4LOKA 1UKAA 2I29A 1MAWA 4M49A 1BS9A 1ZL2A 4P58A 4M4SA 2OOSA 2QS9A 2EZ9A 4OXNA 3HO6A 5GP1A 2ZT6A 3K4QA 3TM5A 1KMHB 1UC8A 1WZNA 2FF5A 3DGFC 2Q3LA 4CHGA 3DTYA 4K28A 1FYWA 5FP0A 2P7HA 1PRYA 1G21E 3C74A 3PXCX 1N6IA 5FI5A 2WP0A 3H2JA 1KETA 1DFIA 3EZ7A 4Z7NB 4OQQA 2I5PO 3WICA 2D1RA 3E22B 1VL5A 2GJAA 3N8IA 1P74A 2MINA 2PYIA 4R2KA 4B3FX 5ENDA 1U0GA 4BP8A 2JFPA 3JR3A 1XJ0A 3LO8A 2YHSA 3NCTA 4JZYA 5HIJA 1SHUX 4X84A 1T13A 1ZUD1 2B3TA 2K2QB 3C85A 4BUJA 2JVKA 5KWVA 1RWQA 1SCKA 2V6JA 3NLLA 4C7XA 2A4KA 3OTIA 5I7EA 4U2KA 2ISSD 5FR2A 1M1UA 2BV3A 4I9HA 1I4TD 3BWDD 3TLKA 3U3XA 1PUXA 3EWSA 3EQZA 3WMFA 2B9VA 4AQDA 3OHMA 3TD9A 2BE7A 4DR3B 1JLLB 2H1VA 3R0JA 5HILA 1KIAA 4RTRA 5DIFA 3ED5A 2QAJA 2WG1A 2DJ5A 3ROGA 3GUUA 3TAUA 3W06A 4MYHA 3HZRA 3RC8A 3R3SA 2OENG 3BPSA 4UVIA 1ZM4A 1QP8A 2YS7A 3IELA 4QO8A 5DU2A 4OXIA 5K6AC 5EXTA 4BNNA 2J32A 2GM9A 2N3ZA 3E2MA 2X23A 3AW9A 4LCEA 5PGMA 5D01A 2YTZA 2PT5A 2I4IA 4J0HA 1QQ6A 3BSYA 2IXAA 4DSTA 1S2DA 1RAIA 1U5CA 4IHAA 3PI6A 1W73A 2DTXA 2PAFA 3FJOA 1SCDA 1XC7A 4NENA 3ZE8A 4D57A 3CJQA 3D3JA 4UMVA 1EBUA 2QNRA 5B2EA 4K9PA 1CPYA 4J0IA 2WY2D 3EF1A 3H5WA 4I2NA 1S8NA 2QDXA 3EUAA 3HL0A 5TF0A 1YFJA 5TJ9A 3FB1A 1JSRA 2P78A 3WK9A 4I1YA 4AF8A 3F3KA 1FK8A 4NH4A 3NRJA 2ZE6A 1C9EA 4FBMA 4BFYA 5KKCA 1WNFA 3S8YA 2WILA 1CVIA 1ZU5A 3GRPA 3KQOA 4LNAA 4QYXA 5D86A 1V71A 4R01A 2EKLA 1H8HD 2H5JA 5JBQA 1HNZB 1P4HA 4IRXA 2JD0A 1I3NA 4GQBA 1USUA 5K4HA 3W8DA 3ZY2A 3HZHA 4KWIA 1TU0A 4GVLA 2G70A 2X40A 1AXGA 3BZBA 2VSNA 4QOFA 3D8BA 3VOBA 2ZRDA 2ZI5A 1HH4A 3H6GA 2LD4A 5JALA 3VYTB 3PPVA 4AKGA 2RGAA 1Q0PA 1ZNZA 3VR6D 4IDFA 1QZXA 3U9TA 4PW0A 4X62B 3UMRA 3ZU3A 5HOQA 3LZ6A 4NS4A 2ZRHA 4OAOA 5P8WA 3GLIE 2OHHA 2QD5A 1UKYA 3L40A 4CV0A 5JEDA 1UKEA 5JI3E 1ZK1A 5BRAA 1NYTA 2B98A 3T7TA 3HA5A 2O5VA 2X6TA 3DW1X 4XOUA 4PLFA 3I8OA 1JEYB 1X7YA 4B0PA 5B53A 4DV7B 2NSJA 1W19A 4OQ4A 4PF1A 1ZK0A 1GG2A 3JPYA 2UZ3A 4XQEA 3L8FA 5F1KA 4MYTA 2C3OA 5K8IA 2HJWA 3A8TA 4ENVA 3D6VA 3AR8A 2Z2YA 1XV5A 1NNI1 3JZIA 1PR3A 4JB2A 1X1AA 3Q7PA 4MVXA 4EG0A 3QPCA 3PFKA 4JVNA 4WNYA 1YOVA 4Y2VA 5GJCA 2HU8A 5LMUB 3TL6A 4QDTA 4D43A 1XTTA 3H8WA 4GUAA 2D62A 2VJPA 1KI6A 1REQA 3RIEA 1CY2A 4Z9YA 4R71A 4FHGA 1NT4A 2XZPA 4HK4A 2I4TA 5EIWA 3IJEB 3FLBA 2W9XA 4U7WA 5KCMA 1K7YA 4URHA 2XTJA 1SKQA 1JJ7A 3FPBA 3SF0A 4RSMA 4ND7A 3OECA 2WW8A 4MLPA 3MF4A 3SZ3A 1M6YA 3BA6A 2CB9A 3TCKA 1TC1A 3EODA 1NQOA 3GZJA 1X7WB 4LY3A 4PX3A 1BHQ1 3TE7A 9ABPA 1RRKA 2GZHA 3A6KA 3DHEA 3K9FC 1D2CA 2WSMA 2TRSB 1WHSA 3MK31 3CIOA 2R5WA 2GSDA 1IHYA 3KOUA 1V4NA 1CUXA 4LK3A 3NBMA 4JVSB 3TTYA 4YRAA 4N3AA 3GOHA 6ADHA 4NEHB 3WBKA 1I7NA 1SQ6A 4CL3A 5C81A 2X0JA 3REFA 2WM8A 3ZUGA 1XNQB 1BGXT 2UDPA 3TSCA 3L79A 3DEKA 1MBZA 4W9NC 2PJRA 1B73A 2R7LA 1JI0A 3G5TA 4UUMA 3CNBA 2FXVA 1K92A 3KT0A 3ITDA 3C1TA 3SBXA 2G0AA 3N2KA 1U98A 1Z4MA 5JQGA 2HWYA 1Y6GA 4ZYTA 3WLNA 4XUDA 5KYWB 2Y9MB 3VC2A 3IXMA 3PRKE 2APJA 2DWOA 2GAOA 3WWEA 3ROFA 5L3SB 4W99A 2YH2A 4FFVA 4MWGA 