4H7MA

The x-ray crystal structure of the trichoderma harzianum endoglucanase 3 from family gh12
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
EAEAEFQTSCEQYAVFSGGNGYSVSNNLWGQSAGSGFGCITVNSLNSAASWHADWQWSGGQNNVKSYPNVQIAIPQKRIVNSIGSMPTTASWSYTGSNLRADVAYDLFTASNPNHVTYSGDYELMIWLARYGDIGPIGSAQGTVTINGQSWTLYYGFNGAMQVYSFVAPSTVTNWSGDVKNFFNYLRDNKGYPASSQYVLSYQFGTEPFTGSGTLNVNSWTASINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-glucanase
publication title X-ray Structure and Molecular Dynamics Simulations of Endoglucanase 3 from Trichoderma harzianum: Structural Organization and Substrate Recognition by Endoglucanases That Lack Cellulose Binding Module.
pubmed doi rcsb
source organism Trichoderma harzianum
molecule tags Hydrolase
total genus 56
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4h7mA00
1PVXA 1OA4A 1UKRA 1XNDA 3MFAA 3VHNA 3B5LB 1BCXA 3LGRA 2NQYA 4S2DA 2D97A 3VZOA 4HKOA 1ENXA 1IGOA 2BWAA 4HK8A 3VZKA 4HK9A 5K9YA 3VZNA 1HV0A 3VZJA 1OA3A 3WP5A 2DFCA 2QZ3A 1XNKA 2JEMA 1UU4A 2VULA 1HIXA 1M4WA 3WP6A 4S2FA 2B42B 1H8VA 3WT3A 3WY6A 4XPVA 3MFCA 3VZLA 3WP3A 2B46X 3M4FA 1OLQA 1T6GC 3AKSA 3VZMA 3AMPA 2VUJA 5K7PA 1REEA 3WR0A 4S2HA 1W2UA 2B45X 2JICA 3AKPA 1BVVA 2JENA 2BWCA 1UU5A 2D98A 2DCJA 1REDA 2F6BA 4HKLA 3RI8A 2DCZA 3VLBB 1OA2A 4XQ4A 5HXVA 5EJ3A 3AMQA 4IXLA 1UU6A 1REFA 2DCYA 3EXUA 3LB9A 3RI9A 1XYOA 2NLRA 3B7MA 1H4GA 1XNCA 2BW8A 3AKTA 3VL9A 2QZ2A 1XYPA 2Z79A 1NLRA 3AMHA 3HD8B 4NPRA 1H4HA 3MF6A 3ZSEA 3MF9A 1OLRA 3VL8A 4H7MA 4S2GA 1TE1B 4HKWA 1XNBA 3AMNA 3WQ7A 3AMMA 2DCKA 3VHOA 2VGDA 2VG9A 1YNAA 3O7OA 1H0BA 4XQDA 1QH7A 3WQ0A 1H1AA 3AKQA 1KS4A 3VHPA 1C5HA 1XXNA 3WXPA 3WP4A 1XYNA 2C1FA 1F5JA 2BVVA 1QH6A 3WQ1A 3AKRA 1KS5A 2DFBA 1HV1A 4XQWA 1BK1A 3VGIA 1C5IA 3WX5A 1AXKA
chains in the Genus database with same CATH superfamily
4JTNA 1XNDA 1UKRA 1JBCA 1RJ7A 5A70A 4QXHA 2BDRA 1YFXA 4XCAA 4Y5SA 1S2BA 4AFAA 4E9KA 1RGSA 5EFUA 2IXLA 4IEQA 1RUI2 5F9TA 4YRDA 1PZ8A 2PXJA 2P3IA 1WMDA 2Y0OA 2YB7A 1IZ3A 3EMRA 3NNFA 2C26A 3O14A 1CAVB 4HK9A 4XVHA 5CEHA 5J98B 2CL2A 4CP9A 3MLJA 1GANA 1XSQA 4QB2A 3VDCA 2E51A 2B9VA 3TEXA 5JCTA 2HYKA 4XURA 5FCCA 3VBOA 3C7FA 3MYXA 4IUGA 4AWDA 4BIOA 1SLBA 3OOXA 4PDWA 2AENA 4JVAA 3TAYA 4CPBA 5I0RA 1ACCA 1I6XA 4BOWA 4I0AA 2VY0A 4XEZA 4C8DA 5C8WA 2WS91 3ZYIB 3HJRA 4HANA 3CJIC 5FY8A 2QQOA 1IOAA 1Q8SA 5J3UA 5F5IA 2E7TA 1AR63 5EJZB 1VAVA 2VMHA 4HPKB 3TBDA 3LSEA 3OEBA 3AMPA 4B4RA 3POYA 2Q8EA 2R041 2P3KA 4S2HA 1NG0A 3WUCA 2J7MA 3WNNA 2DVFA 2WS92 3HWJA 3LEKA 5A3TA 3IWZA 2OA2A 1XSRA 2WLPA 2PQSA 5FZ0A 1HJGA 2LRPA 1DIWA 4JX0A 2H0BA 2NM1A 3GJBA 4JTOA 1H2MA 4XUPA 4C0BA 3D4KA 1PK6C 1WWYA 1PVC1 3BGAA 3JU9A 4GALA 5CAZA 4CCCA 1VBB1 1CX4A 4CU7A 2ZHKA 4ZHNA 1IPSA 3ZFFC 4CCKA 5J7MA 1XYOA 2AACA 3ZYGA 1C3HA 2R042 2R043 2CYFA 2IFRA 4INDA 3VBHC 3VKMA 3VL9A 1NT0A 3VD3A 1BZWA 1UNBA 4QQHA 5FZ9A 3K3NA 2VZ1A 3TNQA 1XE8A 2R1DA 4C90A 2AYHA 4YGDA 3AMHA 1MS1A 2VZ3A 1F35A 2P6CA 1FPN1 2RM23 4N43B 4XABA 3AZWA 3FUQA 2E31A 2R7EB 1PVC2 1PVC3 1U5ZA 3QCWA 4LO5B 1Z78A 1YQCA 2WZ8A 1V0AA 1VBB2 2CHHA 2W5FA 2C0ZA 3JQWA 2VXJA 3R05A 4D8MA 1TMF1 3RJRA 4A4AA 3OGJA 1LOFC 4JCKA 5FO7B 5AFEA 4QQPA 3ACLA 2UWAA 2VQTA 1VE0A 2MNGA 3FFZA 1JU3A 3SH4A 1GZWB 5JSOA 2ARAA 3BOPA 2JXAA 1FV3A 4NR1A 3POSA 5T5OA 4AI0A 5JOYA 1FPN2 3AZZA 1APNA 3GBGA 1H1AA 4XF4A 1ULFA 5I0UA 3W9AA 3OJBA 4I01A 2V73A 4R4XA 3MPPG 4MXVA 4XF9A 5JOXA 1VMFA 4Y33A 1A34A 4KL1A 2G9FA 3LWCA 2V4VA 1TMF2 1CAWA 1TMF3 3FWEA 5DUWA 5A33A 2E7QA 1V6LA 3VDDB 4EN9B 3ZSJA 5FPXA 4CCEA 1JYIA 1UOJA 2B8MA 2FDKA 5FMOS 2Z69A 1QEXA 1QWRA 4BA6A 1C5IA 2VOTA 1WLCA 3WX5A 3ZYHA 5FIXA 4DMIA 1JZ4A 1I3HA 3VHNA 3USSA 3KD4A 4FPEA 1P8JA 4FVVA 4HONA 1Q56A 5JR7B 2G1MA 4BZ4A 4COWA 3ORJA 4WM7A 2XUEA 2C4XA 4YVWC 3ZOIA 1O6UA 4AVVA 1MEC2 5FQ0B 4OHWA 3ACIA 5K9YA 4GKYA 4LEJA 1MS8A 3TYJA 1BHGA 1WMEA 4BXFA 1CD3G 5KXCA 3QH6A 1A3KA 1YI9A 2WNUC 5BNPC 1ULCA 5A7WA 1FT9A 4NVPA 3ZXKA 1XNKA 2BOIA 2C5DA 3PIGA 3ST7A 5A3PA 5SV5A 5JIAA 4LA3A 1X82A 4L97A 2OVUA 3NJZA 2YBPA 3ZXJA 4WVWA 4BM8A 4GKXA 5I8TA 2F17A 1LHVA 1U5IA 3CU7A 1N1SA 4FAHA 3E6BA 4CCMA 2C9KA 3IMNA 3WW1A 1LOBA 5K0UB 1C1FA 2XDVA 1O4YA 2VW1A 2JJ6A 3K75B 4IETA 2V72A 2EXHA 2BTVC 2WYSA 2O0OA 4M3CB 4OZOA 5FZ7A 4WM8A 1OLQA 2E7AA 3LKJA 4H3WA 4KGGA 3BTAA 4A6SA 1XNAA 2WAAA 2WQ4A 4MYEA 3OYWB 2OT7A 1Y43B 3NAPC 2LS6A 3U4SA 5HBAA 1DYKA 3ZN4A 3O1VA 4NIHA 2YZ4A 4HVRA 5AVAA 3E5XA 1DQ4A 3ASIA 3KQRA 1DQ5A 3VKOA 3AYCA 3OCPA 4XJWA 4RR3B 1CGPA 1CJDA 3T0DA 1TG7A 4NPLA 4NRPA 4LBLA 2ILMA 5I8SA 4B4PA 2ZMLA 5E89A 1QJEA 1REFA 4AFBA 1SPPB 2WO7A 2NLRA 5A6YA 1W6MA 4NE9A 4JHZA 1QJU3 1JZ7A 1FV2A 1MVEA 2JIGA 5HCFA 1LODA 5C5UA 3L9JT 4N53A 3HIFA 4WBBA 4QX3A 3H7YA 4XIKA 1ENSA 1UY3A 3WG4A 1Y3TA 4TTGA 1LAJA 4LLOA 1G9BA 4QWNA 1PMIA 4QT6A 3UKVA 4AAPA 3I7DA 3ZVXA 1IG0A 2ET1A 4E4SA 3RDIA 2YXSA 1AX2A 1NY71 4S2GA 4PHZA 1YC61 1HN1A 3APBA 4BPZA 3UKTA 1RUF1 2A7AA 2QDRA 5CG9A 1Y4WA 3LPFA 4DNYA 3UGGA 3DPRA 5FZIA 4OI0A 1B35B 1LU2A 3ZFGA 1GWMA 4FPFA 3K48A 4L11A 4LKDA 1F31A 3KT7A 3HNMA 4QGLA 2J42A 1HRI1 1ZRIA 1WKYA 1MS5A 4N8MA 4EWEA 3D8CA 1IG3A 4L0PA 4Y1XA 1NY72 5TSWA 3CDZB 3T2TA 3INAA 3JBG2 1RUF2 