4H7MA

The x-ray crystal structure of the trichoderma harzianum endoglucanase 3 from family gh12
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
EAEAEFQTSCEQYAVFSGGNGYSVSNNLWGQSAGSGFGCITVNSLNSAASWHADWQWSGGQNNVKSYPNVQIAIPQKRIVNSIGSMPTTASWSYTGSNLRADVAYDLFTASNPNHVTYSGDYELMIWLARYGDIGPIGSAQGTVTINGQSWTLYYGFNGAMQVYSFVAPSTVTNWSGDVKNFFNYLRDNKGYPASSQYVLSYQFGTEPFTGSGTLNVNSWTASINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-glucanase
publication title X-ray Structure and Molecular Dynamics Simulations of Endoglucanase 3 from Trichoderma harzianum: Structural Organization and Substrate Recognition by Endoglucanases That Lack Cellulose Binding Module.
pubmed doi rcsb
source organism Trichoderma harzianum
molecule tags Hydrolase
total genus 56
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4h7mA00
3WP4A 2C1FA 3MF6A 3EXUA 3LB9A 3VL9A 3WQ0A 2JICA 4S2HA 3VZKA 3WP6A 3AKRA 3AKPA 2BWCA 1UU6A 3B5LB 4S2GA 2DFCA 1HIXA 2B46X 2QZ3A 3WT3A 1AXKA 1ENXA 3WQ1A 4S2DA 4NPRA 3WP5A 2BW8A 3VL8A 1W2UA 1H8VA 3AKQA 3B7MA 1QH7A 4XPVA 1C5IA 2DCZA 2D98A 4IXLA 1H4GA 3WX5A 1REEA 1OA4A 1BVVA 2DCKA 3LGRA 1OA2A 4XQ4A 1REDA 2DCYA 3MFCA 1XYOA 3VZNA 3WXPA 3VZOA 2JEMA 1XNBA 4XQWA 3WR0A 1XNDA 2F6BA 3ZSEA 3AMNA 4HKOA 3WQ7A 2BWAA 1IGOA 3RI9A 2NQYA 5K9YA 1OLRA 1NLRA 2BVVA 2DFBA 2VGDA 3VHPA 1YNAA 3VZJA 3AMPA 1KS5A 4HK9A 1XNKA 4HKLA 1XYNA 3VHNA 4H7MA 2QZ2A 3VZMA 1XXNA 1C5HA 3AKTA 1UU4A 3VGIA 3RI8A 1XNCA 3VHOA 1H4HA 3AMHA 2VG9A 3MF9A 1HV1A 1H0BA 1BK1A 2DCJA 3VZLA 2NLRA 2VUJA 3HD8B 2B45X 2Z79A 3AKSA 4HKWA 3WY6A 1OA3A 1PVXA 1REFA 1T6GC 1F5JA 3MFAA 5K7PA 2B42B 4HK8A 1M4WA 2D97A 5HXVA 1BCXA 1QH6A 3AMMA 5EJ3A 2JENA 4XQDA 3O7OA 3M4FA 3WP3A 1OLQA 3AMQA 1H1AA 1UKRA 1UU5A 1HV0A 3VLBB 1KS4A 4S2FA 1TE1B 2VULA 1XYPA
chains in the Genus database with same CATH superfamily
4MV2A 2YC2A 2JKBA 1PVC3 2D5HA 5T5JA 4A41A 1ENRA 1UD1A 1W8FA 3KM5A 3O1TA 5FLHA 4LO4B 1UOBA 4LO6B 2A3XA 3JUUA 2NP0A 1XJAA 4Q29A 3N36A 3DF0A 3OY8B 1CX1A 4V2VA 4UF0B 2W0XA 2IXHA 1PGL1 5FPXA 1CJPA 2DFCA 1O7FA 5FZCA 1UWWA 4OYUA 2R0HA 2VMEA 2ZAAA 5LWBA 1UCXA 3JD73 5E16A 2WWJA 3URFA 1UXXX 3H8OA 1W39A 2XJRA 3JB4C 5L19A 4FTSA 2ZMNA 5FYYA 5A3NA 5JIUA 1JXNA 1X8EA 4IEQA 4XJZA 3LSDA 4XJAA 1PIV1 3VDCA 3V0AB 1OD3A 1RUI2 4NRQA 4B3NA 4CEYA 5C33A 2QBXA 3B7MA 4WVVA 3BUCA 5T50A 4AE2A 4CCDA 3LEKA 2F4PA 1ZZ7A 3PJYA 2X8KA 3K4ZA 4IXLA 5FIXA 3ABZA 1RC6A 4MLOA 1SPPB 2RMU3 1RJ7A 1OA4A 4K6BA 4RR3A 3TYJA 3MO4A 5KHHA 3DCQA 3DXUA 3I59A 3O1UA 1NZCA 1RYYA 2KM2A 1HRV1 2VW1A 3KCXA 4XF0A 1C3HA 5F1RA 3HOBA 4BQ5A 1PZ8A 1HB4A 5FXVA 3GZUC 4I01A 1PO11 1RUC3 1Y9QA 2YZ4A 2ZKLA 4Q4X3 5FWEA 1XNDA 4YVSC 5FZ4A 2XWBB 5JOZA 2OS2A 2A71A 4JKMA 1X9PA 1O91A 1XB9A 3IAQA 1JZ6A 5HXMA 1EV11 1RUD2 5CB7A 1DQ0A 2W1UA 3VBSB 1LCLA 1VBB3 2VW0A 1OLME 3KB5A 4GKYA 5B2GB 4TLGA 5C8CB 4YLZA 1VRH1 1Q8QA 3LDKA 4NJ4A 3PU3A 4AFAA 3J4UH 3ORJA 5FWJA 1S0GA 4W65A 1N3OA 1WW5A 5FYHA 5I93A 4L99A 1HQLA 1YUDA 1XBFA 2W3JA 1UZVA 1JZ8A 1JYTA 3M3IA 4MX3A 1UN1A 2OKXA 2O8QA 2XHNA 5CADA 3KT4A 3I2HA 1GMMA 1FAYA 3IN9A 3MF9A 4NOTA 2WS91 1BEV3 5CAZA 1QIQA 5F3IA 1KJLA 5LBBA 2WFF3 2XQXA 1UMIA 3VBHA 1A6CA 4JDNA 2FZ2A 1T6GC 3WDYA 5K0UA 3ZXAC 1W6QA 3R6SA 5F5AA 1ZBE2 1GYKA 5F7UA 1WA6X 2RS32 1M4WA 4M01A 3CEWA 3H3UA 1W8HA 1W9WA 5HXVA 2FD8A 1YJLA 4H3WA 1CIYA 4CDXA 2YDEA 3HVDA 3O1MA 2GH8A 1V9U3 3MIEA 3M8LA 3PUAA 4LBQD 1XNAA 3AL5A 4XVHA 4WM7B 2UYBA 2ZHNA 1RUOA 1OLQA 2WQZC 1JUHA 2WR9A 4Y5SA 5GZEA 3VBUA 3VKOA 3ZFEB 1FATA 1JU4A 2L9LA 2NZ9A 5JVVA 4CCOA 5BNPC 5F6LB 4COZA 1HXS2 1V9U2 1TE1B 5DAXA 4I3PA 3RJ2X 1O5UA 5FQ0B 3EMRA 3H8UA 3A0KA 2A6WA 4M0NA 5FZ6A 3RNSA 5FZ9A 2Z5WA 1V6OA 4CVUA 3EXUA 1G6NA 4N7UA 3LPGA 2JJ6A 1CZTA 5I8TA 4AFMA 4CDQC 2HWF1 2P17A 1RUF1 2PHUA 4OVEA 1LHUA 4CXWA 1JI6A 4S2GA 2GN7A 4ISQA 2K9ZA 4CEWA 2B46X 5JPMB 4FAGA 3MYXA 3BTAA 2A73B 3K51A 1D4VB 3E1F1 3ZSKA 3FHQA 4NRMA 3VBFA 1GZCA 3T0BA 1UYPA 4IV1A 1W04A 1ZYBA 5C7GA 5F5CA 4S2DA 5LBEA 2GNMA 1NT0A 1MQTB 3ZYFA 5EV7A 5A6QA 4NVPA 1NCQB 2GNTA 2VOVA 4EV0A 5LA2A 4DNYA 2XMLA 2ENRA 2OIIA 4L9BA 4TTGA 2UY9A 5DZGA 1OF4A 1VBA1 4YW4A 2W87A 4AZZA 1PGL2 2J1AA 5FMOL 1ZZ6A 5FOBB 2RJ2A 2WUHA 4MGQA 3NAPC 1H8TC 5L9VA 4GQ7A 1A8DA 2JDMA 3MLLA 4QHBA 3JQXA 3ZXLA 4AVTA 1O3SA 2UU8A 1DZRA 5FYMA 4FPJA 5FZ3A 5JOWA 3EBRA 4W4ZA 1XNBA 1PIV2 1QJX3 2QDNA 1R081 1MZEA 1PZ7A 3MIBA 5JXGA 1OQ1A 2CTVA 1W06A 2XLAA 5L7OB 2RV9A 4FT8A 2X29A 4YPJA 2A70A 2CY6A 2BYVE 4ZHNA 1QJU2 3OPWA 1NQDA 1CVNA 1PO13 4IETA 4AHZA 1GNZA 4PI0A 1BLZA 1HRV2 5AFEA 1JOPA 1KXGA 1UX6A 1VMJA 2BP6A 5H9QA 4AXOA 2FQPA 4HK9A 4Q0PA 4XMAA 2BVBA 2W52A 3WDXA 1EV13 3BVCA 2WL1A 3AZYA 1EP0A 2B8MA 2LS6A 2R1DA 2GN3A 4CU6A 3RI8A 3AZWA 3ZKUA 3ZR5A 4JDMA 3C7FA 1DGWX 4EZHA 4BK4A 1OD5A 1HV1A 3ECQA 4PDWB 1COV1 3RZHA 1C57A 2NLRA 1RMU2 5CYYA 1IKQA 4IW3A 3NMBA 2B45X 4XACA 5DDJ1 3AP6A 4M0HA 1REFA 1VRH2 5D1IA 1IPKA 3VBRA 1T6BX 4RGGA 4G9SB 3LA2A 4AI3A 4EN6B 2ZS6B 4YZ3A 4XABA 2CAUA 1WW7A 2OVUA 2WS93 3GCXA 1XOYA 4IEVA 1QY4A 2ORZA 1QOOA 4KL1A 2JDNA 