2QL6A 4DVGA 3S81A 4N40A 1Z68A 1QG6A 4BNXA 5HIAA 4M1WA 2C84A 2CFCA 2FPIA 1VPVA 1LLFA 1Z0JA 1N3LA 1M2VA 1NL3A 1UFVA 1XP8A 3BWEA 4YRTA 3WADA 2B69A 3FBWA 2QJWA 1IB0A 5LVAA 2IHVA 3OQBA 4XLTA 3K9GA 1M5RA 4HEHA 3CUEF 4PXSA 4W7IA 1YJCA 2WTAA 1QKKA 1T5BA 2ID7A 2J46A 2FU5C 1KS9A 1Y4ZA 2PEYA 3P2JA 4WXHA 4BO3A 4CMGA 1GPBA 1PFYA 2VSXA 3ZTTA 1BDIA 1C7FA 2NU7B 3MTEA 4RBNA 3D3NA 2VA8A 3HKBA 3K1AB 4R3NA 5K6RA 1XXHE 3BMXA 3LYUA 2QJFA 4IZ6A 2WEKA 2VYNA 2WPNA 1S2GA 3EE6A 5CCEA 2PUAA 4DRXB 3KKKA 4W1QA 3BIXA 4CEHA 1PNRA 4YRDA 2QLLA 2C9OA 2HF8A 3EDYA 1CJUC 1LPAB 3LQ4A 1QWOA 4IDDA 4L51A 5K4GA 4I5DA 1PWHA 4QTUB 2RGGA 3P52A 3S28A 3WGJA 5BSWA 4KR2A 2B34A 4CFZA 4IJ6A 3EIQA 2ALJA 1CE8A 3CJTA 2IF0A 4HH4A 1M8JA 5CB6A 4AX4A 2OK8A 4ZMSA 4ZYUA 2FEPA 4QVKA 2Q7OE 1O58A 2WWHA 1QV7A 1YVUA 5A5GA 4F2HA 3NJ8A 5NULA 2O8BA 4I4NA 2WJHA 4N5NA 1BH2A 4HGRA 5CDYA 3FFXA 2NU6B 3Q3EA 2AFHB 3GJ5A 1FRQA 4KSBA 4P82A 1MOSA 1UPTA 3RVBA 3LCUA 1LCIA 1OAOC 1OWNA 1Y3DE 1XB2A 1NHGA 3ZDQA 2GBFA 5BSHA 2RHJA 2XGGA 4LXTA 4DCTA 1WW8A 2OV2A 3ROXA 3CLUC 4ZYYA 4YT2A 2OBXA 3CSUA 5CX4A 4EO9A 1ZD2P 4E11A 1RYBA 3QLVA 2ABWA 1YONA 1OH5A 1VPTA 2B21A 1GGNA 2ID8A 5JZ9A 4MZDA 3PQ7A 5AIAA 4Y7DA 4KR6A 1K2VN 2LGJA 2VXBA 4O4LF 4XGRA 3DZIA 1F3LA 5DT2A 2ACKA 3KTFA 3U0VA 1DUVG 3K0AA 3T8YA 3J7AC 3M2TA 3THOA 2H85A 3ZK9A 4X7PA 2QLMA 4P22A 5ETJA 3ZK8A 1FFWA 2I7VA 1OYYA 1BCRB 1JKMA 2XB6A 3B1YA 4ZAXA 3OWXA 3UB3A 1M6NA 3MWJA 5LLTA 1IFXA 3GA0A 1M0TA 1WQ1R 1K6IA 4MA4A 1OB5A 2JAOA 3D8UA 2X0DA 2ZWPA 2V9ZA 4RPHA 5BSGA 2G04A 5ICGA 5LMNB 1QUFA 1DUSA 5JZOA 1WLYA 3ND5A 2CVPA 2KLHA 3U6KA 2JJQA 2MHCA 4YPFA 1A9XB 1TMGE 2Q4TA 3EPJA 2Z57A 3GEHA 4F3RA 4Q3OA 2BFOA 1O95C 1M8PA 3GRFA 4RHEA 4R1SA 2O8DA 5FOQA 4W8OA 2I55A 4HRAA 1UMBB 2EZTA 1SVOA 2XB4A 3ITKA 3HUFA 4HAZA 2J4DA 2Q8PA 3NDPA 1L7MA 4UU1A 4JUDX 1YBHA 3FPLA 1P1BA 2XYRA 2H07A 2E18A 1WB4A 1JEOA 4MWCA 2NZJA 1J21A 4RZUA 4TUYB 3TLGB 3F97A 5ED4A 4WK2B 2PX6A 1KEUA 1AU9A 1WXDA 3C1OA 3ZU5A 1B8NA 3CVYA 4G0UA 3KXLA 5J4YA 3S5UA 1ZOSA 2HCBA 1M0EA 1JG7A 2JBHA 2IW3A 5TY0A 2IW1A 4FHEA 1LWOA 2BOVA 2IYSA 3NBQA 2R8OA 4WCFC 2I6GA 1VHDA 1J1ZA 3PIRA 5JI2E 3WKAA 3EVNA 3K0AB 4B4DA 4AN1A 2P9YA 5H80A 1GZ4A 3G88A 2AI1A 1PT7A 3BRQA 1GZ7A 2IZ0A 3NYWA 4XDHA 4L8WB 5CDSA 4U7DA 5BXYA 1IMJA 3ZHRA 3TWOA 4EY3A 1IIBA 1LPBB 3V4VB 4ZI7B 2QMHA 4JEIA 2NXJA 2ZIWB 2ANCA 3O2QB 2PKCA 3UUEA 3JQAA 5AW0A 5K1ZA 1X7ZB 3I6ZA 2B35A 3RSFA 4U7TB 4RYDA 4CLEA 3C1AA 2I33A 5E2IA 1E1QA 2XQGA 3RS4A 4CLRA 3AHHA 3IHLA 4P54A 3R5JA 2NUTB 2VP9A 3NWBA 4DSOA 4TKVB 1W5BA 2BHRA 1PNQA 1RRFA 3E8MA 5M5BA 2Y6VA 3OPQA 1OI2A 4DA0A 1MCZA 4RKEA 3ROQA 3KJZA 3QKSA 4IMJB 2ZITA 3GARA 2C99A 2L42A 1BHO1 2ZE5A 3Q40A 1FMFA 3UHPA 2BDTA 1QO0D 4XGNA 5AW7A 4EO4A 3IB6A 4MS1A 3KFVA 1SQ0A 2CDCA 3HO8A 3KTAA 5FFMA 1EP3B 2QZ4A 4MW5A 1Z16A 5F1PA 1I2DA 4OMFG 3BFJA 4ZA2A 5CA0F 5DNDA 1R7RA 2BFCB 4FDVA 1RI1A 2P9JA 3P2EA 1X14A 1LU9A 2X8JA 4OQYA 4FW9A 1PT5A 1VXRA 1O4VA 1H0HA 3WJ2A 5HRCA 4L7QA 