1RUF3 4JGZC 5BNOA 1YCIA 4AAXA 4AW7A 1X8MA 1QJZA 1W9TA 2RDSA 4XIOA 4PDWC 4BQYA 3VBOB 1MACA 2NQYA 3H3UA 2JDHA 1D4VB 1HRI2 1HRI3 1KJRA 5FREA 4IV3A 4ZY9A 3VZOA 2VUDA 2ZEYA 2A75A 5FUNA 2GP3A 3FBYA 1X33A 3UNPA 3ZIWA 3KV5A 3ZLIA 1RUC1 2PA7A 2WSUA 3IAQA 1OUXA 2DVBA 2D6PA 4Q0UA 5JXGA 1Q8OA 3WZ1A 3RZJA 1LTEA 4XTMA 2GC3A 5FWJA 4BCUA 3I2KA 4EN7B 5FP4A 3LDRA 3ACGA 1DU3D 1DF0A 4OYUA 4XDOA 3VBUA 3M1HA 5LA1A 4YNIA 3A4UA 5CZKA 4P9IA 4EQVA 3DUIA 2YHJA 4IQPA 4AZZA 3WCSA 2ZZQA 5FLHA 1RUC2 4C91A 5FUIA 4YM3A 1U5XA 2GNDA 2XR4A 2PHUA 4BHPA 5DDJ1 4DIQA 1HN0A 1K3IA 2WO2A 4MGZE 2RS11 5KBFA 1OOPB 3ZFEA 4Q29A 5GZCA 1CQ9A 1JMUB 4D6SA 3AKSA 3POBA 4F7ZA 1OD3A 2PAEA 1XC6A 3FMGA 5FK8A 1REEA 1SLTA 1XBFA 4DUVA 2ZGRA 2CSGA 2VUAA 1JU4A 4PQQA 3B3QE 4GH4B 2D6LX 1H8TC 2XJTA 4YVSA 2WWSA 3WF0A 2W2IA 2DVAA 4YFZA 1Y9MA 4Y4RA 2OPWA 3DKQA 1LHWA 4COVA 5JIUA 1OLMA 1YFYA 5DDJ3 5DDJ2 5F3EA 5A7SA 1UD1A 4MOAA 2RS12 2RS13 3RI8A 4FSJA 5H9QA 1HXS1 2ARBA 3CKHA 2WUHA 3JD71 1QMJA 1POV1 1QY4A 3IDBB 3JZVA 3POEA 3UETA 4Q0VA 1ULEA 2AR6A 3OGVA 4CDQA 4QPGC 2A6WA 2UWCA 4ISRA 3ZSKA 1UF2C 2W46A 2X5IC 2ZABA 4M4PA 1JYVA 2ZGTA 4BMBA 3OGRA 3CLPA 5LBBA 3AX4A 2Y6LA 4CXWA 4R9BA 3RPQA 4CXXA 3BTXA 4CDWA 2K9ZA 4K1ZA 1N1VA 2R0FA 4M0NA 5FMBA 3FC0A 1HXS2 5IFTA 3ZXFA 2QUOA 3JD73 3JD72 4L8QA 1HB4A 1POV3 1NZIA 1JYWA 2L9LA 1ZRFA 2W1QA 1LOEA 4LUKA 4YM0A 1OH4A 1J84A 2P34A 2GMEA 4M3CF 5CKMA 4TYSA 3WQ7A 3GCWA 4NO4A 3EBRA 2QQLA 1W6NB 5FZMA 1SBDA 1W6PA 2PN5A 4B8EA 1SFNA 3GBWA 5A7NA 3AM2A 1CONA 1OH3A 2JDAA 3QH7A 4NAOA 1I1EA 4V2VA 1JZ8A 1S0IA 3MIBA 4GA9A 4QQOA 1N3PA 2QQJA 2XKPA 1JUHA 1KXGA 4AF9A 3WQ1A 1PO21 5CFCB 1F4AA 4E4DX 1KS5A 2LUWA 3ETPA 1BK1A 4XFBA 2UWBA 3X29B 4CDUC 1HQNA 4YSFA 1D4M1 3N9OA 1EV11 1ODNA 3DYOA 2A6YA 3V0AA 3I8TA 5C4WB 5IJRA 4XUNA 2YROA 4BQXA 1ZZ6A 4IE4A 5JSRA 1DGLA 4HZFA 4QPIB 1IGOA 5KWRA 1SEFA 5ACA3 5FZKA 1GQPA 2D40A 1AYN1 2VNOA 4XC9A 2YDEA 1NA1B 5D21A 3ZDVA 5IYYA 5L36A 1PO22 1PO23 2CWSA 3R4DB 4RN5A 1ND2B 3WNOA 4YARA 4RQPB 4WM8C 4FBFA 5JZGB 3WP5A 1D4M2 1D4M3 1NOVA 4HMZA 2QKDA 4QXCA 5FYYA 4MGQA 1EPWA 1EV13 4OHYA 4LO8A 5I0TA 1BJQA 1WLTA 5IT6A 3FUOA 3ON7A 2WFF3 4JDNA 5F2WA 4BIFA 2W95A 3H3LA 4LK6A 2A6XA 4LR4A 4QQLA 2JB8A 2W92A 4D0QA 5F37A 4TLFA 4GB31 1AYN2 4WZCA 4RGKA 1IPKA 3N4MA 5IWFA 5LA0A 3PU8A 5DAWA 4Q4W1 1UW8A 1VP6A 5EP9A 2PHRA 5LY2A 2ZX3A 4Q2FA 2YPDA 2JDZA 2QQPA 1CZVA 2B46X 4KWKA 1OHFA 3D6EA 3GALA 3J9SA 3N9NA 2J1VA 3VUOA 2BFUL 5A1LA 1FI2A 4LPLA 4BQ4A 1W2UA 2FDIA 4GB32 1ULDA 3LD8A 1EUTA 3OB8A 4GB33 5C3OA 4M00A 2JG9A 2P3JA 4Q4W2 4Q4W3 2YG0A 4U36A 4AEDC 1H6YA 5CB7A 1SDWA 2A6ZA 2BGPA 4Q0SA 1PMJX 4QGNA 4AVSA 5A3LA 1WGPA 2A3YA 2A6VA 2VMFA 2XONA 1RITA 2JWPA 3AMQA 2Y0IA 1URXA 1X7NA 4BYYA 2LROA 2YBSA 2VZUA 2A70A 4EN6B 3U4XA 1PM7A 3AYDA 4BMEA 4KG0A 3MIDA 4DOUA 1XNCA 1NXD1 3DPRC 1QXJA 2W1WA 2YGMA 2ZGSA 3H42B 4QU2A 4DUXA 5GZGA 3I2FA 1NLRA 4RL7A 4RHV1 2R6QA 3ZFGB 4AI8A 4LBOA 4NPRA 4AR2A 3SEEA 4ATFA 4N7UA 4EE2A 5T3NA 1OFNA 5T5LA 1UQXA 1W3VA 2IXJA 4XZUG 2R32A 3PURA 4Y3OA 3WF1A 1XE7A 2XJPA 4AQ6A 1UYXA 2PHWA 2XBO1 3M2MA 3MLLA 1BBT1 5FZFA 2VE1A 4XMIA 1RUE1 3CJIA 3NV2A 2HWE1 1SHWB 2X8KA 4KGQA 4KBBA 5BNOB 5FWEA 3A23A 3AC0A 4I09A 2DU0A 4LA2A 4RHV2 1KQRA 1OUSA 3I59B 3NJXA 1I5ZA 1N3QA 2JG8C 2VG9A 1T2XA 3AK0A 1SACA 4XW3A 1KS4A 1MQTB 3P5BA 4CZSA 1CIYA 3ZDSA 3B02A 4IV3B 2XBO2 3ZIXA 5I0SA 1AX0A 5F6LB 1BBT3 1W9SA 4I30A 1RUE2 4CP1A 3EJKA 2HWE2 3OEAA 1HV1A 1DQ1A 5FY0A 2OZ6A 5H9PA 1UMHA 1FNZA 1W0PA 2XLFA 1NYWA 5T52A 3THCA 4UBHA 3E6CC 3WG3A 2ZMKA 2R1BA 1PK6A 4ASKA 5IK5A 1ZA4A 2XWJB 4P9JA 3PTYA 4MH0E 4YW2A 3UV9A 3ZN6A 4CU6A 2VW2A 3O1UA 4OMCA 1QOTA 3VD5A 3ZFFA 4PI2A 5C6CA 5C7GA 3VBHA 4FFHA 2DUOA 4G9SB 3URFA 4CCJA 4FTEA 2WN3A 1Z0HA 1OD5A 5L73A 2O14A 5L9BA 3I2JA 1F9KA 3DCQA 4J6GA 1OA3A 2QQKA 4GD4A 4A2UA 4L2NA 3ZFEB 4BQWA 2WT1A 1RB8G 1RXFA 3WP6A 4YZ2A 3LIHA 5L9RA 2RHPA 1WCUA 2VOWA 1UOBA 4FXKB 1O3SA 3IN9A 3NRUA 4W4ZA 1V6KA 2X05A 4FTBA 4NIDA 1EP0A 3POFA 4I02A 4YVSB 3JB8A 3GF6A 2DVGA 4HLTA 4R4ZA 1GFF2 1V6NA 1VMJA 2E26A 2FCTA 2ZTNA 4MGYE 3GYDA 4Z07A 1DLCA 1W8HA 2WIIB 2BV4A 4ZXKA 3USUB 4AEJA 1LU1A 1J1TA 1S55A 1C8M1 1NCRC 2C9AA 2D44A 3KVBA 4XMAA 3V64A 4D7YA 5I93A 5IHRA 3ENRA 5K7PA 3FHIB 2Q30A 4JKKA 3RZHA 3RSJA 4ES8A 4HN1A 3WNPA 1ND3B 4CDWC 3HQRA 3KGZA 2I2SA 3J7MA 4QDRA 4J25A 2QJVA 2OUJA 1RTVA 2CU5A 2I45A 2D98A 3OBTA 5F5CA 3NV1A 1SLCA 3WW4A 2ENRA 4Y1UA 5I8YA 4YVWA 2KM2A 2VBPA 1C8M2 1C8M3 5F2SA 3RWKX 3VBRB 1GSLA 4M3CE 3AVSA 4A7KA 1NE6A 3B7MA 3BI3A 3NO8A 3OUIA 4IGQA 1JUIA 2GH8A 2QZ2A 5DG2A 5FYCA 3ZXLA 2VQ0A 4SBVA 1YYNA 1W2AX 2WNUA 3UESA 4X6QB 3M3IA 2BGCA 3J8F1 3S7EA 1VAKA 2IZWA 2UU8A 4QX0A 3RYRA 1NCQB 3D5OA 2QQVA 4XF0A 2HEYF 5C3PA 3N36A 4GMP1 2YUEA 3W21A 4UFIA 4K9SA 3CHXA 4W50A 1LHOA 3LA3A 5FPLA 3J4UH 2PHTA 4NHKA 5FZOA 1FOD1 1KGYA 1YIPA 1O8SA 5LEKA 2OW4A 3BPSA 2IVIB 4MXWA 1HQLA 3L2YA 4Y20A 3NNJA 1UYYA 1H2LA 3KV9A 4RGAA 4Y24A 3R4UA 3VHOA 3GNEA 3J8F3 3J8F2 4MLOA 4OLLA 5D8AC 2WT2A 2XJVA 3BVCA 3GDBA 3TEWA 5JPMB 2YU2A 4W6YA 5FY1A 3B94A 4GMP3 5FXZA 3JUUA 4Q8KA 3K77A 1FOD2 1FOD3 2W39A 4Y26A 3VD4A 4E4ZA 1QH6A 2EA7A 4CUGA 2QBXA 2AC1A 2ZGKA 4RYDA 2DF7A 3T2QA 2NN8A 3MI8A 3HQXA 2VZPA 2R16A 