4H7MA

The x-ray crystal structure of the trichoderma harzianum endoglucanase 3 from family gh12
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
EAEAEFQTSCEQYAVFSGGNGYSVSNNLWGQSAGSGFGCITVNSLNSAASWHADWQWSGGQNNVKSYPNVQIAIPQKRIVNSIGSMPTTASWSYTGSNLRADVAYDLFTASNPNHVTYSGDYELMIWLARYGDIGPIGSAQGTVTINGQSWTLYYGFNGAMQVYSFVAPSTVTNWSGDVKNFFNYLRDNKGYPASSQYVLSYQFGTEPFTGSGTLNVNSWTASINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structure and Molecular Dynamics Simulations of Endoglucanase 3 from Trichoderma harzianum: Structural Organization and Substrate Recognition by Endoglucanases That Lack Cellulose Binding Module.
pubmed doi rcsb
source organism Trichoderma harzianum
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
total genus 56
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4h7mA00
4HK8A 1BK1A 3AKQA 3AMPA 3VHPA 1H4GA 1REFA 1XYPA 1HV1A 3AMNA 1OLQA 1F5JA 3AMHA 2B46X 1XYOA 3B5LB 1KS5A 1OA3A 2DCKA 3VL9A 1KS4A 3AKSA 3VLBB 2JEMA 3WP5A 2NQYA 3MFAA 2C1FA 2DCJA 1W2UA 2D97A 4H7MA 3AMQA 3VZKA 2VG9A 3WQ7A 3HD8B 3AKRA 2QZ2A 2D98A 3WT3A 3WQ1A 3WR0A 4S2GA 2VGDA 2B42B 2BW8A 1H1AA 4XQWA 1NLRA 3VGIA 2B45X 1BCXA 1REDA 3M4FA 3VHNA 2DCZA 1H0BA 1XNDA 4HKWA 1UU5A 3B7MA 4S2HA 3WY6A 1OA2A 1IGOA 1QH7A 1H4HA 1XNBA 4HK9A 1UU6A 3LGRA 3VZLA 1XNCA 2DFBA 1QH6A 3O7OA 1M4WA 1C5HA 2BWAA 2DFCA 1HV0A 3RI9A 1C5IA 1ENXA 3WP4A 3MFCA 5K7PA 1H8VA 1PVXA 4HKOA 3VZJA 3MF9A 4XQ4A 5EJ3A 1HIXA 4NPRA 3VHOA 1BVVA 1UU4A 4S2FA 5K9YA 3AMMA 3WP6A 1YNAA 3VZOA 1REEA 4XQDA 1TE1B 1UKRA 1OLRA 2JICA 1XXNA 2BVVA 4IXLA 4XPVA 2F6BA 3WP3A 3AKTA 2NLRA 3MF6A 2Z79A 1T6GC 3WQ0A 2BWCA 2DCYA 1XYNA 2VUJA 1OA4A 2VULA 4S2DA 4HKLA 3WX5A 3WXPA 3AKPA 2JENA 3RI8A 3LB9A 1AXKA 5HXVA 1XNKA 3EXUA 3VL8A 3VZMA 3VZNA 3ZSEA 2QZ3A
chains in the Genus database with same CATH superfamily
1AR82 2W95A 4GH4A 4IGPA 5A1FA 2D44A 2CV6A 1G9AA 3NV4A 4AEDC 3ATGA 5FKBA 5FO9B 5JSRA 2HEWF 1YQ6A 5FZ4A 2WABA 5L36A 1PIV3 2W1SA 2DCKA 4YPJA 3VL9A 5A33B 3NNJA 4RR3C 4U36A 4UW5A 2WZPP 2XHNA 3N3HA 3OF1A 3T2TA 5A6XA 1ZZBA 1UPIA 1LRHA 2ZGLA 2ZGQA 4L0PA 1CAVA 2ZGMA 5SV5A 3OCPA 4PQQA 2PHLA 1W2UA 2RJKA 2BBAA 2YFZA 3AMQA 3F95A 3Q8EA 3USSA 1MS8A 5A1AA 3E6BA 2FD8A 4G3YC 4FTEA 1GMMA 3HEIA 1PO22 2ZGRA 4DZGA 2FDGA 1GNZA 4LA3A 1V6OA 1BYHA 2KXLA 4UWDA 2FQPA 1I5ZA 2FCTA 1O4YA 4Z92B 3KCYA 2BDRA 1NE6A 3KM5A 5FK8A 1AYN3 2BW8A 4QU1A 3HVDA 3K77A 1LECA 5DDJ2 2XDVA 4CCOA 1MPXA 4NO4A 4CPBD 2BEOA 2XKPA 3ZXFA 1W2NA 4NIHA 3IM0A 4YGBA 3RYKA 4Z82A 4YG3A 4CP9B 1J83A 4MGZE 1H2KA 3B69A 1QH7A 3ETQA 3WV6A 2GC1A 5CFCA 1PIV1 1PIV2 5GLWA 1UU6A 3GCWA 1W6OA 3LEKA 4O61A 4CEWB 2X09A 1OUSA 1JOBA 3NRUA 4OHZA 3ZIWA 2GAUA 4CCNA 5DMYA 4Y1VA 3B93A 1G8WA 2GDFA 4Q8LA 2WS92 2PXJA 4XUTA 1IPKA 2R061 4FP2A 4YM3A 3DGTA 2DYCA 3SEPA 3ZYPA 3URFA 3ES4A 2A7AA 2Y6HA 4DUWA 5KHIA 4MXWB 2UY9A 4XABA 3UYJA 1HXS1 2XPJA 5K0UA 3WCRA 1UO9A 4PJYA 4BH9A 4EYUA 1ND3C 2RM23 1VBD2 2ZS6B 3BVCA 5A70A 1JYWA 3RJRA 1QHDA 3VHOA 3DV8A 4Q1RA 2FMYA 3U37A 4QD2A 4XFHA 4N53C 4DY3A 1RJ8A 5LW9A 1BXHA 2XR4A 1ULDA 4BE3A 1H8TB 1ND3A 2PA7A 1QKQA 3LIHA 4PF1A 3VKLA 1ND2C 3ZN6B 5J1XA 1DYKA 4GWIA 4SLIA 2RMU3 4MGKE 5BNNC 1VBC3 4W4ZA 1UMZA 1PX4A 5HPOA 2C6SA 4WM8C 3ZDSA 1WWYA 5JSPA 3J8F3 1DFQA 2I74A 5B4XA 1LULA 4XDQA 1FNZA 3AKPA 1RHI3 2VCMA 2VOKA 2W08A 1AZDA 2WKKA 1AL21 3E5QA 3Q8CA 1AXZA 3IDBB 4IEPA 4IL7A 4WM7C 4RN5A 1OF4A 1PM7A 2OQ6A 2RS32 4IEXA 4WM8A 5FPBA 5CADA 3VD9A 1WLCA 1H9WA 1V6JA 5APAA 1EP0A 5FZAA 1W9FA 1WLWA 3MUY1 5LA0A 4FAHA 3ZYIB 1GQPA 1W2AX 1RUG2 1E5IA 2P2KA 4WVMB 1J1TA 3WW1A 5A6ZA 3ACHA 3ZPOA 2XLGA 3D3AA 1GP4A 2HWD3 1V00A 4FTSA 2RDNA 1XC6A 4NWWA 1HRI2 2BNOA 3LFIA 1CAWB 1GP5A 4UW3A 1UD1A 1UZZA 2QFEA 4NWVA 5FPAA 4Q4W3 3QH7A 4XF1A 1UY4A 5JSOA 1VAMA 4Q27A 1GZTA 4QQPA 1QJFA 1W99A 3R0RA 1SACA 4BU2A 5A3MA 1MR5A 1O59A 3B00A 1JXNA 2PAMA 4M3CE 2VL4A 4XTPA 4Y1UA 4BA6A 3HT1A 3LA2A 4IETA 3TEWA 1EPWA 1UOGA 3FLTA 3CU7A 4D7YA 2ID4A 3SXWA 2VMFA 4MADA 4JZRA 3A21A 5F6KA 2MEV1 2IXKA 4Q2FA 2V72A 1QJU2 4W6WA 4H55A 1BEV3 1FOD3 1FT9A 1NLQA 2NP0A 4E4DX 1RUI1 5FO8B 2PLV3 1UWWA 2YC2A 5I8YA 1PGW2 1UPSA 3N9NA 1V6KA 2K2SA 3HIFA 4XUOA 2YUEA 4XFIA 1V70A 3VDBA 1CAUA 2E53A 2Y60A 4MG2A 2WDBA 2XG3A 3APBA 1RIRA 3UKNA 1IG3A 3DF0A 4O9GA 5BNOB 4P14A 1COV3 3OY8B 3WY6A 3VBFA 1S4CA 1W6NB 3S7IA 5FDBA 3SCHA 4AFBA 2ZX1A 4UBHA 5LA1A 3HMYA 2UY8A 2VZOA 4CCLA 4CXYA 2OIIA 3VBFC 3EB7A 2H6BA 2XLAA 4AEDB 4AR2A 2G9FA 5KR7A 2BGOA 1W8NA 3ZN6A 1NX9A 2EIGA 2Q0AA 1VBD1 1O4TA 4META 1GWKA 3NAPC 3RZGA 2W91A 4KU8A 3KVAA 1TZOA 4FFIA 1QIQA 3WEZA 1JYIA 4AQ6A 2WYSA 3VUOA 1TMF2 2IXCA 4HKOA 4LMFA 1Y7BA 3H1MA 3RVHA 1UCXA 5T5LA 3WSOA 3OBAA 1XE8A 3E1F1 4L8QA 3HNYM 4XCAA 1BVVA 2ZX2A 5KXBA 4JTOA 1DZQA 1RUH3 3PL0A 3JD71 4N8MA 5CA6A 5C3PA 1LB2A 1UOJA 2KM2A 1LU2A 4P9JA 5FIXA 3DPRB 2ARCA 4WVWA 1W8HA 2XQRA 3NNLA 2YXSA 2CTVA 4A4AA 4D0QA 1GSLA 4XFFA 4RGKA 1LTEA 2KR2A 4LUMA 2VVDA 5JMOA 2O8QA 1PO23 1YI7A 4DUXA 4ASLA 4Q0QA 3E6DA 3K46A 4AL9A 2B7YA 2P4EA 4QX1A 4ZXEA 2B9VA 1J84A 4YM2A 3FUOA 1R091 1LCLA 1F4AA 3OYWB 4IEWA 4W50A 3GBFA 2ZZQA 2WWJA 3RYPA 5CAZA 1VBC1 2DF7A 2VNGA 2W1QA 3VBHB 4CUCA 2QQOA 3AP4A 3K4DA 5K4LA 2W9XA 4QKFA 