4H7HA

Crystal structure of haloalkane dehalogenase linb t135a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVAMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
molecule keywords Haloalkane dehalogenase
molecule tags Hydrolase
source organism Sphingobium
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7hA00
3GELA 1QONA 2PSDA 1XFDA 1E8MA 3GA7A 2JF0A 3BJRA 4BP9A 5A62A 2GYUA 4WY5A 1DX6A 3CN7A 4AMZA 2RONA 3D0KA 2QVBA 1XZGA 2O2IA 4TPKA 5LZ2A 3D5EA 4B80A 4AO8A 1EI9A 3D2BA 3EBLA 5ALVA 2WFMA 1ZI9A 1QTIA 2HFJA 4U2DA 3FWHA 1ZD3A 4OU5A 2HADA 4BVJA 3WWCA 4BTLA 1MX9A 2XQIA 1YSCA 2EDAA 4KRXA 4X85A 1U2EA 1ZI6A 1LBTA 4F21A 3WLAA 4H35A 2O7VA 4UFPA 2WU3A 3G0IA 1R1DA 3G9UA 2OAEA 3FYUB 5HFAA 3AIMA 1AMNA 1IUNA 3IDAA 4Q05A 1LPMA 4L3WA 2VEOA 1XLWA 4U2GA 5ALIA 4C4ZA 3D7RA 4A23A 4BE4A 1ZI8A 3MVEA 5ALDA 2OG1A 4QLOA 4DMCA 5LZ8A 5FRDA 1CUBA 1YS1X 5AOCA 5A7GA 2B20A 1CUXA 1WM1A 5EHZA 1CUUA 4H7KA 4Y2JA 1MO2A 4UFNA 1H23A 5D3KA 3A2LA 1WB4A 2XUKA 2Y6VA 3QMMA 2Y6UA 5C8XA 4KAAA 4Y2RA 4LHEA 4EY4A 4UBLA 1J1IA 1QIFA 5AOBA 1XZEA 2ZYIA 1WB5A 2XUFA 1MTZA 5CT8A 3WK4A 5AKHA 3HLKA 3EQ7A 2R8BA 3QVMA 1BU8A 2OQIA 3DKRA 5LZ9A 1E8DA 5IKXA 3H1BA 4HAIA 3FLAA 4EZIA 2AXEA 3STTA 2D5LA 3HZOA 3FAKA 1KU0A 4ZRDA 2XMCA 3SK0A 3I2KA 1AURA 2G63A 2EDCA 3K9BA 2GYVA 5HQ3B 2E3JA 4B9EA 3LS2A 3C5VA 3SC2A 2WHPA 5JAPA 3LP5A 3LLCA 2WTNA 3R3ZA 3X3HA 5HCUA 1HKHA 3WKAA 2W22A 4G4GA 1ZGBA 1ZD2P 5AJHA 4TGLA 5LLSA 3C5WP 1JU3A 3ZLVA 1HBJA 3C8DA 4EY8A 4BDSA 3W2TA 2NW6A 4W63A 5AKKA 5KWIA 3V1MA 4CCYA 3STXA 1Z68A 3A2MA 4W9RA 3G9ZA 2WUEA 3CXUA 3AILA 1K63A 2CZQA 2CKMA 2Z5GA 1GXSA 2BJHA 2PUJA 1VXOA 5AO9A 5SYMA 3PDCA 3VXKA 3KXPA 1AGYA 2WQZA 3BJMA 1TKRA 4X91A 4UBJA 3LCRA 2J3QA 4M0EA 3SWWA 4QE3A 2XLCA 1ZIXA 5DLPA 5LYYA 3NGMA 5ALQA 4HRYA 1YS2X 1UZAA 4OU4A 5FPPA 4C4YA 1THGA 4OCZA 1F6WA 1XZCA 1G66A 4M0MA 4Y2SA 4AB1A 2XI4A 3BDVA 3M3DA 1Y7HA 2X76A 4D9JA 2WJ3A 1R3DA 6YASA 4OSEA 3ICVA 1Q0RA 1WPRA 1XRLA 4MYSA 1CUVA 3QH4A 4B85A 4U2FA 2HU8A 3OURA 4MQLA 5DNVA 3F67A 3ZV7A 4B82A 3H18A 1CUAA 4G9GA 4UHFA 5SYNA 3V48A 2VT6A 3O4IA 4MJ3A 1H22A 4ZV7A 2JEYA 3ED1A 5DYYA 5AI6A 2QKYA 4FNMA 1ZJ4A 4F5ZA 4J0HA 4BBZA 2C5GA 4ZREA 1U8EA 1B6GA 1MAHA 2VAVA 2X8BA 3C6ZA 4OB7A 2VJAA 3RK4A 4LKOA 4K2AA 2CJPA 2XUHA 5ALOA 1GPKA 1GQRA 4FOLA 3B3QA 2GZSA 3T4UA 4F0JA 4ZI5A 2JGFA 4DNQA 5CH8A 1EDDA 2BKLA 1W4LA 3EQ8A 4G1FA 4MEBA 3LIIA 5AM0A 3QMVA 3O9MA 5DTIA 4KEAA 1JKMA 2BAGA 4Y2XA 4JYMA 2B4KA 3N0TA 5AI5A 1R4ZA 1QIGA 2D0DA 1N1MA 4LXIA 5ALNA 4GWLA 4EA6A 3STUA 5CXUA 2CBGA 3F98A 3FLEA 4RPCA 4GBGA 1FFCA 1XZDA 1E3QA 3L1JA 4UBMA 1EINA 3G0DA 1E89A 4BRZA 1A8QA 4UBOA 4DTCA 4F60A 3BE8A 2C4HA 2PSFA 4LYEA 3AJAA 3VDXA 5DYWA 2XUDA 5AM3A 5ALJA 3FCXA 3DOIA 5ALHA 2ZSIA 4X90A 3RM3A 1DWQA 4Q3KA 5HF6A 1DT5A 3S8YA 4U2BA 1VXRA 1XZAA 3KWFA 2XB6A 3I2IA 5AKIA 5IVHA 2HA4A 2P8SA 4QNNA 5T4HA 3WA6A 5JAOA 4ZXFA 1A7UA 2DQZA 1XQVA 1XLUA 1XZBA 3VVLA 2V96A 2WSLA 2QZPA 3PFCA 4G9EA 5IVKA 3D2AA 1K4YA 3GUUA 3I2JA 3U0VA 2QXTA 3AZPA 1QIJA 4W1QA 1AKNA 4K5QA 2WIGA 1SOMA 4Q82A 3DCNA 4W1RA 2QJRA 1MAAA 5FPQA 1OXMA 3R0VA 4AO7A 2OGSA 5AM4A 1CUDA 3WK8A 2OGTA 1FFAA 4ZV9A 1CVLA 2QM0A 4HS9A 4LXGA 4IH1A 4C01A 5FLKA 4CCWA 4KJXA 2ACEA 4E46A 3IBTA 1ZGCA 5LKRA 4NVRA 3GROA 4RGYA 4BZZA 2VQ6A 1ZJ5A 2DHDA 2CMFA 5ALXA 1FFDA 4DM7A 3STYA 5CTAA 1YA4A 4B84A 4BAUA 1XZJA 1XZMA 2QOEA 2XUJA 1DX4A 3C87A 3Q0TA 1UK6A 3WKDA 3HACA 3G0BA 5AH0A 2WLSA 2XQFA 1MU0A 1BRTA 4CG1A 4MWSA 4N8SA 3K2IA 1E5TA 1Y7IA 2CUTA 4B9AA 3HEAA 3PUHA 4CFSA 2XQKA 2WJ4A 1W76A 4CIAA 1C4XA 1PV1A 1BCSA 2C5FA 2OCKA 4AQDA 1QO9A 5T4BA 5AKGA 2O2GA 2RGUA 4N8EA 4YPVA 4X93A 1DINA 4AN0A 4H18A 2PU5A 4Y2PA 2GYWA 2DSNA 5T4EA 3HABA 1N5MA 2XLBA 1EXWA 4IO0A 3IA2A 3TEJA 4J0CA 5CW2A 3I6MA 4Q3LA 3KD2A 4OYLA 3V1KA 4BCCA 4FMPA 2XMSA 3G0GA 1EDEA 2OGZA 1ACJA 1NU6A 2PM8A 4BDTA 3H1AA 3IUQA 3WL6A 3WK5A 1BN6A 1LLFA 4RNCA 2XMBA 3DLTA 1X2BA 4OB6A 1CLEA 4FWBA 3KOOA 2OLEA 1P0MA 2BUBA 4ROTA 4UHHA 4B0OA 5JD4A 3VISA 4DMFA 4U2CA 3G02A 5AHXA 5ALZA 3WI7A 1JJIA 2WHRA 3WWPA 2HU5A 2ES4A 1KU6A 1H2YA 5LZ4A 3VJLA 3DS8A 3A2NA 4P08A 1SCIA 1F8UA 5FOQA 3GFFA 2WG2A 3ZPXA 4KE9A 2AJLI 4WFKA 1UXOA 3E4DA 3WKCA 4BAZA 5AKYA 5JZ9A 3DQZA 1K6EA 2C0PA 3RKSA 3A70A 1MJ5A 4BC1A 4HRXA 1TCBA 4Q3OA 1CUJA 1GKKA 1CR6A 5HKAA 4E11A 1ORWA 3HC7A 3GZJA 3NUZA 5EHXA 4V2IA 1ZD4A 2Z3ZA 1B41A 4PSCA 1YR2A 1GQSA 3TRDA 5EIAA 2PPLA 3WK6A 5A6VA 4UBNA 2JBWA 3HJUA 1ODTC 4FLFA 4LYDA 4OUKX 1R9MA 1XQWA 4UUQA 1GT6A 1QIKA 3C45A 1XRQA 1WPXA 2C58A 2VSQA 3W9UA 4UHDA 5DWDA 3IVMA 5DNUA 4IHAA 4W1SA 4G8CA 2QJWA 4FFWA 2JGJA 5C8VA 2QT9A 3BIXA 3AIOA 1CEXA 4O08A 1QTRA 3A6ZA 5HF9A 5BV7A 2FJPA 3FYTA 2QR5A 1QJ4A 3AIKA 2XDWA 4QDXA 2GZRA 4J3JA 4C87A 2C7BA 2I3ZA 3EQ9A 1UFOA 1YASA 3QPAA 2IIVA 1CUGA 1LBSA 3VVMA 5JASA 2Q0XA 1QIDA 5JYCA 1MT3A 5K3BA 1L7RA 1HDEA 4X71A 1TRHA 2ZYRA 2PL5A 2XT0A 1UK9A 1YB6A 2XUQA 3WL5A 5HF8A 2H9YA 1LGYA 1CUIA 1USWA 1UOOA 1ZIYA 3BF8A 1CUYA 4DIUA 3PFBA 1IZ8A 3VKFA 4IH9A 2V97A 1UK7A 3ANSA 1D07A 4E14A 3FNBA 2HA2A 5AK6A 3AZQA 1R88A 2QXUA 4AZ3A 1F0PA 3I6YA 4IQ4A 4OB8A 3I6ZA 1QO7A 2FJ0A 2HRRA 3O4HA 2RHTA 