1PVXA 3MFAA 1DP0A 1XRUA 1G7YA 3B5LB 2WAOA 2BPA2 4IEVA 3AZVA 1JZ6A 5FZGA 1MPXA 4IE7A 2ZGUA 1UXXX 2D5HA 2XL9A 5IFPA 3KT1A 4KQ7A 2GU9A 2W9XA 2Q8OA 4Y1YA 4CDXA 5I0DA 1O3RA 3WF3A 4QX8A 2WQ8A 3BB6A 2AREA 5FLJA 1H2KA 2TUNA 4A42A 1ZZ7A 2HWF2 2WRAA 3IPVB 1RUI1 2RS53 4LBQA 4LITA 2J1TA 2ZHLA 2G9GA 4MX3A 1EUUA 1VRH1 3TWIA 5JWPA 3HAGA 2VULA 4CTEA 3N9QA 3WHTA 2HKXA 3VDAA 4FFFA 1K12A 1X50A 4J1XA 1UPSA 2UY9A 2ATFA 4UBGA 1CN1A 4CU8A 1NLSA 1JS9A 3MLKA 1GUIA 4QM8A 2ZACA 2CAUA 3ES4A 2HEWF 5C33A 2ZKLA 4QHBA 1S0EA 1RUI3 3S7IA 3ZO0B 2ZGNA 4RFT0 1VRH2 1JYCA 2WNVC 1RUNA 1LOAA 3EB7A 1N47A 4IESA 1CAXA 1YEWA 2ZGQA 2P6HA 4JGYB 4JGZA 3WOGA 1CZSA 1R091 1ZA7A 1DQ2A 4TSVA 4URTA 4FPLA 1A78A 4FTSA 1LGNA 5CNAA 4GJZA 2BWCA 1GWLA 1Q8PA 4OMDA 2DCJA 1V9U1 3N7KA 2J22A 4EV0A 5CKQA 5FZ8A 1UKGA 5FYHA 1Y9QA 1QOSA 1AHSA 1F4HA 3AZYA 2DCYA 1OC1A 4UW5A 1Q3EA 3M3CA 4DFSA 4Q4Y1 1PGW1 1WLDA 2VMCA 1R092 2ZBJA 4OULA 2VXRA 4RS5B 5DAPA 4BXSV 2Y6GA 1UX7A 2WBKA 1VBE1 2Z79A 3VB9A 3VKNA 1RUD2 1QJX1 2X10A 4CE8A 2BYVE 4HG6B 1V9U2 3KF5A 4GQ7A 2VNRA 3AP9A 4FPJA 1RUG1 3E97A 5I91A 1UXZA 4IV1B 1ZBA1 2JDUA 2VCMA 3TB0A 3O1TA 1OPOA 1QU0A 1RINA 1ZBE1 2WS93 2Y6FA 3SKJE 2Z42A 1W39A 4FQZA 5JXIA 4UXAA 3NSTA 3RZZA 4FOYA 1SFPA 1TE1B 3E5QA 4Q4Y3 1PGW2 1W8ZA 2PHLA 4Q4Y2 1W6OA 4MVTA 5DZEA 2DUQA 3DECA 4BQ5A 2AUYA 1VBE2 1VBE3 2CTVA 3VBFA 4CSWA 1QJX2 1QJX3 1GQHA 1PK6B 3AJZA 1RUG2 4PIYA 2XVKA 4XJ9A 1WZXA 5LK5A 1ZBA2 2PHXA 1JI6A 3ROUA 3T4VA 1GQGA 4AL9A 1ZBE2 4QMAA 1CX1A 2E33A 3T09A 4DS0A 4B7EA 3ZN5A 1H8TA 2C1FA 4XAAA 3T2PA 1F5JA 2BUKA 4JV4A 4CA9A 3T0BA 4HETA 3T3YA 5J48A 3PTRB 4NUBA 4QX1A 2E63A 3LPGA 1VBB3 4A44A 4IL7A 3PL0A 1GOFA 3LEGA 1X36A 1BCXA 1AF9A 4OZXA 1K5MC 4QPGA 2CAVA 3ZYJB 2WL1A 3NVCA 4HKOA 1UY0A 4Q4X1 2X5IA 1CAUA 5CKNA 2PHFA 3A0NA 3CJXA 1FPN3 1UZ0A 1V6JA 3SCHA 3MUZ1 1HRV1 1GNZA 2P2KA 1YUDA 1LGBA 2WJSA 5A6QA 3T0AA 2WNOA 5CFDC 3MO4A 4IERA 5FZLA 2E6VA 1MEC1 4AGVA 1J1LA 4OHZA 1W8WA 4YGEA 3AFGA 2VL4A 4BU2A 5GLWA 3OBRA 3PVOA 2B42B 4UW6A 4Q4X2 3ZSLA 1G9DA 2ZAAA 5IVCA 1AVBA 4A45A 3VBSA 1HRV2 1HRV3 5FPUA 1KD7A 1PM4A 3LDBA 2GDFA 3H50A 4YFWA 2WQZC 1W2OA 1MEC3 3GZEA 3VZMA 5DAXA 5FZ6A 4CVUA 4GJYA 4UF0B 1ENQA 3HNBM 3KV4A 5KXBA 1LECA 3IT8A 5JSPA 5FMCA 3AL5A 4CDUA 4Z8BA 5F8PA 2WNUB 3KCCA 3N9MA 4LKEA 5FYMA 4CCDA 1GZTA 5BNPB 2QQIA 2W91A 3O1OA 4XHXA 3ZYFA 3VLBB 2K0GA 5HXVA 1SCRA 2DYCA 4QXKA 2GN7A 1W8OA 1KFUL 3TRSB 4AK3A 1COV1 4K3UA 4ZS3A 2KA3A 3LA7A 3MEPA 3H0OA 3M3EA 3PDQA 2AGSA 2WZR1 2QTWB 1O4ZA 2VECA 1XYPA 3FHQA 5EV7A 4AVAA 1QKQA 2YV8A 1ONAA 2ZX4A 4D3WA 2OX0A 3EO6A 4CCNA 5FKBA 3PHMA 3HN3A 4E2GA 4GWJA 1UY4A 2VZVA 3S5QA 5BNNB 5J1XA 3PUSA 4H7MA 1LESA 1HDKA 1W8NA 1COV2 2JB4A 4JZRA 5GLTA 2DVDA 3NAPB 4UI9L 5K0UC 3PUQA 1X8EA 1XNTA 3MDPA 1VAMA 1FMD1 1YQ6A 4NHLA 3VD7A 2WZR2 2WZR3 3CZJA 1Q43A 4I2OA 3BU7A 4QKDA 5LBCA 4YYOA 1JYNA 4COUA 1MZFA 1YRZA 3NW4A 5EJ1B 5IUQA 4MSVA 3ZSMA 5FYBA 4XJUA 4CDXC 1DCSA 4LUMA 1XPWA 3ABZA 1PX3A 2Y6KA 2ZMNA 4Q4V1 2BVVA 2BP6A 1I5PA 4WVMA 5H9SA 1FMD2 1FMD3 1XB9A 2ZEXA 2XJSA 5C9AA 3N9LA 5HCBA 1RVF1 3HN1A 4AEDA 3I3MA 2Y6HA 1EYBA 1YFUA 2ZOEB 2JDKA 3O0VA 3BALA 4D69A 3CL1A 3WINE 1OVPA 2YU1A 4NJ4A 4W65A 4E2QA 3AYAA 1VB4A 3JBG1 4K8FA 4S2DA 1E57A 2CGNA 4GIQA 1LJ7A 1O7FA 1US2A 4KWUA 5ABJB 2XXZA 1O5UA 4YW7A 2XOMA 2D93A 4HK8A 1QHDA 4Q4V2 4Q4V3 2Z5WA 4O9GA 3GXUA 1HV0A 2P5BA 3CNAA 1JOBA 1RVF2 1RVF3 1UAIA 2F4PA 1D0GA 4AHYA 4ORFA 4N7IA 4A3XA 5A7OA 4AEMA 2EIDA 3GZUC 4FPGA 4Y5TA 1PGL1 3PUIA 4J1WA 3D0JA 3JBG3 4IEPA 1BKZA 1DZRA 1E5HA 2Q8DA 4C1WA 4H55A 5LCWL 2FDHA 1U0AA 1PX4A 2WC2A 2WWUA 4CP9B 1B35C 2D3SA 3Q8CA 2H0VA 2Q1FA 3SHRA 4LIVA 1WBFA 3WY6A 4I3GA 1RC6A 1QGLA 2CY6A 1J58A 2UYAA 1RIRA 1H9WA 1W6QA 1YO8A 1W28A 4NHYA 2J1UA 2JG8A 2E9QA 3I3EA 4PDWB 3SH5A 3DV8A 4PF1A 1PGL2 5CVRA 1S0JA 5GM0A 1H30A 1NE4A 1W9YA 1LNSA 3MGUA 4PCRA 3O1RA 2NZ9A 4R52A 2CV6A 4YW3A 5HCAA 2W08A 4RSUA 3VKLA 1OKQA 1VIWB 2XGXA 4LBNA 4U2AA 3MBWA 3ZYBA 3AB0A 5FZCA 5G05L 1JHNA 3N7MA 5FMOL 3WNXA 1O3TA 3UJQA 1AYM1 1NX9A 1PNFA 1LENA 5DZFA 5FY9A 4AGGA 2TNFA 1AJKA 1RUC3 4FPCA 5E8AA 4YW6A 5FP8A 4QKNA 2Z2SB 4OUMA 5C5TA 2VD7A 3TEYA 1L7RA 1RUJ1 2Y6JA 4G3YC 1DFQA 3EXUA 2P37A 2E32A 3LB9A 1O4TA 2J1RA 2VBDA 2DBNA 4IEXA 4XUOA 3VBFC 3KSCA 3CZUA 1SMVA 3WDTA 2C24A 1O59A 4PBOA 5D2AA 3VN4A 2CDOA 1H4HA 1AYM2 2IUWA 5FZ3A 1PZ9A 1BVP1 2XB6C 3KZ4C 2ZEZA 1QNYA 4G4FA 3I4IA 2HEVF 1R64A 2VMEA 1UL9A 3B9IA 4CEWA 1RUJ2 1RUJ3 1WCSA 3ITQA 2GNMA 1UN1A 3B69A 2ZS6B 4DPNA 2FDGA 5FV3A 1HLCA 3BN6A 4L92A 3WLUA 2HBUA 3H8OA 4EN8B 5EIYB 4OHXA 1UYZA 1J83A 2ZHMA 3O12A 3FFQA 4UFKA 3BODA 4TN7A 4MHRA 2P17A 4FAGA 4C1XA 1QXRA 3BKZA 1NCRA 3ACFA 4AQSA 5C70A 1YHFA 2WN2A 3I54A 2VTXJ 1LOGA 1BXHA 1ULGA 4QPGB 1OQEA 3NNGA 4MUVA 1NKGA 3IAPA 4CUBA 4DRVA 3N3HA 4OQ8A 4Q8LA 3CMGA 3LF7A 1R1A1 4KH9A 5HV4A 3W20A 3I2OA 3POGA 2D6NA 1HXS3 1A6CA 1TNRA 4Z2WA 5A1FA 2Y38A 4COZA 4EYUA 1PMHX 4CCLA 4LJHA 3K46A 4AQ2A 1YJKA 4YZ4A 3THPA 5A3NA 1CAWB 5A33B 4FT8A 3U78A 1AR81 4MHUA 2D97A 3OPTA 5BNQA 1DGWX 2VJXA 2VZOA 3J7NA 2MEV1 4WVVA 1BQPA 5DMYA 3K2OA 1VB2A 1KDMA 3AXDA 3MW3A 4AHWA 1R1A2 1R1A3 1RXGA 5A3WA 3AP6A 3VBSC 3BYWA 1WUVA 3QOPA 1RHI2 3KM5A 2JD9A 1S2KA 5L7OC 1BYHA 2QZ3A 4WM7B 