2VZ1A 3ZFGB 1XPWA 5FY8A 2YG0A 4QT6A 1O6UA 1B35C 4Z2WA 1H30A 3BALA 4LK6A 1G9DA 3K2OA 4MGIE 4AQTA 3ZLIA 3I3MA 2R30A 4Q4V1 2G1MA 4XURA 1OLQA 3THPA 3GF6A 1AYM2 4XJAA 1L7QA 1UIKA 4AFDA 4ZU7A 1LGBA 4DY5A 1T2XA 1AR83 4GD4A 2R0FA 1Q5OA 2W87A 2VR4A 5F6LB 3LOIA 3R4DB 3OUJA 4JRAA 5L7OA 3C7EA 1HRI3 1RUJ2 3FHIB 3FMGA 1VBB1 4JGZB 1RUC2 1NOVA 3IKWA 3JUUA 1MEC1 4QPGA 2FCUA 1MEC2 3Q8FA 2N7GA 3AYEA 5EJZB 4M4RA 4NPMA 2C1FA 5FZMA 4JRLA 4BIOA 4LKEA 2YMZA 2D97A 3C7FA 2A6ZA 3VBFB 5AC92 3CZUA 4MHUA 2YFUA 5CKQA 4YW3A 5FYHA 2QZ2A 5H9QA 4BQWA 2B9UA 2VD7A 3UKVA 2WWSA 3ZDVA 4BISA 3LPGA 4QX8A 5G04L 1LEDA 4XUQA 2E6VA 3MLKA 4R4ZA 1D4M3 3TWIA 4CCKA 3ZR6A 1NCRC 1H1AA 1OOPB 3Q8AA 1LOFC 1HQLA 3ALQA 3USUB 1NLRA 1APNA 2R071 5ISLA 3ZSLA 3JB4C 1YIFA 4GWJA 3SHRA 2A1XA 3ZKUA 1ODNA 5JMCA 2MEV3 1H2MA 1UW8A 1VBA1 1IS5A 3LA7A 4GULA 1NCQB 4ASMB 4INDA 5DAXA 1RXGA 1KD7A 4P5YA 4P08A 5FY5A 2XONA 3VKOA 4CDXA 4BYYA 2J7MA 5JXJA 2IUWA 1CR7A 1GV9A 2ILMA 3LFMA 4FPLA 4Q4Y2 4QM9A 3WW4A 5AC93 1LHVA 1S2KA 1HXS2 2HYKA 5ACA1 4XEZA 1HN0A 2EA7A 5FYUA 5FXXA 2VH9A 1RUOA 4XW3A 3ZYFA 1G86A 3FJSA 4YGDA 3DPRA 3ZSMA 2IC1A 4D3WA 4XJWA 2JIJA 1PNFA 5JPNB 1R1A1 1J3QA 2WUHA 4RL7A 1S1AA 5J7MA 4O9EA 1FPN3 1VBE2 1OD3A 1PVXA 4PIXA 3VZJA 3PUSA 3SKJE 2SBAA 5FRAA 3THTA 3T0DA 3DL3A 3CMGA 3WNPA 1VP6A 5KXDA 3VBSB 3VKMA 4CU6A 3HNBM 1HXS3 2BVBA 1TQ5A 1MVEA 2RVAA 4DXZA 1SLLA 1U5YA 1VRH2 2JJ6A 2JG8A 2Q5TA 2RM21 3FX3A 3A7QA 3T08A 5DDJ1 2X5IC 1PK6B 4QX5A 2VULA 5FPUA 1WW6A 4BMBA 1NE4A 2R042 1YWKA 1TG7A 1VMJA 3JD73 1N1YA 4V1PA 4XJZA 2OPKA 4NHXA 2OYZA 3NQHA 4KWUA 5BNOC 3E6CC 3M2MA 2ARBA 5CFCC 4TTGA 2Y8KA 4JQRA 1GFF2 3V0AB 1O3SA 3FBMA 4DFSA 2WINB 5IK7A 3BGAA 3PJYA 4NRQA 3J8F1 5C4WB 4BQYA 3VBUC 2KA3A 1SFYA 2DVBA 2BPA2 4XBNA 5I91A 3WF2A 5IWFA 2Q1MA 3J26N 3ZM8A 5BY5A 1S0IA 2YGLA 4UFLA 1H8TA 1OPOA 1ZRRA 2ATFA 2HYXA 5FY7A 1R093 3VBUA 5BYNA 1CWPA 1RUC3 2YPJA 3LSDA 2QVSB 2VTFA 3AB0A 3N35A 1ZBE2 3AVRA 3DECA 1HQNA 4TSVA 4LHSA 3U4XA 1BBT1 1SCSA 3RRDA 3H1WA 4OUMA 4XCBA 4XFCA 1O91A 4MO3M 5EIYB 1ZREA 3USUA 3BUCA 3NAPA 1DGRA 4QM8A 1OMIA 1FMD1 4RGAA 1H2NA 3I2JA 4FOYA 1WUVA 4QHOA 1OQDA 2DCJA 1DLLA 3J7NA 2ZX0A 4H7MA 3WNNA 1TME3 5I0SA 4OQ9A 3AKRA 2RDSA 4V2VA 1H1MA 1Q8OA 3N7KA 4ZHNA 5IK4A 1XSRA 1CN1A 4DB5A 5GZGA 4WVMA 5FO7B 4WM7A 1OFSA 3WT3A 3QACA 4L97A 3WQ1A 1QJX1 2W94A 4TZDA 1BMV1 4QDSA 2JKXA 1X33A 1IPSA 1GOHA 2F17A 2V4AA 1QJU3 5JUVA 1JZ6A 3H3UA 4I3PA 1SLTA 2WO3A 1NXD1 4YGCA 2AEZA 1CIWA 2RR13 5FLJA 1XNDA 4LPLA 3ZX7A 4LT5A 3B7MA 3KCXA 3VBSC 4DQAA 4S2HA 5DAWA 4RFT0 1BHGA 3ZMOA 4CU8A 2PHTA 4F8AA 5LEKA 2QBXA 1FI2A 4LHLA 4MSVA 1Z7S2 5FZ0A 2JB8A 3OSDA 3LGRA 4TYSA 4QHBA 4FXKB 2CWMA 3VBSA 5FP3A 3RMYA 1PK6C 1W39A 1MZEA 4FPFA 3U75A 4X6RB 1BKZA 3IPVA 1C5HA 2E51A 3M3QA 4H2AA 4PF5A 4XZPA 5FY4A 2PTMA 1NY72 3VV1A 4XC9A 5I8SA 1TME1 2VY0A 3KQRA 3WLUA 3TB0A 3WP4A 4AOCA 5B4NA 5LK7B 3M70A 1W6MA 5LRRA 3WDVA 3ME2A 4O65A 3EO6A 3OGJA 3KWVA 1RGSA 5C3QA 4COYA 4CDUB 1EV13 5F8PA 2P3JA 2OQ7A 3FHQA 1X7NA 1AHSA 4UFIA 3A0NA 2RS33 5FZCA 5FZBA 1XXNA 5A1LA 1RUG3 3AKTA 4AVTA 2RDQA 4LIUA 4ISRA 4UYBA 3BN6A 3ITQA 3T0AA 5IAVA 3D82A 4NJ4A 4C1WA 5A7SA 3S57A 3RMXA 3W5MA 4MLOA 4XILA 2DUOA 4ZONA 1DQ0A 1ZZ8A 4Y33A 1NKGA 4JGYA 2QQNA 3JD72 2PHDA 4MXVA 4N9IA 3MIFA 1NCQC 2W0XA 5FXWA 3UESA 5EXOA 4YWAA 5I0UA 5C8CB 1E5RA 1QQP3 1UY3A 4U2AA 4EN8B 3ZR5A 3ORJA 2DVDA 5FZDA 4XHBA 4BZ4A 4ES9A 3ELNA 4Q0UA 5EQUA 5A3TA 4FPYA 1VPHA 1QNYA 1HRV3 1PZ9A 1QXJA 1QGLA 2VQAA 5LBCA 3KV9A 1BK1A 5JXIA 2G19A 4LA2A 4BM8A 4X6QB 4YVWC 2Z4FA 4CEYA 3MGUA 3NKGA 4Y5SA 3OBRA 4ZZ8A 2X53S 1CPMA 2WNEA 5FMDA 4M00A 1R081 2W5FA 4LTAA 4FP3A 4OMCA 1Y3TA 4K8FA 4N7UA 3J7HA 1SFPA 2YHJA 1CESA 2K0GA 4BWOA 3ZMNA 2NMNA 1GUIA 1K45A 2YY1A 1IKPA 1XE0A 5IK8A 1VBE1 4NHMA 3VDDA 3CJIB 1GKBA 2ZACA 4EZHA 4IE6A 4Q4X3 4CDQB 3K4ZA 2VG9A 4HN0A 3QCWA 1EY2A 5FY9A 3BKZA 1GWMA 1X36A 2QDNA 2Z2SB 4B1LA 3RZJA 2YPDA 5EHDA 2VOVA 4BQ2A 2EIDA 3FZ3A 4XXAA 1DP0A 5CZKA 5C9AB 5ABJC 1HRV1 2LS6A 5FUPA 4UBGA 2BNMA 2XQXA 4IEUA 2YBPA 2WL1A 3MUZ1 3KF5A 1X8MA 2VVEA 4C8DA 1UU5A 2WT1A 2WFF1 1BLZA 2EXIA 3M3EA 2WSVA 2WNVA 2FCVA 2PQQA 3IB3A 1NT0A 2TEPA 4D8MA 1TMF3 1CAXA 2BU9A 3CIHA 1O8SA 3ZFGC 1VBA3 2DBNA 5A3NA 3UGHA 2HWF3 4XJ9A 5J96B 1Q8QA 1HV0A 3VKNA 5K0UC 4XFGA 2XKOA 2DVGA 2ZOEB 1C5IA 1EPZA 1ULEA 3PVBB 1L3JA 2UYBA 3WDWA 3BTZA 3NWKA 1DU3D 3CEWA 1FV3A 2AYHA 2ZZJA 5ACA3 4NOTA 4YSFA 1F5FA 4OMDA 4URTA 4C0BA 1JOJA 1UYXA 5FZHA 1PGL2 1QJY3 1VBB2 4LO8A 1CZTA 4A45A 4YFWA 4R9BA 1YNAA 3INAA 3UETA 3V0BA 4JDNA 1UL9A 1C8M3 2A71A 2GH2A 4Q0PA 5C71A 2NLRA 4HN1A 1S0CA 4W65A 3ZXEA 3RFRA 3JU9A 3MIDA 3WQ0A 2WZEA 2XL7A 1DZRA 3EHKA 3GJAA 1D2QA 4FQZA 1TEIA 1ZM1A 2IFWA 4UW4A 5JI9A 2PLV2 2TNFA 4JHZA 5I93A 1BEV2 1FOD2 2ZGUA 1LOEA 4LQRA 3DKQA 3D0JA 3K48A 4PDWB 5IVVA 3H7YA 2BERA 4IGQA 4A3XA 5DDJ3 3WF0A 2W39A 1YHFA 1AL22 3RI8A 1UZVA 2Z5WA 3ACFA 4EN0A 1C1FA 2RS51 4QMAA 4B4RA 2Y38A 5IFTA 3D5OA 1HQWA 4LBJA 4ZU4A 4L92A 1DYPA 1GU3A 3R05A 3JBG2 2JDZA 2VAUA 5GKAC 5HBAA 2W47A 2ADEA 3P6BA 4JCKA 4CE8A 3HT2A 2XWBB 1H4GA 1QMJA 4RFRB 1XNAA 3HNMA 3O5SA 1SLAA 1C8M1 3NNMA 2AR6A 2RS12 3ILFA 1PK6A 3L2YA 3IIIA 4IV3C 3H8RA 4QKBA 1GQHA 1Q8VA 3GBWA 4YW2A 3TAYA 