1GANA 5IVEA 1PM7A 1GQGA 3GYDA 2HYXA 1OFNA 1JBCA 3AMQA 2E7TA 3WINE 3LEMA 4EYUA 2R1BA 1PX4A 1RINA 4EROA 5DZFA 2DVFA 4JV4A 2J1SA 2HEYF 1XQNA 3NV2A 3O5SA 1V6JA 1W6MB 4WVMB 3VDDC 3NWKA 4CDUB 5JXIA 1YJKA 3MV11 2ARBA 2HH9A 3T0DA 2VNGA 5L73A 3VL9A 5LY1A 3RG0A 3N9PA 5T5LA 4B7EA 5J37A 2VJXA 4GALA 1RGSA 1SEFA 2E32A 2FCUA 4HVRA 4JRLA 4QXBA 3SMHA 5C4WB 1I6XA 5FYCA 5F5IA 1XE8A 3CKHA 3FLTA 1WUVA 4JGYC 2IC1A 2PQSA 1VMFA 3OD0A 1OMIA 3OGJA 1W2NA 4HL0A 3ZVXA 2BV4A 4BXFA 4BISA 4DIQA 3TN91 2HWF3 5BUVA 4LXLA 1T2XA 2C0ZA 5T54A 2JDZA 3ZLIA 1RUF3 1W2UA 3OPTA 4DXZA 1H8VA 1B09A 2BBAA 5JDBA 4YVWC 4O61A 5DPNA 2JDUA 2UYAA 2QQMA 3OBRA 1TMF2 2HWF2 2DVAA 2JIGA 3DKWA 4CA9A 3Q8FA 2Q4SA 3KS7A 1RUJ1 2RS11 5FZ8A 4ZZ5A 3SEEA 2A7AA 2IXJA 4RGKA 4ZU7A 4JQRA 4QPWA 1WMXA 4BMEA 2P1BA 3LA7A 3LWCA 5FLJA 2E33A 1JH5A 2VM9A 3PTYA 4EN0A 4XBNA 2PAMA 4MHUA 4HONA 3VD9A 1VBA3 1O4ZA 4P9XA 3VZNA 4QPGC 1SLCA 4XUPA 1FMD3 5FZKA 1ZNPA 1S2KA 2Y64A 2VR4A 1BBT1 2Z42A 4RGAA 5FY9A 1A78A 4DUWA 1J3RA 2VZSA 1BK0A 2JG9C 1J59A 2YU1A 2AREA 1W8ZA 3M2MA 2WSUA 1AR82 1R083 1LGCA 1W6NA 4QB6A 2JIJA 1WLWA 1F8VA 3SH3A 4ASLA 3ES1A 3TBDA 1GLHA 1RUNA 4JDOA 3BIWE 5FR3A 1BMV2 2P3KA 2VZVA 4NHMA 5IW0A 3KCCA 4K3UA 5HCAA 2DU0A 3ENRA 1C5HA 1QHDA 4FPEA 1UU4A 5FOJB 1RXGA 1JZ2A 3MLJA 2DVGA 5DUUA 3TEYA 4LKSA 2W1SA 3NKGA 1UPIA 4LE4A 2WLPA 4QGMA 3I2JA 4EN9B 2RS52 3VZLA 5LEJA 2YBSA 3BTYA 5GJ6A 4UT5A 2XQRA 2FZ1A 1QJFA 3OEAA 3EJKA 4BLJA 2BGPA 2FDKA 5FYVA 5D21A 1AYN2 3LCPA 4QHOA 2ZMLA 2ZZJA 2BFUS 3WVJA 1COV3 2FMYA 3J9SA 1ENQA 1H9PA 4H7LA 4MGZE 2DBIA 4UXAA 4NIGA 5DDJ3 2W1QA 3WW1A 3GCWA 2ZOEB 5ABJC 3N35A 1NCRB 4OUEA 1YIFA 4CSWA 5BNOA 1YWKA 1EPZA 5DG1A 1COV2 3WF4A 1EUTA 2WA4A 1RUH1 4KWKA 1WMDA 2OX0A 5FFOC 1HV0A 2WFPA 5I0SA 4CXYA 3GBWA 3BI3A 1D2QA 4GA9A 4JGZB 4XIKA 5ACA2 5I0TA 1Q8SA 4XFCA 1ZREA 2WKKA 5KHJA 2MEV1 3BYWA 4FFFA 4YVSA 4YZ1A 4AGGA 5BYNA 1SBEA 3ZYRA 3MUZ1 3LB9A 5IHRA 3VBSC 4PF5A 4FBFA 2YMZA 1YQCA 4N8MA 2HWC2 4U36A 5C8CC 5FZ1A 3ACIA 4XDPA 3AKPA 1LU2A 3ZM8A 2AEYA 3H8RA 1CWPA 3DYPA 4D6RA 4I0AA 4E4SA 1L7QA 3D5OA 3S5AA 2A5ZA 1O3RA 3E6DA 1DP0A 3WQ1A 2JDKA 5JR2A 4NPRA 1FPN1 5CU1A 2JDHA 1DCSA 3LA3A 4R9AA 5IAVA 1RUE2 3DV8A 4XPVA 3S5QA 1LOAA 5FUNA 5HCFA 2D98A 2VMDA 4AI8A 4IEPA 5FXXA 1H4GA 2ZEYA 3TN93 3VB9A 3H8XA 3M3EA 4KWUA 1MS5A 1W2AX 3LFMA 3R4UA 2AUYA 2VMFA 4RA0A 5A7QA 2ZXQA 5JXJA 3MZHA 2VD7A 4K9SA 1XE0A 1XU2A 2BFUL 2GSYA 2LRPA 2BERA 1GP4A 4LQRA 2VQTA 3BIEA 2ORXA 2OUHA 2WWSA 2RDSA 1VR3A 1RUJ3 2PHDA 2W95A 2VOTA 4WM7C 4NUBA 2KR2A 1AR91 3ZFEC 5FZIA 1MS9A 4RD7A 2WZR1 5LRSA 1UY3A 5KBFA 1W2TA 2G9GA 3MBWA 1FV2A 4LIVA 1KITA 3S7IA 3ZPYA 5IFPA 4QM8A 2D6KA 1STMA 1RUJ2 2RS12 3L2HA 4WZFA 5BNPA 3WCSA 5GLVA 1QNWA 4AAXA 1VIWB 1I1EA 2FMDA 3T2OA 3QH7A 1OH3A 1QXPA 1BBT3 1NE6A 4Y5Z0 3CU7A 5FUPA 1S0DA 4QX2A 5FAXA 3ZXKA 1B35B 4LUMA 4NAOA 4CDQA 2R0FA 4YZ4A 5FKCA 5FZEA 2XJPA 4M3CF 3VHNA 3WF3A 1VRBA 4XOGA 4Q1PA 2WABA 1KD7A 4H55A 1LESA 5BNNB 2TBVA 3BKZA 5IK7A 3MGUA 1C8M1 1VALA 2TUNA 4AI0A 1QJEA 3HD8B 3LQCA 5DMYA 2DVBA 5EHDA 4PF1A 4AVVA 3LDBA 1LHWA 3NV4A 3UGHA 1ULFA 2QUOA 1Y4WA 4BQYA 3SKJE 4YW3A 1F35A 2B42B 4V2WA 4AVAA 3KHBA 2ZGMA 1F9KA 3N7LA 4U2AA 3USSA 1CAXA 4QPIA 2EAKA 1GICA 1W3XA 4CPBD 1CZVA 3I49A 2PLV1 2YB7A 1PNGA 3IAPA 1W6PB 3O1RA 5G05L 4C1XA 1NA1B 3NAPA 1H8TA 2Z4FA 4XUNA 1CAWB 4QWNA 3LZZA 3RZKA 4CU8A 4QQOA 4UAPA 3NNFA 2P3IA 2ERFA 2IFWA 2KA3A 4YM2A 4QXKA 3U11A 4Y26A 2W68A 4NO4A 3IMNA 4NR1A 5L7OC 3M7AA 4CP9B 2R062 2V72A 4OCTA 3A22A 5GZGA 3KT7A 5ERLA 1ASJ3 5LK7B 3K3OA 1HQWA 1SBFA 3N7KA 5FO8B 4YG6A 1WMFA 1RUH3 3AP4A 1Z7S1 1MS1A 4I02A 4P9YA 4XFBA 5F39A 4IESA 3RRDA 3WNXA 3WW4A 1RB8G 3B5LB 4LEJA 2AEZA 1UY0A 2MEV3 3C7HA 3AYEA 3U0ZA 1IG0A 3D8CA 2DU1A 2VZ3A 3SNMA 4CDWC 1UNBA 1ULCA 3N7JA 4ATFA 1N1SA 1X82A 2O1QA 5IVYA 1KEXA 3MLKA 1ZX5A 3DKQA 4PDWC 2C6SA 5DN2A 1POV3 4DS0A 4ZKTB 4OI0A 1RUI1 4YZ2A 4IGOA 4B4QA 4COVA 3J8F1 4Z2WA 1IPJA 4FPLA 1FPN3 4RS5B 4FAHA 5IVBA 3AYCA 3KV4A 2XUMA 4J1XA 1TNFA 4L2NA 1QGLA 1GOHA 1K5MB 1S0IA 2BBVA 5DAPA 2WNVB 4E8DA 4XQ4A 1JU3A 3ITQA 3G6JB 4QQLA 3THDA 1FPN2 1ULPA 1UY4A 4FP3A 4MYEA 4NPMA 3IPVA 4G4FA 3T30A 1HRI1 2F6BA 4H2AA 1GNHA 3AMNA 5B4NA 5E1RA 2Q8OA 5T55A 3SXWA 3HQXA 5JI7A 5D8AB 4YZ5A 4N7IA 3GDBA 2ZX4A 4CDUC 4LNVA 3OPZA 4UBHA 4SLIA 2JX9A 5CG9A 4DXTA 2WQ8A 3A7QA 4HSLA 3VDDA 2D40A 1AR93 1US3A 1RUD1 3AMPA 4NN0A 2WZR3 1AR72 3V0BB 2VVDA 3WUCA 1QOTA 2VNRA 4UFJA 5A3OA 1CZSA 4CCMA 5C4WC 3NQHA 2E9QA 3DPRB 3CF6E 3KF5A 2QQPA 1V0AA 1LOFC 3HBKA 3NJVA 4ISRA 1AR92 2GC1A 2JDPA 2WZR2 2JE8A 4JGYA 1NY72 2VZOA 2BPA2 1H4HA 1LGNA 3VDBA 4BE3A 3N9OA 2GALA 2DCJA 3ZXDA 4D69A 4LBMA 1LOBA 3PUIA 3ZIWA 4YGBA 2CWMA 4LK7A 4QKNA 4YNIA 1IOAA 3D0SA 3H50A 5LRRA 1U12A 4LUKA 1C8M3 2EAAA 4IQPA 1OLMA 3RPQA 4BIFA 1UIJA 5LCWL 4MG2A 5H9SA 3WNPA 3USUB 4Q2FA 2RS31 4XYXA 4NAMA 4PHZA 3A0NA 1O8PA 1Z0HA 1YXWA 3WSOA 1YFUA 1WBFA 2O0OA 1W8UA 2HEVF 3MDPA 4CCKA 1UU5A 4QPGA 2HWE1 1UAIA 3I3BA 4IGQA 3RWNA 4JKKA 5EZWA 3ZN4A 2Q1FA 3FBYA 5F3CA 4PQ9A 3LSEA 1HXS1 1UQXA 2WYFA 1W05A 1K12A 2JG9A 