2I0FA 2JFBA 3HY6A 1TU4A 4EMSA 5KQGA 1TM7E 2P11A 4BJ3A 2QROA 1OLOA 3STXA 3I04A 4EG3A 5B2ZA 4I5IA 2AOTA 2X0KA 3T95A 4I19A 4QG3A 3B5IA 3ZD9A 2IP2A 3D6TB 4EJSA 1X1RA 1KYTA 4EY5A 4KNVA 1CUAA 3L0DA 3R0VA 1FQOA 1ZAYA 1KORA 3PQ6A 4HAUA 4S2EA 1M34E 3PGA1 3V4SA 3FOZA 2CGEA 2XMRA 4R0MA 1SBNE 2GVDC 1PV1A 4AECA 3VGJA 1SQ5A 3QE4A 1RXEA 2ZETA 3BGVA 3UB2A 3SC6A 3HUDA 1G7CA 3QITA 3RDPA 1XVUA 3CKMA 4G8DA 5A3VA 3G13A 1A76A 1FU8A 2Q3EA 2WDZA 2E21A 3L8CA 7MDHA 2ERXA 4MAFA 2INGX 3AB7A 3N8NA 4JLBA 4L3VA 4QPZA 4ZALA 3E4CA 2VFAA 3AF0A 3M6XA 1QGOA 2D1FA 3NBAA 4V24A 4DKXA 4Q1AA 2GEVA 3O47A 2XD4A 1CP3A 4KB5A 3K16A 4UC0A 4Y6GB 1H85A 5AFSA 5LLSA 4DILA 3X1KA 2XOKA 1RLUA 3D6FA 1J8VA 1UUFA 4JHXA 4LYJA 4Z4CA 2FLWA 3JCZA 3EOBI 5JC1A 2R751 3TZHA 4NARA 1IUPA 5K0BA 4BZZA 2PN1A 4GF5A 1G5QA 4DY4A 1W49A 2II6A 2IYRA 4Z7OB 5DCLA 1TUBA 4PN7A 1FFHA 4C21A 2Y77A 2ST1A 2CXQA 4DLKA 4RV9A 2DPLA 2I4RA 1SBHA 2XCTB 2XWPA 2P2LA 4JD5A 4RVCA 3K31A 2ECQA 3NTQA 2XMZA 3QZUA 5HKAA 5KJ6A 2GEUA 1SUPA 2GN8A 3CC8A 4RHTA 1YOVB 5ALMA 3S2UA 3L18A 4M7PA 5JASA 1KVTA 4B84A 3R3HA 3MB5A 4FDMA 3SZMA 1SH7A 1ZP6A 3OIUA 3BA1A 3EY9A 2PL9A 4N3NA 4L9SA 4UE6A 4P08A 4BO6A 2PO7A 5CBPB 3KSZO 4YCJA 3H05A 3VX3A 1U0EA 4GI3A 3HCOA 3SX4A 4I6JA 4X8LA 4ZGGA 1NUSA 3QFFA 4L6IA 1PZHA 2Y1CA 3D0OA 1QDUA 1QUEA 4KWTA 4U2FA 4NEGA 3GYBA 1MW8X 2YJ4A 3RI3A 3B7PA 4DIMA 4UQLA 1UDAA 4NMXB 1X70A 1V7QA 3B1WA 3CRVA 3WKEA 3L7OA 4Q48A 5DI3B 2OBLA 5F7ZA 2CUKA 1KBOA 3SSOA 4E5MA 3HXQA 4P93A 5GONB 3FCSB 4H1HA 5AVWA 1GIAA 2GKSA 3OZTA 3IEUA 4OYYA 1JMKC 3D7KA 3U81A 5G2OA 2O14A 1HKHA 3OCXA 3MERA 3EVDA 3HUEA 3TJZA 5K3SA 4N49A 3VC7A 4H1VA 3U49A 3ZOZA 1EP9A 1D1QA 1VC2A 5AK3A 3FE2A 1W7AA 2WU3A 2VSFA 1DARA 4WN9A 1ZN9A 3LYAA 3LDFA 4UTXA 3LRPA 5LA6F 3T5TA 4CCAA 1YZKA 3OU6A 1VG1A 4LY0A 2J6BA 1E3IA 2B99A 3GRYA 2A9KA 3JYPA 4L57A 4F3NA 2FN4A 4GPD1 1MX3A 2ZB4A 4IRMA 1RXIA 1T10A 1F4VA 4LSWA 5GV8A 2J9RA 4AJ2A 4AU1A 2D5CA 1WAMA 1BD3A 1S3IA 3GG9A 2BY4A 3BE6A 4ABTA 2PE5A 1DIGA 1ZONA 2DBZA 1MLDA 3MTQA 3OM8A 2JLQA 1T5TA 1AGNA 2QD4A 2B1QA 4RK5A 1LPOA 3QVMA 5GJVC 1E2JA 2XMGA 3DMPA 3AUYA 3KTOA 5A4AA 4FLMA 5C4GB 2ORWA 1U8YA 3BB3A 4Z51A 1U8TA 1QGAA 1CJMA 4H0CA 3W2EA 4WZBA 5CH5A 4J75A 4BNTA 5A02A 3FYHA 3T15A 3GLFA 1YI0A 2REQA 1GV1A 1KTVA 3DMDA 4L9RA 2CEAA 3T9FA 1XZGA 4LV8B 3WGGA 5TIIA 2DM6A 1PVDA 5T57A 3EIUA 4R0NA 4DJTA 1UH5A 4RU1A 4H4CA 2WD7B 3LT0A 1P3Y1 4W5HA 1PLLA 4LPKA 2Q0HA 1KY2A 2QL5A 3DJYA 3ZHZA 1I7DA 3AFIA 3ADOA 3WGMA 3I9OA 3CEPB 1NDQA 3COZA 2C7QA 1N2CA 1QK3A 2CUZA 1UK6A 3Q6NA 5FD8A 2ONJA 5AVSA 1XZCA 4JGIA 1U2ZA 3EEFA 1XQXA 4E4RA 2GN6A 3DHNA 1P72A 4XJXA 4J76A 2Q28A 2CNOA 1WCV1 3UOAB 1JU4A 3AESB 1W4BA 1UADA 1ZCZA 2A3RA 1I7LA 2B6NA 2HDOA 2ZDGA 3N87A 4RXUA 3VRHA 1FF9A 1LSOA 4D9HA 2Q0XA 2YJ5A 4HVAA 5H3HA 3QX7A 1GVNB 2P68A 1JAIA 3O8DA 4U8HA 3G02A 4XB1A 1NE7A 1LY1A 5AI4A 5DH9A 3UHAA 3ZJ5A 4F84A 4EEZA 3HKCA 5IAGA 2C9YA 2E89A 5GINE 1T5IA 2R1VA 4CF4A 1XHEA 1Z2OX 3NX4A 2VHTA 