2JEMA 2JKXA 1UU4A 4IEWA 2ZGPA 3OPWA 4IE6A 4XAEA 1DYOA 1AR82 2V5YA 3ZMNA 2SBAA 3HBZA 2MEV2 2MEV3 3BCWA 4BLIA 5F1RA 5A7WB 4MADA 2VOKA 1LEDA 1POV0 1GLHA 4O7XA 3DYPA 2GZWA 4R8HA 1RYYA 4OI1A 4ZU7A 5D8AA 4XPVA 3ZPOA 1EY2A 5JXJA 1CVNA 2VW0A 3W5MA 2BNMA 3ECQA 4QDQA 5JOWA 3RVHA 1OF3A 2DDUA 4AFMA 3AYEA 3SQOA 4UOJA 1VBC1 1T6GC 3KVAA 2WFPA 1QJFA 1GP6A 4AE2A 5CFCC 5C8CC 5CISA 1UY1A 2UYBA 1OQDA 4PJYA 1UX6A 3JCIA 1W9WA 5LK7B 5C71A 3NL1A 1BVVA 4WM8B 3O0XA 2JENA 4QB1A 5JDBA 1FXZA 2ID4A 4NHXA 3C8XA 2K2SA 3UGFA 5HI0A 2HWB1 1S4CA 1OA2A 2VZQA 3VDBA 2XWBB 1NA1C 3UJOA 4AI9A 1AYN3 1OKOA 1UPIA 1VBC2 3FLPA 4ZPIA 1GZ9A 5DXDA 3K3OA 3M8LA 4XFFA 5CBLA 2R072 3T08A 2XLAA 1ND2C 5FO9B 4KNCA 3FL7A 4ISQA 4RQPC 5JZGC 3KT4A 3LFMA 1G8WA 1F2NA 1YI7A 3WEZA 4QAWA 5FO8B 4K6BA 4W8JA 1FNYA 1PNGA 4AVBA 3AZXA 4L9BA 3U11A 5DAQA 2WLQA 5AFBA 2YC0A 5FBJA 1CWPA 4CRQA 3ZSEA 1IHMA 2HWB2 2HWB3 5FZ1A 4ZZ5A 4BK4A 1W6MB 3LOIA 1M06G 2BNOA 2JE7A 1XU2A 5F39A 4CPBD 2OIIA 5C9AC 4N53B 5GALA 3I2HA 3WD5A 3SKVA 5A32A 3POJA 4JDMA 4Q1PA 4AEDB 2Y64A 3GJAA 2FCUA 4GAZA 3EQEA 2WNVA 4IEYA 3D3AA 2D3RA 1ZRCA 2SLIA 4CXYA 3CF6E 3ZX7A 3MIFA 5JMOA 1E5RA 4PF5A 3C2UA 3OBAA 2JE9A 1C5HA 1HB2A 3DPRB 5A3UA 5IVBA 4O9EA 2ZA9A 3I2IA 3G6JB 5FY7A 2EICA 4EROA 4Y22A 1MR5A 2YGLA 5HV0A 4QPWA 4YZ3A 1DZQA 3VGIA 3T1LA 2ZGLA 1CAVA 2DUPA 3VV1A 5LZ6A 2W68A 2YFZA 3ZKUA 4BISA 4CU9A 3ZR5A 2PLV2 3W59A 1TME1 2GNBA 4A3ZA 5KC6A 4P14A 1SCSA 3WW3A 4RHV3 2HBTA 4X8NA 2OS2A 4URAA 3O1PA 3VZKA 1WW6A 2YFUA 1UIJA 3ZMOA 2JG8B 2DFCA 2JKBA 2BBAA 2GP5A 1BEV2 2XBO3 3HPNA 5A6XA 1GNHA 2QDNA 3H9AA 2FBEA 5APAA 4D7TA 4DEQA 1M4WA 1RUE3 2HWE3 2ZGMA 1KEXA 5FY4A 1TVGA 1NQJA 2VMGA 1T6BX 1W8FA 1TME2 1TME3 1B09A 1BMV1 4HPKA 4KG8A 4KU7A 2ARCA 3VBUB 3SCFA 4XXAA 2ZX1A 3RWNA 2D7FA 2GALA 1J3QA 2IFWA 3MFCA 3VZLA 2MPFA 4IE0A 4XUTA 5JI9A 1N1TA 5FP3A 5T50A 4NHMA 5E1RA 2XHKA 3T4HB 4ZXEA 4AYUA 2XMLA 1WBLA 1F15A 4LK7A 3HNYM 4K40A 5C3RA 3KQ4B 5DABA 1A8DA 3EYPA 1YLLA 3WR0A 5JVVA 1BMV2 3LZZA 4K1YA 1UMZA 1WD4A 4K20A 4XFGA 1ZRDA 2OQ6A 2XVGA 1RUH2 4D6QA 4JKLA 4QGMA 2YC2A 1V6MA 4FXGB 1UU5A 3PMEA 1D2SA 1DGRN 4XUQA 5T54A 1K5MA 3IDEA 1ZM1A 4Q26A 2RV9A 4XILA 4Y1VA 3WNLA 4CEWC 4ZZ8A 5JOZA 1RL3A 5FYSA 3LIGA 2RR11 4V1PA 1LULA 4Z82A 4A7ZA 1ASJ1 3RZMA 4NAMA 1ZZBA 4META 4P5YA 2OKXA 3EHKA 5CFDA 4ITCA 4N9IA 3NQHA 4CDQB 5IVFA 2BGOA 4BJ0A 1AXZA 3BTZA 1WMFA 1GZWA 2D6OX 4JDOA 1MZEA 2RR12 2AH2A 2RR13 1J59A 2FZ1A 3GHMA 4OI4A 5HCHA 1ASJ2 1VRBA 3PUAA 5F3GA 4CDWB 2ZJCA 5FOJB 4LOTA 3IDCB 2DCKA 5DN2A 5FYIA 4LHNA 4QX2A 2D3PA 3VDDA 4LHKA 1VBA1 1O8PA 4XETA 5IAXA 3R4SA 3WUDA 5CA6A 1ND3C 3AKQA 1UZWA 2VZTA 2A5ZA 2WWJA 1WW4A 4PQ9A 1IKQA 2VCAA 4CUCA 2VQAA 1UO9A 4NIIA 2XJQA 3PU3A 4HVQA 2RMU1 3WDWA 3ZKYA 4MGTA 5JUVA 5EQUA 3AKRA 1FYUA 1W6PB 1UZZA 4DY5A 4IW3A 3CBNA 3E6DA 1DLLA 3CO2A 3J26N 4XTPA 5LBFA 3VKFC 2XJRA 1UZYA 5DUVA 3ZXGA 2FDJA 1JXNA 4QHOA 1NXMA 3P1IA 1VBA2 1VBA3 2A3XA 5EXOA 2YMZA 4IE5A 4XXPA 3WDYA 2XPJA 3HMYA 3KHCA 1J3RA 2XH6A 5FKCA 2XL7A 4AHZA 1E5SA 1OVSA 2FHRA 1DG6A 2ORZA 5EYXA 2RMU2 2RMU3 1NCQC 3VZNA 3DL3A 1N1YA 5ISLA 3Q8AA 3V0AB 3POWA 4XOGA 2LTNA 3DN7A 3IIAA 4QU1A 1W0NA 1ZYBA 1JODA 2Q1ZB 2WSVA 2EF6A 4A41A 2ZXQA 5K0UA 4PLNA 1AJOA 1YWKA 2RDNA 5A80A 1DDLA 2VUCA 1PZ7A 4QX5A 4CEYC 1DQ0A 1CJPA 1U12A 2HWF1 1VJ2A 1KITA 1PO11 2QQWA 3H8UA 2VAUA 2D6MA 4M3CA 3ZYRA 3ACHA 5C3QA 1W90A 5FYTA 1US3A 3ELNA 3NJVA 1OXCA 3H7JA 2PQQA 5FK7A 2PHDA 1ALYA 3FN9A 3H3ZA 1WCDJ 3OYWA 2JECA 1FX5A 4XYXA 4XF1A 3ZR6A 4EN0A 1LB2A 5J96B 1W03A 2WT0A 1MZ5A 1VBD1 4YWAA 4AHXA 4NRMA 4SLIA 4DXTA 2ZZJA 1SBFA 2IC1A 3IZOA 2B39A 4TLGA 5ANQA 1S0DA 4RR3A 2HWF3 2ERFA 1PO12 3I3QA 3MIEA 2QNKA 3RYPA 4GMP0 2G4IA 1WD3A 3LQCA 4M01A 4YZ1A 3ATGA 1SPPA 3V65A 4HXCA 2RS31 4ASLA 3WCRA 4UYBA 3PLQA 1S0BA 1YQ2A 4YZ5A 3I2DA 5AVPA 2P4EA 5FLIA 1VBD2 1VBD3 2B4KA 3PUHA 3SITA 2VNGA 5EJ3A 2VQUA 4E27A 2JG9B 4LLFA 4NWWA 3RZGA 3OUHA 2ZKNA 1H4GA 3AFKA 2Q4SA 4FOWA 4RA0A 5FYVA 3WNKA 4YPJA 1VRH3 3PIJA 4GWNA 2BEOA 2FCVA 2RS32 3C3VA 1SQ4A 1XQNA 1DYPA 1DZTA 5F5AA 2F4LA 4XFIA 3SEPA 5F3CA 2WR9A 3UYJA 1GNYA 4AOCA 1JOPA 4CP0A 3ILFA 1B35A 5D1IA 1GWKA 2ZX2A 2EIEA 4P9YA 2TBVA 1RUD1 2W1UA 4R9AA 3MV01 1O3QA 1KJLA 2GSYA 2Z4FA 4QKBA 1MS0A 3A0KA 2VBBA 3Q8BA 4Y22B 4OQ9A 4AI3A 1FAYA 2PELA 2VVDA 3S30A 1SLIA 2YC4A 4XFAA 4XBQA 3GZTB 4JGYC 5CADA 2AEZA 1KDKA 2QQMA 2WA4A 1SFYA 2X53S 3OTFA 4P00B 1R093 3WQ0A 3CJIB 4D7SA 4YW5A 1JZ2A 1IQDC 3T2OA 2PMWB 2EVXA 2IXKA 3WF2A 3UL2A 3T30A 1KRIA 1AR61 3KS7A 1RUD3 1SBEA 1XYNA 3WP4A 4DQAA 4DEVA 1V9U3 4OI2A 4ASMB 4DY3A 4FPKA 4HOOA 1AZDA 4XQWA 5FZHA 5T55A 5JPNB 3U37A 4LKFA 4LMFA 5A7PA 1OFSA 4ARXA 2XQXA 5GZEA 1O5LA 1OA4A 3LEMA 3OY8A 4MGKE 4A7YA 5B2GB 2V4AA 2PYTA 1YQ5A 3RRDA 1LHUA 4RS5C 4H2AA 3SISA 3FHAA 4BWOA 3H8XA 1X9PA 1RMU1 3E1F1 3OGSA 1AR62 2HWC1 4IV1C 3ZN6B 1RUG3 1ZBA3 4DXRA 1GP5A 1OT5A 3ZFFB 1VLNA 1ZBE3 3LEIA 4QB6A 3VBHB 4AVCA 1GMMA 5IVYA 4B4QA 1C57A 4RGGA 1R081 3IM0A 4C0HA 5LA2A 1HIXA 3OD4A 3QLQA 3OGGA 1OOPA 1QIQA 2RM21 1MZ6A 1RMU2 1RMU3 3Q8FA 4BQ2A 4A6OA 1MS4A 3MW2A 2HWC2 2HWC3 2RDRA 4UW4A 4LULA 1F8VA 1CIWA 3RMYA 3U1XA 1NAEA 4GH4A 1GZCA 4LHSA 4OVEA 1K5MB 1R082 1R083 2E53A 4N43C 4XZPA 5FXWA 2ES3A 