3AXEA 4FFIA 1S4CA 4CCLA 4OQ8A 4INDA 2QFEA 4JC1A 4Y4YA 1HN0A 1W6OB 1A8MA 5KXDA 5GZCA 5DXDA 2PLV2 2XDVA 4XDOA 1IPSA 2MPFA 1WW6A 3MIDA 1Y9MA 5EP9A 3OEBA 5EIYB 1VMHA 3R4SA 5FPZA 1O5LA 3LKJA 3OY8A 5FZBA 4LKFA 4LBOA 3N7MA 4UF0A 2DTYA 3B69A 1SLAA 3ZXJA 3IKWA 2UY8A 4D3WA 4UW3A 1Z7S3 3EB7A 3KMHA 1DQ2A 2DCTA 4FXGB 2K0GA 2ILMA 5AFBA 4CCNA 2R7EB 1JYIA 2WRAA 5CEHA 4AFBA 1S0BA 1WMEA 3POYA 1E57A 4QAWA 1MEC2 4AEJA 1Z7S2 2OQ7A 4BQ1A 4KGQA 2E31A 3WCRA 1WLTA 3ALQA 5FZLA 2YYOA 3S0MA 2AYHA 3POBA 4IEUA 2WNUB 4QB2A 1N1YA 1J3QA 4FVVA 4PBPA 3ZMNA 3MFCA 1ND2B 1RUI3 4FPHA 4MO3M 2E63A 3RSJA 1LECA 1NXD1 4XDQA 3J8F3 1NCRC 4XQWA 1Y7BA 1Y3TA 2JD9A 3FHIB 5ABJA 4XFAA 4EWAA 2WQ4A 1O8SA 2QVSB 2Y60A 2CHHA 1IGOA 1C28A 4JGZC 5A1FA 3RI9A 3J8F2 3IDBB 2WA3A 1OPMA 4LO8A 4YW2A 3RGBA 2VECA 4MGTA 4NIHA 2ZHLA 2WT0A 4JZRA 3ZFGB 1QJU1 4Q27A 4RQPB 3AP9A 3VBSA 2ES3A 2ID4A 2NM1A 1XNKA 5BNOC 4HKLA 4Y20B 5C8CA 1MS8A 2HWD2 5BXXA 3HEIA 3AVSA 1HRI2 1V6MA 3ZR6A 1P8JA 1UOFA 3CZJA 4ORFA 1XE7A 1YQ2A 3BPZA 2TEPA 1RUD3 4TXWA 5CKMA 3J26N 3H9AA 4WM8B 1MS3A 2ZEWA 5DUVA 1ST8A 3WDTA 4K8FA 4C90A 1UPSA 1DLCA 1GZTA 5CKNA 3LOBA 5FO7B 2J22A 1RMU1 2ATFA 2XJQA 4R9CA 4OHZA 5F2SA 4BB3A 4FTBA 1V6LA 1NG0A 1RITA 1US2A 2Q1ZB 5L9RA 4XFGA 2QQNA 1FOD2 2A6YA 2B7YA 4KGGA 1X50A 4LORA 4HN0A 1DGRN 1XSQA 2IVIB 3V56A 1F2NA 2JENA 3WD5A 4Q26A 4M4PA 1RHI2 1YYNA 2W5FA 5J48A 5JWPA 4RFT0 4RFRB 1UKRA 2WDBA 2FDFA 4CCEA 3M3OA 5FPBA 1DQ4A 4A4AA 1F4AA 1GU3A 3VLBB 1ND3B 1IS4A 1ZBE3 4RN5A 1UF2C 2BTVC 4WM7A 3J7MA 3VZMA 2VU9A 5AVPA 2RS33 5T5OA 3WNLA 3ZFEA 4AG4A 4D6SA 3BOPA 4DPNA 1KDKA 1UO9A 3CZUA 3POSA 5FMOS 1EUUA 4ATEA 1YC61 5FQ0A 2HWE3 2XGXA 2F4LA 4LBQB 4CYDA 1PO22 4CP0A 1H30A 5J7MA 1W9YA 2G1MA 3OB8A 4KU7A 5GLUA 2DTWA 3HJRA 4OUSA 4MGSA 4EWEA 1HXS3 1NAEA 3BODA 5KC6A 3LOIA 4QXCA 1ENXA 5ANQA 2W94A 2HWE2 1QDCA 3AP5A 2GU9A 2RR12 4Q5OA 4QX8A 2A6ZA 3WV6A 1H6YA 5C6CA 4FOWA 3JXSA 3O14A 5E89A 5GZFA 1WCKA 1XPWA 4WVWA 5BNNC 2OZ6A 5HCHA 2X5IC 2J1EA 2H6BA 3BOWA 3ILFA 4QX3A 5J36A 3SC7X 3ZMOA 1APNA 4IDZA 4LLFA 1IS6A 3U37A 5CBLA 4XBQA 2Y6FA 3IDAA 3PIGA 3OGRA 1LU1A 2HEWF 5LA1A 1DZQA 4XF9A 3EHKA 1QDOA 1TMF1 5FXWA 2YU2A 3T1MA 2Y38A 4GXLA 2VCBA 2G9ZA 3GZTB 5FLIA 3K75B 1URXA 3NVCA 1V6KA 2CV6A 3I54A 3NJZA 4YW7A 1NA1C 1XYOA 2VW2A 3QOPA 4W6WA 2VCMA 1WD4A 1X36A 3P5BA 3VBHB 2ZX3A 4BQWA 5IVFA 1CESA 3OUJA 5K0UB 1D0HA 1WCQA 1W6QB 5FPVA 4D6QA 2CGNA 2Y6KA 3I3EA 1AZDA 2PELA 4R52A 2BWAA 2OT7A 4GWIA 5CISA 2YXSA 4C1WA 3BB6A 1AHSA 3ZYBA 2VBBA 1OUSA 2ZCWA 2DFBA 4QPIC 5L7OA 4QX5A 1KGYA 3I2IA 4XAEA 2D6MA 4M3CB 2UWAA 1R1ZA 4AI9A 5IK4A 1PIV3 3OUIA 1BKZA 1AR81 1KFUL 3MIGA 3IMMA 3VBUB 4A7KA 4OUMA 4NPLA 1GKBA 5JAXA 4P02B 1R091 1ULGA 3SCHA 3POFA 1DQ1A 3CHXA 1MPXA 4O9GA 3ILRA 4LO5B 5FZOA 1BMV1 1G9AA 3ON7A 2OZJA 1EAH2 3VBOB 4IE4A 1QQP1 2VUDA 3ZIXA 2PN5A 5FP7A 3VKNA 5IVJA 4DRRA 4CDWA 1OURA 1QJU3 5D2AA 4Z2AA 4IEZA 3IM0A 3A23A 3HMYA 2R32A 2GC3A 3DYOA 4X6RB 3OSDA 5FK7A 1UZ0A 2GMPA 3JU9A 3T0AA 1DYPA 2ZA9A 4M4RA 3THTA 1WKYA 1UYXA 1HRV3 4QDRA 4UFHA 1OA3A 3PIJA 5F3GA 5AVAA 3UGFA 4B8EA 2RS51 3FBMA 2K46A 4PDWA 1WWYA 1HN1A 1IS3A 4AEKA 4O9EA 3W59A 4I3GA 3VBFB 2ZEXA 4WV8A 5A7WB 4RS5C 2FDIA 1C1LA 2A3WA 1GQPA 2FCTA 1AYN1 3WG3A 3D3AA 4COWA 2UWCA 1HB1A 1K5MC 2UWBA 2YG0A 3GBFA 3WF2A 2WNVC 5LASA 3HN3A 1RMU3 4HZFA 1IHMA 1IQAA 1EPWA 2VOXA 3UJOA 4FO9A 4PT6A 3RJRA 1LAJA 4Q1RA 2VVFA 1VRH3 4GH4B 3C7GA 4FPFA 5JSOA 5LZ6A 1KS4A 4HETA 5DAWA 2BOJA 2P6CA 1W0PA 3N9MA 1H1MA 5D8AC 5ACA1 4TLFA 2ZEZA 1D4M1 4E9KA 3WQ0A 3V65A 4GB32 1W6MA 4WVMA 4CDUA 1SFPA 1NYWA 5LK5A 1XU1A 3POEA 3WG2A 4E2SA 1S0EA 3O0WA 4HXCA 2HWC1 1POV0 3Q8EA 2IXKA 3HIFA 1OVSA 1YLLA 2RM21 4XEZA 5C4WA 1MS0A 3K77A 3FZ3A 4BIOA 5APAA 2ZGUA 1LOFA 2BDRA 4OMCA 3HNYM 3VKLA 2BW8A 4AEMA 4Q4Y2 1OQEA 4GWMA 3BTZA 5FJKA 5JZGB 5C3SA 3SITA 3E97A 1FNZA 1AXZA 4LOTA 2ET7A 4AQTA 2O8OA 5IJRA 1RUE1 1REEA 2YPDA 4W50A 1NE4A 5FZ7A 5FZGA 5A32B 5EPAA 1BVVA 1NZIA 1WLDA 3ACLA 4M3CE 4PIXA 1LULA 1GQHA 1SG3A 5K8SA 4LT5A 3WEZA 2XPJA 3J7HA 2VTXA 3T09A 3IDCB 4NHLA 4Y22B 3B00A 5IVVA 2DWRA 5KWRA 3WHUA 2DUQA 2WO3A 1TMF3 2WIIB 5DAQA 3UKTA 1ZRRA 2BRTA 2XL9A 1ZA4A 3KV9A 3AFGA 2C5DA 3T2QA 3T08A 1SZBA 4IEYA 5JOYA 1OOPB 5G04L 3I3QA 4A3ZA 2QCSB 4XMIA 5LBFA 3SQOA 2BVVA 1LNSA 1N1TA 3ZN6B 3PDQA 4LA2A 1E5RA 2VO5A 3K3NA 4Q8LA 1YQ6A 3PNAA 2VAUA 2BEOA 1X9TA 1GNYA 1RL3A 2R30A 3AZZA 5CNAA 1XYNA 4DFSA 1XXNA 4MXWB 4XJUA 4IV3B 2FDHA 3LIHA 3VGIA 3SCFA 3TAYA 3ZYGA 4GJYA 4X6QB 3N4MA 3ETQA 5HV4A 1AR83 5JIAA 1KQRA 2B9VA 3UL2A 1R093 4P08A 3EO6A 3OBTA 1QEXA 1ZZCA 1BQPA 1QQP3 2G19A 4LKDA 1HQNA 2LTNA 3H1WA 3JZVA 4JRAA 4AWDA 4XHXA 3PTRB 4QQHA 1R092 1OQDA 5FJHA 3AZVA 2GMEA 1CAVB 4AEDB 1W0NA 5E6HA 5JXHA 4OI1A 1G9FA 3VV1A 3O0XA 4XQDA 1QQP2 3IWZA 2WNUC 3K4DA 2RS53 1PM4A 1ND2C 5DUWA 1Y43B 1XRUA 3I7DA 2VTXJ 4P9LA 4BMBA 4E27A 2XVKA 5LA0A 3J7NA 2VZTA 3L9JT 3PURA 1NCRA 1DIWA 1GP5A 2P5BA 2PYTA 1AYN3 1MVEA 4HLTA 1ZZBA 1AX2A 4OZXA 3ZDSA 1BZWA 4XZPA 4JGZA 2QQOA 1UZWA 2JICA 2W92A 4KH9A 4ZS2A 3FLRA 3I2GA 5LATA 3ST7A 2R061 