4EHBA 5C7YA 5LKAA 1JFRA 4BC0A 5JZBA 5ALPA 4J0GA 1XROA 2ZJ7A 2Z8XA 1QZ3A 1XZFA 5ALWA 3E0XA 4FKBA 3C6BA 1Q84A 4B81A 3KDAA 1BROA 4X6UA 2YXPX 2HRQA 3FVRA 3MGAA 4J0DA 3DOHA 4L72A 1LPBB 3WMRA 2LIPA 1ODSA 4PF1A 1VZ3A 4X6YA 4B6GA 2WFZA 3OPMA 3Q8WA 5LZ7A 3WIOA 2DCMA 5IVIA 1BEZA 1U4NA 1VZ2A 2I3DA 4H7EA 3G9XA 2ZYHA 5JANA 4FDMA 2XQJA 2GBFA 3EIOA 4G4IA 5KREA 2WHPB 3DD5A 3M81A 3FSGD 1W6RA 2VAXA 5I9IA 4BAGA 5JD6A 4GHWA 3RLIA 2PSJA 2PBLA 4X7BA 4DNFA 3H04A 3OTQA 3JWEA 5AI8A 1MNQA 2J3DA 4FTWA 3E3AA 5K3DA 3NOXA 2XUOA 5ALLA 4GECA 3DKKA 3I1IA 3E1GA 1CIJA 3ESAA 4CCYB 2HFKA 1UWCA 1E66A 1UOPA 4N8DA 4FNGA 1L7QA 2WUDA 3QPDA 3ANTA 4H7FA 1SCKA 4DGQA 2GBCA 5FV4A 4G4JA 1CQZA 3WA7A 4GEGA 1H2ZA 3O95A 4U2EA 3IULA 1X2EA 1C7JA 3ESDA 1CPYA 2XUIA 5BWCA 4GDMA 5AK5A 1Y37A 5JATA 1BEEA 2ZVDA 3DJYA 1XZIA 1JMKC 2QTBA 1MPXA 1ZOIA 5AKXA 2XUAA 1K5PA 3AUKA 1HLGA 5HFNA 1VJ5A 3HRHA 3QZUA 2O2HA 5DTJA 5AP9A 3R3XA 1MX1A 3VJMA 2FUKA 5I8PA 2V98A 2XMQA 2V9ZA 3WKBA 2JEZA 4YK7A 3OM8A 1J07A 2OAGA 4YASA 3BF7A 3D59A 4DMKA 3L1IA 1GGVA 1YB7A 5A2GA 2B61A 3F97A 1TAHA 1H2XA 4AZ0A 1A8SA 1PFQA 2WU4A 3B5EA 1XQXA 2G4LA 3F8SA 5AK4A 4QA9A 3UUFA 3D2CA 1FJ2A 4H0CA 4AMYA 3M82A 5I7UA 1UK8A 1N5RA 4X97A 5AM2A 1WCYA 4FHZA 3GBSA 5CH3A 5IH7A 2ZJ6A 3R41A 2XE4A 4M0FA 3ICWA 3AINA 1HPLA 4BE9A 4Q1VA 4AN1A 4OYYA 1CQWA 3SX4A 3FCYA 1IMJA 1QIMA 1XRRA 1XRPA 1EVEA 4UHCA 3WIBA 3BL8A 1GKLA 3KWJA 2JGEA 3G9TA 1XQYA 1CFJA 4ZGBA 2XUGA 5E4JA 5YASA 4PV7A 3BIWA 4UPDA 3KSRA 4Y2VA 4Q34A 3H2JA 3HI4A 4PW0A 4XJVA 1IZ7A 1MNAA 2Y2UA 3CCBA 1CUFA 3D4LA 2AJCA 5HKBA 1RWQA 2WILA 2BUAA 3D3NA 4QDUA 2ACKA 4X94A 4EBBA 4QDZA 4LIPD 1XZKA 3H17A 2RI6A 3DYVA 2VJCA 4IH4A 3WL8A 1BS9A 3V1LA 3G0CA 4H7HA 4RE6A 3I1YA 1AUOA 3ILSA 1EK2A 5F4ZA 1SC9A 5FKJA 1XZLA 4KAFA 5A7HA 3S2ZA 2DR0A 3WK7A 1OILA 1DU4A 1GPLA 2WG0A 1FFBA 1QIIA 4BB0A 1CUCA 4OPMA 4WDRA 2X5XA 3C6YA 2JIDA 1EX9A 3YASA 2ZYSA 4P93A 4JNCA 1KEZA 4GXNA 4PO3X 1UKBA 1AX9A 2Y1KA 1JJBA 3V1NA 1OCEA 2R11A 3QYJA 3PICA 1P0PA 1M33A 5ALRA 5JALA 2WIDA 1CUSA 5HZGA 2BGNA 2HA0A 4NZZA 1T2NA 3WQHA 5FXMA 1EDBA 3IIIA 1RYYA 1XKTA 2YYSA 1JJFA 2XMGA 4WCVA 4XIIA 4H77A 5ALFA 4ZWNA 4EUSA 4J0JA 1SFRA 3NWOA 5JAHA 4G8BA 4BCBA 2DHCA 1YAJA 2BUCA 2AJDA 5HF5A 2K2QB 2B9VA 4YX9A 3I2FA 4XWGA 2JGKA 1WHSA 3R3WA 4K6HA 4I3FA 3FLBA 2XMRA 2Y2VA 4QDOA 4WFJA 1P0IA 1VOTA 1AC5A 5CH5A 2OXEA 4J0IA 3OC0A 4DNPA 2JGMA 3O4GA 4A5SA 1JU4A 5FUMA 4UHEA 1MN6A 2VF2A 5JAUA 5K3FA 4FLMA 1DWOA 4X92A 1VE7A 5ALGA 4X3CA 4KYVA 4BVKA 3QMWA 1Q83A 2PKYX 3DL7A 4Y9SA 4Z49A 4H7DA 1AZWA 5K3CA 1ETHA 3H2IA 5HQ3A 2G5TA 2ONCA 2WTMA 1TCAA 3DEAA 2Z8ZA 5CMLA 1EK1A 1LNSA 4K6KA 5EI5A 4C88A 2J4FA 5HK9A 4FBLA 4B0PA 5JARA 3WKEA 3PF8A 4KACA 4AO6A 1TIBA 2YH2A 3C43A 3WWDA 4PNZA 5LIPA 1TQHA 5CT9A 3EF3A 4L0CA 4CIBA 3FVTA 5AICA 4HTAA 1CV2A 3R3YA 4JH0A 2ORYA 3IUNA 2H7CA 4EB0A 3MUNA 1GPNA 3U1TA 3AFIA 4ITVA 4QEKA 4K6GA 4KE7A 4DLNA 5JZSA 1YCDA 5AI0A 1G42A 1G4HA 1U65A 3DNMA 4BATA 4B7ZA 3QPCA 3UMJA 3ZLTA 4UFOA 4FLEA 4WY8A 1NU8A 5DNWA 5CRIA 4UBIA 1LZLA 2ZJFA 4WFIA 1BCRA 2OCLA 3IUJA 5ALEA 3PUIA 1ORVA 5K3FB 1L7AA 1QLWA 3WJ2A 4QWWA 1A88A 4XVCA 1HL7A 2BCEA 1MX5A 3W06A 3WYDA 4LXHA 1CRLA 4HXFB 3WL7A 2PU7A 1LPAB 5AM1A 3B12A 3PE6A 3V9AA 1XZHA 5CXXA 5CT6A 2HU7A 5ALTA 3H0CA 2HA7A 3BDIA 1W52X 3I28A 3H19A 1ISPA 3VJKA 1O6GA 2HHAA 5T4FA 2WJ6A 1F0NA 1XRNA 3TJMA 5CURA 1C7IA 1GZ7A 4ARAA 2BFNA 4P92A 5AI4A 1EA5A 1XKLA 1K8QA 5K3AA 2OQVA 1JI3A 5ALSA 1FFEA 5ESRA 4PSUA 5AOAA 1VA5A 1CUHA 2WG1A 3C6XA 3DL4A 2XMDA 4NMWA 4GW3A 1QOZA 2YASA 4KE6A 3WK9A 3PI6A 4HXEB 5ALYA 2RHWA 5AKJA 5HK8A 4Y2YA 1R50A 2WFLA 5EIEA 3I2GA 4PQEA 1UKCA 2PUHA 5J3JA 3H2GA 4HVTA 1A8UA 3ESCA 2AJBA 2WM2A 3TGLA 4DSAA 3IUMA 5EHNA 5K3EA 1VE6A 2DHEA 2UZ0A 5ALUA 3O9VA 2IITA 1EVQA 7YASA 3MUOA 5H3HA 2ECFA 1VLQA 2PX6A 1LPOA 2AJ8A 5JIBA 3AZOA 3ESBA 3QM1A 2HM7A 5BWBA 3L1HA 4Y2TA 3STVA 4A16A 1QGED 2XMZA 5DJ5A 5AKZA 3JYHA 3O0DA 4JYPA 1BN7A 3I2HA 1CUWA 5AI9A 1QE3A 4AXBA 3FSGA 3FBWA 4Y7DA 1NX9A 2OCGA 5EHQA 2ROQA 3JW8A 1WOMA 4C6HA 3BWXA 3R3VA 1QIEA 1SCQA 3ZWQA 5AIBA 4I4CA 1LPSA 2JGIA 4BCDA 5ISMA 5CT4A 1Q0ZA 2HDWA 4E15A 1TK3A 1WB6A 2DFPA 3O4JA 5BOVA 4C89A 4N5HX 1N8SA 5C8ZA 5IVDA 2WFLB 4ARBA 4EY6A 2HIHA 4J7AA 1XLVA 4W1PA 4DNOA 4DSZA 1LPPA 4EY5A 4BVLA 2GBIA 2VJBA 1T4MA 4KRYA 4FBMA 1DWPA 3H2HA 1EHYA 4P9NA 2IX9A 4H7IA 4BP8A 5ALKA 4FFVA 4BZWA 2VTVA 4MEAA 3M83A 5E4YA 5AM5A 1P0QA 4MXDA 3T52A 1ZICA 2VATA 2VA9A 3OG9A 5JADA 1EH5A 2HA6A 3G8YA 4L9AA 4X95A 1ACLA 3K6KA 1JT2A 1S8OA 4EY7A 4Y2QA 1EB9A 5AK3A 2VT7A 4KE8A 1EB8A 4G5XA 3W05A 4I19A 3C8HA 3CN9A 2HA5A 1BE0A 4S0XA 4KR0A 5A71A 3HXKA 3ZLUA 3R40A 3F9CA 3R3UA 1QFSA 3WJ1A 4GI1A 2QRUA 4UHBA 1O6FA 5KWJA 3DDUA 5ALMA 3WZMA 1W75A 1UKAA 4BTVA 3W04A 2H7YA 2PSEA 4MYDA 4WDQA 3FYUC 1VKHA 3C70A 5CBKA 1DT3A 3CCCA 2OCIA 2QUBA 3F96A 5A7FA 5AKLA 3ZI7A 2VJDA 1DTEA 3QBJA 2RIPA 4KAJA 4CI9A 1FSSA 4MWTA 3HYSA 3FOBA 4WJLA 5LP1A 1AQLA 3STWA 1CUZA 1ODCA 4BRSA 1PJAA 5D7BA 2CEKA 2H1IA 5EFZA 2OPHA 3IB3A 4TVKA 3UUEA 4RE5A 3W9BA 2WUGA 2Z3WA 5E2IA 4GLBA 4INZA 1JMYA 2WIKA 3HSSA 3WYNA 4ETWA 1J2EA 2DQYA 1RP1A 5KBYA 4J03A 4DYHA 1CUEA 5C81A 1UOQA 1W1IA 3WZLA 1UT6A 4OD0A 1QFMA 4QLAA 2XQGA 1TCCA 5AIAA 4AX4A 1IUPA 2I03A 2WHQA 2QS9A 2WIJA 2FX5A 5D6OA 1X70A 3RARA 1XRMA 4BYMA 1G5FA 5AKEA 2G5PA 3WWEA 2EEPA 2PVSA 4PSDA 1E8NA 3H2KA 2CB9A 2XUPA 4X00A 2WIFA 4HXGA 4J0KA 1IUOA 5FDFA 2J4CA 2RAUA 2PSHA 1QIHA 1LPNA 1THTA 4QWMA 4X6XA 1YAHA 2C0QA 5CT5A 3QITA 3IURA 3DYIA 3N2ZB 5JD5A 1LZKA 1IVYA 4DMHA 4B83A 4HZGA 3PF9A 5D3ZA 1J06A 4CG2A 1H2WA 4JEIA 2O7RA 4MQMA 1HQDA 5EGNA 4G8DA 4UBKA 1I6WA 1ZD5A 3FYUA 4H7JA 1DQYA 5E4TA 5EIHA 3LIPA 2WUFA 3WWOA 1DQZA 4NS4A 4XX1A 2HL6A 2I78A 2ZSHA 1WHTA 3BXPA 3G7NA 2QMQA 2BGRA 1VA4A 4QDTA 5DYTA 5K5EA 2GBGA 5FP0A 2WKWA 2W6CX 1YA8A 4CG3A 1R9NA 2H7XA 4JUIA 4N5IX 2JGLA 2HA3A 4Y2UA 2QUAA 4QZVA 3P2MA 5LZ5A 3OOSA 4C4XA