5BXXA 3MICA 5A3MA 2RM22 4UFMA 3MIHA 2OZJA 4B29A 1Q5OA 2JICA 5EPAA 2BERA 2WINB 3PJQA 1EPZA 2XVLA 3HQUA 2OPKA 5CFDB 2FD8A 1IQAA 3M70A 2PAMA 4HKLA 4LKSA 5FBZA 2DCZA 5GZFA 1W2TA 1D0HA 2JDPA 2VR4A 2J1SA 3NWKA 2GC1A 4Q4X3 2IWGB 3UT0A 1YXWA 3IBMA 2CGPA 5LASA 4IXLA 3WDUA 5GKAC 3RI9A 4Y1ZA 5JR2A 4KI5M 5L7OA 3VDDC 3QACA 1Y9GA 4YVWB 1ZNPA 3M3OA 5GLUA 3I49A 2B5HA 1OURA 4FFGA 2EAAA 4IEOA 1H6XA 1RJ8A 1W6NA 3SC7X 5T5JA 5FZDA 3A22A 1MVQA 1IS4A 4JRLA 5F6KA 1CESA 2WO3A 2YY1A 2VTFA 4H7LA 4P9XA 2XLGA 4XBNA 5FZOB 5CFCA 2NP0A 3H1WA 3O7OA 1H0BA 1WW7A 3P3NA 3KGLA 4I0BA 5C8CA 1TNFA 3TOJA 2WNEA 4MXWB 2MHFA 3DKWA 1XXNA 3PNAA 4Y20B 3VHPA 1HQWA 1MS9A 1W2NA 1ZZ8A 1UYPA 2QQNA 4LO4B 1PIV1 2BQPA 4NOTA 5FMDA 5KHJA 3OSDA 1G9CA 1W99A 5C4WA 1E5IA 5FR3A 4LTAA 3BUCA 4DINB 2LW8A 3HBKA 4QPIA 5EYYA 4YW4A 2PTMA 1FATA 1COV3 2BRTA 4K7JA 1NA1A 3P6BA 4NPMA 4MG2A 5LW9A 1LR5A 2W47A 3HEIA 2A3WA 4MGSA 3RYKA 1ND2A 3HT2A 3J7LA 3FJSA 3PMSA 1GKBA 2XUMA 4FO9A 4LE3A 4RQPA 2OYZA 1LGCA 3WG2A 5JZGA 2EXIA 2QCSB 2A73B 2GC2A 3KWVA 1PIV2 1PIV3 2FDFA 1UZVA 2VC9A 4HFSA 1Z7S1 2BZDA 1QDOA 2VOVA 4DO0A 3NMBA 4JQTA 5BNNC 1C4RA 5FJHA 2W0XA 3ME2A 2PAKA 2V5DA 3B93A 4GWMA 4FOVA 1QJU1 5BY5A 1YJLA 1H2NA 5GLZA 3AXEA 4RR3C 2HWD1 1G9FA 4CDXB 1K45A 3O0WA 4PLMA 4Q27A 3WNMA 3K51A 2WYFA 1UIKA 3LFIA 2EXKA 4FOQA 2R49A 4LBQB 3DYMA 4AFCA 4EWDA 4FQ4A 1Z7S2 1Z7S3 3WHUA 3WVJA 4R9DA 1GP4A 4RFRB 1LCLA 2B7YA 4XBLA 1QJU2 5DZGA 5E88A 3SCGA 2ZAHA 3M4FA 4E4HA 4Q0QA 3F95A 3WF4A 2HWD2 2HWD3 3QBQA 4B7KA 4Z1VA 3SMHA 3ES1A 1ZVFA 1OF4A 2EALA 5HXMA 1AL0G 2X29A 5K8SA 1IS6A 2B45X 4E2SA 3AKPA 2NYYA 5GZDA 3LCPA 5ABJC 1W05A 3S5AA 4OHVA 1CAXB 1UWWA 4COYA 4AI1A 5B4XA 4EZ4A 4JGZB 2R0HA 4P5HA 3ZXEA 2D43A 3S57A 3OBZA 3BOWA 4E8CA 4XFCA 2O8QA 4AEKA 1W04A 4JQRA 4FFIA 4TXWA 1Q8VA 3SLIA 3E5UA 1GBGA 5L9VA 4B3NA 3D82A 4IDZA 3P3PA 2VU9A 3S6PA 1LRHA 5K4LA 3BTYA 1JOJA 1VALA 5KHGA 2CGOA 4HT1T 2FZ2A 3ILRA 4NMIA 4QPYA 3HD8B 2GH2A 4LO6B 3MF9A 4NIGA 2VCCA 1NUKA 5DUUA 2N7GA 3NV4A 3VBOC 1S0GA 2D5FA 1OSGA 2QE3A 4FP2A 4KBZA 4OUEA 4YGBA 3I59A 4LT5A 4GULA 2VH9A 5FZ4A 5AC91 1ST8A 3GZAA 2ETEA 3WSOA 1OBNA 1Q8QA 1XNBA 1MQTA 1JH5A 4HKWA 3UGHA 5IK7A 4AGRA 3GGLA 3V0BA 4N90A 4ZONA 1OLME 1AR91 1QXPA 1ODMA 2WA3A 5FFOC 3JQXA 4Y5Z0 2WZPP 4KWLA 3OY8B 4EWAA 5FDBA 4LHLA 1SLLA 4I3PA 5IATA 4Z2AA 1W6OB 3IB3A 3PVEA 3N35A 4UWDA 1SLAA 4K8RB 1YQ8A 2EIGA 2ORXA 3VBFB 5KXEA 5AC92 1NQDA 2BFUS 4GXLA 5AC93 1AYM3 3OPZA 1JTZX 3A7QA 1HX6A 2UY8A 1OPMA 1AR92 1AR93 1AXKA 3FLRA 3SXWA 2VMIA 5F7UA 1H8TB 2DTYA 1OOPC 3LDKA 3BIEA 1ZZCA 2VVFA 3UKNA 2IVJA 3OUJA 1QDCA 2YYOA 1STMA 4DUWA 1LEMA 1PGSA 2QVSB 2Y26A 4FCAA 4LIUA 2J1EA 4GH4C 3VZJA 3AVRA 4YW1A 5ANNA 4HSJA 4QKFA 1AR71 1XOYA 4M4RA 2X5IB 3H1YA 1CAUB 5BUVA 2V09A 3NNMA 1RHI1 1DGRA 1DQ6A 1WLWA 4W6WA 4UFHA 5C3SA 3USUA 4Z92B 4B1LA 3Q9OA 2HH9A 4LBJA 4FI9A 4NN0A 2EAKA 3NJYA 3S0MA 5FXXA 3FE5A 4GZ9A 4AXOA 4ARYA 1ZZ9A 4ONUA 4BQ3A 2AZ5A 5FAXA 1AR72 1AR73 2GAUA 1ND3A 2FMDA 2RE9A 1UOFA 4NROA 2DV9A 3NV3A 4YM2A 3LA2A 3OG2A 2K46A 3KCXA 2HLEA 1RHI3 2JD4A 2DTWA 4KMQA 1V6IA 3VBSB 3KF3A 3KV6A 4JC1A 3NKGA 2UURA 1LHNA 4ZS2A 1I9RA 5L7OB 3DEMA 3B9CA 3R6SA 1HB1A 3VBRA 1YIFA 1AR83 4CYDA 1REDA 2W87A 2P3YA 2EXJA 1V70A 3U10A 3MZHA 4XQ4A 1JZ3A 2OQ7A 5FZAA 4D94A 4W6XA 4CDUB 5HPOA 3B01A 2VNVA 4JRAA 3U0ZA 3CQOA 1NCQA 3L2HA 3ZXDA 1S0CA 1YFWA 4WM7C 1EAH1 3AKTA 1S0FA 2BW8A 4AVTA 3O1SA 1SZBA 2RG4A 4LE4A 4X6RB 4NWVA 5IVVA 5FYUA 5M0TA 3AL6A 5ACA1 2R071 3DGTA 5DUXA 4LBQD 2JX9A 2XJUA 4O61A 1ZREA 4OUSA 2WDBA 3MF6A 2WKKA 4MZUA 4WV8A 4X8PA 1IS3A 3W58A 3VL8A 4MO3M 3HT1A 4KWJA 5LBEA 5C8CB 4CEYA 3K4ZA 2Y60A 4UT5A 1O91A 2CNAA 5C4WC 5LWBA 5CG8A 1GR3A 2NPIA 2IXHA 4QPIC 2EIBA 2WFF1 1EAH2 1EAH3 2BU9A 4AFDA 2JE8A 4HN0A 4YG3A 5BPXA 2GC0A 1DGWA 2VTXA 5GJ6A 2VMDA 2ZPXA 3O5SA 1VBC3 2VGDA 1CPNA 3FZ3A 3GCXA 3SH3A 5ACA2 2TEPA 4V2WA 2R073 5JXHA 3J7HA 4KU8A 1YNAA 3Q8EA 1VR3A 2R061 4XQDA 4O65A 1C8NA 1CPMA 5DAVA 2PFWA 3RNSA 2Q0AA 4TWTA 3N7LA 1EV12 4B1MA 1SG3A 3CEWA 4CUAA 1GICA 3ILNA 5BYNA 2WFF2 5JLVA 4IGOA 3U75A 1QF3A 2DFBA 3K4AA 4F3JA 2G9ZA 4BK5A 4YLZA 3ETQA 3LAGA 1JW6A 4R9CA 3THDA 3BIWE 4FP3A 4MGIE 3ZXAC 4QDSA 4WVZA 4DXZA 3LE0A 2R062 2R063 3LGRA 1S1AA 4WVMB 3UK9A 2ZGOA 5C9AB 1UCXA 3IPVA 4H14A 5CIRA 4QD2A 4ET7A 5FRAA 4DZGA 1ULPA 4LQRA 2BOJA 3VD9A 1QNWA 4UFLA 3KMHA 1GOGA 5FY5A 4NIAA 1W9FA 2ARXA 5LB6A 1GV9A 4N9HA 2JDYA 1NZCA 1H1MA 2BJSA 1G86A 2PLV1 3A21A 2DCTA 3MHZA 4N53C 4YG0A 5JI7A 1OQ1A 1W0OA 2YPJA 2DWRA 3KHBA 3RGBA 4JKMA 1PHMA 2BVBA 3RZKA 4S2FA 1H8VA 5KHHA 5E16A 1JZ5A 1BEV1 5LA9A 3T1MA 2HJIA 1OI6A 2NMOA 4HL0A 4BB3A 5KHIA 1LKNA 1N3OA 4JGYA 2XQRA 4OFGA 2PLV3 4XFHA 5H9RA 1AXYA 1CR7A 2Y8KA 3ZFGC 2KD7A 1H9PA 3ZM8A 4F8AA 2HYXA 4UW3A 4AG4A 5G04L 1WCKA 4QM9A 4Y4YA 3RJ2X 2LM3A 3FX3A 2OUHA 4JHTA 1W6QB 2ET7A 2RJ2A 1ZX5A 4Q1RA 3SNMA 1OMIA 1BEV3 2CDPA 4PBPA 5EZWA 4D6RA 4PI0A 2IXIA 2P1BA 2VCBA 2VM9A 3IIIA 4P9GA 1WCQA 3BPZA 5BNOC 5IK8A 4YGCA 2F6BA 3F2ZA 1LOCA 4UFJA 1XJAA 4LNVA 4M0HA 4RS5A 3FBMA 3IDAA 5DQ0A 1AX1A 4XACA 2ZX0A 3V56A 1UOGA 1RUH1 4HBNA 3OF1A 3PVNA 4MV2A 1UU6A 2GMPA 5FJKA 1MQTC 5FPAA 4XJZA 4EJRA 3PVBB 2ADEA 4IV1A 4IV3C 3NKTA 4LBKA 3TEZA 4IEZA 4CCOA 