1SBDA 4BH9A 4BU2A 4N43B 3WNOA 3WP6A 1IG3A 5DAVA 2PHWA 2V4AA 2VY0A 5T52A 4HMZA 2GH2A 3CNAA 1O6UA 1WGPA 1Q8OA 2P37A 4RQPC 4AL9A 4J25A 4BCUA 5KXEA 4NIDA 1LEMA 5ACA3 2V09A 3R4DB 2GZWA 1AXKA 4GMP1 3MICA 2BQPA 3AB0A 4P9GA 5FKBA 5JOXA 4XFFA 4YFWA 4C8DA 3CIHA 5FXZA 5LY2A 3EQEA 4CCJA 1RJ8A 3GF6A 2C4XA 4RL7A 4WM8C 1NUKA 3H3ZA 1D4M2 2HWC3 2XOMA 3OYWB 4Q4W1 2DF7A 3P3NA 3WW3A 3MIFA 2AR6A 4YWAA 2VUCA 4R8HA 2ZX0A 1PK6B 2DCKA 1AR61 3HNBM 4E8CA 2RM22 3GALA 1J84A 2VXJA 4GWJA 4JTNA 4ARYA 4Y5TA 2Z2SB 3P6BA 4QX1A 1RUE3 1QMJA 4DMIA 1DHKB 1O4TA 1ZBA1 5A6ZA 3OTFA 1QXJA 2P4EA 1GP6A 1W2OA 1ND3C 3O1OA 3AFKA 2R071 1QU0A 2V73A 2VZPA 3KZ4C 4OLLA 5F2WA 3CBNA 5CA6A 1G86A 2OXBA 2XJSA 4MOAA 1OLRA 2VMHA 3CMGA 3U07A 4B1LA 2ARXA 1UOJA 1JZ5A 2VMIA 3KV5A 1TNRA 2ZGOA 2X09A 2YY1A 4PI2A 2QQKA 2PAEA 3FUOA 2W47A 3LEIA 1XSRA 2ZHKA 4EZ4A 2DVDA 1AR71 1LHVA 3DN7A 2EICA 2VOWA 2Q8DA 3I97A 3OOXA 2RS13 2X05A 4AR2A 2ZTNA 3ZDVA 1YRZA 3FLPA 3IT8A 3A4UA 3T3YA 1RVF2 1DLLA 4DEVA 5A80A 3Q8CA 3NNMA 2Q1MA 1NY71 2Q8CA 5AC92 3FFZA 4DZGA 5A3LA 1BJQA 2P2KA 5BNNA 3AYAA 1WCUA 4YARA 4EJRA 2X5IA 3CJIB 3B9CA 1VBC2 4HN1A 4A44A 3LIGA 1MR5A 4QX7A 5FZMA 4KBZA 5K7PA 3RYPA 4HK8A 2PHRA 4D7YA 4M00A 3W5MA 4GD4A 2K2SA 4FCAA 1SLBA 1EYBA 1UXZA 2JG8B 2WBKA 2ZGQA 4BQXA 3SLIA 1DG6A 2PFWA 2W91A 1QJY2 4RHV2 1AUYA 1W6PA 4UOJA 3UNPA 1WD3A 3BN6A 3LPFA 1NA1A 3OBZA 2H0VA 3DL3A 4LMFA 3GHMA 5LB6A 1CAWA 1MQTC 3WP4A 2RDQA 3N9LA 1NCQC 4OMDA 4QU2A 1KJRA 1QKQA 2VZUA 4UW6A 1SLIA 4E4ZA 1G9BA 3M1HA 4JCKA 2DUOA 3C2UA 1ZZ9A 2D3SA 4QQPA 5GLTA 3VKFC 4CP9A 5C3PA 3N3HA 1UU6A 2Y6GA 2Y8KA 4QKDA 5FY0A 3PVEA 1HJGA 4AHWA 1W8NA 5BPXA 4DXRA 3KCYA 1UMHA 5FREA 5SV8A 3EYPA 4LBNA 3O12A 2V4VA 3SH5A 2D3PA 3BCWA 1CIWA 1QNYA 2XKPA 4Z82A 5A70A 2R063 1WCSA 3THPA 2Z69A 1FX5A 1VBE1 4IE7A 1PGSA 4C0BA 1CAUA 2A3YA 3RMYA 1RUG1 1NXMA 2FHRA 3HN1A 1CGPA 1TVGA 3HBZA 1W03A 3GGLA 4LIUA 1X33A 4NHKA 2C9AA 2OA2A 2IZWA 2PAKA 2VE1A 4GMP3 1TME1 5DZEA 2ZGKA 2B5HA 3DYMA 1MEC1 5IUQA 1FT9A 1YFWA 4ZU5A 4JTOA 2Y26A 2XWJB 3D6EA 3ZYIB 4RS5A 1U5YA 5C9AB 3DGTA 3DECA 4Z1VA 5C5UA 5CG8A 5FDBA 1V6IA 4ZU4A 4AI2A 4LITA 4B7KA 1K5MA 1SQ4A 4LLOA 4PIZA 4Y4RA 3UK9A 2WNVA 5CVRA 4AW7A 1HKDA 3RZLA 2YHJA 1ZVFA 4Q4W2 1AR63 4GH4C 3GM8A 4TYSA 4XF1A 3RVHA 2RDRA 5LW9A 1CAXB 2J1TA 2I45A 2D44A 3VHPA 1Q8PA 3NAPB 1ZBA3 3ZFFB 3M3QA 5DUXA 5CFDB 5D8AA 1AR62 2PA7A 3H42B 4N90A 4KQ7A 4RYDA 4NIIA 1DGRA 4URTA 4Y3OA 5M0TA 1DYKA 4P00B 3O1VA 4FTEA 3Q8AA 2QE3A 1MACA 2ZBJA 2J1VA 3FWEA 3H3LA 4FI9A 1ZBA2 4NHXA 3V0BA 2J42A 2XUEA 4KU8A 1S2EA 1IS5A 3AM2A 4QPYA 1POQA 2HWD1 2R072 1OUXA 4GAZA 1I3HA 3RS6A 4DQAA 5FO9B 3OBAA 3WF1A 3OGGA 3VD4A 1AR73 4JX0A 3OF1A 5JZGC 4OHWA 4K1YA 5F5QA 2X10A 1F5JA 4N53B 4XXAA 1GOGA 5FBZA 4K40A 3DUIA 3TEZA 2D43A 2YGLA 3LF7A 1AJOA 5ANNA 2E26A 1W8WA 3HWJA 2J1UA 2VQ0A 2ZABA 2N7GA 4FPOB 5EJ3A 1H2KA 2HWB2 4XJ9A 3U4SA 1U5ZA 3RFRA 1FOD1 2VPVA 1MZ5A 1RXFA 1FV3A 3RZGA 1AVBA 3WP3A 4DO0A 3W20A 4BYYA 4DRVA 1RHI1 4XUTA 3USUA 4CP1A 1V6NA 2IFRA 1NX9A 2WINB 3PMSA 4UW4A 2ZPXA 3ASIA 5JUVA 3TEWA 4NIAA 5A33B 1H1IA 4MGYE 4NROA 2C1FA 3AXDA 4L8QA 5T5PA 1SCRA 3E6CC 2QJVA 3MF6A 3WNKA 1S0FA 1OOPC 2NPIA 1WCDJ 2NMOA 3GJAA 3T1LA 4AFDA 4CE8A 1I5PA 1RUC1 1CX4A 2Q30A 4DOUA 4KWJA 3APBA 1HX6A 4TN7A 2BGOA 4CP2A 2B4KA 1M06G 1N47A 5A3WA 5CFCB 3N9NA 4BJ0A 3AKRA 4K7JA 4MADA 5FP3A 1UZYA 2DUPA 1JODA 1UX7A 1GZWB 1W6OA 3RZZA 4IUGA 1W8OA 5F32A 2D6OX 2P6HA 3S7EA 4WBBA 1W3VA 4QX0A 1PO21 4AGRA 3ZYHA 4IV3C 4XTMA 1DBNA 1DDLA 2ZGSA 1H2LA 1VAMA 1CPNA 4E2GA 2PHLA 2JDYA 2E7AA 2XL7A 5FZDA 5A3TA 3BU7A 5FPUA 3NSTA 3AKQA 3RZMA 2RR11 1Z78A 2PLV3 1QH7A 4W6YA 1JOJA 1PHMA 1R1A1 3CQOA 4O7XA 5GLZA 4A7ZA 4JAAA 4L11A 1ODMA 2JD4A 3U10A 1O3QA 4GKXA 3POGA 3IIAA 4LHNA 4XF4A 4UWDA 3ZOIA 2QQLA 1O59A 4XF3A 3MPBA 1CONA 2PXJA 1F4HA 3W9AA 1SHWB 3OGVA 1G9CA 2WFF1 1ODNA 4GULA 5FY5A 4AEDC 1H9WA 3DEMA 1AX0A 3M3CA 2VOKA 3NV3A 3TNQA 3SHRA 3JBG2 1GBGA 4GIQA 5JMOA 2QQVA 2H0BA 2WN3A 3POJA 1VBE2 3HR9A 1ZRFA 2WNUA 4META 5BV6A 1RUG2 1SFYA 4UFKA 4YVWB 1MEC3 1ND2A 4HKOA 3WLUA 4DUXA 4UYBA 4QKBA 2ARCA 2H6CA 4P9WA 1J58A 1TME2 1OI6A 3KV6A 3VD5A 3NW4A 2XVLA 3HAGA 4OI2A 5K9YA 1CJDA 4QDSA 1ZRDA 4QQ2A 1Q56A 2C26A 1AYM2 1IKPA 1NLRA 4KI5M 4Q4V2 2WT2A 3V0AA 2WN2A 1DGLA 1Q5OA 1H2MA 2GNBA 2QQJA 4D7TA 1F15A 4AQ6A 1H2NA 4J1WA 3U14A 1JYXA 1UYYA 4N43C 2VBDA 2OYZA 1F31A 1SPPA 3NV1A 2GC2A 5FMCA 3ZFGA 2GC0A 1LENA 4OULA 2Q5TA 4DY5A 4RQPA 5LBCA 1VBD2 1VB4A 2BNOA 3KQRA 4AVBA 4WVZA 4BA6A 3F2ZA 5K4LA 4Y20A 1LRHA 1V70A 3BALA 3OG2A 4IGPA 1EAH1 1H0BA 2YV8A 2WLQA 4HPKB 2WO7A 2PTMA 4HBNA 5GALA 2C9KA 4HG6B 3NJXA 2EA7A 3MW2A 4C0HA 5H9RA 4WM8A 2XLGA 3H7JA 3NL1A 2IUWA 2D93A 4QB1A 5BNQA 2HWD3 3B9IA 4OHYA 3ZYJB 1PVC2 1DU3D 1HRI3 4MGIE 2Q8EA 2R16A 1JYVA 4QM9A 5KHKA 4D8MA 1PK6C 5F3EA 4K21A 4YW5A 3VHRA 3LD8A 3W5NA 3M4FA 1HLCA 3B94A 4Y1XA 1OPOA 1LTEA 4QD2A 3QD6A 4HANA 3I8TA 2MNGA 4D7SA 3AZXA 3JD72 1LB2A 4PCRA 4K8RB 5DQ0A 1SMVA 1JYWA 2CDPA 1FOD3 3SISA 2QNKA 3B01A 1ND3A 1QJX1 1W90A 4LR4A 4Y1VA 2VQAA 2XKOA 3B02A 4FFGA 