chains in the Genus database with same CATH superfamily
4F85A 5EWLA 4DQDA 3AESB 3QNWA 2XHEA 4MOWA 2Y92A 1R9GA 4TSFA 4UNPA 2PSDA 3SF0A 1TM7E 1SIUA 3A06A 4LQ4A 4WBNA 1XFDA 2A0UA 2HLDA 2W6JA 4XYGA 4E3ZA 3EVFA 1DRVA 2WD7A 4QG3A 2K7ZA 4BP9A 1X8JA 3NMUF 1OTHA 3KCQA 5A62A 3CE9A 2C78A 1YL5A 9ATCA 3TXAA 1DX6A 2ASEA 2F3TA 2PMWB 3P2EA 4TLDA 4MA4A 3D02A 5FHQA 4ZC1A 4AMZA 3FR8A 4KN6A 1JR4A 1SQ6A 1F2TB 1V8BA 3CRZA 3KFLA 5DPMA 1DCMA 3DO6A 2CV2A 1E20A 3D0KA 1GLNA 4AWBA 2WFAA 4DM4A 1KY3A 1PNRA 4QPCA 2DETA 2QVBA 3IAS6 1NXTA 2O2IA 2NU6B 2NP7A 3PB3A 5A3SA 4O4JB 2QQGA 4AO8A 1FJXA 4FK8A 1KDPA 1KAOA 1EI9A 4M9QA 4P83A 2OHOA 2YHSA 5FWYB 4F4HA 1GGEA 4PYOA 2BFMA 2ZAMA 4XH9B 1ZMRA 3FX2A 1RD4A 4QTUB 2VF7A 2EJCA 1MKYA 5CU7A 4X60A 1JAHA 3WADA 2HADA 4XRGA 5ADUS 4HDCA 2YIJA 3IIMA 4HAXA 5A04A 1UP6A 2UZ1A 3B20A 4J29A 4MKZA 4MW0A 3PVCA 3K9NA 3LQYA 4YCMA 4DLVA 4HY3A 3LCMA 4BTLA 3UWMA 1MX9A 1U5BA 4IZIA 5DULA 4DB2A 1ZSNA 2W11A 2Y71A 2CFIA 2JEOA 2XQIA 2HW8A 3VNBA 1V96A 2CUNA 3KK0A 1YSCA 3DZKA 2IPNA 2J3MA 2FTKE 3AEUB 3DT9A 3NAGA 2F48A 2YKGA 4CF3A 1HYQA 1ZI6A 2QVXX 3GBVA 3IQHX 1Q7CA 3PA8A 4F6RB 1LBTA 3GP5A 4CMAA 1C50A 1SXHA 2O7VA 3E48A 1TD9A 4GXQA 2X0FA 4MGEA 4LZNA 4ZAXA 3G0IA 1GARA 1R1DA 3ELDA 4HMPA 3O2NA 3CKMA 4RK6A 3C7KA 4XB1A 2W5UA 3DNPA 4X62B 2NSYA 1VIMA 2CKDA 3FUVA 4EKYA 4RKWA 2FFAA 3KQPA 3PE4A 4DLLA 4OHRA 1NY6A 2EOAA 1EUQA 2VNHA 1JNYA 2Q5OA 4DCTA 2Q4OA 2EWMA 3U26A 1UT8A 1UMCA 3E22B 3ZGVA 3I3OA 2QLNA 1WHTB 1Z6TA 1JXQA 5CVEA 4TMVA 2AKAB 4R1OA 1Z5WA 2FZWA 1HTBA 2V5UA 1X0VA 4HO1X 1R66A 3BJZA 5KDDA 3OZGA 4I1UA 2OG1A 4A0RA 4Y6OA 4L73A 4TLEA 1JWAB 4UJ3A 3SHQA 1PL8A 3EAQA 1WM1A 3AEKB 4FMCB 3LSYA 1SC1A 5KO2A 2NXWA 1CUUA 4FJ0A 2W42A 1GG9A 4H7KA 1HO3A 4XVUA 4OLAA 2ZIEA 1HSZA 3FMPB 3THSA 2PUEA 2VZ0A 3T3OA 1W2HA 5ICSA 1O0CA 3TAHA 1BDBA 2DKFA 3AEZA 3VI4B 4Q1CA 1IY8A 3I04M 1JFTA 5D3KA 1H23A 4OO3A 3T15A 4K1LA 1ESCA 4DAOA 3FZNA 4D79A 1X1TA 1Q7GA 3EJ6A 3H1EA 4YRPA 4D44A 4KNYA 1L7VC 1U99A 1U7DA 3ICQB 4HH3C 1NTOA 1WMBA 3OKFA 3ROXA 2J85A 2J9FA 3VSAA 4UTRA 4LC9A 2B8JA 4JI2B 5K09A 1NT2A 3NEJA 2DPXA 4DA8A 3RJMA 4Y2RA 4LHEA 2D1YA 3T1OA 4UU1A 2Y1WA 3WG9A 4UEQA 1Z0SA 2ZYIA 2PH3A 4IDHA 3GLKA 1E64A 4DR1B 2A9VA 3OLZA 5MFZA 1BKYA 2XUFA 4L5YA 5CT8A 4CV3A 1ONBA 4R9VA 4JN6B 2G0TA 4LWQA 1YO6A 3EQ7A 1Y7TA 2XVAA 2CK3A 2NZ8A 2ZRIA 3T7CA 4ZCTA 4ZZ1A 2V58A 5M29A 2OYCA 3WRXC 3X1KA 1IXYA 1G21E 5DV9A 2HD4A 1JI0A 4GZMA 3WZ2A 2H1HA 4L0MA 4EHIA 2YZGA 4HAIA 3QXSA 1X7XB 2W0SA 2ZJZA 2AXEA 4P4SB 4AYXA 1W88B 1YI8A 2WMNB 4EYGA 1WP4A 2D5LA 3ABQB 1VCIA 3Q41A 4PR3A 3HZOA 3KR0A 5FUYA 3RPEA 4B4DA 3FAKA 3H2YA 3ADPA 1HFWA 3WWYA 3OJCA 5D3MA 4RD0A 2EL7A 1QKIA 8OHMA 1A95A 1AURA 3I2KA 4P34A 3ZUPA 4ER3A 2GYVA 2E3JA 4OQQA 2M2IA 1JUDA 4TX1A 2CV1A 1P7YA 1FSGA 4YHHB 4UUBA 1KR2A 3O26A 2OK7A 4MTCA 4ES6A 1MR3F 3EXFA 3FGZA 1VHJA 1UMDB 3FNFA 2EYQA 4IZOA 1P74A 2AEJA 1DAMA 3R3ZA 3W7VA 5AVWA 3PRKE 1PAUA 1HKHA 4C76A 1NNLA 5JECA 4EJSA 5FBQB 1T3ZA 4BJHB 2GUWA 4R9UC 3NDRA 2P78A 4YJHB 3QSGA 2G6BA 3BSWA 4DCOA 1SKMA 3EQZA 1AMOA 3IQWA 4LJ9A 5LLSA 4N01A 2AUTA 3JALB 3OZSA 3DG9A 3K6RA 3M9XA 4NOKA 4OJNA 2QQ5A 3ZLVA 2X77A 2Q0SA 2XZLA 3CE6A 4F86A 2FE1A 3C8DA 2NMVA 1N2CE 2D2IA 2QROA 3FKQA 4FWIB 2HDOA 4XIJA 2H3EA 3P52A 1M5TA 1SIOA 1EXVA 3W2TA 2G0NA 4MINA 3CT4A 1ONOA 2QVZX 5ENVA 3G1TA 1OWMA 4I50F 1SXJA 3DMFA 2HIAA 4ND1A 1T9GR 3C48A 4O2RA 4P82A 5FTJA 5KYGA 5NLLA 3THYB 1IEWA 1EX6A 2Y67A 1F8GA 4EELA 3VR5H 2IKSA 3STXA 3U48A 1WF6A 3MNFA 4GH5A 4MB0A 3Q7QA 4MWEA 4OJTA 1X94A 1GRNA 2PD6A 3AEYA 3GLVA 4RHFA 5DM0A 3UJ9A 1HM5A 5A9RA 1DPGA 4A9AA 4OIMA 3SBXA 5LYJB 4UMVA 2KI5A 3OBBA 3C3AA 1XBTA 1C30B 1K63A 2PLRA 3MTJA 3O5AA 3URMA 1I2CA 1U0TA 1XMSA 1PT6A 4QUGA 5JPIA 3VSBA 1UC5B 2PQMA 1YOBA 4H17A 4NZOA 1JE1A 2B6NA 2BJHA 3EQ2A 3QKSA 4GM0A 5FCDA 3EULA 1YKGA 3VXKA 5SYMA 3PDCA 1JYFA 1AGYA 1AZTA 1JSXA 1QORA 1MLDA 3B9BA 1DWUA 2ZM6B 3LVRE 4V39A 1N6IA 3BZBA 4UPEA 2RIRA 4UE6A 2NN3C 3SHWA 5ITVA 2FRDC 1WR8A 1JAZA 3N8IA 3UAZA 2CLLB 2EXXA 3KVRA 1YK1A 1QH1B 2GT1A 2J3QA 1MAWA 2Y8EA 4NMLA 4M0EA 2UV8A 5BOSA 3KETA 1DXHA 2CVFA 1RBQA 2DC1A 1Q1EA 1R4MB 1G5PA 1TA0A 1ZIXA 1XEWY 3MM4A 3PC3A 4FS3A 4EB8A 3NGMA 1ZP6A 2G9RA 5TQ2B 5IAAA 1YS2X 1UZAA 2BFAA 4JJZA 1IN1A 3DOFA 1YBMA 2BGTA 4HB0A 1THGA 4IM7A 4S2EA 1ICIA 3KQSA 1DUSA 2ZZNA 5IC4A 4B73A 4FGWA 4KOEC 3NDJA 1EMDA 3OBIA 5JCXA 2HWXA 4IGKA 