1DBNA 1JYXA 1S2EA 2FMYA 3N7JA 1W3XA 2LALA 5LY1A 1G6NA 2B9UA 2JIJA 5IAVA 4XE9A 2Q8CA 3VHRA 3ZPYA 3V0BB 3TNPB 1BBT2 2X09A 4LOSA 1D7PM 2NMNA 1OLRA 1XU1A 4JAAA 2BNNA 3VBUC 4LORA 1RUH3 1H1IA 1XE0A 3TN91 5LEJA 2VZSA 5FYZA 3MPBA 3QD6A 3U14A 2RJKA 5E6HA 1IKPA 3WQBA 3DXTA 4P08A 3ZYPA 5JMCA 4QX7A 3AMNA 5FZBA 5CU1A 4YM1A 2JDNA 3AJYA 3AMMA 5GLVA 5IVJA 4TZDA 5KXDA 1K42A 4AI2A 1VMHA 1L7LA 3HVDA 1JYTA 4I0WB 1WW5A 3THTA 4CEWB 1GOHA 2A1XA 5LRSA 2W52A 4N43A 5FXVA 5A7QA 2ZEWA 1QH7A 3M7AA 3ZFEC 1F5FA 3JB4C 5JAXA 4AQTA 3TN92 5F32A 2RVAA 2VPVA 3TN93 3D0SA 3WXPA 1K5JA 4P9LA 5FZEA 5F3IA 1V00A 2ZCWA 2ADDA 1QQP1 3MIGA 1NCRB 1R1ZA 4XCBA 4QQ2A 4BQ1A 5IVEA 4YVSC 1SDDB 3GHNA 1LOFA 3I2GA 3RG0A 4DB5A 3FLTA 3I3BA 1QJY1 4IEUA 1BK0A 4BDVB 1ASJ3 3B00A 3RQ0A 5F5QA 2Q1MA 4OCTA 1VPHA 3DXUA 4ZU4A 4ATEA 4ES9A 3N9PA 1HJFA 4FPYA 2W1SA 1ENXA 4HSLA 3JXSA 2BWAA 1D2QA 2G19A 5BV6A 3WW2A 4CDQC 3C7HA 3WDVA 1QOOA 4XJ8A 3WG1A 2XKOA 3I3DA 1C28A 1QQP2 1QQP3 3M3QA 4P02B 3OD0A 1NLQA 2I74A 5A6ZA 2QFEA 5IK4A 5FTTC 1QJY2 1QJY3 1W06A 2CWMA 3HOBA 5J09A 1UY2A 2A71A 5FOBB 1JN2P 4XF3A 4GWIA 4L99A 2YBKA 5T5PA 1G9AA 2WABA 5FPZA 4Q0PA 3DF0A 1CZTA 3RMXA 2C6SA 3WT3A 5KHKA 4QHZA 3RS6A 5FQ0A 4XDPA 3VBRC 1A8MA 1JHJA 2O1QA 2RDQA 4PIXA 5ERLA 4XDQA 4UF0A 2GNTA 4UAPA 5FUPA 4E8DA 1TQ5A 2KR2A 1L7QA 2QQUA 2R30A 4BE3A 4HVOA 3IMMA 5KC5A 1ZRRA 5KR7A 4DXSA 3WP3A 2I07B 3C7GA 1KFXL 1BLZA 5J37A 5FP9A 5BNPA 1L3JA 1W8UA 3MV11 2DU1A 2OXBA 1UMIA 2VUJA 5LATA 4XHBA 2GN3A 5D8AB 3H8RA 4ZKTB 2VZRA 1HB3A 1DHKB 1TZOA 2WO1A 2H6CA 5IW0A 2D6KA 2FQPA 5LRRA 1MS3A 3LSDA 4FPOB 2VOXA 2O8OA 4FPHA 4K21A 4LXLA 4IGPA 5A3OA 1U5YA 2BBVA 3R0RA 2IXCA 2W3JA 2Y34A 3AP7A 4NRQA 4CEYB 4PT6A 5FPBA 4F83A 1X9TA 2JDMA 4DRRA 4QXBA 5BNNA 1IS5A 3BU0A 5EWSA 1POQA 1V6OA 1HKDA 3NAPA 4XJAA 3MUY1 2H6BA 3GM8A 4LO7A 4P9WA 1HW5A 4RD7A 3U07A 2KXLA 3KB5A 2RJLA 5DPNA 3GBFA 4EZHA 1PO13 3C7OA 1WMXA 3G7DA 3H1MA 3IKWA 3NNLA 5J36A 4CP2A 3I97A 3RZLA 1WA6X 2RS51 5EHDA 1C1LA 3PJYA 4BLJA 2WZEA 1RUOA 4BH9A 3ALQA 3KLSA 1IPJA 3HR9A 5B4NA 5FP7A 2VVEA 1WA4A 5A1AA 3W5NA 3WV6A 1AL21 1ENRA 2Q5TA 4WZFA 3CIHA 3POIA 5SV8A 3MW4A 5CYYA 2XHNA 2Y33A 3KCYA 3AP5A 4LBMA 5DG1A 3RFRA 4YG6A 1GYKA 4ZU5A 5A32B 4PIZA 2RS52 1GU3A 3C7EA 3K4DA 2J1AA 5FPVA 1W8TA 2DURA 2RS33 2DBIA 2GMMA 1AUYA 5L19A 1ULOA 2WNVB 2VO5A 1TEIA 2XG3A 3WDXA 1J3PA 4PLOA 3O1MA 5ABJA 2W94A 1AL22 1AL23 3LOBA 3AP4A 2ZHNA 2AEYA 4Q5OA 2JG9C 1Y7BA
chains in the Genus database with same CATH topology
4JTNA 1XNDA 1UKRA 1JBCA 1RJ7A 1YFXA 1S2BA 4AFAA 4E9KA 1RGSA 5EFUA 2IXLA 4IEQA 1RUI2 5F9TA 4YRDA 1PZ8A 2Y0OA 2P3IA 1WMDA 3O14A 1IZ3A 1CAVB 4HK9A 5J98B 2CL2A 3MLJA 1GANA 2E51A 5JCTA 2HYKA 5FCCA 3VBOA 3MYXA 4AWDA 4BIOA 1SLBA 4PDWA 2AENA 4JVAA 3TAYA 5I0RA 1I6XA 4BOWA 4I0AA 2VY0A 4XEZA 5C8WA 2WS91 3ZYIB 4HANA 3CJIC 1IOAA 1Q8SA 5J3UA 2E7TA 1AR63 1VAVA 2VMHA 4HPKB 3TBDA 3LSEA 3AMPA 4B4RA 3POYA 2R041 2P3KA 4S2HA 1NG0A 3WUCA 2DVFA 2WS92 3HWJA 3IWZA 2OA2A 2WLPA 1DIWA 2H0BA 2NM1A 4JTOA 4C0BA 1H2MA 3D4KA 1PK6C 1PVC1 3JU9A 4GALA 5CAZA 1VBB1 1CX4A 2ZHKA 3ZFFC 5J7MA 1XYOA 3ZYGA 1C3HA 2R042 2R043 2CYFA 2IFRA 4INDA 3VBHC 3VKMA 3VL9A 1BZWA 4QQHA 3TNQA 1XE8A 2R1DA 4C90A 2AYHA 4YGDA 3AMHA 1MS1A 4N43B 1FPN1 2RM23 3AZWA 3FUQA 4LO5B 1PVC2 1PVC3 1U5ZA 3QCWA 1Z78A 1VBB2 2C0ZA 3JQWA 3R05A 1TMF1 3RJRA 3OGJA 1LOFC 4JCKA 5FO7B 5AFEA 4QQPA 3ACLA 2UWAA 3FFZA 2MNGA 3SH4A 1GZWB 5JSOA 3BOPA 5T5OA 2JXAA 1FV3A 4NR1A 3POSA 4AI0A 5JOYA 1FPN2 3AZZA 1APNA 3GBGA 1H1AA 4XF4A 1ULFA 5I0UA 3W9AA 3OJBA 4I01A 2V73A 4R4XA 3MPPG 4MXVA 4XF9A 5JOXA 4KL1A 2G9FA 3LWCA 1TMF2 1CAWA 1TMF3 3FWEA 5DUWA 5A33A 2E7QA 1V6LA 3VDDB 4EN9B 3ZSJA 5FPXA 1JYIA 2B8MA 5FMOS 2Z69A 4BA6A 1QWRA 1C5IA 1WLCA 3WX5A 4DMIA 1I3HA 3VHNA 3USSA 3KD4A 4FPEA 4FVVA 1Q56A 5JR7B 4BZ4A 4COWA 4WM7A 4YVWC 4AVVA 1MEC2 5FQ0B 4OHWA 5K9YA 4GKYA 4LEJA 1MS8A 3TYJA 1WMEA 1CD3G 5KXCA 3QH6A 1A3KA 1YI9A 2WNUC 5BNPC 1ULCA 1FT9A 4NVPA 3ZXKA 1XNKA 2C5DA 3ST7A 5SV5A 5JIAA 4LA3A 1X82A 4L97A 2OVUA 3NJZA 3ZXJA 4WVWA 4BM8A 4GKXA 5I8TA 1LHVA 1U5IA 3CU7A 1N1SA 4FAHA 3E6BA 3IMNA 3WW1A 1LOBA 5K0UB 1C1FA 1O4YA 2VW1A 2JJ6A 4IETA 2EXHA 2BTVC 2O0OA 4M3CB 4WM8A 1OLQA 2E7AA 3LKJA 4H3WA 4KGGA 3BTAA 2WQ4A 4MYEA 3OYWB 1Y43B 3NAPC 5HBAA 1DYKA 3ZN4A 2YZ4A 4HVRA 5AVAA 3E5XA 1DQ4A 3ASIA 3KQRA 1DQ5A 3VKOA 3AYCA 3OCPA 4XJWA 4RR3B 1CGPA 1CJDA 4LBLA 2ILMA 5I8SA 4B4PA 2ZMLA 5E89A 4AFBA 1REFA 2NLRA 1W6MA 1QJU3 1FV2A 1MVEA 5HCFA 1LODA 3L9JT 4N53A 3HIFA 4WBBA 4XIKA 3H7YA 1ENSA 3WG4A 1Y3TA 4LLOA 1G9BA 1PMIA 4QT6A 3UKVA 3I7DA 3ZVXA 2ET1A 4E4SA 3RDIA 2YXSA 1AX2A 1NY71 4S2GA 4BPZA 3APBA 3UKTA 1RUF1 2A7AA 2QDRA 5CG9A 4OI0A 4DNYA 3DPRA 1B35B 1LU2A 3ZFGA 4FPFA 3K48A 4L11A 1F31A 3KT7A 4QGLA 1HRI1 1MS5A 4EWEA 3D8CA 4Y1XA 1NY72 5TSWA 3T2TA 3INAA 3JBG2 1RUF2 1RUF3 4JGZC 5BNOA 1YCIA 4AW7A 1X8MA 1QJZA 4XIOA 4PDWC 3VBOB 1MACA 2NQYA 3H3UA 1D4VB 1HRI2 1HRI3 1KJRA 5FREA 4IV3A 3VZOA 2A75A 3FBYA 1X33A 3ZIWA 1RUC1 2PA7A 2WSUA 2DVBA 2D6PA 4Q0UA 1Q8OA 3WZ1A 1LTEA 4XTMA 2GC3A 4BCUA 4EN7B 1DU3D 1DF0A 3VBUA 3M1HA 4YNIA 3A4UA 4P9IA 3DUIA 2YHJA 4IQPA 3WCSA 2ZZQA 5FLHA 1RUC2 4C91A 4YM3A 1U5XA 2GNDA 2PHUA 4BHPA 5DDJ1 4MGZE 5KBFA 