1RHI3 3GXUA 4UI9L 2ZZQA 4LOSA 3Q9OA 3RWKX 2HYKA 2D3RA 4I0WB 4UBGA 1XC6A 2IXCA 4GWNA 4GB31 2WC2A 1PZ9A 5ABJB 2G4IA 4EWDA 1U5XA 4YFZA 5A7SA 2HBUA 2RMU2 3NRUA 3UETA 5CZKA 3UYJA 2W2IA 4CEYB 3C3VA 4XXPA 5E88A 5FYSA 4LBQA 2GP5A 4P9JA 1MVQA 2OPWA 4AK3A 1SDWA 5IAXA 3GZAA 3OD4A 2EVXA 1AL0G 4I0BA 4YG3A 5F6KA 4H14A 1Q8VA 4LE3A 1RUC2 4RR3B 4AVCA 2XJVA 1LOEA 4Q4X2 2ZJCA 4Q4Y1 1N3QA 2W08A 4XUQA 1PO23 4RSUA 3I59B 1PGW1 5EXOA 3OGSA 3CJIC 3WX5A 5A3PA 5IT6A 4A2UA 1TZOA 3WNMA 3ZO0B 3POWA 1X8MA 2RR13 1K3IA 1LEDA 1R1A3 1VBB2 5A1AA 2SLIA 2ZGTA 3L2YA 3WQBA 4CU9A 2DCYA 1B35C 3W58A 2JG8C 5C70A 1IQDC 2F17A 2VZ1A 4PLOA 2RVAA 3VZOA 4K20A 5JSRA 2JXAA 1OVPA 3FL7A 5I0UA 2LM3A 3GNEA 4BZ4A 4IEOA 3AVRA 1C8NA 1R1A2 1ULOA 3LDRA 3KSCA 3KLSA 4BLIA 1E5HA 4LKEA 1OKOA 1S55A 2D7FA 4I09A 3PVBB 1WW4A 4Y1ZA 1JOBA 1QXRA 2GP3A 1IZ3A 1MQTA 2JB4A 1QF3A 4ITCA 4YSFA 1BEV2 1NCQA 4IE6A 2EXKA 2JB8A 2WFF2 2PHFA 2BNMA 3UGGA 2A6VA 4Y33A 3PVOA 1JHNA 1SLLA 5FMBA 5KXCA 3OUHA 4HFSA 5HCBA 1RIRA 4FSJA 4Q0VA 3RYRA 1YI7A 3AKTA 4M3CA 3RMXA 3ACHA 4COUA 1KFXL 1F5FA 2BJSA 1XNCA 3IIIA 1EY2A 2XVGA 2R49A 2VG9A 2EXIA 2JWPA 3UKVA 3VBOA 2YFUA 2E6VA 4HKWA 5JMCA 5I8YA 2RHPA 4CZSA 4MGKE 1JN2P 1W9FA 2VUAA 4CDXB 3R05A 4A6OA 2E7QA 1YQ8A 4R9DA 5FZ0A 1EAH3 3D0JA 3CDZB 4XCAA 1E5IA 2YROA 3I2KA 2GDFA 3NJYA 4F8AA 1SLTA 2EXHA 3C7EA 4XE9A 5A7WA 4ZXKA 2NN8A 2XH6A 4CXXA 5C9AC 1C1FA 5FBJA 5IK5A 5FYTA 3AK0A 3J7LA 4ZS3A 5KR7A 2Y6LA 5EYYA 1UKGA 5EJ1B 4A6SA 3POIA 5A6XA 1BXHA 1AL21 4S2FA 3SEPA 1LOCA 1XYPA 5KXBA 3D4KA 4CUBA 2VQUA 1NQJA 5C8WA 4GH4A 1LHNA 2CGOA 4OZOA 3RQ0A 1FMD1 2OUJA 4CEWB 5I91A 2WZPP 2LROA 5F37A 3ZFFC 5FZHA 1H6XA 2D5FA 2QQIA 5CFDC 4S2HA 1JZ3A 4IV1B 3WDUA 2WJSA 1UZZA 3HT2A 5EJZB 1HIXA 2VZRA 2X53S 4BWOA 5C3OA 2CNAA 1TG7A 1PMHX 3R0RA 1WZXA 2Y6HA 3WT3A 2CWSA 2YBKA 3CL1A 4GMP0 5J98B 1U5IA 3WUDA 1ACCA 4NE9A 4BK5A 1VP6A 1YHFA 2VZQA 4DB5A 4Y1UA 5F8PA 4AYUA 3ILNA 2WNOA 4FPKA 2VC9A 4GB33 3VKMA 4XFHA 5IWFA 5DABA 1QJX2 2I07B 3MPPG 1WA4A 3PL0A 4QKFA 5HBAA 2XBO1 5FY1A 2FDJA 4N53C 5JZGA 5FZOB 4XC9A 4G3YC 2UURA 2GAUA 3ZXEA 1VPHA 4ZONA 5BY5A 4CDWB 1PO12 1SCSA 4LULA 1OA2A 1VAVA 2YC0A 1REDA 1DYOA 5A32A 4Q4Y3 4PLMA 2QDRA 3NNLA 3DPRC 3WXPA 4Z8BA 1NLQA 2JEMA 4L0PA 3NNGA 4ASKA 5FYZA 2I2SA 2QTWB 1EV12 1YEWA 1LKNA 1OSGA 4Y22A 1UOGA 2A1XA 5IFTA 5CKQA 3X29B 1PGW2 2NQYA 3RDIA 2CYFA 1ONAA 2FBEA 2VCCA 2VGDA 3K4AA 4Z07A 3VZJA 3OJBA 4B4RA 2DDUA 1OOPA 3FMGA 4MUVA 3UESA 3AC0A 3B93A 1KS5A 2XLFA 4LTAA 4I30A 2Q0AA 5CFCC 2HJIA 4FP2A 4BOWA 2TNFA 1W9SA 1CPMA 1I5ZA 2I74A 1JMUB 3ZN6A 2QZ2A 3IB3A 5KHIA 1HW5A 3ZSJA 1TQ5A 4LBKA 2ZHMA 2WS92 4I2OA 2XONA 3W21A 4F83A 5IYYA 1C4RA 2WT1A 3AMHA 2BZDA 1ZA7A 5EFUA 4EE2A 4MXWA 3VBRB 4IV3A 2D6NA 1K5JA 5EWSA 2W1WA 5FZFA 4AGVA 1VJ2A 2XG3A 1OBNA 1RVF1 2Z79A 3AKSA 4PJYA 4DINB 2DURA 4XJ8A 4QHZA 1Q3EA 3PMEA 5AC91 2BU9A 3T4HB 3MFAA 3TNPB 2AC1A 4P14A 4XILA 3H7YA 1YO8A 1PNFA 2D97A 1VBC1 4IE5A 1QH6A 3SCGA 1FYUA 2WWUA 4F3JA 2QKDA 3QACA 4LO7A 4AQ2A 4YRDA 4JHZA 4IE0A 2G9FA 1OF3A 1CN1A 3G7DA 4AEDA 1CAVA 4YG0A 2VTFA 1K45A 1BVP1 1HJFA 2HKXA 1G8WA 3FHAA 3P3PA 4PIYA 1QJY1 3ETPA 4RHV1 4JKLA 4CTEA 1GWKA 3M70A 4ZY9A 4ET7A 3O1PA 3HNMA 1D7PM 4B4PA 3S57A 4E4DX 4PBOA 3SH4A 1LGBA 1RUF2 3CLPA 3N9QA 3WDWA 1WLCA 4JHTA 1VE0A 2R041 1G7YA 2RE9A 4IL7A 1ZRIA 3ACFA 5FPLA 4TZDA 3IZOA 1AL23 4A7YA 1VAKA 3TWIA 1V00A 2E51A 5FP8A 2DBNA 1UIKA 1MS4A 5GLWA 5FY4A 2EIDA 3MV01 1AF9A 1YCIA 4N43A 3FJSA 1TEIA 3DXTA 4R4XA 5JI9A 1GV9A 4P5YA 1DQ5A 1Q43A 1AL22 1MZ6A 1D2SA 4ZXEA 5LEKA 2JKXA 4FOQA 4YYOA 1AJKA 3ME2A 1VBA2 1GR3A 2VVEA 3K48A 1J1LA 2WZ8A 1FMD2 5I0DA 1K42A 4AF9A 2ZACA 4ARXA 4GJZA 3VDAA 1L7RA 1YFXA 1LR5A 1SFNA 2BUKA 3KVBA 4BHPA 2XB6C 1O3TA 2VL4A 3OYWA 2MHFA 2RDNA 4CU7A 2OPKA 1ULDA 3ES4A 3ZFGC 4XTPA 1N1VA 1R082 2EALA 2GNDA 3KGZA 3VD3A 3O1SA 2D6PA 3CO2A 4XHBA 4UFIA 1VLNA 2B9UA 2XBO3 1D4M3 5I0RA 1PK6A 2RG4A 2WAAA 1VB2A 3AX4A 3ZSEA 4Y24A 5J1XA 1QWRA 4J6GA 1OH4A 4CRQA 5JPNB 1W6NB 5FV3A 4Z92B 2VMCA 5EQUA 2HBTA 2JE9A 1GUIA 2XBO2 2IXLA 5HPOA 3KVAA 2SBAA 3PUHA 4BQ4A 2YGMA 1FI2A 2BNNA 2AZ5A 2Y33A 5TSWA 2RM23 3ACGA 3UV9A 1PMIA 1YNAA 4ES8A 5JLVA 3WOGA 2WYSA 3AP7A 3BPSA 3UJQA 1RTVA 3SKVA 1SDDB 3VD7A 3VUOA 2YFZA 3AJYA 1XNTA 3LFIA 3UKNA 3H0OA 3ZX7A 4ZZ8A 3NNJA 4MVTA 4B1MA 1ASJ1 4F7ZA 2CGPA 4GZ9A 2A6XA 4CEYC 3MHZA 4SBVA 2BGCA 5J09A 4Q0SA 3QBQA 1JW6A 2ETEA 4YM1A 3E5QA 5DDJ2 3VHOA 1JYNA 2R6QA 4PLNA 1GWMA 5CIRA 4OI4A 2AACA 4B29A 3WNNA 2VUJA 4KMQA 4FQZA 5JR7B 3IBMA 5FPAA 2YBPA 3ROUA 4NWVA 4AOCA 4RR3C 2PQQA 2XJTA 1JHJA 3WW2A 3E6BA 4BPZA 1KRIA 4YM0A 3QH6A 2WSVA 3K46A 4AQSA 5HV0A 4D0QA 2W46A 4LHSA 4YGCA 5EYXA 5BNOB 3CJIA 4BM8A 1POV1 2IWGB 3T2TA 1HDKA 4Q0UA 1CQ9A 1RVF3 4FPYA 4JQTA 5FRAA 4EN8B 1NKGA 1Y9GA 2ET1A 3HQUA 3ZSLA 5AC93 5FUIA 1YIPA 3BU0A 4XCBA 2CSGA 1H1AA 3I2DA 2HWB1 1GFF2 4YVSB 2NYYA 1B35A 3KF3A 2ADDA 2JG8A 5FCCA 5GM0A 2OQ6A 1VBC3 4HT1T 2QQWA 3B3QE 5GKAC 1HB3A 3TOJA 4ASMB 4QDQA 5F9TA 5FYIA 4KG8A 2LUWA 4K1ZA 4QGLA 3T4VA 2VMGA 2DV9A 2XXZA 3PLQA 4DY3A 5A7OA 5A1LA 5A6YA 1JTZX 