3M3DA 3WGKA 3TCNA 1RACA 2BDUA 2H57A 2LZ0A 4U0JA 3CGWA 1J6UA 3FG9A 4Q47A 1H2FA 3SI7A 3WMFA 1X0XA 3KZOA 5AXBA 2AH5A 2FSHA 2ZCJA 3L7KA 2P30A 3NBZC 4TV9B 2WWGA 3EC7A 3GYBA 3VAYA 4YCNA 5LP6C 4TQAA 4FW8A 3ZWXA 4DBLE 1R64A 2I91A 3A3YA 3GCXA 4QQFA 1L1EA 2PCLA 2AEFA 2O6HA 4XIGS 4HYQA 2JFOA 5LDHA 3K5PA 3OQMA 1HTTA 3TX2A 3N6VA 4KOAA 1C29B 1PDVA 3LRXA 3WNBA 3FWYA 4CLRB 1JHOA 1AVTA 1E7SA 2AR0A 5DM1A 4AK9A 4AJKA 4CN9A 3H18A 1CUAA 3NM6B 4ZJUA 1QKKA 2ZUDA 5HS4A 3NHKA 2I2CA 1AQJA 1QGOA 1TYBE 3DOEA 1IEXA 4TWRA 4A2CA 4QAQA 3TDMA 4D81A 5HRUA 1Z8DA 3B5JA 3FGPA 3TYXA 4MVJM 1X3LA 2JI9A 4M38A 5FOSA 5HIIA 4IJUA 1XMQB 1H4QA 3JYLA 2G07A 5AI6A 1VCHA 1CF2O 2C5EA 2HU2A 1XTTA 2AKEA 4WRRA 4Y3UA 3AOEC 3ELBA 1YZ3A 4MW4A 4PZDA 5JUWA 2FZGA 2PKQO 2X9VA 4X5OA 1P45A 5F1PA 2YMLA 4F5ZA 1OI2A 1A9TA 1K4MA 3TLMA 2K2WA 5J4YA 4JV5B 2VN8A 5JEDA 1RE0A 1Y4SA 1HFKA 2WKSA 4W5HA 1FXSA 1II8A 2YZ2A 3T8YA 4U9UA 3BWBA 3L05A 1J39A 1MQAA 2H0RA 4P6VF 1CR2A 5G0VA 3ZCQA 3PFKA 3M1IA 2J3EA 3OA0A 1SURA 4IIYA 2SECE 1I0LA 5HSGA 2XE7A 4K28A 2YJ4A 1S7GA 1GQRA 3DDWA 4MYHA 5FLYA 4F0JA 4BO1A 2JGFA 1N1EA 4WGGA 2FP4A 5J2TB 2PXCA 5DHSA 5BMVA 4QGFA 4NYJQ 3NC1C 4FEGA 2CFOA 2IEGA 3NIBA 4FX2A 1GAQA 4LPKA 1Q1ZA 1YQEA 4URWR 1E9RA 2BKLA 3FVVA 1W4LA 5PGMA 3IAUA 4PZZA 4UEOA 2PUTA 3CZAA 4G1FA 2R1UA 4MEBA 3PHLA 4C0XA 2HF2A 3QMVA 2ZRCA 5K8IA 3GUCA 2Z98A 4ENSA 4ZI2A 2ISQA 1Z2CA 5I9MA 4I6GA 3SC3A 2LE0A 3MQFA 4FYMA 3IEVA 4R41A 4EA9A 2XZPA 4B2IA 2B4KA 2VJMA 2DEUA 3C1AA 5L3QA 1YU6A 4RLFA 1O94C 2E9SA 4Z4FA 4ZO7A 3DE6X 2QI9C 5HG0A 5HR5A 1Y3FE 3QIAA 4M60A 2C5HA 1ARZA 3CG0A 3FPAA 4MVJF 5IDYA 4HQFA 5EJ6A 2BKAA 1N1MA 3QW2A 4LXIA 3ZQ6A 2FPRA 2C4MA 2IOQA 3HUFA 3HYLA 3ZHVA 4EM6A 4ZOEA 2H4JA 4Z1MD 1X1CA 1BIFA 1WD5A 5JQWA 2C9OA 3B6EA 2ZQYA 3F4LA 1JHRA 3HHEA 5FFNA 2I6TA 3STUA 4BZQA 2VQEB 2CBGA 2WB4A 1IN7A 1O77A 2J0UB 1NYRA 2OD7A 2ZYUX 4XYEA 4KQJA 2PGDA 2GCOA 3LVQE 2I8AA 4H60A 2KPOA 4RPCA 4B6QA 3ZDAA 3ZNQA 1FFCA 3IO3A 4Z0NA 3UCEA 3JYPA 3EPHA 2NSHA 2GILA 3V5NA 1XZDA 4K9QA 3LQKA 2BEWA 4PS0A 4EFMA 2WMDA 5JVDB 5AJTA 3ZHTA 3L1JA 1QB8A 2XTMA 3A4NA 2W8BB 5FQOA 4DDUA 4LZAA 5LXTF 3WBBA 4BRZA 2PZMA 4YRIA 2FXVA 5EZYF 2E4YA 5ICMA 1A8QA 1Z6QA 2JJ8A 2PA3A 2QN1A 2EEZA 4DA9A 4DTCA 5DN6A 3NHUA 5B6PA 5J47A 2WQ6A 2OP0A 1IWOA 5KOHA 4JSTA 4G0PA 4X8OA 3RF7A 3VRHA 1XVVA 3PNSA 5CXQA 2DAPA 1KS2A 1NAHA 1U8CB 5CJPA 2PE5A 1T2UA 2XWQA 4JXZA 4QM6A 3ZI4A 3VDXA 3F3MA 5DB4A 1LV8A 5EUBA 1WL8A 1U0FA 2N0SA 2YN2A 3WP1B 5KOIA 4EGQA 4MUKA 2FZLA 4O59O 4QBTA 5T8KA 5ALHA 5CGZA 1M8FA 4D82A 1DWQA 1KE1A 4YCBA 1X87A 1X1DA 1DT5A 3SXJA 2OBBA 1MDFA 3N7UA 3WXMA 3AIIA 2GCPA 1O3YA 5DP2A 4IFBA 1VXRA 5HKKA 2HK8A 1YQXA 1SK8A 4GLOA 4ZANA 1G9TA 1SOWA 1X7ZB 3LW8A 3FMFA 2GLUA 4EHNA 4H3KB 3QU7A 1CP2A 1DTWB 1YZKA 2ZEJA 2IU0A 3V4OA 4YJ2A 3I2IA 5AKIA 3QVOA 4BNLA 4CQJA 2NU9B 3TMAA 4RTOA 1AQ6A 3ZJTA 1Q7TA 2FSPA 1P31A 1U2DC 3Q5EA 2WRZA 1PBNA 5D85A 3HGTA 3TBFA 3ZCSA 4HRVA 5JNVA 3NONA 4XSHA 1U0EA 5JQGF 4RTNA 1XQVA 4UEKA 4F5DA 1I33A 1TQ4A 3IDSA 1KVTA 3EA0A 2QZPA 4XTRA 5C4GB 3UW3A 4HPWA 1CIPA 2K4MA 2OFPA 2BM8A 4NDNE 2FN9A 2Y1CA 3RYCA 5GQSA 2ERYA 5F52A 5TNXA 3I2JA 3ZE7A 1V7QA 2A4KA 2ZRKA 1T1EA 4B6PA 2PTGA 3E5RA 1NQ5A 1EGVB 2QXTA 3H11B 1ZSVA 4K26A 4YALA 1JQJC 1KH1A 2EV9A 2ZW9A 1MAUA 1QK5A 3JPYA 2OUIA 3K0KA 2I99A 1QIJA 5H1YA 3WFZA 4CM7A 1MZVA 3ESXA 1H0RA 2QPOA 3SPXA 4Y6QA 3TJZA 2B37A 2A5DA 3BPSA 1P9WA 2A5JA 3EVDA 3TAXA 2HMYB 3TVDA 5E2AA 1F9AA 1FDWA 2B8NA 2JHFA 3DW3X 4FBGA 3B89A 3DAPA 5T6BA 8ADHA 3I4FA 2JATA 2H29A 1BMFD 2OCAA 3AKZA 5ERGB 1NBAA 1I7QB 2PS0A 4IJKA 3W1EA 2PT5A 5G0TA 3ZCUA 3QEKA 5FPQA 3KPYA 4KO1S 1KRXA 1OXMA 4MK4A 3WMEA 3DFIA 4AO7A 4EG8A 2OGSA 3D8TA 5AM4A 1GTMA 3C8ZA 3E3MA 2KX7A 3NAZA 2FJUA 4KVGA 2EC5A 1ISGA 1SOVA 3KYDA 3OUTA 4BO7A 4FFBB 3JQGB 3P9CA 4WN3A 1K8YB 1P1CA 1OAOC 5DGIA 5HYVA 4NPCA 1CKEA 4UD2A 4ZV9A 1H85A 1TF5A 2PVPA 4UATA 2V1XA 4KQ1A 1P5JA 4LXGA 4IH1A 3G5AA 4BL5A 2TMDA 4GP7A 5FLKA 4CCWA 5KTMA 4CM1A 5FWNA 2ACEA 2VWGA 4XR4A 2XB2A 1EK0A 5DHAA 2IE8A 3N75A 1ZIDA 4TXNA 3IBTA 4EPWA 3WBKA 1C1DA 4Q6WA 2WJGA 4QC2A 5K3SA 2B2XA 1KSGA 5K6TA 1CF4A 4RGYA 4Q4HA 1QS0A 1B43A 1Z7GA 4N54A 3BDAA 4IV5A 1GZDA 1QMPA 1YDMA 4DMUB 3QFSA 5H7XA 1EEXB 5ALXA 2YC4C 3MAAC 4WXPA 1TMGE 4D9BA 1IHXA 3LUAA 3WC4A 5EXXA 4HGNA 5BSHA 3TR0A 3LKVA 4OM7A 2G5GX 1GYQA 2QP3A 3NRBA 1HZJA 4UQPA 3UJBA 1XD2B 3WLTA 4BKOA 3G68A 3NYWA 5INTA 1XZMA 2I76A 2PK3A 2Z30A 5K8UA 2H31A 3E0QA 2FK8A 3QXXA 4UNNA 2VG8A 5HM8A 1UK6A 5JS7A 3G0BA 1L4UA 2OFXA 1N33B 3I3SR 4II7A 2H54A 4FGKA 2QR3A 2VYFA 1Y9AA 1SBIA 3MINB 4ND2A 1HT2E 1K3TA 4NARA 4U8HA 3ACBA 3GG9A 3UGJA 1JTEA 5JRZA 2ZJYA 1PYDA 1UFQA 5GM1A 1T4CA 1Y1QA 3WOHA 2VZ9A 4LGCA 4F45A 3S1AA 3EC1A 3CRMA 4GL4A 4E7OA 3VTZA 2P9ZA 3GAMA 2KWIA 2XQKA 4N49A 4BOYA 4MQ5A 3EF1A 2QAGB 3JVVA 4Q7JB 5KTSA 2PXXA 1ILEA 1QCYA 5TQJA 1ZM4A 3SY8A 1BQ4A 1DG1G 3T41A 4CIAA 3HBAA 1H3EA 2O52A 4P3OA 2IH4A 3BKWA 3ZVMA 3WSVA 3NHRA 1R5JA 3CF2A 3KIPA 4HDOB 1BHSA 1M6WA 3FETA 1NJ2A 4JASB 5AKGA 5T4BA 3VO2A 5K20A 1DAIA 2FG6C 3I52A 2H1SA 3OA2A 3AU8A 5ER9A 4AMGA 2O2GA 5DH9A 4D0GA 1G1MA 4DUPA 3BZUA 2VP6A 2X40A 4X93A 