2RS11 1OOPB 3ZFEA 4Q29A 5GZCA 1CQ9A 3AKSA 4F7ZA 2PAEA 3FMGA 1REEA 1SLTA 2ZGRA 2VUAA 3B3QE 4GH4B 2D6LX 1H8TC 2XJTA 4YVSA 2WWSA 2DVAA 4YFZA 1LHWA 4COVA 5JIUA 5DDJ2 1YFYA 5DDJ3 1UD1A 2RS12 2RS13 3RI8A 4FSJA 5H9QA 1HXS1 2ARBA 3JD71 1QMJA 1POV1 1QY4A 3IDBB 3JZVA 4Q0VA 1ULEA 2AR6A 4CDQA 4QPGC 2A6WA 2UWCA 4ISRA 3ZSKA 1UF2C 2X5IC 2ZABA 2ZGTA 4BMBA 3CLPA 3AX4A 4R9BA 3RPQA 4CDWA 2K9ZA 4K1ZA 1N1VA 2R0FA 4M0NA 3FC0A 1HXS2 3ZXFA 2QUOA 3JD73 3JD72 4L8QA 1POV3 1ZRFA 1LOEA 4LUKA 4YM0A 2P34A 2GMEA 4M3CF 3WQ7A 4TYSA 4NO4A 3EBRA 1W6NB 1SBDA 1W6PA 2PN5A 4B8EA 1SFNA 3GBWA 3AM2A 1CONA 1I1EA 3QH7A 1S0IA 3MIBA 4GA9A 4QQOA 1N3PA 2XKPA 1JUHA 1KXGA 4AF9A 3WQ1A 1PO21 5CFCB 4E4DX 1KS5A 2LUWA 1BK1A 4XFBA 2UWBA 3X29B 4CDUC 1HQNA 4YSFA 1D4M1 1EV11 2A6YA 3V0AA 3I8TA 5C4WB 5JSRA 2YROA 1ZZ6A 1DGLA 4HZFA 4QPIB 1IGOA 5KWRA 1SEFA 5ACA3 2D40A 1AYN1 2VNOA 2YDEA 1NA1B 5L36A 1PO22 1PO23 2CWSA 3R4DB 1ND2B 4YARA 4RQPB 4WM8C 4FBFA 5JZGB 3WP5A 1D4M2 1D4M3 1NOVA 4HMZA 2QKDA 1EPWA 1EV13 4OHYA 4LO8A 5I0TA 1BJQA 1WLTA 5IT6A 3FUOA 2WFF3 4JDNA 4BIFA 2A6XA 4LR4A 4QQLA 4TLFA 4GB31 1AYN2 4WZCA 1IPKA 3N4MA 4Q4W1 1UW8A 1VP6A 2PHRA 2ZX3A 4Q2FA 2JDZA 2QQPA 2B46X 4KWKA 1OHFA 3D6EA 3GALA 3J9SA 3VUOA 2BFUL 1FI2A 1W2UA 4GB32 1ULDA 4GB33 4M00A 2JG9A 2P3JA 4Q4W2 4Q4W3 4U36A 4AEDC 5CB7A 1SDWA 2A6ZA 4Q0SA 4QGNA 4AVSA 5A3LA 1WGPA 2A3YA 2A6VA 1RITA 3AMQA 2Y0IA 1URXA 1X7NA 4BYYA 4EN6B 3U4XA 2A70A 1PM7A 3AYDA 4BMEA 4KG0A 3MIDA 4DOUA 1XNCA 1NXD1 3DPRC 1QXJA 2YGMA 2ZGSA 4QU2A 5GZGA 4RL7A 1NLRA 4RHV1 2R6QA 3ZFGB 4AI8A 4LBOA 4NPRA 4ATFA 4N7UA 5T3NA 1OFNA 5T5LA 2IXJA 2R32A 1XE7A 2XJPA 4AQ6A 2PHWA 2XBO1 3M2MA 3MLLA 1BBT1 4XMIA 1RUE1 3CJIA 3NV2A 2HWE1 2X8KA 4KGQA 4KBBA 5BNOB 4I09A 2DU0A 4LA2A 4RHV2 1KQRA 3I59B 1I5ZA 1N3QA 2JG8C 2VG9A 3AK0A 1SACA 4XW3A 1KS4A 1MQTB 4CZSA 3ZDSA 3B02A 4IV3B 2XBO2 3ZIXA 5I0SA 1AX0A 5F6LB 1BBT3 4I30A 1RUE2 4CP1A 3EJKA 2HWE2 5H9PA 1HV1A 1DQ1A 2OZ6A 1FNZA 1W0PA 2XLFA 1NYWA 5T52A 4UBHA 3E6CC 3WG3A 2ZMKA 2R1BA 1PK6A 5IK5A 1ZA4A 2XWJB 4P9JA 3PTYA 4MH0E 4YW2A 3UV9A 3ZN6A 2VW2A 1QOTA 3ZFFA 5C6CA 3VBHA 2DUOA 4G9SB 3URFA 4FTEA 1Z0HA 1OD5A 5L73A 1F9KA 4J6GA 1OA3A 4A2UA 4L2NA 3ZFEB 2WT1A 1RB8G 3WP6A 4YZ2A 2RHPA 4FXKB 2VOWA 1O3SA 3IN9A 4FTBA 1V6KA 1EP0A 4I02A 4YVSB 3JB8A 3GF6A 2DVGA 4HLTA 4R4ZA 1GFF2 1V6NA 2ZTNA 4MGYE 3GYDA 4Z07A 2WIIB 4ZXKA 3USUB 4AEJA 1LU1A 1J1TA 1S55A 1C8M1 1NCRC 2C9AA 2D44A 4XMAA 5I93A 3V64A 4D7YA 3ENRA 5K7PA 3FHIB 2Q30A 3RSJA 4ES8A 4HN1A 1ND3B 4CDWC 3KGZA 2I2SA 2QJVA 2OUJA 1RTVA 2I45A 2D98A 3OBTA 3NV1A 1SLCA 3WW4A 2ENRA 4Y1UA 5I8YA 4YVWA 2KM2A 1C8M2 1C8M3 3VBRB 1GSLA 4M3CE 4A7KA 1NE6A 3B7MA 3NO8A 1JUIA 2GH8A 2QZ2A 5DG2A 3ZXLA 2VQ0A 4SBVA 1YYNA 2WNUA 4X6QB 3M3IA 2BGCA 3J8F1 3S7EA 1VAKA 2IZWA 2UU8A 3RYRA 1NCQB 3D5OA 4XF0A 2HEYF 3N36A 4GMP1 2YUEA 4K9SA 1LHOA 3LA3A 3J4UH 2PHTA 4NHKA 1FOD1 1YIPA 5LEKA 2OW4A 4MXWA 1HQLA 3L2YA 4Y20A 4RGAA 4Y24A 1H2LA 3VHOA 3R4UA 3GNEA 3J8F3 3J8F2 4MLOA 4OLLA 5D8AC 2WT2A 2XJVA 5JPMB 4W6YA 3B94A 4GMP3 3JUUA 4Q8KA 1FOD2 1FOD3 2W39A 4Y26A 4E4ZA 1QH6A 2EA7A 2ZGKA 2DF7A 2NN8A 3MI8A 3HQXA 2R16A 1PVXA 3MFAA 1XRUA 1G7YA 3B5LB 2BPA2 4IEVA 3AZVA 2ZGUA 2D5HA 2XL9A 3KT1A 4KQ7A 2GU9A 2Q8OA 4Y1YA 4CDXA 1O3RA 3BB6A 2AREA 5FLJA 1H2KA 2TUNA 1ZZ7A 2HWF2 3IPVB 1RUI1 2RS53 4LBQA 2ZHLA 2G9GA 4MX3A 3TWIA 1VRH1 5JWPA 3HAGA 2VULA 4CTEA 3WHTA 2HKXA 1X50A 4J1XA 1UPSA 2UY9A 2ATFA 4UBGA 1CN1A 1NLSA 3MLKA 4QM8A 2ZACA 2CAUA 3ES4A 2HEWF 5C33A 2ZKLA 4QHBA 1S0EA 1RUI3 3S7IA 3ZO0B 2ZGNA 4RFT0 1VRH2 1JYCA 2WNVC 1RUNA 1LOAA 1N47A 4IESA 1CAXA 2ZGQA 4JGYB 4JGZA 3WOGA 1R091 1DQ2A 4TSVA 4URTA 4FPLA 1A78A 4FTSA 1LGNA 5CNAA 2BWCA 1Q8PA 2DCJA 1V9U1 3N7KA 4EV0A 1UKGA 1Y9QA 1QOSA 1AHSA 3AZYA 2DCYA 4UW5A 1Q3EA 3M3CA 4DFSA 4Q4Y1 1PGW1 1WLDA 1R092 2ZBJA 4OULA 2VXRA 4RS5B 1VBE1 2Z79A 3VKNA 1RUD2 1QJX1 2BYVE 1V9U2 4GQ7A 2VNRA 3AP9A 4FPJA 1RUG1 3E97A 5I91A 4IV1B 1ZBA1 3TB0A 1OPOA 1QU0A 1RINA 1ZBE1 2WS93 2Z42A 1W39A 4FQZA 4UXAA 3NSTA 3RZZA 4FOYA 1TE1B 3E5QA 4Q4Y3 4Q4Y2 1PGW2 2PHLA 5DZEA 1W6OA 4MVTA 2DUQA 2AUYA 1VBE2 1VBE3 2CTVA 3VBFA 1QJX2 1QJX3 1GQHA 1PK6B 3AJZA 1RUG2 4PIYA 2XVKA 4XJ9A 5LK5A 3ROUA 1ZBA2 2PHXA 1GQGA 1ZBE2 4QMAA 4DS0A 4B7EA 3ZN5A 1H8TA 2C1FA 1F5JA 2BUKA 4JV4A 4HETA 5J48A 2E63A 1VBB3 4IL7A 1X36A 1BCXA 1AF9A 4OZXA 1K5MC 4QPGA 2CAVA 3ZYJB 2WL1A 3NVCA 4HKOA 4Q4X1 2X5IA 1CAUA 2PHFA 3A0NA 3CJXA 1FPN3 1V6JA 3SCHA 1HRV1 1GNZA 2P2KA 1YUDA 1LGBA 2WJSA 5CFDC 4IERA 2E6VA 1MEC1 4AGVA 1J1LA 4OHZA 4YGEA 3AFGA 5GLWA 3OBRA 3PVOA 2B42B 4UW6A 4Q4X2 3ZSLA 1G9DA 2ZAAA 1AVBA 3VBSA 1HRV2 1HRV3 1KD7A 2GDFA 3H50A 4YFWA 2WQZC 1MEC3 3VZMA 1ENQA 5KXBA 1LECA 3IT8A 5JSPA 4CDUA 4Z8BA 2WNUB 3KCCA 5BNPB 4XHXA 3VLBB 2K0GA 5HXVA 1SCRA 2DYCA 4QXKA 2GN7A 4AK3A 1KFUL 3TRSB 1COV1 4K3UA 2KA3A 3LA7A 3MEPA 3H0OA 3M3EA 2AGSA 2WZR1 1O4ZA 2VECA 1XYPA 5EV7A 4AVAA 1QKQA 2YV8A 1ONAA 2ZX4A 4D3WA 3EO6A 3PHMA 4E2GA 5BNNB 4H7MA 5GLTA 1LESA 1HDKA 1COV2 5K0UC 2DVDA 3NAPB 1X8EA 3MDPA 1VAMA 1FMD1 4NHLA 2WZR2 2WZR3 1Q43A 4I2OA 3BU7A 4YYOA 4COUA 1MZFA 1YRZA 3NW4A 5IUQA 4MSVA 3ZSMA 4XJUA 4CDXC 4LUMA 2ZMNA 4Q4V1 2BVVA 4WVMA 5H9SA 1FMD2 1FMD3 5C9AA 2XJSA 4AEDA 5HCBA 1RVF1 3HN1A 