3AYDA 2A75A 2ZAHA 3CJXA 3I3MA 3QCWA 1OKQA 3I4IA 3NKTA 5C3RA 3VZKA 1QJY3 4RHV3 3F95A 1QJZA 2PMWB 5C71A 4CPBA 3OCPA 3TN92 1JS9A 4ZPIA 3LE0A 1WBLA 1UMZA 2QZ3A 1QOSA 5FZAA 4NMIA 2R043 3JB8A 2BOIA 4UFLA 2PHTA 3MIHA 4NHYA 3VBHC 2VCAA 3JQWA 2ZGNA 5K0UC 3KD4A 1GWLA 4MHRA 3RZJA 1G9DA 3KWVA 5J96B 2KXLA 1C5IA 3PUSA 1A34A 3H1YA 1FNYA 3NO8A 2R042 5B4XA 2QQUA 2P3JA 3C8XA 3WHTA 1DF0A 2WAOA 1LJ7A 5FYBA 4CDXC 4R9BA 3S6PA 3H1MA 4LHKA 5IATA 4MH0E 1DZTA 1FXZA 1W28A 2IXIA 4XAAA 2WZEA 4EQVA 5L36A 2Y6JA 3VBUC 1W0OA 1JZ7A 4N9IA 5GZDA 1BBT2 1X7NA 4Q0QA 2ARAA 4YW6A 3FFQA 4FXKB 1NLSA 5BNPB 2X5IB 3WR0A 4HVOA 1ENSA 3VBOC 3JBG1 5JSPA 4A45A 5C9AA 1R64A 2XHKA 4QU1A 2PHXA 2WO2A 5H9PA 3FUQA 4R4ZA 1CD3G 4CDQB 4HVQA 2YUEA 3ZXFA 4QXHA 5FK8A 5IK8A 2VNOA 1NOVA 2AENA 4L92A 3U1XA 3TB0A 3PU8A 3ZXGA 4CEWC 4TWTA 4MSVA 2O14A 1AYM1 1L3JA 3QLQA 4IERA 2EIEA 4N9HA 3KT1A 4Q4V1 2V5YA 4XIOA 3VBFC 4A42A 4IV1C 2KD7A 3ZFFA 2ZGPA 4AVSA 4BQ2A 2B39A 4D94A 5CFDA 4DUVA 4H7MA 4Q4W3 3HT1A 2EF6A 4W6XA 1LODA 4MZUA 1BYHA 5KHGA 4YGEA 4QGNA 1A3KA 5C3QA 5KC5A 4CUAA 2VBPA 1BK1A 1VBD1 4YGDA 5A7PA 3ZN5A 1ZM1A 2GMMA 2CAVA 5HI0A 3E5UA 2V5DA 1ZRCA 4FQ4A 4QPIB 1PVXA 4XBLA 3UT0A 5C5TA 4LPLA 4XETA 2IVJA 3U75A 1GZ9A 4ES9A 1W9TA 5FMDA 3WF0A 1H8TB 2J7MA 3IDEA 3BTXA 3LAGA 1BCXA 4HOOA 1AXYA 3THCA 4N53A 1ASJ2 4OHXA 4FFHA 4OQ9A 1W99A 2R073 1PVC1 2E53A 1OHFA 1ALYA 1CAUB 1RUH2 1JUIA 1PX3A 4JVAA 4KG0A 5T3NA 4IEWA 1S0CA 1E5SA 2FDGA 4FPCA 2XR4A 1DQ6A 2WO1A 1AX1A 2MEV2 1OC1A 2NMNA 2RJLA 3DPRA 4MXVA 2DYCA 3PHMA 3KGLA 1OXCA 3JCIA 1D0GA 2VULA 4URAA 4XZUG 2HLEA 5FYUA 4NRPA 1W8TA 4O65A 1YI9A 4COYA 4Q8KA 2VNVA 3JD71 1U0AA 3HQRA 3MI8A 2W9XA 4DXSA 3LEGA 1KDMA 2D6LX 5A33A 2HWB3 3PJQA 2ZX1A 4XJWA 2P3YA 4X8PA 3AJZA 1JZ4A 3FN9A 2BWCA 3MW3A 2ZGRA 4BDVB 4FPGA 4LBJA 2EXJA 4LA3A 5FY7A 2EIGA 4LJHA 4WZCA 3O0VA 4UW5A 5CFCA 1UL9A 1DGWA 5FTTC 4EN7B 1LHOA 4P9IA 2RMU1 1S2BA 1I9RA 1GZWA 3WP5A 3KHCA 4KWLA 4BXSV 3VL8A 4KNCA 4CCCA 2JECA 2C24A 3VBRC 3RYKA 3PUQA 3U78A 1S0JA 3MEPA 2AH2A 2ZMKA 2OW4A 4LK6A 4V1PA 2DCZA 3V64A 1J1TA 3ZPOA 3E5XA 3GBGA 4X8NA 4P5HA 3T2PA 4UFMA 3MUY1 4Q4X1 4CUGA 3P1IA 2YPJA 3GZEA 3WG1A 4IEXA 4HSJA 2P34A 1LOGA 3IPVB 3ZYPA 3LGRA 4OFGA 3TEXA 4QT6A 2XJUA 3MW4A 2CU5A 1VBB1 2RJKA 5J3UA 2J1RA 3I2OA 1ZZ8A 5A3MA 2JDAA 4LBLA 4LHLA 4XW3A 3VDDB 3WZ1A 1PMJX 1UW8A 3PVNA 1JYCA 3WQ7A 5SV5A 2LALA 3C7OA 1O4YA 2YC4A 4AFCA 1YFYA 4AI1A 4E2QA 3ZSMA 3VN4A 4YVWA 2ADEA 4C91A 1UYZA 1GSLA 2ZX2A 4ONUA 1N3PA 4OHVA 2CL2A 3HPNA 3INAA 4AHYA 5JCTA 4KBBA 3S30A 3JBG3 4W8JA 1ZBE1 1SACA 1CR7A 1VBE3 1L7LA 4JGYB 1BEV1 3GJBA 4NWWA 1RUG3 3K2OA 4FOYA 3GHNA 5DG2A 3D82A 2ZGLA 3I2FA 1GOFA 2VH9A 1C8M2 1OT5A 1MZFA 1TME3 4XFIA 5A3UA 4BQ3A 2FCVA 5A7NA 3ZKYA 3U4XA 3ATGA 5L9BA 4Q4V3 1AYM3 4QMAA 3A21A 3Q8BA 4AHXA 3AL6A 3BGAA 4FOVA 1ULEA 4Y1YA 5FP9A 4L97A 2JE7A 1V9U1 3WY6A 2WNEA 2W39A 3ELNA 4DEQA 4E4HA 4HPKA 4YW1A 4PQQA 5E8AA 3WDVA 5IVCA 1UY2A 3KQ4B 2Y0IA 2ZKNA 1S1AA 3FE5A 1HB2A 3WG4A 1VBD3 5I8SA 4CUCA 3AMMA 4AAPA 1J3PA 1YQ5A 1OFSA 2AGSA 2VXRA 3FX3A 4QPGB 4XURA 3FC0A 3O7OA 3I3DA 5ISLA 1BHGA 2CDOA 2LW8A 1J83A 3TRSB 4A3XA 4XUOA 2Y34A 5FP4A 5LA9A 1DFQA 2EIBA 1UY1A 2JG9B 2Y0OA 4YM3A 5FY8A 4TSVA
chains in the Genus database with same CATH topology
4MV2A 2JKBA 1PVC3 2D5HA 5T5JA 1ENRA 1UD1A 3KM5A 5FLHA 4LO4B 4LO6B 2A3XA 3JUUA 2NP0A 4Q29A 3N36A 3DF0A 3OY8B 2W0XA 2IXHA 1PGL1 5FPXA 1CJPA 2DFCA 1O7FA 2R0HA 2ZAAA 1UCXA 3JD73 5E16A 3URFA 1W39A 2XJRA 3JB4C 5L19A 4FTSA 2ZMNA 5JIUA 1JXNA 1X8EA 4IEQA 4XJZA 3LSDA 4XJAA 1PIV1 3V0AB 5C33A 1RUI2 4B3NA 4CEYA 3B7MA 4WVVA 5T50A 4AE2A 2F4PA 1ZZ7A 3PJYA 2X8KA 4IXLA 1RC6A 4MLOA 2RMU3 1RJ7A 1OA4A 4K6BA 4RR3A 3TYJA 5KHHA 3I59A 1NZCA 2KM2A 1HRV1 2VW1A 3KCXA 4XF0A 1C3HA 5F1RA 1PZ8A 3GZUC 4I01A 1PO11 1RUC3 1Y9QA 2YZ4A 2ZKLA 4Q4X3 1XNDA 4YVSC 2XWBB 5JOZA 2A71A 1O91A 1EV11 1RUD2 5CB7A 1DQ0A 3VBSB 1LCLA 1VBB3 2VW0A 3KB5A 5B2GB 4GKYA 5C8CB 4YLZA 1VRH1 1Q8QA 4AFAA 3J4UH 1S0GA 4W65A 1N3OA 1WW5A 5I93A 4L99A 1HQLA 1YUDA 3M3IA 4MX3A 1UN1A 2O8QA 5CADA 3KT4A 3IN9A 1FAYA 3MF9A 4NOTA 2WS91 1BEV3 5CAZA 1KJLA 2WFF3 3VBHA 1A6CA 4JDNA 2FZ2A 1T6GC 3WDYA 5K0UA 3ZXAC 1W6QA 3R6SA 1ZBE2 1GYKA 2RS32 1M4WA 4M01A 3CEWA 3H3UA 5HXVA 1YJLA 4H3WA 4CDXA 2YDEA 2GH8A 1V9U3 3MIEA 3M8LA 4LBQD 4WM7B 2UYBA 2ZHNA 1RUOA 1OLQA 2WQZC 1JUHA 3VBUA 5GZEA 3VKOA 3ZFEB 1FATA 2NZ9A 5JVVA 5BNPC 5F6LB 4COZA 1HXS2 1V9U2 1TE1B 4I3PA 3RJ2X 1O5UA 5FQ0B 3RNSA 3H8UA 3A0KA 2A6WA 4M0NA 2Z5WA 1V6OA 5I8TA 3EXUA 1G6NA 4N7UA 2JJ6A 4AFMA 4CDQC 2HWF1 2P17A 1RUF1 2PHUA 4OVEA 1LHUA 4S2GA 2GN7A 4ISQA 2K9ZA 4CEWA 2B46X 5JPMB 4FAGA 3MYXA 3BTAA 2A73B 3K51A 1D4VB 3ZSKA 3VBFA 1GZCA 4IV1A 1ZYBA 4S2DA 2GNMA 1MQTB 5EV7A 4NVPA 1NCQB 2GNTA 2VOVA 4EV0A 4DNYA 2ENRA 2OIIA 4L9BA 2UY9A 5DZGA 1VBA1 4YW4A 1PGL2 5FMOL 1ZZ6A 5FOBB 3NAPC 1H8TC 4GQ7A 1A8DA 3ZXLA 3MLLA 4QHBA 3JQXA 4AVTA 1O3SA 2UU8A 1DZRA 4FPJA 5JOWA 3EBRA 1XNBA 1PIV2 1QJX3 2QDNA 1R081 1MZEA 1PZ7A 3MIBA 1OQ1A 2CTVA 2XLAA 5L7OB 4FT8A 2X29A 2A70A 2CY6A 2BYVE 1QJU2 1NQDA 