4CP0A 4RQPC 2NZ9A 2W68A 4LIVA 1IQAA 5FKCA 2ENRA 3NKTA 5TSWA 2Y34A 2JG8C 4QWNA 3THDA 1QJX2 2AC1A 3IMNA 4AQ2A 3S5AA 4Y5Z0 2XBO1 3AZXA 2UWBA 3PVOA 5JZGA 4COZA 4LNVA 3WQ7A 3B9IA 2DUPA 3GXUA 1RUE3 4CU7A 5BNQA 3PMSA 4LBQD 4NE9A 1FMD3 2JG9A 2VE1A 5IVJA 1QOSA 1B35B 1RUH1 1J3RA 1O8PA 2NMOA 2QUOA 3CQOA 4B7KA 5FZOB 3T2QA 3JQWA 3OY8A 1J59A 2B42B 3U14A 3KHBA 3WINE 1OQ1A 5IT6A 3LE0A 5J37A 2Y0OA 3ZO0B 2XL9A 5DXDA 5FZ7A 1H0BA 1QJX3 3LA3A 2YB7A 4JGZC 3ZFFA 1OA2A 1KJLA 4GB33 4F83A 4Y20A 4CSWA 5IJRA 3OPZA 3B9CA 5C8WA 1A8DA 1OLME 3SEEA 5IVCA 4FOQA 3ZFFC 4QXBA 5L19A 4FFHA 2RS13 2WNUC 5A33A 4MUVA 2P34A 3HBZA 3MEPA 4YVSB 4ZU5A 1US2A 5FZGA 5AFBA 1CGPA 4R4XA 4IGOA 4XUNA 4V2WA 2SLIA 1JMUB 1UYYA 4UFKA 2CWSA 2D5FA 5FZ6A 4WM7B 2JE7A 4YM0A 2WNUA 4Y4RA 4JKMA 5FYMA 3I49A 3POFA 3GALA 5FYTA 3AVSA 3ES1A 3ETPA 1JYTA 1JI6A 5CEHA 5I0TA 5T55A 2HWF1 3MPPG 3RWKX 2HWD2 1HLCA 4AEKA 2BZDA 2GP5A 4HSLA 3POSA 1DG6A 1PX3A 1Z7S3 3N9OA 3IIAA 5JOZA 1HRI1 2VOXA 3H9AA 4XBQA 3O1OA 3M7AA 2O14A 3AFGA 4XYXA 4XF9A 4Y1ZA 5FPLA 1U5XA 3ZPYA 1HB3A 2QQIA 4QDQA 2A6WA 3RG0A 5LBEA 5FPVA 3WXPA 1RINA 1ZNPA 1KJRA 2W1WA 3HWJA 4B1MA 3N7MA 4XF4A 2YBSA 4DXSA 3EBRA 5CVRA 4AFCA 4ITCA 3LB9A 1NLSA 4AFMA 3RZZA 5HXVA 3RDIA 1GR3A 4MHRA 3OGRA 5C33A 4CP1A 2VMDA 4ARYA 3PMEA 3J7MA 1U5IA 1XSQA 4TLGA 3CKHA 3K75B 3BTYA 3ZSEA 1S0BA 1VB2A 3G7DA 1FYUA 1KQRA 4HOOA 5FYBA 3SITA 3ZXKA 3KD4A 4BLJA 1RHI1 5FOBB 4NHYA 1SZBA 2WRAA 2ZKNA 2CL2A 4XFAA 2X29A 2OZJA 2B46X 5J48A 5ANQA 3E5XA 1VBA2 2P5BA 1ZBA3 1X82A 2LUWA 2OA2A 5D21A 5IYYA 4FCAA 3I7DA 2ZGNA 4ARXA 4PI0A 5JOWA 3WNMA 1W6PA 2GNBA 4JGYB 3WF4A 3WNXA 2R1BA 1A3KA 3IAQA 4W6YA 1WD4A 4CEWA 1W6OB 5CG8A 1EAH1 4DEQA 2NQYA 1NYWA 3FWEA 4R9DA 4QQOA 5D2AA 5C4WC 4PIZA 1JZ3A 2PHFA 1OOPA 2L9LA 1SDWA 4Y1XA 3LEIA 1E57A 3W20A 1NCRA 2XJTA 1O5LA 4PI2A 2A6XA 3WW2A 1SG3A 4OFGA 1DQ4A 3WVJA 4FPJA 4LO7A 5D1IA 4JDOA 3CNAA 3S30A 5FMOL 4DXTA 3J4UH 2B39A 4DNYA 2ZPXA 2CGNA 3P3NA 1LENA 3SC7X 2LRPA 2WT2A 4IEZA 1ASJ1 1RUE1 1V9U2 3TNPB 2EXJA 1YQ8A 2OUJA 4H3WA 3VBRA 1Y9GA 5C7GA 1PMHX 1UQXA 3MV01 2VECA 1KRIA 2JDUA 5F32A 2HWB2 2E63A 2J42A 1H4HA 2IVJA 1KGYA 2QNKA 2UYAA 4A44A 1YI9A 4C91A 1S0EA 2DVAA 4Q4X2 2XB6C 4ATEA 2WZR3 3CJXA 1LGCA 4WV8A 4RS5C 2VW1A 3LOBA 2MNGA 3I3BA 5BPXA 2I2SA 3I3EA 3I2KA 4P9YA 5HV0A 4XF3A 4NIDA 3TEXA 3AYDA 4QX3A 4YVWB 1TMF1 1GICA 4GJZA 4KU7A 3MIHA 1DGWX 2R0HA 1F35A 1SEFA 1PVC1 1ZRCA 2J22A 3H42B 4AHWA 2DVFA 1UX6A 2D43A 3ZFEA 2DTYA 1V6IA 4L99A 5ANNA 4IV3A 1IS3A 1X8EA 3I97A 4DO0A 1CVNA 5C3RA 1ENRA 4KBZA 3ENRA 4Q0SA 5JIUA 1OC1A 3CLPA 2WJSA 5AVAA 1ALYA 3IDEA 1N3PA 3ST7A 2R7EB 3U10A 3ZXDA 3K4AA 4AI3A 1U12A 1CAUB 1QXPA 2OZ6A 2KD7A 4E2QA 3WDYA 1YEWA 4Z07A 5JZGC 1QQP2 3T1LA 4A2UA 3VDDB 3SISA 3LF7A 5AFEA 1W6NA 3IDAA 3QH6A 3TYJA 5G05L 2VUDA 2WZR1 2WNVC 1RC6A 2ZEYA 3LDKA 5BV6A 2LTNA 4YW5A 5JXHA 1Z7S1 5F39A 4DIQA 3FC0A 4QXCA 1RTVA 2VZUA 2YYOA 3EXUA 3UKTA 3KV5A 1JW6A 4GKXA 1OT5A 4CDWB 5F3IA 1QY4A 5C9AA 4CYDA 1N1SA 5A6YA 3ZSJA 4ATFA 3GDBA 3HQUA 1MACA 1UY2A 1LAJA 3AK0A 2DBIA 2FDFA 3IN9A 4YVSC 3AMPA 3SH4A 5FWEA 1ULGA 2VXRA 3NAPB 1IG0A 3NJXA 3AMHA 5KC6A 5F3GA 3VD3A 5EV7A 2D7FA 5FWJA 2GNTA 1UOFA 4OYUA 1KS5A 2P17A 1W8TA 4R52A 5A32A 2ETEA 1KS4A 4KWLA 1SFNA 1Q56A 2Q1FA 4QB6A 2NN8A 3OD4A 2VZ3A 4XE9A 5DAQA 4HVOA 2WN2A 5HXMA 1RUI2 3KS7A 3GJBA 3W21A 2F4LA 2E7QA 1PO13 5FUIA 3MLJA 4Y1YA 4RS5B 1MS5A 4LKDA 2ZXQA 2XJRA 3AP6A 1PMJX 4CDXC 1LNSA 4E2GA 1X50A 2BOJA 1FATA 1RL3A 2BUKA 2PAKA 3EYPA 1IHMA 3T2OA 3A4UA 3AX4A 4YLZA 2E33A 1CD3G 5FREA 1FX5A 4B29A 4XQWA 3GZAA 1OVPA 1TME2 1QNWA 3SCFA 4YW7A 1BJQA 2HWE2 5IVFA 3FFQA 1LESA 5IVBA 1RUI3 4X8PA 5F37A 4WVZA 1QEXA 4A3ZA 3N4MA 3UNPA 4LITA 3UJOA 4RR3B 1OUXA 1F15A 4PDWA 4M3CF 2JDMA 1PGSA 4ZXKA 4CXWA 2BGCA 3NNFA 4E4ZA 2QJVA 1PNGA 4NAMA 1MS9A 2R1DA 2Q1ZB 4YGEA 2X5IB 1AJKA 1A6CA 2ZHMA 2R073 1I9RA 2PAEA 5JZGB 2XWJB 1ASJ3 1ZBE3 1SCRA 5FBJA 3VDDC 3UGGA 4D94A 5B2GB 1W6QB 1VAKA 3U1XA 1WMFA 3QD6A 4AVVA 1ST8A 1AR71 1UN1A 4FXGB 3KHCA 1S0DA 1LHOA 3MFCA 4UFMA 2XBO2 1PM4A 2LM3A 2XVGA 1KXGA 2DCTA 3PVEA 4MV2A 3TNQA 2FZ2A 4IESA 5FZ9A 4CP9A 1BMV2 1C3HA 2WWUA 4Y22B 1ZRFA 1LOBA 4BB3A 1RVF1 1T6BX 4BQ5A 5C5TA 5IVEA 5LRSA 2JDKA 2GH8A 4IXLA 2ZGPA 4GWMA 4XOGA 3AJZA 4AI2A 2XHKA 3BU7A 4MX3A 5T3NA 4YW1A 3J9SA 4CEWC 5C70A 4XACA 5C8CA 1QJZA 2GU9A 4EROA 2WLQA 1SPPB 2VUAA 3JXSA 4NIIA 5JXGA 1JH5A 2AUYA 2HH9A 2AEYA 2HWE3 2QQPA 2QCSB 3U4SA 2V4VA 4BLIA 3K3NA 3U11A 3T3YA 4GA9A 1L7RA 3POGA 1ZBE1 1W8ZA 2VMGA 2WZ8A 2J1UA 3KSCA 4TN7A 1VAVA 1WW7A 1QOTA 4HZFA 1ND3B 3FLPA 4RD7A 1AR93 4XMAA 4B8EA 1H1IA 1PO21 2WS91 5BNNA 3VZMA 4AVBA 2XUEA 5HV4A 4NPLA 4DRVA 3MDPA 5T54A 4CCDA 4R8HA 2EAAA 2D3SA 1PO12 5T5JA 5L9RA 3GZEA 1MQTA 1GP6A 4AW7A 4BPZA 1OH4A 5E8AA 4BK4A 1ZVFA 3RGBA 3AMNA 4D7SA 3MYXA 2HWB1 2BJSA 5FYYA 1I1EA 1F5JA 1OFNA 2R6QA 2ZGTA 2PN5A 3NVCA 3CZJA 4XAAA 1JU3A 4A6OA 3NJZA 5KXCA 3DEMA 4AAPA 3IT8A 2D6OX 2GALA 2VOWA 4AE2A 1SQ4A 1VALA 2EAKA 5LBBA 3KB5A 5FV3A 4P5HA 3RWNA 1KDMA 4LBMA 3UV9A 2B8MA 4LO6B 3RZHA 4UF0A 1RMU2 3FE5A 1AR92 3KCCA 5JWPA 3T4VA 1OF3A 1NA1A 4IE0A 1IS4A 4M0NA 3A22A 3JB8A 1DQ6A 1RUC1 3PJQA 2GN3A 4C1XA 3MFAA 2RS52 3T2PA 3I2IA 3V56A 4AI0A 4SBVA 4FBFA 