1EYBA 1YFUA 2ZOEB 3O0VA 3BALA 4D69A 3CL1A 3WINE 4E2QA 4W65A 3AYAA 1VB4A 3JBG1 4K8FA 4S2DA 1E57A 2CGNA 4GIQA 1LJ7A 1O7FA 5ABJB 1O5UA 2D93A 4HK8A 1QHDA 4Q4V2 4Q4V3 2Z5WA 4O9GA 1HV0A 3CNAA 1RVF2 1RVF3 1UAIA 2F4PA 1D0GA 4AHYA 4ORFA 4N7IA 4A3XA 4AEMA 3GZUC 4FPGA 1PGL1 4J1WA 3D0JA 3JBG3 4IEPA 1BKZA 1DZRA 4C1WA 4H55A 1U0AA 2WC2A 1B35C 2D3SA 2H0VA 3SHRA 1WBFA 3WY6A 4I3GA 1RC6A 1QGLA 2CY6A 1J58A 2UYAA 1RIRA 1H9WA 1W6QA 1YO8A 2JG8A 2E9QA 4PDWB 3SH5A 3DV8A 1PGL2 5CVRA 1S0JA 5GM0A 1H30A 1NE4A 4PCRA 3MGUA 2NZ9A 4R52A 2CV6A 4YW3A 5HCAA 2W08A 4RSUA 1OKQA 1VIWB 2XGXA 4LBNA 4U2AA 3AB0A 1JHNA 3N7MA 5FMOL 3WNXA 1O3TA 3UJQA 1AYM1 1PNFA 1LENA 5DZFA 4AGGA 2TNFA 1AJKA 1RUC3 4FPCA 5E8AA 2Z2SB 4OUMA 1RUJ1 4G3YC 1DFQA 3EXUA 2P37A 3LB9A 1O4TA 4IEXA 3VBFC 3KSCA 1SMVA 3WDTA 4PBOA 3VN4A 1H4HA 1AYM2 1PZ9A 1BVP1 2XB6C 3KZ4C 4G4FA 1QNYA 3I4IA 2HEVF 1UL9A 3B9IA 4CEWA 1RUJ2 1RUJ3 1WCSA 2GNMA 1UN1A 3B69A 2ZS6B 4DPNA 1HLCA 4L92A 3WLUA 4EN8B 4OHXA 2ZHMA 3O12A 3FFQA 3BODA 2P17A 4FAGA 4C1XA 1QXRA 1NCRA 4AQSA 1YHFA 3I54A 1LOGA 1BXHA 1ULGA 4QPGB 1OQEA 4MUVA 4DRVA 3N3HA 4Q8LA 1R1A1 4KH9A 2D6NA 1HXS3 1A6CA 1TNRA 4Z2WA 2Y38A 4COZA 4AQ2A 1YJKA 4YZ4A 3THPA 1CAWB 5A33B 4FT8A 1AR81 2D97A 5BNQA 1DGWX 4WVVA 2MEV1 1BQPA 1VB2A 1KDMA 3AXDA 3MW3A 4AHWA 1R1A2 1R1A3 3VBSC 3AP6A 1WUVA 3QOPA 1RHI2 3KM5A 1S2KA 5L7OC 1BYHA 2QZ3A 4WM7B 2JEMA 1UU4A 4IEWA 2ZGPA 1AR82 2V5YA 3ZMNA 2SBAA 3HBZA 2MEV2 2MEV3 3BCWA 4BLIA 5F1RA 2VOKA 1LEDA 1POV0 1GLHA 4OI1A 2GZWA 4R8HA 4ZU7A 5D8AA 4XPVA 1EY2A 1CVNA 2VW0A 2BNMA 3ECQA 5JOWA 4AFMA 3AYEA 4AE2A 1VBC1 1T6GC 5CFCC 2WFPA 5C8CC 2UYBA 1OQDA 4PJYA 1UX6A 3JCIA 5LK7B 3NL1A 1BVVA 4WM8B 3O0XA 2JENA 5JDBA 1FXZA 2K2SA 5HI0A 2HWB1 1OA2A 2XWBB 1NA1C 3UJOA 1AYN3 1UPIA 5DXDA 1VBC2 3FLPA 4BQ1A 1GZ9A 3M8LA 5CBLA 4XFFA 2R072 2XLAA 1ND2C 5FO9B 4KNCA 4ISQA 4RQPC 5JZGC 3KT4A 1G8WA 1F2NA 1YI7A 5FO8B 4K6BA 1FNYA 1PNGA 4AVBA 3AZXA 4L9BA 3U11A 2WLQA 5AFBA 2YC0A 4CRQA 3ZSEA 1IHMA 2HWB2 2HWB3 1W6MB 3LOIA 1M06G 2BNOA 2JE7A 1XU2A 2OIIA 5C9AC 4N53B 5GALA 3WD5A 5A32A 4JDMA 4Q1PA 4AEDB 3EQEA 2WNVA 4IEYA 2D3RA 1ZRCA 2SLIA 3CF6E 3ZX7A 3MIFA 4PF5A 3C2UA 2JE9A 1C5HA 3DPRB 4O9EA 2ZA9A 3G6JB 4EROA 4Y22A 1MR5A 2YGLA 4YZ3A 1DZQA 3VGIA 3T1LA 2ZGLA 1CAVA 2DUPA 3VV1A 2W68A 2PLV2 3W59A 1TME1 2GNBA 5KC6A 4P14A 1SCSA 3WW3A 4RHV3 4X8NA 3VZKA 1WW6A 1UIJA 3ZMOA 2JG8B 2DFCA 2JKBA 2XBO3 1BEV2 1GNHA 2QDNA 3H9AA 2FBEA 4D7TA 1M4WA 1RUE3 2HWE3 2ZGMA 1NQJA 2VMGA 1TME2 1TME3 1B09A 1BMV1 4HPKA 4KG8A 4KU7A 3VBUB 3SCFA 4XXAA 2ZX1A 3RWNA 2D7FA 2GALA 1J3QA 2IFWA 3MFCA 3VZLA 2MPFA 5JI9A 1N1TA 5T50A 4NHMA 5E1RA 2XHKA 4AYUA 1WBLA 4K40A 1A8DA 1YLLA 3WR0A 5JVVA 1BMV2 3LZZA 4K1YA 1UMZA 1WD4A 4K20A 4XFGA 1ZRDA 2XVGA 1RUH2 4QGMA 1V6MA 4FXGB 1UU5A 3PMEA 1D2SA 1DGRN 5T54A 1K5MA 3IDEA 1ZM1A 4Q26A 4XILA 4Y1VA 4CEWC 5JOZA 1RL3A 2RR11 4V1PA 1LULA 4Z82A 4A7ZA 1ASJ1 1ZZBA 4META 3EHKA 5CFDA 4ITCA 4N9IA 4CDQB 1AXZA 1WMFA 1GZWA 2D6OX 4JDOA 1MZEA 2RR12 2AH2A 2RR13 1J59A 2FZ1A 3GHMA 4OI4A 1ASJ2 4CDWB 2ZJCA 5FOJB 3IDCB 2DCKA 4LHNA 2D3PA 3VDDA 4LHKA 1VBA1 4XETA 3R4SA 3WUDA 5CA6A 1ND3C 3AKQA 2A5ZA 1WW4A 4PQ9A 1IKQA 2VQAA 2XJQA 4HVQA 2RMU1 3WDWA 3AKRA 1FYUA 1W6PB 1UZZA 4DY5A 4AVCA 3E6DA 3VKFC 1DLLA 3CO2A 3J26N 4XTPA 3W58A 2XJRA 1UZYA 5DUVA 3ZXGA 1JXNA 1NXMA 1VBA2 1VBA3 2A3XA 5EXOA 2YMZA 4XXPA 3WDYA 2XPJA 3HMYA 1J3RA 2XH6A 2XL7A 4AHZA 2FHRA 1DG6A 5EYXA 2RMU2 2RMU3 1NCQC 3VZNA 3DL3A 1N1YA 3V0AB 3POWA 4XOGA 2LTNA 3DN7A 3IIAA 1ZYBA 2Q1ZB 2WSVA 2EF6A 5K0UA 4PLNA 1AJOA 1YWKA 1DDLA 1PZ7A 4QX5A 4CEYC 1DQ0A 1CJPA 1U12A 2HWF1 1VJ2A 1KITA 1PO11 3H8UA 4M3CA 2D6MA 3ZYRA 3ELNA 3H7JA 2PQQA 2PHDA 1ALYA 3H3ZA 3OYWA 1WCDJ 2JECA 1FX5A 4XYXA 4XF1A 4EN0A 1LB2A 5J96B 2WT0A 1MZ5A 1VBD1 4AHXA 4SLIA 2ZZJA 1SBFA 2IC1A 2B39A 1S0DA 4RR3A 2HWF3 2ERFA 1PO12 3MIEA 2QNKA 3RYPA 4GMP0 2G4IA 1WD3A 4M01A 4YZ1A 3ATGA 3V65A 4ASLA 2RS31 3WCRA 3PLQA 1S0BA 4YZ5A 3I2DA 5AVPA 5FLIA 3SITA 1VBD2 1VBD3 2VNGA 5EJ3A 4E27A 2JG9B 4LLFA 4NWWA 2ZKNA 1H4GA 3AFKA 2Q4SA 4FOWA 4RA0A 1VRH3 4GWNA 2BEOA 2RS32 3C3VA 1SQ4A 1XQNA 1DYPA 1DZTA 4XFIA 4CP0A 3ILFA 1B35A 5D1IA 2ZX2A 4P9YA 2TBVA 1RUD1 4R9AA 1O3QA 1KJLA 2GSYA 1MS0A 3A0KA 4Y22B 4AI3A 1FAYA 2PELA 2VVDA 3S30A 1SLIA 4XFAA 4XBQA 3GZTB 4JGYC 5CADA 3OTFA 1KDKA 2X53S 2WA4A 1SFYA 3WQ0A 4D7SA 1R093 3CJIB 4YW5A 2EVXA 2IXKA 1KRIA 3UL2A 1AR61 3KS7A 1RUD3 1SBEA 1XYNA 3WP4A 4DQAA 1V9U3 4OI2A 4ASMB 4DY3A 4FPKA 1AZDA 4XQWA 5T55A 5JPNB 1OFSA 5GZEA 1O5LA 1OA4A 3OY8A 4MGKE 5B2GB 4A7YA 2PYTA 3RRDA 1LHUA 4RS5C 3SISA 4BWOA 1RMU1 1AR62 2HWC1 4IV1C 3ZN6B 1RUG3 1ZBA3 3ZFFB 1VLNA 1ZBE3 3VBHB 4B4QA 1C57A 4RGGA 1R081 3IM0A 4C0HA 1HIXA 3OD4A 3QLQA 3OGGA 1OOPA 2RM21 1MZ6A 1RMU2 1RMU3 1MS4A 3MW2A 2HWC2 2HWC3 4UW4A 4LULA 1F8VA 1CIWA 3RMYA 4GH4A 1GZCA 4OVEA 1K5MB 1R082 1R083 2E53A 4N43C 4XZPA 2ES3A 5BXXA 3MICA 5A3MA 2RM22 3MIHA 2OZJA 4B29A 1Q5OA 2JICA 2WINB 3PJQA 1EPZA 2XVLA 2OPKA 5CFDB 1IQAA 3M70A 2PAMA 4HKLA 5FBZA 2DCZA 5GZFA 1D0HA 4Q4X3 3NWKA 2GC1A 2IWGB 1YXWA 3IBMA 2CGPA 4IXLA 3WDUA 5GKAC 3RI9A 4Y1ZA 5L7OA 3VDDC 3QACA 4YVWB 1ZNPA 3M3OA 5GLUA 2B5HA 2EAAA 4IEOA 1W6NA 1RJ8A 5T5JA 1MVQA 1IS4A 4JRLA 5F6KA 1CESA