1CVNA 1PO13 4IETA 4AHZA 1GNZA 1HRV2 5AFEA 1UX6A 1KXGA 5H9QA 4AXOA 2FQPA 4HK9A 4Q0PA 4XMAA 2BVBA 2W52A 3WDXA 1EV13 2WL1A 3AZYA 1EP0A 2B8MA 2R1DA 2GN3A 3RI8A 3AZWA 4JDMA 1DGWX 1OD5A 1HV1A 3ECQA 4PDWB 1COV1 1C57A 2NLRA 1RMU2 1IKQA 2B45X 5DDJ1 3AP6A 4M0HA 1REFA 1VRH2 5D1IA 1IPKA 3VBRA 4RGGA 4G9SB 3LA2A 4AI3A 4EN6B 2ZS6B 4YZ3A 2CAUA 1WW7A 2OVUA 2WS93 4IEVA 1QY4A 4KL1A 1QOOA 1GANA 1PM7A 1GQGA 3GYDA 1OFNA 1JBCA 3AMQA 2E7TA 3WINE 2R1BA 1RINA 4EROA 5DZFA 2DVFA 4JV4A 2HEYF 1XQNA 3NV2A 3O5SA 1V6JA 1W6MB 4WVMB 3VDDC 3NWKA 4CDUB 1YJKA 2ARBA 2VNGA 5L73A 3VL9A 3RG0A 5T5LA 4B7EA 5J37A 4GALA 1RGSA 1SEFA 4HVRA 4JRLA 3SMHA 5C4WB 1I6XA 1XE8A 3FLTA 1WUVA 4JGYC 2IC1A 3OD0A 3OGJA 4HL0A 1OMIA 3ZVXA 3TN91 2HWF3 5BUVA 2C0ZA 5T54A 2JDZA 1RUF3 1W2UA 4DXZA 1H8VA 1B09A 5JDBA 4YVWC 2UYAA 3OBRA 1TMF2 2HWF2 2DVAA 3DKWA 2Q4SA 3KS7A 1RUJ1 2RS11 2A7AA 2IXJA 4ZU7A 4JQRA 4BMEA 3LA7A 3LWCA 5FLJA 3PTYA 1JH5A 4EN0A 4XBNA 2PAMA 1VBA3 1O4ZA 4P9XA 3VZNA 4QPGC 1SLCA 1FMD3 1ZNPA 1S2KA 1BBT1 2Z42A 4RGAA 1A78A 1J3RA 2JG9C 1J59A 2AREA 3M2MA 2WSUA 1AR82 1R083 1LGCA 1W6NA 1F8VA 1WLWA 3SH3A 4ASLA 3ES1A 3TBDA 1GLHA 1RUNA 4JDOA 3BIWE 1BMV2 2P3KA 4NHMA 3KCCA 4K3UA 5HCAA 2DU0A 3ENRA 1C5HA 1QHDA 4FPEA 1UU4A 5FOJB 3MLJA 2DVGA 5DUUA 3NKGA 1UPIA 4LE4A 2WLPA 4QGMA 4EN9B 2RS52 3VZLA 5LEJA 5GJ6A 2FZ1A 4BLJA 3EJKA 1AYN2 3LCPA 2ZMLA 2ZZJA 2BFUS 3WVJA 1COV3 2FMYA 3J9SA 1ENQA 1H9PA 4H7LA 4MGZE 4UXAA 5DDJ3 3WW1A 2ZOEB 5ABJC 3N35A 1NCRB 1YIFA 5BNOA 1YWKA 1EPZA 5DG1A 1COV2 2WA4A 1RUH1 4KWKA 1WMDA 5I0SA 5FFOC 1HV0A 2WFPA 3GBWA 1D2QA 4GA9A 4JGZB 4XIKA 5ACA2 5I0TA 1Q8SA 4XFCA 1ZREA 2WKKA 5KHJA 2MEV1 4YVSA 4YZ1A 4AGGA 5BYNA 1SBEA 3ZYRA 3LB9A 3VBSC 4PF5A 4FBFA 2YMZA 2HWC2 4U36A 5C8CC 3AKPA 1LU2A 4E4SA 4I0AA 3D5OA 2A5ZA 1O3RA 3E6DA 3WQ1A 4NPRA 1FPN1 5CU1A 3LA3A 4R9AA 1RUE2 3DV8A 4XPVA 1LOAA 5HCFA 2D98A 4AI8A 4IEPA 1H4GA 3TN93 3M3EA 1MS5A 3MZHA 3R4UA 2AUYA 4RA0A 4K9SA 1XU2A 2BFUL 2GSYA 2OUHA 2WWSA 1VR3A 1RUJ3 2PHDA 4WM7C 1AR91 3ZFEC 1MS9A 4RD7A 2WZR1 5LRSA 5KBFA 2G9GA 1FV2A 3S7IA 1KITA 3ZPYA 4QM8A 2D6KA 1RUJ2 2RS12 3L2HA 4WZFA 5BNPA 3WCSA 5GLVA 1QNWA 1VIWB 1I1EA 2FMDA 3QH7A 1QXPA 1BBT3 1NE6A 4Y5Z0 3CU7A 1S0DA 5FAXA 3ZXKA 1B35B 4LUMA 4CDQA 2R0FA 4YZ4A 2XJPA 4M3CF 3VHNA 4XOGA 4Q1PA 1KD7A 4H55A 1LESA 5BNNB 2TBVA 5IK7A 3MGUA 1C8M1 1VALA 2TUNA 4AI0A 3HD8B 2DVBA 4AVVA 1LHWA 3NV4A 1ULFA 2QUOA 4YW3A 2B42B 4AVAA 2ZGMA 1F9KA 3N7LA 4U2AA 3USSA 1CAXA 4QPIA 1GICA 2EAKA 2PLV1 1PNGA 1W6PB 4C1XA 1NA1B 3NAPA 1H8TA 1CAWB 3LZZA 4QQOA 2P3IA 2ERFA 2IFWA 2KA3A 4YM2A 4QXKA 3U11A 4Y26A 2W68A 4NO4A 3IMNA 4NR1A 5L7OC 3M7AA 2R062 5GZGA 3KT7A 1ASJ3 5LK7B 1HQWA 1SBFA 3N7KA 5FO8B 4YG6A 1WMFA 1RUH3 3AP4A 1Z7S1 1MS1A 4I02A 4P9YA 4XFBA 3RRDA 4IESA 3WNXA 1RB8G 3WW4A 3B5LB 4LEJA 2MEV3 3AYEA 3U0ZA 3D8CA 2DU1A 3SNMA 4CDWC 1ULCA 3N7JA 4ATFA 1N1SA 1X82A 2O1QA 3MLKA 1ZX5A 4PDWC 1POV3 4DS0A 4ZKTB 4OI0A 1RUI1 4YZ2A 4B4QA 4COVA 3J8F1 4Z2WA 1IPJA 4FPLA 1FPN3 4RS5B 4FAHA 3AYCA 2XUMA 4J1XA 1TNFA 4L2NA 1QGLA 1K5MB 1S0IA 2BBVA 2WNVB 4XQ4A 3G6JB 4QQLA 1FPN2 4FP3A 4MYEA 3IPVA 4G4FA 1HRI1 2F6BA 1GNHA 3AMNA 5E1RA 2Q8OA 5T55A 3SXWA 3HQXA 5JI7A 5D8AB 4N7IA 2ZX4A 4CDUC 4LNVA 3OPZA 4UBHA 4SLIA 2JX9A 5CG9A 4HSLA 3VDDA 2D40A 1AR93 1RUD1 3AMPA 4NN0A 2WZR3 1AR72 3V0BB 2VVDA 3WUCA 1QOTA 2VNRA 5C4WC 2E9QA 3DPRB 3CF6E 2QQPA 1LOFC 4ISRA 1AR92 2GC1A 2WZR2 4JGYA 1NY72 2BPA2 1H4HA 1LGNA 4BE3A 2GALA 2DCJA 3ZXDA 4D69A 4LBMA 1LOBA 3ZIWA 4YGBA 2CWMA 4YNIA 1IOAA 3D0SA 3H50A 5LRRA 1U12A 4LUKA 1C8M3 2EAAA 4IQPA 3RPQA 4BIFA 1UIJA 5H9SA 3USUB 4Q2FA 2RS31 4XYXA 3A0NA 1Z0HA 1YXWA 1YFUA 1WBFA 2O0OA 2HEVF 3MDPA 1UU5A 4QPGA 2HWE1 1UAIA 3RWNA 5EZWA 3FBYA 4PQ9A 3LSEA 1HXS1 2JG9A 3AXEA 4INDA 2QFEA 4JC1A 4Y4YA 5KXDA 1W6OB 1A8MA 5GZCA 5DXDA 2PLV2 2MPFA 1WW6A 3MIDA 3R4SA 5FPZA 1O5LA 3LKJA 3OY8A 4LBOA 3N7MA 2DTYA 3B69A 1SLAA 3ZXJA 3IKWA 2UY8A 4D3WA 4UW3A 1Z7S3 3KMHA 1DQ2A 2DCTA 4FXGB 2K0GA 2ILMA 5AFBA 1JYIA 4AFBA 1S0BA 1WMEA 3POYA 1E57A 1MEC2 4AEJA 1Z7S2 4BQ1A 4KGQA 3WCRA 1WLTA 3ALQA 2YYOA 3S0MA 2AYHA 4IEUA 2WNUB 1N1YA 1J3QA 4FVVA 4PBPA 3ZMNA 3MFCA 1ND2B 1RUI3 4FPHA 2E63A 3RSJA 1LECA 1NXD1 4XDQA 3J8F3 1NCRC 4XQWA 1Y7BA 1Y3TA 3FHIB 5ABJA 4XFAA 4EWAA 2WQ4A 2QVSB 1IGOA 1C28A 4JGZC 3RI9A 3J8F2 3IDBB 2WA3A 1OPMA 4LO8A 4YW2A 2VECA 2ZHLA 2WT0A 3ZFGB 1QJU1 4Q27A 4RQPB 3AP9A 3VBSA 2ES3A 2NM1A 1XNKA 5BNOC 4HKLA 4Y20B 5C8CA 1MS8A 2HWD2 5BXXA 1HRI2 1V6MA 4ORFA 1XE7A 3BPZA 2TEPA 1RUD3 3J26N 3H9AA 4WM8B 1MS3A 5DUVA 3LOBA 3WDTA 4K8FA 4C90A 1UPSA 5FO7B 1RMU1 2ATFA 2XJQA 4R9CA 4OHZA 4FTBA 1V6LA 1NG0A 1RITA 2Q1ZB 4XFGA 1FOD2 2A6YA 2B7YA 4KGGA 1X50A 4HN0A 1DGRN 3V56A 1F2NA 2JENA 3WD5A 4Q26A 1RHI2 1YYNA 5J48A 5JWPA 4RFT0 1UKRA 3M3OA 1DQ4A 3VLBB 1ND3B 1IS4A 1ZBE3 1UF2C 2BTVC 4WM7A 3VZMA 2VU9A 5AVPA 2RS33 5T5OA 3ZFEA 4AG4A 3BOPA 4DPNA 1KDKA 3POSA 5FMOS 4ATEA 5FQ0A 2HWE3 2XGXA 4LBQB 4CYDA 1PO22 4CP0A 1H30A 5J7MA 5GLUA 4KU7A 2DTWA 4OUSA 4EWEA 1HXS3 3BODA 3LOIA 1ENXA 2HWE2 1QDCA 3AP5A 2GU9A 2RR12 2A6ZA 3WV6A 5C6CA 