4JR2A 4LK3A 1Z2PX 2H51A 4M36A 4BVHA 1M1NA 3D8BA 3AETB 1PF7E 1V9LA 1V5EA 3AMVA 4FT4A 4YWHA 1ULUA 1HDXA 1KWGA 4YGXB 1LB1B 3VR3A 5LD2C 1N5MA 1BGVA 3V42A 1UL1X 4ARCA 4XGIA 4N40A 1G17A 1YKFA 4I4IA 1F9EA 4CETA 4Q3LA 5IK2A 5FF9A 2XVMA 3U3DA 4KWIA 3MS7A 1J2RA 3IKVA 4TLLB 3S2FA 1K9SA 1RYZA 5CW1A 4AJIA 3RSSA 3U6BA 3MB8A 4GMXA 4EW3A 2EKDA 3HKEA 1OASA 4Q7KA 4EF6A 1NXWA 1MP0A 2EQBA 3LPAA 4YYEA 1KJ9A 2XMSA 4L6CA 4MO2A 4J76A 3MWYW 4PVCA 5PNTA 1H0SA 3O3CA 3N58A 4FFRA 2BTQB 1Y8QB 2PRYA 1A5SB 1F14A 1N1DA 1E2JA 4UCQA 4C4OA 3WL6A 2XITA 1A4UA 2DERA 3HEMA 3Q87B 3VZDA 4M54A 4AMUA 7ADHA 3G85A 1ZIOA 1UWVA 1DOZA 1JDUA 4S24A 1G5IA 3UJCA 3W8DA 4LXTA 1ABBA 3FUUA 5CLGA 3OIYA 2R79A 3WNQA 4X65B 1T4BA 2B4TO 1R0YA 3LUKA 2P91A 4OB6A 3EPRA 4OQXA 4ZTZB 3LDUA 1IFXA 4ZYZA 1YZYA 1D1PA 1OTXA 3KALA 4OXXA 4WNYA 1JJVA 5FPSA 2OLEA 2Q2NA 2Q3DA 1E9DA 4HX9A 1TF7A 2A33A 5DP1A 4A4DA 4EK9A 1KS9A 2CNOA 4C6TB 3C14C 1IXRC 2MDTA 3ND8A 4E5YA 1RZRD 4KFCA 1R7RA 1UPXA 1BW9B 2LDBA 4P86A 4RHEA 4CL2A 1AHPA 4IICA 5M7EA 3IP3A 4ABYA 4NBKA 4RGQA 5KWSA 3G02A 2BBSA 5KYNA 1LK7A 1VPLA 2XHZA 4WK0B 1R0CA 3W8FA 2I4LA 4QUEA 2JAOA 1FFGA 1LBHA 2WOOA 2ZG6A 3X2SA 3U5ZB 5TR9A 1SNYA 1GRQA 2NO6A 3VPFA 5ALZA 2PL3A 2WT9A 2GEBA 4UDYX 4QQNA 1STOA 2FG5A 5KNLA 3P27A 4R6XA 2ID9A 3HA2A 5D6NA 1OLOA 4I4TB 4NKRA 4HB4A 5FBVB 4GYYA 4LJLA 4GKBA 3CVOA 4IYRA 4ZOLA 5LZ4A 2YUTA 3T54A 3VJLA 2G7ZA 1SCUB 2EJTA 4TTTS 3IJRA 2IYVA 2OLJA 4ZK6A 2H4YA 4YRSA 3DTVB 3ZGZA 1R27A 5FTLA 4GSKA 4FSHA 4HN4B 3TUIC 3D6UA 2WJIA 3GFFA 1LNZA 3HWSA 1PVOA 3ZPXA 5CDYA 2BGJA 4KE9A 2FSVA 1PD1A 2ID7A 2PT9A 3EVNA 4ENTA 4OUDA 5K8TA 5AJXA 3ZY4A 3QX3A 1SBTA 3TS1A 3M1AA 1UXOA 3E4DA 2DWUA 1CS4C 4IJMA 4QQ8A 3SCZA 3TGPA 1YVUA 4IWXA 3LHKA 3G2PA 3RNLA 4BAZA 3OZUA 3KKQA 4OHZA 1NW3A 5JZ9A 1IJKA 4E6EA 1A2OA 2IXEA 3CUYA 3EMKA 4ROSA 1WX1A 2VNAA 1NW7A 2HMSA 1J9EA 4K3UA 3UB2A 5ITSA 4Q3OA 1WXWA 3HA3A 3R0JA 2G70A 1E4VA 3LT2A 1GKKA 1CR6A 1TK2A 2BFPA 2CXSA 2G40A 3HBJA 1C4OA 4RKQA 3UXYA 2ZVQX 3DQQA 1QZXA 3QX9A 10MHA 3EBOA 4B3DA 5BY2A 1KJWA 2CB0A 3L4JA 4QECA 4AD8A 2IDJA 4RD4A 3GB9A 3GRKA 3GZJA 3RB8A 1RS0A 4ND8A 5F7OA 3D3QA 4D80A 4S12A 4INAA 1OHHD 3PIDA 5CFRA 4PZEA 2VUHB 3ZHQA 2XD4A 3OZDA 3LUCA 1D4FA 4S04A 1T5DX 1VJTA 2Q46A 3AG6A 2BHLA 2PPLA 3I4LA 4JOCA 3VMFA 3ZDCA 2YBDA 1AXEA 3AHJA 3ZHZA 3HUEA 3LO5A 1M73E 1M1YA 2JGAA 2I5PO 4LYDA 3TD6A 4ITRC 1XQWA 5ESWA 3RRJA 1WCV1 1W30A 4UUQA 1GT6A 2ABWA 4IZ6A 4C20A 2IEZA 4QYSA 1QRTA 2ZJ3A 4QSHA 4CDGA 1ZN2A 4LZZA 1KY2A 4R4JA 2C58A 3LYHA 4X9XA 3OQHA 2XCSB 4UHDA 4B7AA 2JA1A 1M67A 3CLRC 3F3SA 2P7HA 3AP2A 2H65A 2H08A 1K08A 1DKQA 1P2DA 3PCRB 3KT6A 3MTEA 4H1TA 4QUAA 5HTOA 1EXDA 4W1SA 3I8XA 1NQOA 4G8CA 4HS4A 1FTGA 5E6SA 2VVTA 1M8GA 4R01A 3TLCA 1LVHA 1UDAA 4C4AA 3RRMA 3FFXA 1W8IA 2EBUA 4NXMB 4S1NA 3IJ5A 2QT9A 2RAVA 3WFJA 3AIOA 5KNCD 1M7GA 3MQ4A 3P94A 4N12A 4QRDA 4YHBA 5TS3A 3RFFA 1CEXA 4O08A 1QTRA 2V8BA 4E09A 3ONNA 4JL5A 5IP5A 5JMOA 2NTYC 3RFXA 4HXYA 1QMGA 1UKZA 1YHZA 1EK6A 3E84A 5EJMA 1UBGA 3E7PA 4ZU6X 1RJDA 2XKBA 5HF9A 3FYTA 3ZD9A 5LQDA 2ZT7A 3IAEA 3SYKA 3MSCA 3RJTA 2XDWA 3AVWA 2FV8A 4QAJA 5I7VA 1OOEA 5K4HA 4I55B 4F7WA 1A9QA 3UMBA 1SWVA 1YQUA 1OGJA 2V4ZA 4YFVA 4BO2A 2D1TA 1LRLA 3QPAA 4LPSA 1GKIA 3EIFA 2TMGA 4RGVA 3HJNA 4U8GA 1H2HA 5KSYA 3CUKA 1V95A 3FJOA 1CUGA 1KAMA 1Q44A 4GGOA 1ID8A 2AT1A 1MZPA 1PQ4A 2ZSEA 2DFLA 3H05A 4OMCA 1P4RA 1D5WA 5JASA 4V0ME 2OYSA 2V54A 4C07A 5P21A 1X42A 3AR3A 6PFKA 3BUSA 3A3KA 5HS6A 1L7RA 3AK4A 4MW9A 3QWIA 2ZYRA 2PL5A 1VSQA 1JR3A 1T5LA 1WE2A 2LKDA 1TE2A 3D3EA 4X6LA 3RAPR 5K9ZA 3X44A 2V45A 2X3FA 1OLXA 3DMNA 2B5VA 3HDQA 8MHTA 1P39A 2OD9A 3DB2A 3WL5A 2XRZA 1OKKD 3N3BC 5H02A 3CYFA 2NYAA 1NHGA 5BMOA 4PZUA 1LGYA 1T6BY 1P3DA 4H9GA 4PR0A 4DPKA 4OATA 1WIWA 5FUQA 2J0SA 4OXYA 1G3MA 3ETGA 4D92A 3HVUA 3Q2IA 3FDFA 1USWA 1LRJA 3BWDD 1L5GB 3ZHSA 2JS7A 4KV9A 4MS3A 4YFYA 3O21A 4IH9A 1KZ4A 3LOQA 5KPJA 2LKCA 2E55A 2IU6A 2HMAA 2OAQ1 3DKPA 4MKIA 4BNMA 1F1BA 1OBCA 1D07A 1R0LA 4HYYA 1PQWA 1I01A 3GH3A 4EMUA 2IVFA 1DKPA 1HI9A 2B1IA 3KQTA 3MK31 4YA6A 4Y1RA 5HOEA 4RS3A 3AZQA 2E18A 3I0NA 1G2IA 1UANA 4JLDA 4DJFC 1W36C 3FH0A 3WFIA 1KZ9A 2F3QA 1RKVA 3VUFA 1F0PA 1VKJA 4PG8A 1Y81A 4IQ4A 1OGIA 3JQCA 3H5RA 1I2DA 4C7XA 1CEEA 4QU9A 4R68A 2XBUA 4H15A 1I2MA 1E3WA 2HRRA 3O4HA 1GU7A 5TX7A 5KJFA 5LKAA 5J4KA 5JZBA 3OIVA 1P5ZB 1EP3B 5A9SA 1OB2A 4IFEA 4J0GA 3UC9A 2CN1A 3MCTA 4H1WA 3TSOA 4RY9A 3NH6A 2JNWA 3IDZA 4YRQA 2C8JA 3TG8A 1VDMA 2NUTA 1T0IA 2JLVA 1OFUA 1TZ2A 1XZFA 3SG0A 3L8DA 3QA9A 4U5XA 3PIRA 3C6BA 3REGA 3GGCA 4UAJA 1E7YA 2XYHA 4NP6A 4B81A 1F48A 4RQUA 3KDAA 2A0FA 4D8WA 5DI3B 1ZM9A 1J49A 2DUUA 2IYUA 3A27A 2YY6A 4Q9HA 4KLZA 4QHYA 1RYDA 2GFQA 2GM4A 4URXR 3DOHA 3P9RA 3HCAA 3KB2A 3L4BA 4L72A 3CY6A 2ZM5A 1US8B 1GGKA 4HDRA 4MQFA 3ZTTA 2G88A 3NB0A 4PF1A 3VPCA 4M1ZA 3BE6A 1WMDA 1PTKA 4X6YA 1YQ9A 3H83A 2WFZA 2V3VA 1SOAA 2Z2IA 3S5JA 2GJAA 1U4NA 2NZUG 2I3DA 4I8IA 3CNBA 3JY6A 2GPBA 3RHTA 2XQJA 1Y9DA 2BH2A 1ZLYA 2O19A 4DY6A 3IRUA 1BJKA 1E6WA 1M2GA 3DBRB 3OIGA 2ERCA 4NYIQ 4CMIA 4Z4HA 2P4UA 3M81A 2A4MA 2VF4X 3OE7D 5F9FA 2VUSA 1NG9A 1JW9B 4O2AB 1QYDA 2GR9A 