1WBBA 1EWRA 2A9FA 3GLVA 3UGJA 2JPDA 2PKXA 5MGNA 2QTZA 4C7OB 2HNAA 5IVIA 1C7JA 2ENUA 4R54A 4LJ5A 2FFAA 1L5HB 3LVFO 4TRMA 4A0FA 3H9UA 4X6LA 4YJFB 2ZI4A 5AR1A 1ZBDA 2C9DA 1JQ3A 3CN7A 4RH1A 4L15A 1QH8A 3I1JA 5I8ZA 3UWPA 1MR3F 2BHLA 3DHVA 3F7MA 1DEXA 4E5YA 3NFYA 2OY0A 1FOEB 4Q18A 3RABA 2HB6A 3T6KA 1A1VA 1BDBA 3ZWVA 3ZHBA 1G59A 4ND6A 5JT1A 1A9RA 1HLFA 3AEYA 1QYCA 4IXDA 5D5PA 1T8UA 1UEJA 3JQBA 3O1IC 3WWDA 1VM6A 2W2LA 1PDWA 3L6UA 2H17A 4LJYA 4RKQA 1Y1LA 3W7BA 4GI2A 5AXBA 3BULA 1C7ZA 1WEHA 3X2EA 3T5PA 1U2RA 4S05A 1IN7A 5CU7A 4M21A 4LI0A 2PVCA 1OZGA 1PKXA 2FSVA 3AMVA 2HCRA 3M6AA 2OHJA 3AJRA 4HDMA 2PKQP 5ICMA 3I62A 1UMBA 1ZRHA 4JSTA 4OTZA 3N2KB 3BE4A 5JQGB 1UBEA 4RE5A 1G8JA 4XWTA 3SOPA 4GBED 1T26A 1SXJE 3EW7A 3KE9A 4BB0A 3U3JA 5CDTA 1JPNA 2YIDA 3L8DA 5HP4A 5EIFA 2GH1A 2B5VA 2YNMA 4H7IA 4ZVOA 5EWLA 5CHEA 1NY5A 5DHRA 1VECA 1QRDA 2P6NA 5FJJA 3RGWS 2O52A 1WRBA 2Q5EA 3RAGA 3PPWA 4JFRA 2XDAA 5LD2C 3THYA 2IQ5A 2AH5A 1SBQA 1X7DA 3AVTA 3DYIA 1B1CA 1GZ5A 4F72A 4BO7A 1QK5A 2ETXA 3AUSA 5AK4A 5J4VA 1XZKA 3QV1A 3A9WA 2WB2A 2QORA 2WTUA 2AOVA 1MT0A 3KWLA 4WLOA 5IJ0A 1N3YA 4Y3UA 1V11A 2POQX 3F6CA 5JJKA 1MB2A 2EWVA 1ONOA 3PNOA 4P7BA 3USCS 2XTMA 1PLJA 1ESCA 2YYZA 2QRJA 5F4ZA 3RU9A 3EQ6A 3U6BA 1XDWA 1GDDA 2XTZA 3Q8KA 4HNAA 1NV8A 4QBTA 3EIEA 1WXQA 3FJYA 4EQZA 1R0ZA 5KYYB 1RCUA 2BL4A 4URZR 2H8GA 1P62B 1I10A 5E7JA 2G36A 1IVNA 1S2OA 3ZHOA 1BH6A 3O8OB 1G41A 1NJ2A 1Q7BA 2R5FA 2WT8A 1TJ4A 3NAGA 3QJ5A 3SCZA 5I4KA 1JR3A 2QLFA 4GW3A 3W9YA 3E84A 4AZ3B 2JG3A 4DR2B 4R40A 1A7JA 1B6SA 1BN6A 1J00A 4B2LA 1T6BY 2DOKA 3CVUA 2H2DA 4PG6A 3VR4H 3PEWA 1DQSA 1DFGA 3BJMA 4QNRA 4AJNA 4EX6A 3ADDA 2YVAA 2B78A 5E9JA 3W3ZB 4LFCB 4H6XA 1QCCA 1QTNA 1C1HA 4G0YA 4YDRA 4ZXFA 3MZ0A 1U9JA 2O0HA 4ESEA 2AZDA 3VBCA 3GK3A 3CF2A 2PWAA 4O5AA 2BFCA 1TJYA 5EIBC 3U4DA 1J49A 3BB1A 3IUJA 2FPWA 3GUCA 4PWYA 4YP1A 1T2AA 1MMFB 5PNTA 1WUJS 3EGVA 3EWAA 2IH4A 2ZRFA 5IJ0B 3WL8A 4H60A 1ZVQA 1TM1E 4S35A 2BKAA 5FJIA 5CCXA 3N74A 3VPXA 4BNDA 1W52X 4EUSA 3OJ0A 3HH8A 2VNJA 3P0FA 4W63A 4I0WB 3UWSA 4KFSA 1DBPA 1JHYA 1CUWA 1E2PA 1P4GA 3ZGYA 2VQ6A 3ASZA 1P1FA 1KE2A 2Z4TA 1SXIA 3M6LA 4HNAB 3LPLA 3OMXA 1JV2B 2CXTA 2JCVA 4PZUA 1UCFA 4PPFA 1DC4A 3GFSA 4EYOA 1QM5A 2W4QA 1ID8A 3WLMA 4NU0A 4Q6BA 5DBIA 1P29A 4BV2A 2XGMA 3IAUA 2CLMB 1G16A 1ABFA 1XJQA 1GDTA 4OHPA 1AY0A 4H3KB 5EINA 4BMYA 1QP4A 3OPVA 1ZHOA 4C0KA 5IRCD 4DLUA 4B6SA 4L5JA 3RPEA 5KBYA 1QJCA 2YQZA 1HFWA 3MS7A 1H2ZA 3ZCQA 2OLKA 4JSYA 3DMTA 3P0IA 4QLAA 4DT1A 2I1VB 3L4BA 4GQIA 1JKXA 2QG9A 1CZRA 4HQRA 4MQ6A 1H1LA 4C30A 1Z6YA 2ZJZA 4HAXA 2EKZA 4J0GA 2NP6A 1GNPA 1TQHA 3BWVA 2XW6A 3NKLA 3LG2A 1QHFA 1JBKA 2VT6A 1JTEA 4FDLA 3AEKA 4O5OA 4R1QA 3K8OE 3O83A 2B30A 4KBYA 1G20B 1UXHA 4RQTA 3JZAA 3AKEA 1Q3TA 4HB0A 4XSHA 5LWQA 3NVKI 1N6HA 1OI4A 3TMYA 4EKNB 4MUNA 1U04A 1YQWA 4YCCA 2GZAA 2KPOA 4QXAA 4YQEA 1LLCA 2CMHA 2Y4NA 4M86A 2R8XA 4W8HA 5KMGB 4PS0A 4YAOA 2CNWD 2ZWMA 4P83A 3EZLA 2WKWA 4PFKA 2HW8A 