5JOXA 3W59A 1N3QA 2OKXA 2XH6A 3CL1A 2W92A 4R9CA 1D0HA 4GJYA 4A7KA 1HJFA 3IZOA 3LZZA 1EAH3 4PQ9A 2ARAA 3OOXA 3ABZA 4Y3OA 4LEJA 2VGDA 1AR62 3CO2A 2VMCA 1W6QA 4CPBA 2HKXA 4CDUC 1K5MB 1E5HA 5FZEA 1ACCA 2E7AA 4OLLA 1EUTA 4UXAA 4CDWC 5DG2A 3I3DA 1K42A 3BU0A 1VBC2 2AZ5A 3C2UA 3MW2A 2GC3A 1LHWA 2JG8B 5EWSA 2ZCWA 5GZFA 3WNLA 4HK9A 2QDRA 1NUKA 2EIBA 2ZAAA 3MIGA 2WO1A 3RSJA 1QH6A 5DPNA 1AVBA 5FQ0A 5EYXA 4EV0A 4HPKB 5FP8A 4LBLA 5FTTC 5EPAA 4OHXA 2Q8EA 2QQMA 2ZEWA 1WA6X 3FBYA 4A41A 1XJAA 1W04A 2PMWB 2RV9A 3PTRB 3RS6A 1RUF2 2D5HA 1AR61 1OURA 2XGXA 3G6JB 1H8VA 1S55A 1W9TA 1W8OA 5FYIA 4QXHA 2VW2A 3AZWA 3BODA 3DYOA 3O14A 3TBDA 2D93A 4EWEA 1RJ7A 4RHV3 3E5UA 2WFF2 5BNPC 3OUIA 4JGYC 3WP3A 2EXKA 4KG0A 4E8DA 2WZR2 2VTXA 5GLTA 4Z1VA 2Z79A 4G4FA 1M06G 1G9FA 5A7WB 3FL7A 3H8UA 4NN0A 3VDAA 3JCIA 3WNOA 5JLVA 5DUUA 3GYDA 5FYSA 1DIWA 4ZS3A 1RMU1 4BHPA 1MQTB 1OA4A 1Y4WA 2BYVE 1US3A 4ZPIA 5D8AC 2G4IA 2ZMNA 1UY0A 2WFPA 1YFYA 5DAVA 4CCEA 1QWRA 4AZZA 2NPIA 3LDBA 4PBOA 1UYPA 2C0ZA 1NCRB 3TN92 4YVWA 3W5NA 4BQXA 3I59B 1Y9MA 1AXKA 5D8AA 2VNVA 1D4VB 1NZCA 3PU3A 5C3SA 4OUEA 5DZFA 3ZN5A 5GLZA 3AJYA 2D6PA 1WCSA 4M3CB 3VL8A 2JE9A 4L11A 2WQZC 4K9SA 1NAEA 2IXIA 3M3CA 2WYFA 3P1IA 4R9AA 1GWLA 4OHVA 1CJDA 2QZ3A 5IW0A 1UZWA 4LHNA 1CAVB 5KC5A 1W0PA 4JVAA 1R082 2Q4SA 3VBRB 4MVTA 5IVYA 1XYPA 3OD0A 1PZ7A 1JOPA 1OPMA 2WC2A 1MS3A 4RQPA 1WW4A 2A75A 4HANA 4OI1A 5GZCA 4HMZA 1UNBA 1V0AA 3A23A 1YQ2A 5FY1A 2JDNA 4QGNA 3GNEA 4YG6A 4QPIB 3POYA 3UK9A 3HQXA 4W6XA 1PZ8A 4HXCA 4EE2A 2JDAA 3AC0A 2A73B 4I01A 1GLHA 1V9U1 4NHKA 5ABJA 1COV2 2B5HA 3H7JA 1BBT3 1YO8A 1ULPA 4YW6A 3NW4A 4KMQA 1TNRA 5F3CA 4EN7B 4UT5A 4UFJA 2W1UA 2VZSA 1UY1A 2IXLA 2I07B 3IDCB 2DDUA 2K46A 4DUVA 5LWBA 3ASIA 1DGLA 2R043 1XE7A 1RVF2 2RE9A 3PIJA 1O4ZA 5GLUA 2P3YA 3POIA 3HJRA 5A3OA 3Q9OA 1HKDA 4NIGA 3VHRA 3LEMA 1JZ7A 4S2GA 2B4KA 3PDQA 4FPCA 4RSUA 5JIAA 3UL2A 1JYNA 1F31A 3L9JT 2WQ4A 4JGZA 4QPGC 5C8CC 3VGIA 4E2SA 2JG9B 1H2LA 1LU1A 3M4FA 5FJHA 5FOJB 5A32B 3OTFA 5A7QA 5FZIA 1ZYBA 1ZA4A 3EMRA 5FZLA 1RB8G 5FP7A 1W90A 2ZJCA 1HB1A 5ERLA 4YW4A 4GMP3 5A7PA 3TEYA 4J1WA 1G9BA 2ZHKA 4OZXA 1RUF3 4Q4W1 1BVP1 3LD8A 2ET1A 1SBFA 3O7OA 3I4IA 2JECA 3OGGA 2DFCA 1OKOA 2MHFA 5FY0A 3JBG1 4FT8A 3R4UA 3OGSA 2VPVA 4NROA 4MYEA 1G7YA 1VR3A 4NMIA 5GZEA 1KITA 4K20A 4Y4YA 3CJIA 2WSUA 5C5UA 3C7OA 2GMEA 1UF2C 4K1ZA 2QQWA 3MF9A 3WUCA 4X8NA 1W2OA 1J3PA 2D6MA 4S2FA 3KGLA 4OHWA 5J3UA 2VBDA 4RGGA 4AI9A 1TE1B 1HB4A 1ZRIA 2UWCA 2PLV1 1ZBA1 2BVVA 3O1VA 2F6BA 1UZ0A 1W8WA 4YFZA 1JUIA 1RHI2 2JIGA 3VBRC 5IATA 1EV11 1XBFA 1X9TA 3KGZA 5KHKA 2DCYA 3M3IA 4XETA 2ZEXA 2HBTA 4EWDA 4CTEA 1OHFA 3AZZA 3PVNA 3RJ2X 2YZ4A 3WHUA 4GKYA 4GMP1 3P3PA 2QQLA 3I3QA 4RS5A 2JB4A 1JUHA 4RQPB 1EUUA 4LO5B 3TOJA 4COVA 3VD5A 4BQ3A 2GMPA 2CHHA 3MO4A 3KLSA 2D6LX 4FVVA 1XNTA 1Z78A 3ZYRA 1XB9A 1UKGA 2GC0A 2XJQA 3MICA 1I3HA 2WO2A 3T0BA 1FMD2 1QJY2 1N47A 1GOFA 2W3JA 3POEA 4O7XA 2RG4A 5JR2A 2ZMKA 3PHMA 2C5DA 4IEQA 1F9KA 2QKDA 2XUMA 2XJVA 4XDPA 4IW3A 5FZFA 3PTYA 5T52A 1AR91 4A7ZA 2VZPA 3GM8A 5KBFA 1IS6A 2VM9A 4LBQA 3POJA 2RM22 4KH9A 2JG9C 4EQVA 4Q5OA 2YBKA 2VBPA 2QQJA 2WNVB 2WN3A 1QU0A 2QTWB 4OZOA 5FMBA 3SQOA 5BNPB 1NZIA 2AENA 2HEVF 3PNAA 1IPJA 4Q1PA 5AVPA 3VLBB 1H8TC 2A5ZA 2DWRA 2TBVA 3NMBA 2C9KA 1VRBA 3HAGA 1FPN1 2VQUA 4LKSA 2HWC3 4AYUA 1XU2A 5A3WA 3VBUB 1CPNA 5LASA 3SH5A 3ZVXA 1R1A2 4YZ2A 5BNNB 2WAOA 4JHTA 1GZWB 1W6PB 3GBGA 3ZYGA 1A8MA 1Z0HA 5T5OA 4XHXA 3WUDA 2A3XA 1Q43A 1F4HA 3ECQA 3NSTA 1V9U3 5FR3A 2GZWA 2P6CA 4LKFA 2FDJA 3ZYJB 4GXLA 1YCIA 1WW5A 1VRH1 2PQSA 4NUBA 1JZ8A 4DS0A 2DCZA 3N7LA 1U5ZA 2H0BA 4I02A 2AH2A 3LIGA 4N43A 4AWDA 4FFFA 3AYAA 4K8RB 5GZDA 3MLLA 2BNNA 2XJUA 1XNBA 3S0MA 1GZCA 3AFKA 2V09A 3AP7A 4KGGA 5A80A 4BMEA 3LDRA 1YFWA 3M8LA 4N43C 3AZYA 4YM1A 4CA9A 3N9LA 2FDHA 3AM2A 4NIAA 3RI9A 1VBB3 4CCMA 2IVIB 3KT7A 3QBQA 4IV3B 5C3OA 1W9SA 3AL5A 4MH0E 1H9PA 5T50A 2PHUA 5ACA2 3OEBA 2EALA 4KL1A 4CVUA 4ZKTB 5I0RA 5F9TA 1C8NA 1IZ3A 2D3RA 4AVSA 4IE4A 4DRRA 4GB32 1HIXA 3I2DA 1K5MA 3AXDA 2IFRA 2AGSA 2DTWA 2RS11 4HG6B 4CP2A 3BI3A 4QX2A 4AVCA 1ZRDA 1RYYA 4XPVA 4GMP0 1JS9A 1S2EA 3W9AA 3IPVB 5FYZA 4IERA 4PT6A 3NJVA 2JD4A 1T6GC 3IMMA 3OBTA 1SHWB 3ZFEB 5FBZA 3IBMA 5CFDB 5CIRA 3AZVA 1XYNA 1BZWA 1W6MB 1VB4A 4MZUA 3WX5A 1RUNA 1CZVA 3NJYA 4LBQB 2JDHA 3AP9A 4Y24A 5JI7A 2Y26A 1ZX5A 5LA9A 2FBEA 4NHLA 2XLFA 3KVBA 3MW4A 1KFUL 2ORZA 3WW3A 1SLBA 2P37A 5DG1A 4A6SA 4AI1A 2VZRA 1VJ2A 4FO9A 5L7OC 4FOVA 3I2OA 2P1BA 1HW5A 2CGOA 3MV11 4HETA 1XRUA 4XJUA 2HWC2 1JTZX 1JODA 2RS53 1BQPA 1N1TA 3OPWA 5FZKA 1DGRN 1HV1A 2QQVA 4K6BA 2HEYF 2Y6GA 4KQ7A 4BIFA 1O3QA 1AYM1 1OOPC 2IWGB 2LALA 3H0OA 5L9BA 3T09A 1K12A 1XYOA 5EYYA 2XVKA 3NL1A 4TXWA 1POQA 3O1SA 5FMCA 1K5JA 1F2NA 5FZ3A 4DINB 1G9CA 1PGL1 4XMIA 1FNYA 4YYOA 2G9GA 3RZKA 1JZ2A 1AX1A 1KDKA 3AKSA 4BQ4A 1LOFA 4GH4C 5J09A 1UMIA 4ASKA 2JEMA 2CAVA 3MW3A 4MGYE 2RR12 3WP5A 4AHYA 4B4PA 4K3UA 3DPRC 1HRV2 3L2HA 1AR73 1UXZA 4N43B 1BK0A 4QX0A 2I45A 5SV8A 4FPGA 1LJ7A 3LAGA 1ND2B 1WCQA 4COWA 1OBNA 2EIEA 3AL6A 2E9QA 1XOYA 3I2GA 4KNCA 2VW0A 4D7TA 2WBKA 4I2OA 2VZTA 1HB2A 1RVF3 2YROA 1MQTC 4OULA 3WG2A 4B4QA 1X9PA 4BJ0A 4PDWC 4CZSA 1CAWA 3SH3A 3KT1A 