5U4QA 1T43A 1YE3A 1XPUA 1PJLA 1HF3A 2I0FA 4MRRA 3R4CA 1U4SA 2CNWD 4XYMA 4IF4A 5DSTA 1G63A 4DXAA 2XXAA 5TGZA 1QYIA 4GHWA 3PQEA 2V55B 5KKAA 5BWNA 1A8IA 3OF3A 2PBLA 2QVLA 3I72A 2FNAA 2FMKA 3W7BA 2A14A 4FQ7A 2NOAA 4WFIA 3UUWA 4MAAA 4KXYA 2EHJA 2NNLD 1OX4A 4A0SA 8LDHA 1DUVG 4K9DA 2FK7A 4YNBA 5A4MS 4FTWA 5KVVA 3KE8A 3DE1X 3QW4B 3NOXA 3S8EA 1XZPA 2J07A 3K0BA 1E1QD 2ZWIA 2GX6A 4JI8B 4GECA 3OPYI 4AZTA 4DJAA 1ZKMA 1X74A 4FXPA 5LPNA 1RVDA 4QBGB 3BYZA 3QI7A 4HQ0A 4RENA 3ZDXB 2O8BB 1UPTA 3UJ6A 4PX2A 2DR2A 1DEOA 2YV2A 4URFA 5FI0B 4E07A 3VDNB 3GIDA 2QY6A 1B15A 2CFRA 1MENA 2QB5A 4BFXA 1E66A 1JDVA 3LPMA 3GXBA 3IDFA 3LHDA 4JJAA 3JQBC 1FTQA 3OLVA 2AYZA 3P45A 4DLBA 5JI3E 4OQNA 2YWHA 4LYGA 4IRXA 2VJOA 4ANFA 3EASA 1X80B 3G0HA 4S1PA 3B8HA 4KQWA 2IFTA 3IEKA 3QPDA 1NRJB 1B16A 1TJNA 2JLCA 2Z56A 3MOSA 1A9ZA 3CMMA 3TFQA 3MLAA 3UJ8A 2DYKA 1JLHA 4FN5A 1ZUHA 3GRPA 2QDKA 5GMOA 4LI0A 4G4JA 5TRTA 1AHHA 4CWAA 1O95D 4IVQA 3I01M 3T5AA 4UM9B 3MT7A 3E9RA 3JYQA 2QUZA 2ZROA 4JVNA 1GZ5A 3IULA 2E89A 1XJ0A 1X2EA 2Q5LA 5J2UF 3O9ZA 4JJ6A 4BJ5A 1N34B 2V65A 1C7JA 3ESDA 5JWRA 2VC2B 1CPYA 4W82A 1ESNA 2DT8A 3OHPA 2NSDA 2J3JA 5A6SA 4EQ6B 2R8XA 1KI3A 4R71A 3PKJA 3FMGA 4RSRA 5FL7D 4F5YA 5AK5A 2F1RA 4ZGGA 1A0OA 1I3MA 3NHFA 1GSHA 1T1JA 4TUYB 1Z63A 1KA9H 5K03A 1Y37A 2FDRA 1DXYA 2ZBGA 5EC8A 4FZ5A 2GZ3A 1XTUA 4G65A 2VP5A 1LA2A 1VI2A 3SNHA 3DMTC 3FBTA 5BSFA 2ZVDA 2RBKA 3DJYA 4NZ9A 2Q5JA 1HQKA 1RCTE 2NZJA 3SR0A 1M2HA 3ZHCA 1D3AA 1U1GA 4RVNA 4ZVKA 3GVIA 5D2CA 3IO5A 4EG6A 4WH0A 1MABB 2E5LB 2HH9A 2YTZA 3V8RA 3UWSA 2XAAA 1OA1A 1DBIA 2NTVA 2V7VA 2XUAA 5B1IA 3DDOA 1YVDA 3OCVA 4LOJA 4Q39A 5AVQA 1Z8NA 1HLGA 2Q0QA 2KJQA 3IB6A 3KTDA 2XW6A 4K3VA 4EGSA 3PJEA 3UAVA 1JX6A 4Q01A 1HNNA 3CWZA 2Q3BA 4CIVA 4GVPA 4NAHA 4NFSA 3QZUA 3T1NA 2O2HA 2XDQB 3FJ1A 5CDTA 1EZ4A 1GPBA 3KOZA 5JFGA 1UOEA 4BKRA 2OO3A 3OD5A 5I8PA 4FM9A 3PUJA 2WF5A 2XMQA 3ABRB 2E49A 1GPJA 3SR3A 4L85A 5SY9A 3F6EX 4V0OA 4P35A 3WKBA 3BMNB 2JEZA 4C3UA 1GV1A 4TROA 1J07A 1JU9A 2OAGA 3FDZB 3Q9LA 4MA5A 1QU2A 4F4FA 2VHZA 5LMCA 4BASA 2VDKB 3D59A 1TUBA 3ZI0A 1W44A 3FGNA 5A2GA 5KQMA 2NYRA 2IJGX 5EAIA 1KAQA 5GPBA 3WGZA 3ZS8A 4NEQA 3ZY2A 3F97A 3RWBA 1TAHA 3LBHA 4KSBA 1L4BA 1H2XA 3DULA 3FVQA 1A8SA 2QR2A 1YVPA 4RK0A 4D4KA 4EG7A 1PFQA 2VPQA 3NPMA 3F7MA 3TSYA 4OH7A 1INLA 2I22A 1E2BA 3WAGA 1TRKA 2JLWA 2G4LA 3F8SA 5KU1A 4GBMA 4JBNA 3ZD8A 2Q8NA 3GZNA 4DWVA 4G0QA 4LBWA 4MSUA 5REQB 1WLSA 3W2FA 1DZ3A 3WGLA 4AMYA 2I62A 4RIIA 5I7UA 1RHQA 3K92A 3UMGA 2O06A 3EWIA 5HPYB 1RHMA 4EX6A 1WCYA 4BNDA 1QB7A 1RHUA 1KWKA 2ONYA 2C84A 2AQHA 1TDJA 2O2SA 4WE3A 4M9CA 1PWXA 2ZJBA 1VIYA 3TW6A 4YIKA 5JBQA 5MN4A 4JI0B 1FW8A 4L5BA 4MR7A 4HLUA 4P3XA 3W5UA 4M0FA 1D2MA 1WVIA 1WOYA 2R8ZA 1NJ6A 3ICWA 4JGGA 1UPUA 2X0DA 5F12A 3P9QA 4RK1A 5GADl 3TOVA 1U8UA 1EFVB 1W6UA 2UXCB 2FR8A 1ZEJA 3NOVA 4WZ6A 1UEIA 4HI0E 1ZRHA 2O3SA 4ASUD 3FCYA 4CLOA 4HOYA 3GJ0A 2XF2A 4PN7A 2ETVA 3VNRA 5CD9A 4Z99A 1FMLA 1UDRA 4YLYA 3ROQA 1DKUA 2OTCA 2JDIA 2PZEA 2QMYA 2X1MA 3IESA 4IEIA 5H4HA 3OX1A 4H16A 3WIVA 1T29A 1EVEA 1MH9A 2DWOA 3VU1A 3WMXA 4A2PA 2HK6A 2Y05A 3D0RA 3EGIA 3KZKA 4G01B 3RIYA 5JAQA 3RT9A 3ABIA 4DA6A 2FGKA 1C2TA 2F7SA 3GU3A 4RAQA 4U6SA 4CXMA 1GKLA 1XTVA 2IOFA 3K15A 2PYIA 3OQBA 5JEEA 4GPIB 1Z07A 3MWJA 3P26A 1R6AA 3BGSA 4JSRA 3CX6A 3G9TA 4QG7A 4BGUA 3T61A 4ALJA 4FYYA 4ZGBA 4YAJA 3OSUA 5LCXA 2NVUB 2WAOA 5YASA 4G1BA 2P4HX 2CEAA 1IG3A 3C4JA 4P7GA 4QX6A 4X44A 4XOUA 5TXGA 1VTKA 1I1OA 3RU2A 5D5PA 5IULC 1E0DA 1GCIA 2BKXA 3IP7A 2H7VA 1XVIA 1IZ7A 4LF4B 5LIRA 3CCBA 2ZSKA 3JAKB 1VIAA 2E48A 2OCXA 2WJWA 4HUQB 4CKCA 2AJCA 5HKBA 1RWQA 3FZEA 3KRTA 4WVLA 3OJFA 1HNWB 3PUVA 1W4ZA 4FI3F 1S2IA 3CRRA 1MC4A 3S29A 5SZHB 2I2BA 4OV6B 5B1DA 4IYJA 4C5AA 3CNNA 1KI2A 3AR2A 3TLEA 1Q1GA 4F4DA 4IXMA 1LX6A 4GMKA 4J6EA 4DR7B 2WINI 2VNKA 3LDFA 1NN1A 1ISFA 2FUEA 3NHSA 2Q3HA 4EAAA 2EZTA 3WL8A 1L3BA 3W3AA 2WT4A 5KNDA 5LUAA 3SICE 3MWEA 5ERXA 2Z43A 1DAPA 5AUOB 3PKZA 3BL5A 4ZI7F 3DGEC 3DTVD 2FEOA 2EATA 2GJKA 3NDIA 4P3KA 5DSXA 1O96A 3LCVB 1KRHA 3M6AA 4XJSA 3K0FA 3PNKA 5FKJA 3QYFA 3ZZNA 1XZLA 1NONA 1ZNZA 2AJTA 3ZDEA 1GDHA 4KMRA 4EW1A 4F9EA 4KAFA 3RVJA 2VPZA 1DCTA 2AC7A 1RWBA 4JUBA 3R7LA 3WK7A 4K0RA 1TTTA 2RGNC 4F9GA 2C2XA 2L42A 2XVXA 3R6WA 4GXRA 4ZQEA 5AVXA 3AWDA 5JXWA 3KUKA 5EJEA 4PPFA 2IYOA 5HMMA 2JAPA 2P4QA 4OPMA 1YXMA 4A8JA 3B1VA 3B1WA 4DMGA 5A3JA 4RO0A 3FDXA 4FD2A 4O2BF 1T2EA 5E1BA 2JIDA 2FF7A 4IDDA 2M6RA 3U81A 3GLFB 2VPWA 2Y93A 4P0QB 3HB9A 5HCNA 3YASA 2KSQA 3QUBA 4D99A 2ZYSA 4JI4B 3GJXC 3VR4H 4EEZA 1UWLA 5B30A 4RADA 1UJ2A 2H4FA 1NR5A 1XA0A 2RHMA 2EWVA 3W5JA 4AY2A 2A84A 1GAWA 3I30X 3V8PA 1WMEA 2A9PA 3SJ7A 4N18A 1UKBA 2AZDA 2WP8J 4LA4A 4CKEB 1J0AA 1JJBA 5IX8A 4V0KA 3SDZA 3IE0A 3OWOA 3IEUA 5I7RA 1RWXA 1FX1A 1AQYA 1U2GA 1FQJA 3R2JA 4N65A 4NXNB 2G1JA 2RMKA 4IIDA 2X15A 2QRZA 1CCWA 1GTL1 1P0PA 1M33A 1Q21A 3SNKA 3K7EA 4J1TA 3FN4A 3SHOA 4WBSA 2HA0A 4OAQA 3IOEA 4KXNA 1PJQA 3R9XA 2FOXA 4QPJC 1OBVA 5FXMA 4G85A 2RK4A 3IIKA 3IIIA 2PH5A 2YV5A 3IV6A 1DIHA 3FPBA 1RYYA 3WLSA 1UJ5A 1Z47A 4PICA 1E0AA 2F1IA 3BE5A 3FSEA 3S2EA 3E23A 4MULA 4X3OA 