3OX4A 3KR0A 2DU8A 3C7AA 5DNCA 5KNBH 2FW7A 2H08A 1NDUA 4KP7A 4D8XA 1FX0A 5KCZA 3LFTA 4F5ZA 1JEAA 3LHKA 2R6GA 2QRNA 1UZAA 3BTVA 4AJ9A 5K45A 4A36A 1UC5B 2C2XA 4OP3A 2OP0A 4QJBA 5EPOA 1PVOA 2GBIA 1SKBA 4GWLA 1PL0A 2AW3A 5FUWA 2HJ9A 2IIQA 1CF4A 4GOMD 5LCXA 4LZZA 1H93A 1ID1A 4GECA 2HA5A 3PX7A 3LDHA 3L6RA 1M1XB 4DN6A 4WCFA 1KYWA 1LJ8A 4IVPA 2YICA 3HJTA 4CUKA 1Z4JA 4RKFA 1W1UA 3JVEA 3K2EA 4RGBA 5EAIA 4D0NA 4BLSA 3EMBA 1F51E 4MRVA 4KTTE 1N5IA 4OU4A 4R7GA 3SYLA 4DLWA 1N25A 4WZAE 4EMUA 1DWPA 2PBLA 4MHOA 1SOMA 5ECDA 1A96A 3R20A 4Q1VA 2X0IA 4XWOA 1R00A 4BLRA 4TV9F 3OUZA 2E49A 5FAXA 3DEFA 5IYZA 5JDCA 4QSHA 5KQSA 1XNHA 1YDEA 4FFSA 1BO6A 4EVQA 4RYLA 4ZI3A 3GELA 3DVLA 3JQFA 4R7TA 4KWCA 5LQRA 4NYMQ 2R00C 3DE2X 4XIGS 2G4CA 2XAUA 3AB3A 3DZCA 1XLTA 3QUCA 3PL1A 4IDBA 4FI3F 4BATA 3VV3A 4W9MC 4D5EA 4KN9S 1F2TA 1NP6A 3HDGA 4DUGA 2R97A 3BQ9A 4XJTA 3U9LA 4L5AA 4UHJA 3AQIA 4NBVA 3GUHA 1JQJC 3EISA 1T5SA 4RVDA 5TE9A 4IQ8A 2GCOB 1N3BA 3JY6A 1P5JA 1KZHA 3L8YA 3WX0A 1GAQA 5AD1A 1MIHA 4OK6A 3G1WA 4HFJA 4O4JB 2MOKA 1LK0A 3ZCPA 1N0VC 3HGTA 4FC6A 4OV6B 4P4SB 3S8EA 1U8XX 2GEFA 4P5DA 2CYBA 2K7FA 4DSUA 1NONA 3L6DA 4PHHA 1POWA 1MEOA 2I34A 2QZZA 1BTOA 1K68A 3QYAA 4BO5A 3QM1A 3R7LA 2PD6A 4RVUA 1KJZA 4TXJA 4ZEMA 4YP9A 3UCXA 3KVRA 1TZMA 3I0NA 3L0SA 5FTKA 3DB2A 4HTFA 1NBIA 2HUNA 4CM8A 5JCZA 1EVLA 5CJJA 4CI0B 5E4JA 1R5BA 5CFOA 3NHLA 1A72A 1PEDA 5FA8A 3UT6A 2O54A 1MIOB 1TT5B 4G0OA 5ALVA 2R8EA 2HBRA 4WZBE 1ILEA 1GPWB 3NGLA 3LF2A 3QVSA 3VZPA 4M83A 3BERA 1KDVA 1IHUA 1PJCA 1QKIA 4WSOA 4A8JB 4AS3A 1RZRD 3UB4A 3HABA 4PYLA 4RMGA 4HMOA 1ZMTA 5T5QA 3A6GA 4B47A 3HXMA 4WXRA 3CGGA 4PAWA 3H3XA 1L5GB 3FBGA 1IVYA 3K0FA 1VDZA 3OQVA 1B6GA 2IEIA 3K4HA 3KG2A 1J9EA 3NYIA 4OBBA 3ROMA 2WSSD 2A0YA 3B9RA 4M2LA 4XRRA 2NADA 5BV8A 3HMKA 4M0LA 1XAJA 4QT0A 1EWQA 1IZ8A 4IQFA 4IQGA 4L74A 5HW0A 1KFCB 1YZYA 4IIFA 1IRIA 1XTVA 4F3KA 3MSXA 7AT1A 4AO6A 2WHXA 3VPGA 2QU8A 2YV5A 1SCNE 5D7BA 4BQOA 2ACVA 1RKUA 1MHPA 3G6WA 4IWNA 4KUHA 4XB2A 5JPDA 1OZ0A 4D4HA 2IYAA 3SQLA 2YNMC 3ASYA 3ONFA 4XVCA 2CBXA 2HD4A 3A0UA 4F21A 2V7BA 4GNKA 4YCNA 4BFWA 1EA7A 3ZLTA 2VHCA 3LPMA 3L7DA 5JJCA 3PUKA 2QM3A 1OGYA 3H9GA 1VMEA 4JT8A 4NK4A 2C88A 1KC1A 1UPAA 3BWMA 2ZJ2A 3PNKA 2G9ZA 3PHLA 5G3ZA 4F2GA 5JBNA 5JEEA 1FYVA 2HO4A 4ZVVA 4H77A 4BMXA 2XD9A 5E3HA 3D9QX 1JXMA 4LXGA 1HZZA 1STOA 4CEIA 4C76A 4IMRA 1D9XA 5BQ5A 4AJ1A 4MNTA 3VAAA 1SO8A 2E4WA 3ONVA 3UXHA 2HMSA 3DOOA 5MGBA 1ZD8A 4FLEA 4JP5A 2B8NA 2YW9A 3VSBA 2JIQA 1DEKA 1DELA 1W2GA 3IPXA 4LVOA 3N39C 2EHJA 3I42A 2CNKA 3JPWA 3RU2A 1NTOA 1RPNA 3GWGA 4J1TA 4KEAA 3AHDA 1HY3A 2O23A 4UZFA 5AVOA 4B09A 2FPLA 1AT1A 1U8UA 3GJXC 2QRVA 4FPXA 3WOHA 3D3QA 2NTVA 3KUDA 3TI9A 3HV0A 1Q1NA 5HQJA 2YFYA 2H5LA 4V0OA 4GP7A 3F90A 4BECA 1WB5A 1BDJA 2ATEA 1DRWA 1ECLA 4Q4CA 2BZ1A 1FFXB 3RGGA 2NVBA 1Q21A 2XMPA 4FYPA 4HNGA 3VTKA 2ONCA 3HK2A 5GPBA 2XI4A 3E9MA 3K72B 3M6WA 4NZZA 5EQJB 5DLQC 1SC3A 5T64A 3KPVA 2MWMA 1LI5A 1OLUB 3TZKA 3IRUA 