1BBT2 1AL0G 2VCBA 2IXJA 2J1EA 3AYCA 5FZ8A 2C9AA 3S5QA 5FXZA 2ZMLA 5E1RA 4CUAA 4C90A 3GHNA 3O1TA 2LW8A 1YC61 3N9QA 2J1AA 3NNGA 1UAIA 3LPFA 4HLTA 5BUVA 4XDOA 3DYMA 1A78A 2OUHA 1O7FA 1MS0A 3W58A 2ZA9A 1GYKA 2C24A 4AEMA 4NVPA 5JOYA 1PVC2 2MPFA 2Q8CA 5CNAA 1DYOA 2JE8A 4ET7A 5FCCA 2R16A 4B7EA 2X5IA 2JDPA 4LJHA 4UW6A 2X8KA 1F8VA 3D8CA 2NM1A 4Y5TA 2BOIA 4XQ4A 3JZVA 4AI8A 3LWCA 1WGPA 1AUYA 1S2BA 3MI8A 4NPRA 2VO5A 2Q8DA 1RUD1 4QPIC 1C1LA 4GWNA 3K51A 3S7EA 1JHJA 4P9LA 3RQ0A 1YYNA 4AQSA 4LLFA 1SDDB 1PHMA 3NV3A 5LATA 1R083 2WQ8A 4WZFA 5BNOA 4YZ3A 3RPQA 3MF6A 3TN93 3DUIA 4QPIA 4D69A 1VMHA 2VOTA 4NR1A 5IHRA 4K40A 1AYN2 1MS4A 5GALA 5F7UA 1SLCA 3PUAA 4Y22A 4EZ4A 3U0ZA 4I0BA 1W3VA 1UX7A 2IXHA 2VUJA 3TEZA 4S2DA 2V5DA 2VC9A 4LBNA 2VNRA 2VCCA 3HBKA 3KZ4C 2Y6KA 2JENA 3BPSA 1C8M2 2ZKLA 4GH4B 3H50A 1LHUA 4RHV2 4J25A 4IUGA 4FTBA 4MOAA 2XVLA 2ZGKA 2WAAA 3D6EA 2RDRA 1GNHA 3PUIA 1DQ2A 5CYYA 1LODA 3VZNA 4N53B 5FPZA 5CB7A 2ORXA 2HBUA 4AGGA 3CBNA 4HK8A 2FZ1A 3AKQA 1RUD3 2ERFA 2WFF3 3M3OA 3VHPA 2R49A 5T5PA 3SKVA 1OSGA 4QAWA 5JR7B 4QKNA 4AEJA 5EFUA 4EN9B 5K8SA 4IE5A 4EJRA 1ZZ7A 2ZHLA 1R1ZA 1NA1C 2PHXA 2VQTA 1DZTA 1JBCA 1BEV1 1FOD1 1WLDA 4AEDA 5F5IA 4Y26A 2JKBA 3OEAA 3DKWA 1JYCA 1QDCA 4LHKA 5FAXA 3ZXAC 2P3IA 2IZWA 1W03A 2CAUA 4UAPA 3HPNA 4OI0A 2V73A 4G9SB 4EWAA 2FDIA 2R062 1ODMA 3MBWA 4OHYA 1AR63 4UF0B 2D98A 1STMA 4RHV1 4XTMA 4AFAA 5FLIA 3PIGA 1QQP1 1R64A 4HL0A 2OXBA 4JX0A 4LE3A 5EP9A 1FV2A 5CU1A 3HQRA 3WR0A 1AF9A 4P9IA 4D6RA 5A6QA 4OCTA 1RUJ1 4ONUA 5H9RA 4CUGA 2DURA 4LE4A 3SNMA 2YU1A 1PO11 2BBVA 2OT7A 1REDA 2YC0A 3LEGA 4LLOA 2HJIA 3MPBA 5LY1A 3VHNA 3POWA 5DAPA 1D0GA 1CIYA 4PLNA 3MZHA 1H6XA 2J1RA 5L7OB 1YQCA 4FOWA 4UFHA 1IGOA 4AAXA 5A3UA 3UJQA 5DUVA 4IEYA 3U07A 4BXFA 5IK5A 5CISA 2NYYA 4Z2AA 2YU2A 2H0VA 1SMVA 2D40A 1MVQA 3NO8A 2BWAA 3O1PA 4FPEA 5E6HA 2YGMA 3KF3A 4I30A 4P9XA 4CUBA 5FZ1A 3HOBA 4TWTA 1LOAA 1W9WA 2BTVC 2Y33A 4QB2A 1JZ4A 1WCUA 2BGPA 3OJBA 1WMDA 1GNYA 1ULOA 2UWAA 5EJ3A 4UI9L 1W8FA 3ZIXA 4W8JA 2OS2A 4K7JA 5A7OA 3WDTA 5JDBA 5K9YA 3AMMA 2GMMA 4LO4B 5KWRA 3VZOA 1OI6A 4OUSA 2YC4A 4KI5M 1JYVA 4LR4A 2JICA 2CYFA 4FPHA 1NCQA 3IWZA 4JQTA 2FMDA 2R32A 1AYN1 2WR9A 3U78A 2ZGOA 3CF6E 3I2HA 4OI2A 2ZGSA 5KHHA 4CDXB 1W28A 5I8TA 3K3OA 2BWCA 2E7TA 1YFXA 3LKJA 3O1MA 4E27A 4LUKA 4YZ4A 1LOCA 4Z8BA 2WNUB 3BIWE 4RR3A 2BP6A 4HKLA 4NRPA 4BOWA 2AACA 2EXHA 1NG0A 4XZUG 1RITA 1U0AA 1CJPA 2O0OA 5DUXA 4Q4V3 4CEYC 1WBFA 1I5PA 3MIBA 1V6LA 3BIEA 1RUH2 1EAH2 2VQ0A 3SMHA 2C26A 4HONA 3CJIC 4HT1T 4ISQA 1DQ1A 4CDQC 5FXVA 2D3PA 2Y6LA 4AHZA 4KG8A 1D2SA 1WA4A 2WA3A 2Y6FA 2HWE1 4JC1A 5DN2A 4QB1A 4YZ1A 1XQNA 2CSGA 3F2ZA 3I59A 4QQ2A 1WMEA 2ZX3A 4JAAA 4Q29A 5FYVA 3Q8BA 4OI4A 1MEC3 1OH3A 4XF0A 3QLQA 4CDQA 3BOPA 4QKDA 2ZABA 2PELA 2JD9A 3TRSB 3ZYHA 1UOBA 4AGVA 2O8OA 2F4PA 4QXKA 4AXOA 3DXTA 5CFDA 2PYTA 1SBDA 2Y64A 1K5MC 3PURA 1UMHA 2WNOA 4JDMA 2BFUS 3S6PA 1WMXA 1ZBA2 3B02A 4C0HA 2VXJA 3J7LA 1P8JA 3R6SA 1GANA 1MS1A 1RUF1 4P9WA 1D4M1 2C4XA 4ZY9A 3BTXA 2JXAA 3RZMA 5CG9A 1SPPA 1LR5A 1TNFA 5J36A 1ZZ9A 4HFSA 1AL23 1CZSA 2PFWA 2TUNA 5C4WA 4XAEA 1QJU1 4BK5A 5LBFA 3OUHA 1LOGA 1YUDA 4QU2A 1G6NA 1ZZCA 1J58A 2RR11 2WLPA 1UYZA 1MZFA 3O0XA 1JU4A 1ENQA 4CCCA 5AC91 1JZ5A 4QDRA 1DLCA 3MHZA 2XJPA 2EVXA 3ACGA 3DYPA 3KMHA 1IKQA 4J1XA 5A7NA 2B45X 3POBA 4HVQA 1NY71 4BQ1A 5L9VA 4NAOA 1W0OA 1V6NA 3WZ1A 2D6NA 2J1SA 4GAZA 4E9KA 2CDPA 4D6SA 4KBBA 4MGTA 3PUHA 5BXXA 4OQ8A 1O5UA 3D4KA 4FI9A 3CHXA 1CONA 3DCQA 3VZLA 1URXA 2E26A 3SCGA 4YARA 3NV2A 3V0AA 3FUQA 3H3ZA 2BFUL 1MZ6A 3OG2A 3VBOA 3RZLA 2WA4A 2Y0IA 2VNOA 5HCBA 5M0TA 1WD3A 4IQPA 2X10A 2RS31 1SBEA 2XBO3 1J1LA 2GP3A 2ARXA 4QPYA 4DPNA 4I3GA 3VBOC 1HDKA 5CBLA 5L73A 1KFXL 3O1RA 2DUQA 5DZGA 1OXCA 4Q8KA 1GZ9A 1UU4A 4IEOA 4WVVA 3ACLA 3V65A 4ZS2A 2JWPA 2Z69A 4XQDA 5HI0A 5DUWA 4QGLA 3HR9A 1DGWA 3HN3A 4Q4V2 3MIEA 3N9MA 5E89A 3PUQA 3EQEA 2P3KA 1D7PM 5FUNA 2VZVA 1CX1A 2P6HA 5IUQA 1NQJA 4DXRA 1VMFA 1D4M2 2DV9A 2VUCA 1YQ5A 4ES8A 3O1UA 2BRTA 4FQ4A 2WT0A 5C6CA 2YDEA 2E31A 4GB31 1POV1 1SLIA 2VU9A 4B3NA 2A6YA 1WCDJ 4BCUA 1YXWA 1QXRA 1JYXA 4M0HA 5FQ0B 3VD7A 1OQEA 4BDVB 2EICA 3KQ4B 5JVVA 5HCHA 4TLFA 1RMU3 2GNDA 4XBLA 3WF3A 5IAXA 1O3RA 1VBD3 1Q8SA 1DQ5A 2VVFA 1VRH3 3ROUA 4E4SA 1AR72 1FPN2 3I2FA 3WF1A 3OYWA 4ORFA 2G9ZA 4A7YA 3VKFC 5K0UB 3GZTB 1H6YA 4LULA 4DMIA 3OB8A 3N9PA 1W06A 5HCFA 4ZZ5A 4HVRA 2CDOA 4H14A 5F2SA 4FFGA 1AX2A 1DHKB 1VBE3 2W46A 1JHNA 3B5LB 4IEVA 1QDOA 2CU5A 2VMHA 1K3IA 2XMLA 3T4HB 3RNSA 2HWB3 5LA2A 4K1YA 4CXXA 5CFCB 2OX0A 1QF3A 3IAPA 2ZAHA 4IV1B 2DU1A 3WG4A 2VJXA 4P9GA 1ULCA 4FPKA 5KHGA 3ZFFB 1QJEA 1N3OA 1PGW1 3VZKA 3HD8B 1WBLA 3BYWA 4GQ7A 4KWJA 5CKMA 1C4RA 5KXEA 1YLLA 4N53A 2QE3A 4N7IA 5D8AB 5H9PA 4WM8B 2AREA 3T1MA 4M3CA 1W2TA 3FFZA 4JKKA 4PBPA 5F5QA 1CQ9A 4YVSA 2UU8A 3VBOB 5EZWA 4CEYB 4OVEA 2BQPA 3RYRA 1YJLA 1BCXA 1GZWA 1WCKA 2PHRA 3ZN4A 5CKNA 3ZOIA 2A3YA 4KGQA 4URAA 3H1YA 3CDZB 3DXUA 2ZHNA 2ES3A 3N7JA 3JQXA 5F3EA 3VN4A 4FSJA 4N90A 4F3JA 3HN1A 5A7WA 1EV12 3ZXLA 2R063 4XIOA 1C57A 3B94A 3PU8A 3LSEA 4Q4Y1 5FP4A 4E4HA 1LEMA 3GHMA 2DU0A 1AR81 1OVSA 3BB6A 1XNCA 3C8XA 5GJ6A 2DFBA 4LORA 4UOJA 3O0VA 1OLMA 1S0FA 4I0WB 1QJY1 5I0DA 