4JGIA 3K9HA 4EUSA 3KBBA 4CQMB 3KSZO 3KDSE 4EFDA 2YXEA 3ILHA 3IRVA 3OPYA 4JQOA 4K9KA 3TQHA 1MXHA 4DCCA 4RTSA 5JLAA 3THXA 3PR2B 4FDTA 4XQGA 5L3RA 4MWGA 1TEHA 4BFWA 1TVKB 1CETA 3V32A 1YAJA 1IVNA 1AE1A 2GB4A 1UZMA 4GVLA 4YV2A 1CE8A 4OJYA 1A9SA 3H6KA 3IR5A 4P7KA 2R4QA 2QE7D 4FFPA 4NSNA 3JWJA 1MV8A 3AB3A 2QPTA 4P2BA 5DISB 5G3ZA 4YX9A 2OFFA 2IPMA 1Q3KA 3RUFA 2DECA 2G4VA 4S3MA 3I09A 3R3WA 1YH3A 3VR6H 4KXLA 4XYLA 1JHMA 2C04A 4I3FA 4XYBA 1QZZA 4BFTA 2MINB 5KTNA 2AMFA 3WYAA 3TVYA 3ZZUA 2XMRA 4HGYA 4P5EA 5FWXB 3CBQA 1YFKA 4G84A 5CA0B 1D2NA 3WLEA 2OO5C 3MMZA 3NJ8A 1JQAA 3OOJA 4DUGD 5J4HA 4F1KA 4LDRA 4WFJA 1UMBB 1SBQA 5F9HA 1GV0A 4PLVA 1P0IA 4C05A 1JVNA 5C52B 1VOTA 1AC5A 1CY1A 1ADGA 4R1LA 5AJYA 2NU8A 4CMKA 1USGA 2OXEA 4BYGA 5ER6A 3UHFA 4P81A 1SZJG 1M66A 3OZBA 4LRWA 3CVWA 2QT0A 5KOYA 2JGMA 1ITZA 4FGLA 4C30A 5CLLA 4AJLA 4IGIA 1YMVA 2IHTA 2I6SA 2PFSA 2YV4A 4UHEA 3I92A 2QL6A 1XUOA 2JH8A 1EVYA 2QN6A 4QQRA 4U39A 3C3EA 3HS3A 3AHEA 2ZUVA 1G21A 3T9CA 4ATNA 4NF2A 1QZUA 1NG1A 4HNRA 4NEHB 4WCDA 2XB4A 3TKYA 4DA0A 2HF8A 4MPPA 5B3JC 4X92A 4FDAA 1H6DA 2PUDA 4B3XA 4BB5A 4BGDA 1CR4A 1AT1A 3D43A 4X3CA 3IGFA 1FP1D 1HE1C 3AWIA 5IABA 3EIUA 4BVKA 5I47A 4NPHA 2QX6A 3OMXA 4DR4B 4Y9SA 5AJZA 2RGCA 4WWHA 3U4CA 5JNTA 3H2IA 2CNDA 5FPHA 4UHKA 2VJPA 4BIMA 1FLDA 3WY9A 2Z8YA 3ZNPA 4ZMSA 1TVEA 4HAWA 4Q9IA 1TCAA 2HSJA 4H27A 2Z8ZA 4XEUA 2FHPA 4ZVOA 5CMLA 1UKEA 5E7JA 4YO7A 4NE7A 5K0LA 5BUSA 1FDVA 1POWA 1FZTA 2X5JO 4ZT2A 1MF7A 5I9TA 4KAXA 4MTLA 5F2OA 1OMOA 1TPYA 4C88A 5KTOA 1AMUA 2BDTA 3NI2A 5DN9A 1M5UA 2VXBA 3JQAB 4KH1A 4AJEA 4FBLA 4PLCA 2ZAIA 1T3GA 1W25A 2X7HA 1YU9A 4IDAA 1YQGA 4B5LA 2V7XA 4BV2A 4ZI7B 4WBNF 1KI6B 4B0PA 4F91B 4O02B 5DRYA 4KACA 3L1KA 3SKVA 3S81A 2VIIA 1T9GS 4PYRA 1ZRSA 5JHGB 1N2CA 1I3CA 1Z06A 4K9OA 3WLIA 5LIPA 5CT9A 3NBYC 4U6NA 4CMEC 1U2PA 3GLUA 1L6RA 3E03A 3P2YA 4CIBA 4DKJA 2PZLA 3B1FA 4ZVUA 5AICA 1JLLA 4HNAA 1CV2A 1KETA 2JCXA 3BHIA 4L8WB 4YMLA 5E9AA 3IUNA 1QNLA 3HCWA 4H4EA 1RVV1 3IIEA 5G2OA 2QUIA 4ZC8A 3T06B 1RI4A 3DZHA 3ON5A 4PHGA 4Y6RA 1GPNA 2PAFA 1I7PA 1XWIA 2XOKA 1ZH0A 4WASA 2IUFA 3H7IA 4FCCA 2X8JA 3EPKA 1P4AA 3FNGA 5GZ6A 5H0IA 1ZK4A 4JP8A 3R74A 1JKXA 1Z74A 1TK9A 3EGDB 2J6IA 4NX2A 3GVCA 1RT9A 2RK6A 2DQ4A 4N4AA 1SVSA 1A4XA 4KQ6A 1Q14A 2OKCA 3V6MA 2DBYA 2WW8A 2EKZA 3TFOA 4GZ5A 2PL1A 1Q92A 4KQXA 5ECWA 3M6WA 4C7OB 4LVUA 2OMKA 4AX8A 1XNQB 2GD6A 1FDSA 4YK7A 1ZMTA 2BHSA 1U65A 2QJTA 3D3WA 2ATIA 1YCGA 3UFXB 1HG0A 4W7HA 4YCDA 3W8RA 1PYOA 2WY2D 1GR1A 3QPCA 3WLJA 2A1IA 3NEPX 2JD1A 2GXAA 5EEGA 4FX5A 4OP3A 3HV0A 1JBKA 4LCBA 4BQIA 1D0SA 1Y8RA 2RGDA 3GF4A 3H8SA 3AQ4A 3LI2A 4UFOA 3Q6MA 4LGYA 5CNMA 1DV1A 4JEUA 1VSUA 4GGMX 4WY8A 4YRMA 4NENB 4MAMA 5CFLA 1CVIA 3GEIA 1NSYA 2UZAA 4TRRA 4C0AC 3DR5A 2R62A 4HDKA 2B7BA 2ZJFA 4HWGA 1JDZA 2FPIA 3QVKA 2B3TA 1S89A 2ZPTX 1KHHA 3IUJA 1ULTA 3QE4A 4KI0A 1UDBA 3BB1A 2XTNA 3L0YA 2D5CA 1AKRA 4JT8A 1AM4D 2JLQA 4Z0TA 3CNHA 1WV0A 1G291 2EKPA 1L7AA 2J6BA 4AJHA 5CBPB 3S28A 4XB2A 4QWWA 4XVCA 7MDHA 2IL1A 3JARB 1E32A 1MX5A 2OBFA 1C9EA 4YACA 1L7PA 1GLGA 4PX3A 1IZ9A 3UCXA 3KVYA 4EAQA 4UM7A 3BB3A 2PU7A 3GDHA 5KSZA 3OTWA 4G4SO 2W2MA 1MB2A 1PGOA 5T3YA 3A9CA 5EJ5A 2DBQA 3OJEA 3EFOB 3MWDA 4QU5A 5CAEA 2GCNA 2BM9A 4MRMB 4QJ5A 1EHIA 2CWWA 1A5AB 2QMUA 4O5OA 1S02A 2Y76A 4G0ZA 4BLOA 2XH8A 3EZNA 1TM3E 1ZVKA 3MCUA 1QRDA 3I28A 3HJHA 2YHIA 1JECA 1OWOA 1P77A 3QWAA 3H3JA 4PSKA 3QWBA 5E4FA 1U1EA 2TRSB 1Q20A 5FO1A 3VJKA 2RK3A 1P7PA 5CDGA 3J7AC 1K06A 5BXYA 3ZKWB 1LDEA 1K7CA 2BHNA 3QF4B 1N7HA 1PJ2A 2OORA 3GYGA 4B31A 1NN3A 2BN4A 2MYNA 2H1CA 1EX1A 3N0XA 5LVAA 4RK7A 4ZCPA 4DDTA 4F8YA 2BKUA 3TJMA 1Y6ZA 3CZCA 4BP1A 1YJAA 1AO3A 4O25A 3JSXA 1SXPA 4WL0A 1L5HA 3OAAD 3RBXA 2GAOA 3G2HA 2OXTA 4HJXA 4RETA 5I4BA 5LL6P 4PSVA 3L01A 3RJ9A 4ARAA 3NTUA 1YDWA 3OO1A 3UJHA 1ECBA 2WC1A 2RGYA 4ED9A 3KKLA 5JDIC 2WICA 3OY7A 5EQDA 3FCAA 4ZXPA 4G5FA 1DTSA 4UM9D 5LD2B 2BW0A 2VCHA 2REQA 4X1OA 1PZEA 3C5CA 4I1IA 5C7IO 2CVQA 3X2FA 4O3MA 2XNJA 4Y2GA 3TBKA 4A10A 2JB9A 2CDNA 1KXZA 1XA4A 3D3KA 1CUHA 3C6XA 2ZPAA 2CJYA 3DE7X 4NMWA 2D74A 3ISVA 3AF4A 3FFTA 5DYGA 3BRQA 3H8JA 1KH2A 3K4QA 3KUUA 2FZCA 5CP8A 3ZW7A 4CV1A 1FYFA 4K9NA 4KE6A 2FPKA 1KJNA 3OKAA 1TEXA 2FSGA 3OSZA 1BE1A 4MVYA 3HO1A 5IJZA 2QZ9A 3ZS9A 1QVZA 3AFGA 3F5MA 3OH8A 3P97A 4I50B 4W9NC 4WZBE 5FFMA 5AKJA 3R76A 2EHDA 1UXIA 3KB1A 1K92A 2AMVA 2C4KA 2ZBVA 3BSYA 1AUQA 4M0DA 3WSTA 4JLBA 4PQEA 3A4IA 4EUEA 5KKCA 2QSUA 4HEA1 2FW8A 5AFSA 4ODIA 2VFAA 3H2GA 4WI1A 3UIEA 1E9VA 3VC1A 1VBMA 2RB4A 3QTTA 2WJVA 2YW9A 4JQYA 1PN3A 3L5KA 1L4MA 5FYDA 4CM6A 2ENUA 4DSAA 3VTKA 1JR2A 2FEPA 5LBIA 4YR7A 2ZIGA 2ZJ2A 2QG9A 3NNSA 2XWBF 2YVKA 4XB6B 3LWDA 2KW5A 3KJNA 1X6VA 2CUZA 1YIDA 3JQ9C 2H5EA 4LGVA 5DHPA 4ZVLA 3RC9A 3RS8A 4PGGA 2EZ9A 3BFXA 1VE6A 2YVUA 2Z3VA 3R0IA 4QVKA 2DHEA 2UZ0A 4ZZ0A 3JRNA 3PHJA 1OXUA 5ALUA 5F7JA 3ETDA 3O9VA 3ZWKA 3HB4X 3BXGA 3HVHA 3TLXA 1BEUB 1IRIA 1RMQA 4LY0A 5EJAA 2I7DA 3CZRA 4AYTA 3QPVA 1EVQA 4A8TA 1SG0A 3LBIA 5DTEA 4E70A 1JQDA 1NN5A 4AJ9A 1Y34E 2F90A 1VLHA 4BB6A 1VKRA 3MWKA 2V7UA 6REQA 3S27A 5NULA 3MC1A 1LPOA 2R7AA 3ESBA 1UT5A 3QM1A 3HCCA 