3ADCA 3GJ0A 1V16A 2KB0A 1SG0A 5ESWA 6REQB 2QQEA 1GXSA 2P5YA 1ORDA 2C1EA 1F8YA 4JYZA 5K0SA 3MWDB 1RE1A 4LQCA 4ZZIA 3PNMA 4DV2B 1QQAA 3H5RA 3ETDA 1WPGA 3HVIA 4LEIA 5EJAA 5FUXA 3L6EA 5HFAA 4CL0A 3TK1A 2FCAA 2PR2A 5FXMA 3SS7X 3Q88A 1PG5A 4KBFA 4RVHA 2B20A 4MQEA 1N2CB 1UK7A 2PX3A 3SC2B 3WZLA 2WDPA 1RXSA 4ZCQA 1NP7A 3GJTA 4EPYA 2OL4A 4KIWA 4QODA 1XTQA 2W8BA 3QMVA 4ZJZA 2DTEA 1NASA 3ECAA 2PA0A 3RLIA 4F92B 5I47A 2ARKA 2YXNA 2BZ0A 1Z08A 4LYHA 1WQ4A 2BBSA 2HK9A 1GDHA 3EUEA 1TXGA 2PKEA 2JFXA 3GHYA 4B80A 3PA8A 2HWXA 4FILA 3HKCB 2AMYA 1XQ9A 1RQLA 1EJ2A 4KPUB 4W6QA 3B38A 2YDXA 5HXAA 3ROTA 3TYXA 5L95A 3UJ7A 3F73A 3GFOA 3Q0IA 3H2BA 4JLVA 1AMNA 2ZYAA 1QHHA 2QT0A 1UXOA 3Q3HA 2PUTA 5EA2A 4TMXA 4C2TA 2PA3A 2A30A 4JKOA 3K94A 2IVFA 3LI2A 4IYJA 5EEHA 4BNFA 1J5XA 2QTLA 3OZWA 3TLAA 5IKOA 4BNJA 4PTYA 4CTOA 4BMZA 3E5NA 2OAP1 3ZBUA 4YB8A 3SF8A 4H3SA 4B33A 4N39A 1K5DA 1CY4A 2CC2A 4YBZA 4E5VA 2R8RA 3IT0A 3BORA 3LKVA 1C2TA 2PUHA 3I5XA 3WWYA 3V5NA 3I58A 4LWQA 3VKFA 1J06A 2WU0A 1DJPA 2PYZA 2V6BA 5LNK1 2BWJA 3WYNA 3IKLA 5K0EA 2CXOA 1F2UA 1M2EA 3RYCA 4YYZA 4QULA 2WICA 4MUGA 4TGLA 4UAVA 1VSQA 5HJ2A 5IAKA 1VJRA 2VP6A 4F5WA 1T1SA 2XKJE 3TMKA 3LT1A 5IJZA 2CJWA 2VAVA 1LBEA 5EE1A 5BOVA 3JD1A 1LNSA 3OUTA 3DS8A 2DWPA 2H1WA 2CHUA 2Q9BA 3ANLA 4OQMA 5AVKA 1RKBA 1XHLA 2FB9A 2OZVA 3G23A 2W2XA 5AK5A 2WOOA 4A2WA 4ECAA 1DIOB 1QLHA 1Y5MA 1GKKA 1RQ2A 2Q41A 1ZDMA 2VSOA 3D7LA 1HYEA 3DMNA 2TMDA 1FP4A 4LKRA 3LBYA 5HF9A 1JVNA 4C2AA 4TRJA 4M1QA 3ZGZA 1DS6A 1BMFA 5CLJA 1IN4A 1XAIA 2BKXA 2PSSA 2V6FA 2D2IA 3FYUA 4TS9A 3VU0A 4F7DA 4NBTA 2AMVA 3PNYA 1R4NA 5CFQA 1P2TA 3G82C 1KO4A 3VVLA 1U7XA 1M5TA 1G19A 2GS9A 4LC1A 2AJTA 4IIJB 3UZUA 6ABPA 2AEEA 1DOHA 4IY1A 2FEXA 1QJ4A 1E1RD 2F8LA 3HBAA 1O89A 2OYCA 2ZB2A 3SEAA 4HZGA 3V8MA 2CLDX 4ON9A 5A0VA 3DLHA 2HT1A 3D7SA 4R2WA 4ZOLF 3BX1A 4ASUD 4EKDA 2HL6A 1FXWA 3UK7A 5K0JA 4S12A 4R9NA 2PUWA 3OFVA 1GWNA 5IAOA 1Q77A 4PGGA 1EK2A 2WHYA 4A1FA 4BQRA 1DAKA 3N2YA 4YFVA 3R1IA 3SHVA 3TQIA 1YRQA 1FRZA 1QHSA 4OM8A 4PGHA 4Q3AA 3WE7A 2VPWA 3DAGA 2ZE7A 1TQDA 4NV3A 4TMYA 4R69A 3ZLBA 3EBPA 1QK4A 4U9IS 3ZY5A 2H51A 5JS8A 3EXFA 3IXQA 4S2UA 4IH9A 2EQ5A 4E15A 2I3BA 1L8XA 1PK8A 2C8KA 2NUPA 5DGIA 5EY5B 3GBSA 1OXXK 3F9RA 3OZSA 1VLHA 3AXSA 3D2BA 3L49A 1T9BA 5BSVA 2ZSAA 3C0KA 2W5UA 3N70A 4K87A 4A2CA 5CT9A 2NO4A 3AM3A 2ZIFA 4ALLA 2R7MA 1ACLA 5BV0A 1P2DA 1FDRA 1Z5WA 4RANA 5BPHA 4JP2A 3CCBA 3PFHA 2FF7A 2F3PA 1SVIA 2ZJ6A 4F45A 3CNOA 4U7GA 2G5TA 4EDHA 1LPNA 3KJXA 4L5CA 3A32A 3LOUA 5BMVB 5CD1A 4WEOA 1EHIA 3I6MA 3E5MA 5JDIC 3C8MA 4MW1A 1DHRA 3W0LB 4ENSA 2PNJA 1F7UA 1MKYA 3LX8A 1Q92A 1B93A 3PNBA 4Y7CA 4I3HA 3FNIA 1YGYA 4I6EA 4OJYA 3IE1A 1E0KA 5T67A 2NQTA 1DDGA 4N7MA 2XUPA 3BQMB 2O7NA 2VRCD 2VEDA 4FGJA 5A3RA 1Y42X 1EXNA 3OJCA 2Z3WA 1U3DA 1U9YA 2JHCA 3L8ZA 3NRCA 3LDUA 3P27A 3HN7A 1K1EA 1M8FA 1R8XA 3ZDEA 1JRLA 3GJZA 5KPDA 2YIVX 1GL9B 4HY3A 2GDJA 1GU7A 2QR5A 2W2OA 4ZQCB 1AXRA 3RRNA 3UJ9A 3UMMA 3C98A 