4BXSV 1ENXA 3WG3A 2WO7A 5J98B 3N36A 1RUG1 4M4PA 5E88A 4PHZA 2R072 3UGFA 2UURA 3AXEA 5LCWL 3DN7A 2ET7A 1OD5A 5K7PA 2VMEA 4I09A 4LBOA 5FYCA 2W52A 1YJKA 4IE7A 2XJSA 4L2NA 5DQ0A 1AYM3 1VLNA 3VD4A 5JAXA 5JCTA 5KHJA 2HWF2 3GCXA 5GLVA 1DCSA 5FP9A 3WDUA 3ZXGA 1RUD2 1UKRA 1OLRA 5FFOC 4MGQA 2XOMA 4AG4A 2J1TA 2J1VA 1W05A 5GM0A 4GALA 3WHTA 4P00B 5JPMB 2Z42A 1WKYA 3C7GA 3AP5A 3LQCA 1CAXB 2V5YA 2VBBA 2VMIA 4RYDA 4FPOB 4HBNA 5HCAA 2D6KA 3KV4A 2ADDA 3BOWA 1UIJA 3ON7A 2ZX4A 5F5AA 1FXZA 2ZTNA 3V64A 1FAYA 4PCRA 3GGLA 1Y43B 1AJOA 2CNAA 3WDXA 1W8UA 5A3LA 1OKQA 5ABJB 3O0WA 5F2WA 3ZXJA 4JV4A 1E5SA 3H3LA 4AGRA 4IV1C 1C28A 5F5CA 4AHXA 1LGNA 1IOAA 1ONAA 3VB9A 3SLIA 4CRQA 4H7LA 4DEVA 4YZ5A 2XXZA 4GIQA 3ACIA 1R1A3 1W9YA 3WCSA 1EYBA 2W2IA 1L7LA 1LKNA 4IV1A 2FDKA 2Q30A 1S0JA 3BPZA 4Q4W2 4LXLA 1PVC3 1REFA 3FLRA 1S0GA 2JX9A 3BTAA 5LB6A 1R092 4Q4X1 1Q8PA 2H6CA 3O12A 1HJGA 3ILNA 4KWKA 3THCA 4IDZA 1OA3A 2GC2A 4XUPA 1TVGA 3OBZA 4QGMA 3A0KA 1KEXA 1O3TA 1ND2A 4LK7A 5LK5A 4LOSA 1W0NA 4RA0A 1ASJ2 3KV6A 3OPTA 3WNKA 5H9SA 1WLTA 3UT0A 1ZZ6A 4J6GA 2FHRA 1QOOA 4M01A 1JN2P 2RHPA 2YV8A 3KT4A 4N9HA 3FN9A 3PLQA 3WD5A 1DDLA 2VZQA 4QQHA 3J8F2 4AK3A 2E32A 2RJLA 3WOGA 4Q0VA 3M1HA 2QQUA 5LZ6A 4QQLA 2Y6JA 3X29B 1COV1 3V0BB 4JTNA 4YNIA 3TN91 3VBHA 1VE0A 3FHAA 2CGPA 1RUE2 4MGSA 2RJ2A 1AXYA 2HWC1 2R041 2VCAA 2JDYA 4LOTA 1GOGA 1Y9QA 4LBKA 4XVHA 4YG0A 1NA1B 3BCWA 5FMOS 4AF9A 4HKWA 2CY6A 3VBHC 4XFBA 3E97A 4WBBA 1NQDA 1GBGA 1AX0A 3OGVA 2OVUA 4P02B 1B09A 4K21A 5FLHA 4WZCA 5EJ1B 1I6XA 1ULFA 2GNMA 2ZBJA 4PIYA 3ZFEC 4CU9A 4CCJA 1NXMA 1YFUA 1MZ5A 4EN6B 5CFDC 2BV4A 4FAGA 4F7ZA 4XXPA 1M4WA 4CDUA 3D0SA 2WS93 4E8CA 4NRMA 1YRZA 2K9ZA 1B35A 1ENSA 2ZEZA 1CX4A 2A70A 3C3VA 5FJKA 5LY2A 5FZOA 1A34A 3GZUC 2HLEA 4QX7A 1YIPA 2GN7A 2RMU1 4PLMA 4Q4Y3 5DABA 4XJ8A 4AVAA 5C9AC 2OPWA 3B3QE 5F1RA 3H8XA 3JBG3 1Q3EA 1W3XA 3LCPA 3C7HA 1IQDC 1ZA7A 2O1QA 5DZEA 3ZFGA 3WP6A 4QPWA 1UXXX 1REEA 1UZYA 2Q8OA 5IFPA 4A42A 2MEV2 3H8OA 3T30A 4DOUA 1GQGA 1HN1A 1WZXA 2A6VA 4HPKA 4PLOA 2X05A 1RXFA 4Y20B 4CDWA 1N1VA 2QQKA 2OW4A 3P5BA 4Q26A 4QHZA 2EF6A 4XIKA 2A3WA 3B01A 3QOPA 3EJKA 3I54A 4MXWA 2GSYA 4JKLA 5A3PA 3ZYBA 5FPXA 5LEJA 3VDCA 1VIWB 3ZSKA 5BNPA 2PHWA 4COUA 4HSJA 2HWD1 4QPGB 2WIIB 4I0AA 1V6MA 5FK7A 1DF0A 3R4SA 4GZ9A 1XNKA 1POV0 3I8TA 4L9BA 4YRDA 1HX6A 3NV1A 1DBNA 2RMU2 1RUJ3 3WG1A 3WQBA 4D6QA 1POV3 1XU1A 5E16A 1LHNA 3ZKYA 2LROA 2VTXJ 3ILRA 1PMIA
chains in the Genus database with same CATH topology
1AR82 4GH4A 2D44A 2CV6A 1G9AA 3NV4A 4AEDC 3ATGA 5FO9B 5JSRA 2HEWF 5L36A 1PIV3 2DCKA 3VL9A 5A33B 4RR3C 4U36A 4UW5A 2WZPP 3N3HA 3OF1A 3T2TA 1ZZBA 1UPIA 1LRHA 2ZGLA 2ZGQA 1CAVA 2ZGMA 5SV5A 3OCPA 2PHLA 1W2UA 2RJKA 1ZRFA 3AMQA 3USSA 1MS8A 3E6BA 4G3YC 4FTEA 1PO22 2ZGRA 4DZGA 1GNZA 4LA3A 1V6OA 1BYHA 2KXLA 2FQPA 1I5ZA 1O4YA 4Z92B 3KCYA 1NE6A 3KM5A 1AYN3 2BW8A 5DDJ2 1LECA 4NO4A 2BEOA 2XKPA 3ZXFA 3IM0A 4YGBA 3RYKA 4Z82A 4YG3A 4MGZE 1H2KA 3B69A 1QH7A 3ETQA 3WV6A 2GC1A 5CFCA 1PIV1 1PIV2 5GLWA 1UU6A 4CEWB 1W6OA 4OHZA 3ZIWA 2GAUA 4Y1VA 3B93A 1G8WA 2GDFA 4Q8LA 2WS92 1IPKA 2R061 4FP2A 4YM3A 3DGTA 2DYCA 3ZYPA 3URFA 3ES4A 2A7AA 5KHIA 4MXWB 2UY9A 1HXS1 2XPJA 5K0UA 3WCRA 4PJYA 4BH9A 1ND3C 2RM23 1VBD2 2ZS6B 3RJRA 1QHDA 3VHOA 3DV8A 4Q1RA 2FMYA 4QD2A 4XFHA 4N53C 4DY3A 1RJ8A 1BXHA 1ULDA 4BE3A 1H8TB 1ND3A 2PA7A 1QKQA 3ZN6B 3VKLA 1ND2C 1DYKA 4SLIA 2RMU3 4MGKE 5BNNC 1VBC3 1UMZA 4WM8C 3ZDSA 5JSPA 3J8F3 1DFQA 2I74A 1LULA 4XDQA 1FNZA 3AKPA 1RHI3 2WKKA 2VOKA 2W08A 1AZDA 3E5QA 1AL21 4IEPA 4IL7A 1AXZA 3IDBB 4WM7C 1PM7A 4IEXA 2RS32 4WM8A 5CADA 1WLCA 1H9WA 1V6JA 1EP0A 1WLWA 4FAHA 3ZYIB 1RUG2 2P2KA 4WVMB 1J1TA 3WW1A 2XLGA 2HWD3 1V00A 4FTSA 4NWWA 1HRI2 2BNOA 1CAWB 4UW3A 1UD1A 1UZZA 2QFEA 4NWVA 4Q4W3 3QH7A 4XF1A 5JSOA 1VAMA 4Q27A 4QQPA 3R0RA 1SACA 5A3MA 1MR5A 3B00A 1JXNA 2PAMA 4M3CE 4XTPA 4Y1UA 4BA6A 3HT1A 3LA2A 4IETA 1EPWA 3FLTA 3CU7A 4D7YA 3SXWA 5F6KA 2MEV1 2IXKA 4Q2FA 1QJU2 4W6WA 4H55A 1BEV3 1FOD3 1FT9A 2NP0A 4E4DX 1RUI1 5FO8B 2PLV3 5I8YA 1PGW2 1UPSA 1V6KA 2K2SA 3HIFA 2YUEA 4XFIA 1V70A 1CAUA 2E53A 2XG3A 3APBA 1RIRA 3UKNA 3DF0A 4O9GA 5BNOB 4P14A 1COV3 3OY8B 3WY6A 3VBFA 1W6NB 3S7IA 3SCHA 4AFBA 2ZX1A 4UBHA 3HMYA 2UY8A 2OIIA 3VBFC 2H6BA 2XLAA 4AEDB 2G9FA 3ZN6A 2EIGA 2Q0AA 1VBD1 1O4TA 4META 3NAPC 4KU8A 1JYIA 3VUOA 1TMF2 2IXCA 4HKOA 1Y7BA 3H1MA 1UCXA 5T5LA 1XE8A 4L8QA 1BVVA 2ZX2A 5KXBA 4JTOA 1DZQA 1RUH3 3JD71 5CA6A 1LB2A 2KM2A 1LU2A 4P9JA 3DPRB 4WVWA 2YXSA 2CTVA 1GSLA 4XFFA 1LTEA 4LUMA 2VVDA 2O8QA 1PO23 1YI7A 4ASLA 4Q0QA 3E6DA 2B7YA 4YM2A 3FUOA 1R091 1LCLA 3OYWB 4IEWA 3GBFA 2ZZQA 3RYPA 5CAZA 1VBC1 2DF7A 2VNGA 3VBHB 3AP4A 3ZFGB 4QT6A 1B35C 4Z2WA 1H30A 3BALA 1G9DA 4MGIE 4AQTA 2R30A 4Q4V1 1OLQA 3THPA 3GF6A 1AYM2 4XJAA 1UIKA 4AFDA 4ZU7A 1LGBA 4DY5A 1AR83 2R0FA 1Q5OA 5F6LB 3LOIA 3R4DB 4JRAA 5L7OA 4JGZB 1HRI3 1RUJ2 3FHIB 3FMGA 1VBB1 1RUC2 1NOVA 3IKWA 3JUUA 1MEC1 4QPGA 1MEC2 2N7GA 3AYEA 2C1FA 4JRLA 4BIOA 2YMZA 2D97A 2A6ZA 3VBFB 5AC92 5H9QA 4YW3A 2QZ2A 2B9UA 3UKVA 2WWSA 1LEDA 2E6VA 3MLKA 4R4ZA 1D4M3 3TWIA 1NCRC 1H1AA 1OOPB 1LOFC 1HQLA 3ALQA 3USUB 1NLRA 1APNA 2R071 3ZSLA 3JB4C 1YIFA 3SHRA 5JMCA 2MEV3 1H2MA 1UW8A 1VBA1 1IS5A 