4N39A 4MYUA 4IF6A 1JIQA 2DLNA 3BH7A 4MV5A 4WPGA 1KEEA 4LZPA 3U4HA 1LNQA 3F6SA 1CQIB 3W6OA 1H1LA 1R0BA 4IJ6A 4JJEA 1MVOA 4GRAA 3U5TA 4RH1A 4B3TB 1N6LA 7REQA 1T6XA 1AHNA 1EM6A 2COKA 1OPXA 1QGED 2CL0X 2XMZA 5DJ5A 3OQIA 5DBEX 1EWVA 3AXTA 4Q1BA 2RH9B 3GEEA 5AKZA 3SS9X 1HYHA 1SVKA 3JYHA 4NYMQ 4CLDA 3O0DA 4Q93A 4FI3C 3KU1A 4MHOA 2I4OA 2WWYA 3ZV3A 4O3FA 1L5WA 2O7NA 4RACA 1GL6A 3ONEA 4GUDA 4WY2A 4IIGA 3S5UA 3Q40A 3WGNA 1WXGA 4YCJA 4EEKA 2AMLA 5TEWA 5K99A 4IXDA 3RKUA 2ZS9A 4QUIA 4FVTA 4MR9B 5JNUA 2PTHA 4ZZ2A 1HLPA 1FMCA 1QP7A 1TO2E 5JT1A 1R5NA 3OP4A 4H4DA 1WOMA 1VM6A 4P3PA 3G6KA 3FUTA 2O4CA 3O93A 2G1KA 2ARKA 4ZYLA 2AC2A 4M2LA 3ESRA 2F4VB 1J2TA 3N76A 4IHKA 4LY3A 3VBEA 3X2EA 1Z45A 1RQXA 5BQXA 4O4IA 5C1PA 3FRHA 5AIBA 4AZ3B 4L5IA 4I4CA 4YGYA 1AUXA 2BGLA 2DFTA 2Y1FA 2WQ7A 2AX3A 3RTDA 3EG5A 1KFEB 1MB9A 2WTBA 1RRFA 4NJMA 3LX6A 4RBNA 1PVVA 2W2OA 3ETCA 3OJXA 4URYR 1V26A 2YJ6A 3ROZA 4G25A 1RMTA 5FA8A 1XHEA 1WB6A 3OUZA 4NCIA 2CHQA 5BNTA 2AFIB 4CFZA 4Z51A 2XCQA 1AKWA 3CUSA 1JDTA 3RC7A 1WEHA 3GRFA 3IA7A 1Z25A 2RG1A 1D1SA 2AG8A 3COPA 3SZRA 1YB1A 1M8KA 2WSBA 3HWX1 3RO7A 2UU9B 4XD2A 5DX0A 5KSPA 4N5HX 3BE4A 3LP6A 4KYTA 2ZXFA 1K98A 1OZHA 4WLEA 5IVDA 2YZMA 5L7YA 3TTWA 1X1BA 3QBDA 4R3NA 4NQZA 1B6SA 1GIAA 2NX2A 2R6ZA 3WHLA 2A2ZA 4KWCA 2JC3A 1LCIA 4LZJA 4YRLA 2JAQA 4L1KA 3CJQA 5GJVC 1EFKA 2HO4A 4FBMA 2WPNA 1T9HA 1YR3A 1DWPA 3H2HA 3RFUA 5JTTA 3TCXB 1VP9A 2F9FA 4Z4IA 1VGQA 4H7IA 5JRJA 2WWIA 4ZQCB 4ICIA 5AQ1A 1T26A 2X5NA 1AS3A 1A82A 2E1RA 4MV7A 3OT4A 4Q66C 1LDYA 4CLHA 2IYPA 2TYSB 3IQXA 4L3VA 1MUUA 1KJIA 3ZWNA 2RGXA 4BZWA 4NE2A 1I7SB 1SIWA 2CT8A 2XCOA 1TUIA 3HM9A 2BC9A 1UXGA 2ADFA 2CLCX 1P0QA 3T52A 1I1QB 4FZVA 3LOUA 2QRHA 3RJZA 1IY1A 1VFPA 2PGIA 1QHIA 3PGMA 4RD1A 4V1CB 2ZYAA 1EH5A 1K8ZB 1XJWA 2H1VA 3AC0A 1HXHA 4ZODA 3ZBTA 1ODLA 3UG7A 3U3KA 4X95A 3T7RA 4AL4A 1G0OA 2BEUB 2HMWA 1PJ4A 2GJ4A 3K6KA 3TZCA 1S8OA 2J1LA 1W0JD 4NNJA 4Z1MA 1LS6A 4BS9A 2ACVA 1Q3TA 1VG1A 3LAWA 4REQB 1L5RA 2NXJA 4OBBA 2G71A 1RBYA 5GJWC 3EVTA 4GPD1 4KE8A 3LGAA 3VR4D 3MPUA 2OBXA 2ZRDA 2WMYA 3EOZA 1ANKA 1EB8A 3CLHA 4K88A 4AZSA 1RQ7A 4B35A 2NLOA 4QODA 1F6DA 2D0PB 1RQLA 1I0ZA 2FPUA 2G0AA 3C8HA 2J0VA 5FBZA 1Y9EA 2NO7A 3MLBA 5EYPB 1BE0A 3OTIA 5BMVF 3HKBA 3OZEA 4DCVA 3UPTA 3MS2A 2H59A 3AKCA 2YQ5A 4RHYA 5H82A 5A71A 2GEJA 5GV8A 3ZLUA 5LP6A 4CMGA 1JLRA 4MQEB 3QLJA 4MVJH 2VH1A 5K0TA 3DZFA 3GOHA 4PTZA 3SZLA 2A3RA 3QE9Y 2ODNA 2A92A 3GOQA 3WJ1A 4LSMA 5IT5A 1LD3A 2QRUA 3LBNA 3RYHA 4J9VA 3ZXXA 3QQ5A 1VYUA 3WISA 5BNIA 1ZS9A 5B58C 3AL2A 4DWJA 3L8CA 2YICA 1A76A 1E77A 1RYHA 2I1QA 3L6DA 2DX7A 3LVBA 5EZYB 4B3MB 1NVBA 3C8UA 3WZMA 5FIUA 1BFKA 3ZG6A 2Z4SA 1E2NA 3ENVA 3I9NA 3R5SA 3FLMA 1ODFA 2D2XA 1Z73A 2O2YA 4JLKA 1A77A 2ZPUA 2JFGA 2PSEA 2WYWA 4FUTA 4MYDA 3ZD7A 1XEWX 1KNXA 1ADFA 2H9IA 4FYIA 4II2A 5CG2A 3L0SA 1TYEB 3GCWA 1B4DA 3QWHA 2FA9A 2M9MA 1MT0A 3I9KA 4F4JA 1P4SA 4YDHB 2J09A 2NPIA 3CFYA 3TSZA 2B25A 4IWNA 5CBKA 5DIZA 2OCIA 3EK2A 1RXWA 2XYGA 3UYLA 3UA3A 4AU1A 2QUBA 3B13B 3F96A 1W36B 2AFVA 1ISIA 1Z5OA 3KJQA 3QKIA 1GPYA 3C6KA 4Q3NA 5BYAA 2IE0A 5E9WA 2ZTHA 2RIPA 5T6MA 3CVUA 4HK4A 4AXXA 5I4IA 4TQ9A 4CQMD 1GRRA 2WHYA 4K6FA 3D6AA 1P18A 3HKCA 1LH0A 1TW2A 3N0VA 2EJBA 3MUEA 2I1VB 4ND3A 4WJLA 1FBTA 5J1TB 2P35A 1IEVA 5IG2A 2HJRA 1RI3A 5SZKB 4HHEA 3GFBA 2C3YA 2X8LA 1AQLA 1AA6A 3AHGA 4WCFB 1M2WA 1N8TA 3GRAA 4LDJA 1Y5RA 1ZHHA 4G1MB 2Z5FA 2FVYA 4G0VA 1CUZA 2VJKA 2R5FA 3PTLA 3CEMA 2ZB3A 5EIBD 3TRHA 1FNNA 1ZSYA 2DZDA 4IXWA 1ZNQO 2QTRA 4BFZA 5IAKA 3GJ6A 4IVNA 4KTVE 1M6VA 1SUAA 4BQNA 4J75A 4XKJA 1NJFA 3CX4A 1XYGA 5GOTA 4Y18A 1MIOB 1CLUA 5JG7A 1DC7A 2K5UA 1EJBA 3F7TA 5FI5A 3UWOA 4LHSA 1T35A 1RPZA 1OF1A 4QXRA 1RQ2A 3RVPA 1TCVA 1XTQA 2C2ZA 4JI3B 2PWAA 2PXAA 4DWWA 1JMYA 2WIKA 1BMFA 1O97D 1XU9A 1VPEA 2GCGA 3MGKA 3PLAE 2OCYC 3LD9A 3PXUA 1JALA 1DI0A 2C3MA 2R4UA 4BMPB 2HK7A 3I9OA 4ETWA 2X13A 1WZ2A 1ORHA 2XJ4A 3AESA 1IIBA 2XZOA 4DSNA 3M5PA 4YJ2F 1RZVA 2GWHA 2IODA 3RC8A 4G24A 4DYHA 1QU3A 3MRXA 4B4UA 1AZSC 1EJ6A 2RBEA 4QXMA 1O54A 5C81A 4KMMA 2G77B 2WTUA 1SCAA 1JWLA 3BORA 5F9MA 3ZJUA 2P3OA 3H87A 4QLAA 1ABFA 1FIUA 5TT0A 1J33A 2NYUA 1TCCA 3L7NA 4YP0A 2GBLA 1IUPA 2HY7A 2I03A 2P27A 2QS9A 1IHDA 2JG3A 4IVRA 1F2TA 1SVMA 1N6PA 3ITNA 3TN7A 1F7VA 3PJDA 5GV7A 3U1BA 3RU3A 1KEPA 1SBZA 3AFHA 2ACWA 3M0EA 4Q03A 5AKEA 2D2FA 4U1RA 5JU6A 2NU6A 4O4JA 2VZLA 1EXMA 4LE0A 2P1ZA 2PVSA 4AZ0B 2FPOA 1LEHA 2QEQA 4QFMA 2NVOA 4X00A 4BO6A 5CYPA 1JEDA 2J48A 4INOA 1K88A 2UYYA 4HAUA 4J0KA 4RF4A 1H2AS 5DXJA 3BSFA 4DR5B 3LE8A 1QGZA 1H9CA 1UJMA 2GA9A 2A9QA 3N7TA 2DFVA 3E2IA 3QKWA 4Z7JA 3GLFE 4K6CA 2ZYGA 1W34A 5TEVA 3JSAA 3SBOA 4D6XA 3KZ1E 3OLYA 4O6VA 1SG6A 3N0WA 2R2AA 3TMYA 2UUBB 1ZDMA 3H97A 4NAUA 1Z8HA 5IFKA 1XB2A 1NKVA 2C0QA 2P9QA 3GJRA 3IOBA 2IWHA 3RYIB 5CT5A 3QITA 3MT8A 4K2HA 4Q00A 4OLBA 4B74A 1JQ3A 4PO1A 2ID4A 4B1FA 1I24A 3JQAD 1NSFA 2EW1A 4KV7A 1Z0FA 1DMSA 3JVIA 2PGLA 2ZAYA 3COWA 3AEUA 1LBEA 1XMVA 2FLKA 1RI2A 5D3ZA 4NDZA 1HT1E 4F6RA 3IPXA 4B2LA 1H2WA 4QXPA 5JTUA 4PZ9A 1F0KA 2WWWA 4MQMA 3UK6A 5I51A 2X6RA 1LTKA 3DBIA 4XQ0A 4UBKA 1IL0A 1C81A 1RYMA 1WUIS 1I5EA