2NYUA 2H65A 3MQ2A 4CE6A 4UJ3A 3MJRA 4RTMA 1E2EA 2GXSA 5IBQA 4YO7A 4A8TA 3TFOA 2HEIA 4RMJA 3JQAB 3OF3A 2OCKA 3QWFA 4P4NA 1TGYA 2IE8A 2P5UA 4ER6A 4QOJA 5CD9A 5L8VA 1PGQA 3BRSA 4JNKA 2ONYA 1H66A 3ZW9A 3IEKA 2P1DA 4DMRA 3WLSA 1AKTA 2BSXA 1GITA 2VHQA 3ORRA 3RC9A 2YWJA 5AMXA 1JPVA 5A4JA 1ZQ9A 8LDHA 5AVQA 1SD2A 5BVHA 5HZGA 3IHTA 1ZVVA 4MWZA 4RFVA 3E9QA 4W9RA 2WR8A 3L93A 4JOBA 2XVXA 5LMZA 2PLAA 3S2EA 1T3ZA 2N1MA 3RD5A 1T15A 4G8BA 4O0MA 1MIOA 3N1UA 4P53A 3L7KA 4RSGA 1AJEA 1M2GA 1CR1A 1F0YA 1NJ5A 4CV3A 5C7YA 2YWRA 3GBVA 4L4ZA 3C4JA 2XIJA 4TKUA 1BOFA 5CT6A 1E1CB 5F78A 4L78A 4XWKA 1L4HA 1Y5IA 3IE2A 3B36A 13PKA 3PWZA 3JQEA 1USWA 2RAPA 3A6ZA 4HEQA 4PYKA 4WA8A 1FRVA 2WJIA 5BO5A 4RKRA 5BW5A 1FXSA 3AVPA 3DA8A 1KDZA 3JW8A 3YASA 5CB0A 3ZH2A 1E1DA 2ASVA 5JNTA 3LTNC 4XWWA 1EFRD 3HWSA 1NA5A 5K8UA 1VL1A 5KX5F 1O3YA 1TU3A 2FG6C 2PGLA 3A9TA 3S4YA 2KS6A 3CWCA 5FTNA 5KZMB 3ETLA 3PTLA 4IIVA 1DCFA 1ZH2A 2WFZA 1TOAA 1JILA 1K66A 2HAEA 3SHQA 2CXHA 4F2DA 1MFPA 1HEUA 4U63A 4KFCA 4NJEA 2J1LA 3CUKA 5C8YA 3DD5A 4K46A 2LUOA 1AKYA 4YV1A 3A1EA 4OX9B 4P1ZA 5CTJA 1QH0A 2ZRMA 3KSDO 4RX1A 1MJGM 3HDYA 1DQYA 4JIGA 4KG7A 3WHKA 1ESZA 4C78A 5DWVA 5AIBA 1XFAA 5T6BA 2VI5A 4DMLA 2QTHA 2VP3A 3PJFA 3WXMA 4ARCA 2NSHA 4XD7A 3HYTA 4WK0B 5BSUA 1KWKA 3QPVA 4IZIA 1PS9A 2PK3A 3ENVA 3BL5A 2WD8A 3I6YA 4HLNA 4IQ4A 5IYZB 3I4FA 1V48A 1U8FO 4EB8A 1CQIA 1R4MB 1BROA 1EBFA 1YR3A 3WHIA 5DBFA 4EF4A 3N53A 2OO5A 2XT6A 1DJLA 4EM6A 3R24A 1G9TA 1XRJA 2A33A 3JQCA 4MQMA 3HXTA 4B31A 3HCEA 1MJFA 1TIKA 4K6KA 3ADKA 1Y80A 1R3UA 3IUBA 5ED0A 2HU7A 4MRAA 5I9BA 5KWIA 1OWMA 3KB1A 1AA9A 4AM8A 3F2VA 3OF5A 3G2OA 2OZLA 3ZWBA 1B8PA 3B7GA 2L0XA 2O8CB 2IPXA 4V0LA 1F5SA 5U1PA 4CG0A 1HQDA 1JHVA 3CW8X 4YJ2B 4K8OA 4G85A 5K09A 3CB4A 4RPGA 3EQ7A 5DM4A 1SJ9A 2H92A 1MUUA 3I1YA 4BLTA 1YZVA 4G8CA 2X42A 4IF4A 4HB2A 2FUNB 3P9YA 4H59A 4NZ9A 2EFEB 2ZCUA 4XOIA 2J09A 1Y5NA 3W5UA 4MQFA 2VHEA 4YHBA 4YXFA 4ZKDA 5FUQA 5JHGB 3IA7A 1DKNA 5JAHA 1Z62A 3CW2A 4DC0A 5LFAA 4C3UA 1FRNA 2LWIA 2PH1A 5HKLA 3USZA 1KMIY 3DBLB 3OZGA 1EGQA 2EJWA 2AFIE 4CMEC 1N78A 4JVMA 4K9DA 3AUKA 4C2BA 3BM5A 2X5KO 3H7IA 4HSEA 4XVQA 2IU3A 4B0OA 1JIKA 1T2CA 4AKSA 1DGQA 4NBWA 1ZI9A 3E9DA 4GOKA 4I8DA 3VPBA 1MDBA 4GX2A 1RBMA 4KDEA 2HC9A 5EI5A 3FR8A 3VR0A 1GQOA 1QIHA 1UMCA 4ENRA 4YDHB 1QTIA 2P41A 4B76A 2DSTA 3LBAA 4WFKA 5IM4F 1VI5A 2X58A 1XCLA 3B60A 4UEWA 1M6HA 4WNAA 4CIVA 1QYRA 4KDCA 4RA9B 4KR9A 1BX3A 1DC6A 4D46A 3VH2A 3JATB 4I5GA 4UHDA 4DUPA 3KOXA 4ZVRA 3U48A 5CB8A 4BTEA 1XI2A 4P9NA 2Q1WA 4FMCF 4EK9A 1FYEA 3M1IA 1VYVA 3JR7A 2BH2A 4RENA 1J97A 3BQNB 5TNXA 4H7JA 4YHHB 3RIXA 4DLBA 4MYCA 2ZXUA 1RZ3A 4MKZA 5CA1B 2OORC 3SZRA 3U17A 3DAYA 4LQLA 4ND3A 1QRSA 2R87A 5I4CA 3R76A 1NDHA 3M34A 1R6UA 2GFHA 1TAUA 4NULA 1O96B 3PQ8A 5JD5A 4FGSA 1AS2A 1RHMA 5EMKA 1JR3D 1SUEA 1MENA 1YR1A 1L4UA 3UTDA 3GDWA 4O2RA 5K0GA 1KKUA 1GNQA 1C7EA 2ATVA 1H23A 3A4VA 3H6HA 4M7WA 2VDLB 4GSKA 5LOVA 4X41A 1XZPA 3GFBA 1KEVA 