3LA7A 4GULA 1NCQB 4ASMB 4INDA 1KD7A 3VKOA 4CDXA 4BYYA 1CR7A 4QM9A 1GV9A 2ILMA 4Q4Y2 4FPLA 3WW4A 5AC93 1LHVA 1S2KA 1HXS2 2HYKA 5ACA1 4XEZA 2EA7A 1RUOA 2VH9A 4XW3A 4D3WA 1G86A 3FJSA 4YGDA 3DPRA 3ZSMA 2IC1A 4XJWA 1PNFA 5JPNB 1R1A1 1J3QA 4RL7A 1S1AA 5J7MA 4O9EA 1FPN3 1VBE2 1PVXA 4PIXA 3VZJA 2SBAA 5FRAA 3THTA 3DL3A 5KXDA 1VP6A 3VBSB 3VKMA 1HXS3 2BVBA 1TQ5A 1MVEA 4DXZA 1SLLA 1U5YA 1VRH2 2JJ6A 2JG8A 2Q5TA 2RM21 3FX3A 5DDJ1 2X5IC 1PK6B 4QX5A 2VULA 1WW6A 4BMBA 1NE4A 2R042 1YWKA 3JD73 4V1PA 4XJZA 1N1YA 2OPKA 2OYZA 5BNOC 3E6CC 3M2MA 2ARBA 5CFCC 4JQRA 1GFF2 3V0AB 1O3SA 3FBMA 4DFSA 2WINB 5IK7A 3PJYA 3J8F1 5C4WB 3VBUC 2KA3A 1SFYA 2DVBA 2BPA2 4XBNA 5I91A 2Q1MA 3J26N 5BY5A 1S0IA 2YGLA 1H8TA 1OPOA 1ZRRA 2ATFA 5BYNA 3VBUA 1R093 1RUC3 2YPJA 3LSDA 2QVSB 3AB0A 3N35A 1ZBE2 1HQNA 4TSVA 3U4XA 1BBT1 1SCSA 3RRDA 3H1WA 4OUMA 4XFCA 1O91A 1ZREA 3USUA 3NAPA 1DGRA 4QM8A 1OMIA 1FMD1 4RGAA 1H2NA 4FOYA 1WUVA 1OQDA 2DCJA 1DLLA 5I0SA 2ZX0A 4H7MA 1TME3 3AKRA 1H1MA 1Q8OA 3N7KA 5IK4A 1CN1A 4DB5A 5GZGA 4WVMA 5FO7B 4WM7A 1OFSA 3WT3A 3QACA 4L97A 3WQ1A 1QJX1 4TZDA 1BMV1 1X33A 1QJU3 3H3UA 4I3PA 1SLTA 1NXD1 4YGCA 4LT5A 1CIWA 2RR13 5FLJA 1XNDA 3ZX7A 3B7MA 3KCXA 3VBSC 4DQAA 4S2HA 4RFT0 3ZMOA 4F8AA 2PHTA 5LEKA 1FI2A 4LHLA 4MSVA 1Z7S2 3LGRA 4TYSA 4QHBA 4FXKB 2CWMA 3VBSA 3RMYA 1PK6C 1W39A 1MZEA 4FPFA 4X6RB 1BKZA 3IPVA 1C5HA 2E51A 3M3QA 4PF5A 4XZPA 2PTMA 1NY72 3VV1A 3WLUA 5I8SA 1TME1 2VY0A 3KQRA 3WP4A 3TB0A 5LK7B 3M70A 1W6MA 5LRRA 3WDVA 3ME2A 3EO6A 3OGJA 1RGSA 4COYA 4CDUB 1EV13 2P3JA 1X7NA 1AHSA 3A0NA 2RS33 1XXNA 1RUG3 3AKTA 4AVTA 4ISRA 3D82A 4C1WA 3RMXA 4MLOA 4XILA 2DUOA 1DQ0A 1ZZ8A 4JGYA 4FAGA 3JD72 2PHDA 4MXVA 4N9IA 3MIFA 1NCQC 2W0XA 5EXOA 5I0UA 5C8CB 1QQP3 4U2AA 4EN8B 2DVDA 4XHBA 4BZ4A 4ES9A 3ELNA 4Q0UA 4FPYA 1QNYA 1HRV3 1PZ9A 1QXJA 1QGLA 2VQAA 1BK1A 4LA2A 4BM8A 4X6QB 4YVWC 4CEYA 3MGUA 3NKGA 3OBRA 2X53S 1CPMA 2WNEA 4M00A 1R081 4LTAA 4FP3A 1Y3TA 4K8FA 4N7UA 2YHJA 1CESA 2K0GA 4BWOA 3ZMNA 2NMNA 2YY1A 1IKPA 5IK8A 1VBE1 4NHMA 3VDDA 3CJIB 1GKBA 2ZACA 4Q4X3 4CDQB 2VG9A 4HN0A 3QCWA 1EY2A 1X36A 2QDNA 2Z2SB 2VOVA 3FZ3A 4XXAA 5C9AB 5ABJC 1HRV1 4UBGA 2BNMA 4IEUA 2WL1A 1X8MA 2VVEA 1UU5A 2WT1A 2WFF1 3M3EA 2EXIA 2WSVA 2WNVA 2PQQA 2TEPA 1TMF3 1CAXA 3ZFGC 1VBA3 2HWF3 4XJ9A 5J96B 1Q8QA 1HV0A 3VKNA 5K0UC 4XFGA 2XKOA 2DVGA 2ZOEB 1C5IA 1EPZA 1ULEA 3PVBB 1L3JA 2UYBA 3WDWA 3NWKA 1DU3D 3CEWA 1FV3A 2AYHA 2ZZJA 5ACA3 4NOTA 4YSFA 1F5FA 4URTA 4C0BA 1JOJA 1PGL2 1QJY3 1VBB2 4LO8A 4YFWA 4R9BA 1YNAA 3INAA 3V0BA 4JDNA 1UL9A 1C8M3 2A71A 2GH2A 4Q0PA 2NLRA 4HN1A 1S0CA 4W65A 3ZXEA 3JU9A 3MIDA 3WQ0A 2XL7A 1DZRA 3EHKA 1D2QA 4FQZA 1TEIA 1ZM1A 2IFWA 4UW4A 5JI9A 2PLV2 2TNFA 5I93A 1BEV2 1FOD2 2ZGUA 1LOEA 4PDWB 3D0JA 3K48A 3H7YA 4A3XA 5DDJ3 2W39A 1YHFA 1AL22 3RI8A 2Z5WA 4EN0A 1C1FA 2RS51 4QMAA 4B4RA 2Y38A 3D5OA 1HQWA 4LBJA 4ZU4A 4L92A 1DYPA 3R05A 3JBG2 2JDZA 5GKAC 5HBAA 4JCKA 3HT2A 2XWBB 1H4GA 1QMJA 3O5SA 1SLAA 1C8M1 2AR6A 2RS12 3ILFA 1PK6A 3L2YA 4IV3C 1GQHA 1Q8VA 3GBWA 4YW2A 3TAYA 4CP0A 4RQPC 2NZ9A 2W68A 1IQAA 2ENRA 3NKTA 5TSWA 2JG8C 1QJX2 3IMNA 4AQ2A 4Y5Z0 2XBO1 3AZXA 2UWBA 3PVOA 5JZGA 4COZA 4LNVA 3WQ7A 3B9IA 2DUPA 5BNQA 1RUE3 3PMSA 4LBQD 1FMD3 2JG9A 1QOSA 1B35B 1RUH1 1J3RA 2NMOA 2QUOA 4B7KA 3JQWA 3OY8A 1J59A 2B42B 3WINE 1OQ1A 5IT6A 5J37A 2Y0OA 3ZO0B 2XL9A 5DXDA 1H0BA 1QJX3 3LA3A 4JGZC 3ZFFA 1OA2A 1KJLA 4GB33 4F83A 4Y20A 3OPZA 3B9CA 5C8WA 1A8DA 4FOQA 3ZFFC 5L19A 2RS13 2WNUC 5A33A 4MUVA 2P34A 3HBZA 3MEPA 4YVSB 4ZU5A 5AFBA 1CGPA 4R4XA 2SLIA 2CWSA 2D5FA 4WM7B 2JE7A 4YM0A 2WNUA 3GALA 3ES1A 5I0TA 5T55A 2HWF1 3MPPG 2HWD2 1HLCA 4AEKA 4HSLA 3POSA 1DG6A 1Z7S3 3IIAA 5JOZA 1HRI1 2VOXA 3H9AA 4XBQA 3M7AA 3AFGA 4XYXA 4XF9A 4Y1ZA 1U5XA 3ZPYA 2A6WA 3RG0A 3WXPA 1RINA 1ZNPA 1KJRA 3HWJA 3N7MA 4XF4A 3EBRA 5CVRA 4AFCA 4ITCA 3LB9A 1NLSA 4AFMA 3RZZA 5HXVA 3RDIA 1GR3A 5C33A 3PMEA 1U5IA 3ZSEA 1S0BA 1VB2A 3G7DA 1FYUA 1KQRA 3SITA 3ZXKA 4BLJA 3KD4A 1RHI1 5FOBB 2ZKNA 2CL2A 4XFAA 2X29A 2OZJA 2B46X 5J48A 3E5XA 1VBA2 1ZBA3 1X82A 2LUWA 2OA2A 4FCAA 3I7DA 2ZGNA 5JOWA 1W6PA 2GNBA 4JGYB 3WNXA 2R1BA 1A3KA 4W6YA 4CEWA 1WD4A 5CG8A 1W6OB 1EAH1 2NQYA 1NYWA 3FWEA 4R9DA 4QQOA 5C4WC 4PIZA 2PHFA 1OOPA 1SDWA 4Y1XA 1E57A 1NCRA 2XJTA 1O5LA 2A6XA 3WW2A 4OFGA 1DQ4A 3WVJA 4FPJA 4LO7A 5D1IA 4JDOA 3CNAA 3S30A 5FMOL 3J4UH 2B39A 4DNYA 2ZPXA 2CGNA 3P3NA 1LENA 2WT2A 4IEZA 1ASJ1 1RUE1 1V9U2 3TNPB 2EXJA 2OUJA 4H3WA 3VBRA 1KRIA 2VECA 2HWB2 2E63A 1H4HA 2QNKA 2UYAA 4C91A 1YI9A 1S0EA 2DVAA 4Q4X2 2XB6C 4ATEA 3CJXA 2WZR3 1LGCA 4WV8A 4RS5C 2VW1A 3LOBA 2MNGA 5BPXA 2I2SA 4P9YA 4XF3A 3AYDA 4YVWB 1TMF1 1GICA 4KU7A 3MIHA 1DGWX 2R0HA 1SEFA 1ZRCA 1PVC1 4AHWA 2DVFA 1UX6A 2D43A 3ZFEA 2DTYA 1V6IA 4L99A 4IV3A 1IS3A 1X8EA 1CVNA 1ENRA 3ENRA 4Q0SA 5JIUA 3CLPA 3U10A 2WJSA 5AVAA 1ALYA 3IDEA 1N3PA 3ST7A 3ZXDA 4AI3A 1U12A 1CAUB 1QXPA 2OZ6A 4E2QA 3WDYA 4Z07A 5JZGC 1QQP2 3T1LA 4A2UA 3VDDB 3SISA 5AFEA 1W6NA 3QH6A 3TYJA 2WZR1 2WNVC 1RC6A 5BV6A 2LTNA 4YW5A 1Z7S1 3FC0A 1RTVA 2YYOA 3EXUA 3UKTA 1JW6A 4GKXA 4CDWB 1QY4A 5C9AA 4CYDA 1N1SA 3ZSJA 4ATFA 1MACA 3AK0A 3IN9A 4YVSC 3AMPA 3SH4A 1ULGA 2VXRA 3NAPB 3AMHA 5KC6A 5EV7A 2D7FA 2GNTA 5A32A 1KS5A 