5F12A 4FINA 3GX1A 4XASA 1SU6A 2XNKA 5JXIA 1M2JA 3MUFA 1AA6A 3NRBA 3T7EA 3RS8A 2O2CA 1QC5B 4EFKA 1U0SY 2O07A 4QGBA 2CZCA 1UOQA 3GVXA 1O0BA 1RADA 2RKOA 1ZSYA 1MC8A 3QYJA 2HV8A 1NWCA 1LW6E 1JJAA 1YNSA 1MJ5A 2AOUA 2I71A 2NV6A 1YZLA 2DBQA 2H4JA 3I9V1 3LC0A 1TTQB 1YMQA 1C9KA 1GTL1 4P7FA 1WZUA 3O26A 4PNPA 4JLJA 4RA9A 3EA5A 3ISVA 3TNLA 1VCIA 2DPMA 4WK6A 4H7FA 3NJ4A 4CU2A 1UZLA 2QUIA 5IM4A 2Q45A 1XVTA 3HDQA 4PQRA 5IULC 1CBUA 2CYCA 2E6UX 4RY0A 5JD3A 4DJEC 2R8YA 1I2ZA 1U0NA 4RAQA 3F1KA 3FTEA 3ZEAA 1VTKA 1QIMA 1YJAA 2YL2A 1C4KA 2QI9F 3CX7A 1RYZA 2C5SA 2FLVA 2QMOA 2X2OA 3UVEA 4E6EA 4EVSA 4CIYA 1L3IA 1JFSA 2BFDA 5KJ1A 2P9EA 4QOIA 2BGLA 3QXSA 3HNOA 2P9QA 1GPJA 1ZRMA 3RAFC 4F11A 3PQFA 4L5BA 5FRDA 5AYVA 4LF9B 2PRKA 3ORHA 1I14A 3KCNA 4ZVNA 2WM9B 3R3UA 2AMJA 2DETA 3OSUA 2E6KA 3K9QO 2L17A 2XB8A 2EJCA 4FW8A 4Z2AA 3AEQB 2QP9X 5F33A 4EJ2A 1Y9DA 2BDEA 1DXOA 4WY8A 1C3LA 1FXWF 1RVV1 1ZVMA 3B52X 3D59A 3QW2A 3DXXA 2IBMA 4A6XA 2XECA 1VJ1A 3IAM1 5GQSA 2RB5A 4AJPA 1U3FA 4HDMB 3FZYA 4K9OA 2OFPA 3T06B 3TW0A 1EUYA 2QHXA 2AOUB 2BM0A 5FV7A 2BSAA 2G9VA 1QHNA 1T3TA 4IOLA 4B75A 1DBSA 2PKWA 2NG1A 3OD5A 2DCMA 4RS4A 1B6RA 1ZMXA 3FTCA 3UC9A 2BT4A 1JLKA 5B4UA 5JG7A 4EABA 5JY1A 1B16A 2JI7A 2NZ8A 4II7A 3RB8A 1QZUA 1NQWA 1VMKA 3IA2A 4JLUA 2C5EA 5DB4A 4OL9A 1A8PA 2Z8XA 3PPYA 5EKUA 4M8SA 1AUPA 1ML4A 3SSNA 4A7PA 1IC6A 5AWFC 5TV2A 4HI0E 2AR7A 1P1JA 1N0WA 2HIHA 4D4LA 1Z2DA 3PFCA 2I8AA 3ZIDA 1QQ5A 3SBDA 5LD2B 4X65B 4RF3A 1VI2A 3KB8A 4JBHA 4KE6A 1F7VA 1HYQA 1YE8A 4KPGA 1XKTA 3GEDA 3QJYA 3V7WA 1XZHA 2DUMA 3VPFA 5BNZA 4OHKA 5KOIA 4ILKA 2VUUA 5EE5B 1Z56C 2IY9A 2H57A 3MT7A 3ZE0B 1CUVA 4YJ3A 1PLKA 1Q12A 5EWMB 3BIOA 1FXUA 1RI2A 2HCTA 3X2FA 3JD0A 1C8BA 1N2IA 4OFBA 4DIFA 4UMFA 1CS0B 3D6MA 2QN8A 5HQ3A 1ZI6A 2V03A 2YWBA 1RABA 4DNFA 5CM2Z 5JNSA 1J7JA 3PFNA 4B8ZA 1DWQA 2GCPA 1BVUA 2AEJA 1NOJA 3N5CA 4FFWA 3QELA 4EJSC 3BK2A 4QPPA 4A15A 2WWIA 3CHYA 1KI7A 2V45A 4QYSA 1EH5A 4IO0A 3ZTWA 1W85A 1EK0A 1T5LA 4JLSA 4ZFNA 3HJFA 1OXUA 5D87A 3PD1A 4OLAA 2W6NA 3DVQX 1DPGA 4YMWA 1PW5A 3IULA 5IF9A 1OTHA 3CH5A 2P91A 1RNLA 3EIWA 3Q7EA 1R4AA 3EZ6A 2PGJA 4N01A 4WE3A 3G49A 2D06A 3FYCA 1C81A 3LQ1A 2X77A 4DEVA 4GT1A 2BGTA 4TKUB 2P40A 4JENA 3GGJA 3B1FA 2VNSA 1GUZA 1Y63A 1YBFA 1B0PA 4EB3A 3A1UA 2EATA 4R7ZA 4YRCA 3K1JA 2XTAA 1W88A 3PEUA 3PV0A 1C3VA 3FPCA 3QIVA 5IHPA 1PJTA 1VE5A 2O8VA 3DTTA 3RS7A 1O94C 2WAYA 4K88A 3TINA 3ESRA 2W2NA 1PSZA 2PXCA 3V1UA 4W9NA 1QRTA 1JQDA 4GMHA 4BIIA 5J9FA 2IBTA 2P4HX 1USGA 1Z0ZA 2EP7A 1W29A 4YASA 1CQZA 1J8MF 2NO1A 4BU1A 4C6HA 3EHEA 1IY1A 1S7GA 3MAAC 4ZU6X 3T35A 2JLUA 3OLWA 2A8YA 4ZGWA 4MXDA 1ULAA 3EMDA 2WQ7A 4Y2XA 4HNSA 5FA5A 5HWSA 1X7XB 1ZH6A 2PJDA 1ZH4A 3ASUA 1F1BA 4J3FA 2VC2B 1IBKB 2HH9A 5EVJA 1QU2A 1NUPA 2HF2A 4FYIA 1P9NA 1YR8A 1ZW1A 1YE3A 5H82A 1W4AA 1GG5A 1L2TA 2Q1YA 3RUEA 4ZCIA 4YRFA 3T3IA 5A5FA 6AT1A 1XEWY 2RKWA 1CT9A 1LSUA 2Q27A 3IPLA 4OKNA 1QORA 2WP8J 3CPSA 2IDZA 4JA0A 3QWIA 2H1FA 3UK0A 3W6PA