2P17A 4R52A 2ETEA 1KS4A 4KWLA 1SFNA 1Q56A 2NN8A 3OD4A 4XE9A 4HVOA 1RUI2 3KS7A 2E7QA 1PO13 3MLJA 4Y1YA 4RS5B 1MS5A 2XJRA 3AP6A 4CDXC 4E2GA 1X50A 2BUKA 1FATA 1RL3A 2PAKA 1IHMA 3A4UA 3AX4A 4YLZA 1CD3G 5FREA 1FX5A 4B29A 4XQWA 3GZAA 1TME2 1QNWA 3SCFA 1BJQA 2HWE2 3FFQA 1LESA 1RUI3 4X8PA 4WVZA 3N4MA 3UJOA 4RR3B 5FDBA 4PDWA 4E4ZA 4M3CF 1PGSA 4ZXKA 2BGCA 2QJVA 1PNGA 1MS9A 2R1DA 2Q1ZB 4YGEA 2X5IB 1AJKA 1A6CA 2ZHMA 2R073 1I9RA 2PAEA 5JZGB 2XWJB 1ASJ3 1ZBE3 1SCRA 3VDDC 4D94A 5B2GB 1W6QB 1VAKA 1WMFA 3QD6A 4AVVA 1AR71 1UN1A 4FXGB 1S0DA 1LHOA 3MFCA 2XBO2 2LM3A 2XVGA 1KXGA 2DCTA 3PVEA 4MV2A 3TNQA 2FZ2A 4IESA 1BMV2 1C3HA 4Y22B 1LOBA 1RVF1 5LRSA 2GH8A 4IXLA 2ZGPA 4GWMA 4XOGA 3AJZA 4AI2A 2XHKA 3BU7A 4MX3A 5T3NA 4YW1A 3J9SA 4CEWC 5C8CA 1QJZA 2GU9A 4EROA 2WLQA 2VUAA 1JH5A 2AUYA 2HWE3 2QQPA 2QCSB 4BLIA 3U11A 4GA9A 1ZBE1 2VMGA 3KSCA 1VAVA 1WW7A 1QOTA 4HZFA 1ND3B 3FLPA 4RD7A 1AR93 4XMAA 4B8EA 1H1IA 1PO21 2WS91 5BNNA 3VZMA 4AVBA 4DRVA 3MDPA 5T54A 4R8HA 2EAAA 2D3SA 1PO12 5T5JA 1MQTA 4AW7A 4BPZA 5E8AA 1ZVFA 3AMNA 4D7SA 3MYXA 2HWB1 1I1EA 1F5JA 1OFNA 2R6QA 2ZGTA 2PN5A 3NVCA 3NJZA 5KXCA 3IT8A 2D6OX 2GALA 2VOWA 4AE2A 1SQ4A 1VALA 2EAKA 3KB5A 4P5HA 3RWNA 1KDMA 4LBMA 3UV9A 2B8MA 4LO6B 1RMU2 3FE5A 1AR92 3KCCA 5JWPA 1NA1A 1IS4A 4M0NA 3JB8A 3PJQA 1DQ6A 1RUC1 4C1XA 2GN3A 3MFAA 2RS52 4AI0A 3V56A 4FBFA 4SBVA 5JOXA 3W59A 1N3QA 2XH6A 3CL1A 4R9CA 1D0HA 4A7KA 3LZZA 1EAH3 4PQ9A 4LEJA 2VGDA 1AR62 3CO2A 1W6QA 2HKXA 4CDUC 1K5MB 2E7AA 4OLLA 4UXAA 4CDWC 5DG2A 1VBC2 2AZ5A 3C2UA 3MW2A 2GC3A 1LHWA 2JG8B 5EWSA 2ZCWA 5GZFA 4HK9A 2QDRA 2ZAAA 3RSJA 3MIGA 1QH6A 1AVBA 5FQ0A 5EYXA 4EV0A 4HPKB 4LBLA 5FTTC 4OHXA 3FBYA 3RS6A 1RUF2 2D5HA 1AR61 2XGXA 3G6JB 1H8VA 1S55A 2VW2A 3AZWA 3BODA 3O14A 3TBDA 2D93A 4EWEA 1RJ7A 4RHV3 3E5UA 2WFF2 5BNPC 4JGYC 3WP3A 2EXKA 4KG0A 2WZR2 5GLTA 4Z1VA 2Z79A 4G4FA 1M06G 1G9FA 3H8UA 4NN0A 5JLVA 3JCIA 5DUUA 3GYDA 1DIWA 1RMU1 4BHPA 1MQTB 1OA4A 2BYVE 5D8AC 2G4IA 2ZMNA 2WFPA 1YFYA 1QWRA 2NPIA 4PBOA 2C0ZA 1NCRB 3TN92 4YVWA 3I59B 1AXKA 5D8AA 1D4VB 1NZCA 5DZFA 3ZN5A 5GLZA 3AJYA 2D6PA 1WCSA 4M3CB 3VL8A 2JE9A 4L11A 2WQZC 4K9SA 2IXIA 3M3CA 4R9AA 4OHVA 1CJDA 2QZ3A 4LHNA 1CAVB 5KC5A 1W0PA 4JVAA 1R082 2Q4SA 3VBRB 4MVTA 1XYPA 3OD0A 1PZ7A 1OPMA 2WC2A 1MS3A 4RQPA 1WW4A 2A75A 4HANA 4OI1A 5GZCA 4HMZA 4QGNA 3GNEA 4YG6A 4QPIB 3POYA 3UK9A 3HQXA 4W6XA 1PZ8A 4I01A 2A73B 1GLHA 1V9U1 4NHKA 5ABJA 1COV2 2B5HA 3H7JA 1BBT3 1YO8A 3NW4A 1TNRA 4EN7B 2IXLA 2I07B 3IDCB 3ASIA 1DGLA 2R043 1XE7A 1RVF2 2RE9A 5GLUA 1O4ZA 3Q9OA 1HKDA 3VHRA 4S2GA 4FPCA 3UL2A 4RSUA 5JIAA 1F31A 3L9JT 2WQ4A 4JGZA 4QPGC 5C8CC 3VGIA 4E2SA 2JG9B 1H2LA 1LU1A 3M4FA 5FOJB 5A32B 3OTFA 1ZYBA 1ZA4A 1RB8G 2ZJCA 4YW4A 4GMP3 4J1WA 1G9BA 2ZHKA 4OZXA 1RUF3 4Q4W1 1BVP1 2ET1A 1SBFA 3O7OA 3I4IA 2JECA 3OGGA 2DFCA 2MHFA 3JBG1 4FT8A 3R4UA 2VPVA 4MYEA 1G7YA 1VR3A 5GZEA 1KITA 4K20A 4Y4YA 3CJIA 2WSUA 2GMEA 1UF2C 4K1ZA 3WUCA 3MF9A 4X8NA 1J3PA 2D6MA 4S2FA 3KGLA 4OHWA 5J3UA 4RGGA 1TE1B 2UWCA 2PLV1 1ZBA1 2BVVA 2F6BA 4YFZA 1JUIA 1RHI2 3VBRC 1EV11 3KGZA 5KHKA 2DCYA 3M3IA 4XETA 4EWDA 4CTEA 1OHFA 3AZZA 3PVNA 3RJ2X 2YZ4A 3WHUA 4GKYA 4GMP1 3P3PA 4RS5A 1JUHA 4RQPB 4LO5B 3TOJA 4COVA 2GMPA 3KLSA 2D6LX 4FVVA 1Z78A 3ZYRA 1UKGA 2GC0A 2XJQA 3MICA 1I3HA 1FMD2 1QJY2 1N47A 2ZMKA 3PHMA 2C5DA 4IEQA 1F9KA 2QKDA 2XUMA 2XJVA 4A7ZA 4CP1A 5KBFA 3PTYA 5T52A 1AR91 1IS6A 4LBQA 2RM22 4KH9A 2JG9C 2WNVB 1QU0A 5BNPB 2AENA 2HEVF 3PNAA 1IPJA 4Q1PA 5AVPA 3VLBB 1H8TC 2A5ZA 2DWRA 2TBVA 3HAGA 4AYUA 1FPN1 2HWC3 1XU2A 3VBUB 1CPNA 3SH5A 3ZVXA 4YZ2A 1R1A2 5BNNB 1GZWB 1W6PB 3GBGA 3ZYGA 1A8MA 1Z0HA 5T5OA 4XHXA 3WUDA 2A3XA 1Q43A 3ECQA 3NSTA 1V9U3 2GZWA 3ZYJB 4GXLA 1YCIA 1WW5A 1VRH1 4DS0A 2DCZA 3N7LA 1U5ZA 2H0BA 4I02A 2AH2A 4N43A 4AWDA 5GZDA 3AYAA 3MLLA 2BNNA 2XJUA 1XNBA 3S0MA 1GZCA 3AFKA 2V09A 3AP7A 4KGGA 4BMEA 1YFWA 3M8LA 4N43C 3AZYA 4YM1A 3AM2A 3RI9A 1VBB3 3KT7A 3QBQA 4IV3B 4MH0E 1H9PA 5T50A 2PHUA 5ACA2 2EALA 4KL1A 4ZKTB 5I0RA 5F9TA 1C8NA 1IZ3A 2D3RA 4AVSA 4DRRA 4GB32 1HIXA 3I2DA 1K5MA 3AXDA 2IFRA 2AGSA 2DTWA 2RS11 4CP2A 1ZRDA 4AVCA 4XPVA 4GMP0 3W9AA 3IPVB 4IERA 2JD4A 1T6GC 3OBTA 3ZFEB 5FBZA 3IBMA 5CFDB 5CIRA 3AZVA 1XYNA 1BZWA 1W6MB 1VB4A 4MZUA 3WX5A 1RUNA 4LBQB 3AP9A 4Y24A 5JI7A 2Y26A 1ZX5A 2FBEA 4NHLA 2XLFA 3MW4A 1KFUL 3WW3A 1SLBA 2P37A 5DG1A 4AI1A 1VJ2A 4FO9A 5L7OC 4FOVA 4HETA 1HW5A 2CGOA 1XRUA 4XJUA 2HWC2 1JTZX 2RS53 1BQPA 1N1TA 1DGRN 1HV1A 4K6BA 2HEYF 4KQ7A 4BIFA 1O3QA 1AYM1 1OOPC 2IWGB 2LALA 3H0OA 1XYOA 5EYYA 2XVKA 3NL1A 1F2NA 1G9CA 4DINB 1PGL1 4XMIA 1FNYA 4YYOA 2G9GA 1AX1A 1KDKA 3AKSA 1LOFA 4GH4C 5J09A 4B4PA 2JEMA 2CAVA 3MW3A 4MGYE 2RR12 3WP5A 4AHYA 4K3UA 3DPRC 1HRV2 3L2HA 1AR73 4N43B 2I45A 5SV8A 4FPGA 1LJ7A 3LAGA 1ND2B 4COWA 2E9QA 4KNCA 4D7TA 2VW0A 4I2OA 1RVF3 2YROA 3WG2A 1MQTC 4OULA 4B4QA 4CZSA 4PDWC 1CAWA 3SH3A 3KT1A 1BBT2 1AL0G 2IXJA 3AYCA 2C9AA 2ZMLA 5E1RA 4C90A 3GHNA 1UAIA 4HLTA 5BUVA 1A78A 2OUHA 1O7FA 1MS0A 3W58A 2ZA9A 1GYKA 4AEMA 4NVPA 5JOYA 1PVC2 2MPFA 5CNAA 5FCCA 2R16A 4B7EA 2X5IA 4UW6A 2X8KA 1F8VA 3D8CA 2NM1A 4XQ4A 4AQ6A 3JZVA 4AI8A 3LWCA 1WGPA 1AUYA 1S2BA 3MI8A 4NPRA 1RUD1 4QPIC 1C1LA 4GWNA 3K51A 3S7EA 4P9LA