4FOWA 3O14A 5E89A 5GZFA 1WCKA 4WVWA 5BNNC 2OZ6A 2X5IC 2H6BA 3BOWA 3ILFA 5J36A 3ZMOA 1APNA 4LLFA 1IS6A 5CBLA 4XBQA 1LU1A 2HEWF 1DZQA 4XF9A 3EHKA 1QDOA 1TMF1 3T1MA 2Y38A 4GXLA 3GZTB 5FLIA 1URXA 3NVCA 1V6KA 2CV6A 3I54A 3NJZA 1NA1C 1XYOA 2VW2A 3QOPA 4W6WA 1WD4A 1X36A 3VBHB 2ZX3A 1CESA 5K0UB 1D0HA 1W6QB 2CGNA 1AZDA 2PELA 4R52A 2BWAA 2YXSA 4C1WA 3BB6A 1AHSA 2ZCWA 2DFBA 4QPIC 5L7OA 4QX5A 2D6MA 4M3CB 2UWAA 1R1ZA 5IK4A 1PIV3 3VBUB 1BKZA 1AR81 1KFUL 3MIGA 4A7KA 4OUMA 1GKBA 5JAXA 1R091 1ULGA 3SCHA 1DQ1A 4O9GA 3ILRA 4LO5B 1BMV1 1G9AA 2OZJA 1EAH2 3VBOB 1QQP1 3ZIXA 2PN5A 3VKNA 4DRRA 4CDWA 1QJU3 4IEZA 3IM0A 3HMYA 2R32A 2GC3A 4X6RB 3JU9A 2GMPA 1DYPA 2ZA9A 3THTA 1HRV3 1OA3A 5AVAA 4B8EA 2RS51 3FBMA 4PDWA 1IS3A 4AEKA 4O9EA 3W59A 4I3GA 3VBFB 4WV8A 4RS5C 1C1LA 2A3WA 1AYN1 3WG3A 4COWA 2UWCA 1K5MC 2UWBA 3GBFA 2WNVC 1RMU3 4HZFA 1IHMA 1IQAA 1EPWA 2VOXA 3UJOA 4FO9A 3RJRA 4Q1RA 2VVFA 1VRH3 4GH4B 5JSOA 4FPFA 1KS4A 4HETA 1W0PA 1H1MA 5D8AC 5ACA1 4TLFA 1D4M1 4E9KA 3WQ0A 3V65A 4GB32 1W6MA 4WVMA 4CDUA 1NYWA 5LK5A 1XU1A 3WG2A 4E2SA 1S0EA 3O0WA 2HWC1 1POV0 2IXKA 3HIFA 1YLLA 2RM21 4XEZA 5C4WA 1MS0A 3FZ3A 4BIOA 2ZGUA 1LOFA 3VKLA 2BW8A 4AEMA 4Q4Y2 1OQEA 4GWMA 5JZGB 3SITA 3E97A 1FNZA 1AXZA 2ET7A 4AQTA 2O8OA 1RUE1 1REEA 1NE4A 5A32B 1BVVA 4M3CE 1WLDA 3ACLA 4PIXA 1LULA 1GQHA 5K8SA 4LT5A 2XPJA 3IDCB 4NHLA 4Y22B 3B00A 5KWRA 2DWRA 3WHUA 2DUQA 1TMF3 2WIIB 3UKTA 1ZRRA 2XL9A 1ZA4A 3AFGA 2C5DA 4IEYA 5JOYA 1OOPB 2QCSB 4XMIA 2BVVA 1N1TA 3ZN6B 4LA2A 4Q8LA 3PNAA 2BEOA 2R30A 1RL3A 3AZZA 5CNAA 1XYNA 4DFSA 1XXNA 4MXWB 4XJUA 4IV3B 3VGIA 3SCFA 3TAYA 3ZYGA 4X6QB 3N4MA 3ETQA 1AR83 5JIAA 1KQRA 3UL2A 1R093 3EO6A 3OBTA 1ZZCA 1BQPA 1QQP3 1HQNA 2LTNA 3H1WA 3JZVA 4JRAA 4AWDA 4XHXA 4QQHA 1R092 1OQDA 3AZVA 2GMEA 1CAVB 4AEDB 4OI1A 1G9FA 3VV1A 3O0XA 4XQDA 1QQP2 3IWZA 2WNUC 2RS53 1ND2C 5DUWA 1Y43B 1XRUA 3I7DA 4P9LA 4BMBA 4E27A 2XVKA 3L9JT 1NCRA 1DIWA 2PYTA 1AYN3 1MVEA 4HLTA 1ZZBA 1AX2A 4OZXA 3ZDSA 1BZWA 4XZPA 4JGZA 2JICA 4KH9A 3ST7A 3FLRA 2R061 1SBDA 4BH9A 4N43B 3WP6A 2PHWA 2VY0A 5T52A 4HMZA 2GH2A 3CNAA 4RQPC 1WGPA 1Q8OA 2P37A 4BCUA 5KXEA 1LEMA 5ACA3 2V09A 3R4DB 2GZWA 1AXKA 4GMP1 3MICA 2BQPA 3AB0A 4P9GA 5JOXA 4XFFA 4YFWA 3EQEA 1RJ8A 3GF6A 4RL7A 4WM8C 3H3ZA 1D4M2 2HWC3 3OYWB 4Q4W1 2DF7A 3P3NA 3WW3A 3MIFA 2AR6A 4R8HA 2ZX0A 1PK6B 2DCKA 1AR61 2RM22 3GALA 4JTNA 2Z2SB 1RUE3 1QMJA 4DMIA 1DHKB 1O4TA 1ZBA1 3OTFA 1QXJA 1ND3C 3AFKA 2R071 1QU0A 2V73A 3KZ4C 4OLLA 5CA6A 1G86A 3U07A 2XJSA 1OLRA 2VMHA 2ARXA 2VMIA 1TNRA 2ZGOA 2YY1A 2PAEA 3FUOA 2ZHKA 1AR71 2DVDA 1LHVA 3DN7A 2VOWA 2RS13 2ZTNA 1YRZA 3FLPA 3IT8A 3A4UA 1RVF2 1DLLA 2Q1MA 1NY71 5AC92 3FFZA 4DZGA 5A3LA 1BJQA 2P2KA 5BNNA 3AYAA 4YARA 4EJRA 2X5IA 3CJIB 3B9CA 1VBC2 4HN1A 1MR5A 5K7PA 3RYPA 4HK8A 2PHRA 4D7YA 4M00A 2K2SA 4FCAA 1SLBA 1EYBA 2JG8B 2ZGQA 3SLIA 1DG6A 2PFWA 1QJY2 4RHV2 1AUYA 1W6PA 1WD3A 1NA1A 2H0VA 3DL3A 3GHMA 1CAWA 1MQTC 3WP4A 1NCQC 4QU2A 1KJRA 1QKQA 4UW6A 1SLIA 4E4ZA 1G9BA 3M1HA 4JCKA 2DUOA 3C2UA 1ZZ9A 2D3SA 4QQPA 5GLTA 3VKFC 3N3HA 1UU6A 4AHWA 3PVEA 3KCYA 5FREA 5SV8A 4LBNA 3SH5A 3O12A 2D3PA 3BCWA 1CIWA 1QNYA 2XKPA 4Z82A 2R063 1WCSA 3THPA 2Z69A 1FX5A 1VBE1 4C0BA 1PGSA 1CAUA 2A3YA 3RMYA 1RUG1 1NXMA 2FHRA 3HN1A 1CGPA 3HBZA 1X33A 4NHKA 2C9AA 2OA2A 2IZWA 2PAKA 4GMP3 5DZEA 1TME1 2ZGKA 2B5HA 1MEC1 5IUQA 1FT9A 1YFWA 4ZU5A 4JTOA 2Y26A 2XWJB 3D6EA 3ZYIB 4RS5A 1U5YA 5C9AB 3DGTA 4Z1VA 5CG8A 5FDBA 1V6IA 4ZU4A 4AI2A 4YZ5A 1K5MA 1SQ4A 4LLOA 4PIZA 3UK9A 2WNVA 5CVRA 4AW7A 1HKDA 2YHJA 1ZVFA 4Q4W2 1AR63 4GH4C 4TYSA 4XF1A 1CAXB 2I45A 2D44A 3VHPA 1Q8PA 3NAPB 1ZBA3 3ZFFB 3M3QA 5DUXA 5CFDB 5D8AA 1AR62 2PA7A 4N90A 4KQ7A 1DGRA 4URTA 1DYKA 4FTEA 2QE3A 1MACA 2ZBJA 3FWEA 3V0BA 1ZBA2 4KU8A 1IS5A 3AM2A 4QPYA 2HWD1 2R072 1I3HA 3RS6A 4DQAA 5FO9B 3OGGA 1AR73 3OF1A 5JZGC 4OHWA 4K1YA 5F5QA 1F5JA 4N53B 4XXAA 5FBZA 4K40A 3DUIA 2D43A 2YGLA 1AJOA 3HWJA 2VQ0A 2ZABA 2N7GA 4FPOB 5EJ3A 1H2KA 2HWB2 4XJ9A 1U5ZA 1FOD1 2VPVA 1MZ5A 1FV3A 1AVBA 3WP3A 4BYYA 4DRVA 1RHI1 3USUA 4CP1A 1V6NA 2IFRA 3PMSA 2WINB 4UW4A 2ZPXA 3ASIA 5A33B 1H1IA 4MGYE 2C1FA 3AXDA 4L8QA 5T5PA 1SCRA 3E6CC 2QJVA 3MF6A 1S0FA 1OOPC 2NPIA 1WCDJ 2NMOA 3T1LA 4AFDA 1RUC1 1CX4A 2Q30A 4DOUA 4KWJA 3APBA 1HX6A 4CP2A 1M06G 1N47A 5CFCB 3AKRA 4K7JA 1UZYA 2DUPA 1GZWB 1W6OA 3RZZA 2D6OX 3S7EA 4WBBA 4AGRA 1PO21 4IV3C 4XTMA 1DBNA 1DDLA 2ZGSA 1H2LA 1VAMA 1CPNA 4E2GA 2PHLA 2XL7A 2E7AA 3BU7A 3NSTA 3AKQA 2RR11 1Z78A 2PLV3 1QH7A 4W6YA 1JOJA 1PHMA 1R1A1 5GLZA 4A7ZA 4JAAA 4L11A 2JD4A 3U10A 1O3QA 4GKXA 3IIAA 4LHNA 4XF4A 4XF3A 3MPBA 1CONA 3W9AA 1G9CA 2WFF1 4GULA 4AEDC 1H9WA 1AX0A 3M3CA 2VOKA 3NV3A 3TNQA 3SHRA 3JBG2 1GBGA 4GIQA 2H0BA 1VBE2 3HR9A 1ZRFA 2WNUA 4META 5BV6A 1RUG2 1SFYA 4YVWB 1MEC3 1ND2A 4HKOA 3WLUA 2H6CA 4P9WA 1J58A 1TME2 1OI6A 3NW4A 2XVLA 3HAGA 4OI2A 5K9YA 1CJDA 1ZRDA 4QQ2A 1Q56A 4Q4V2 1AYM2 1IKPA 1NLRA 2WT2A 3V0AA 1DGLA 1Q5OA 1H2MA 2GNBA 4D7TA 4AQ6A 1H2NA 4J1WA 4N43C 2OYZA 1F31A 3NV1A 2GC2A 3ZFGA 2GC0A 1LENA 4OULA 2Q5TA 4DY5A 4RQPA 1VBD2 1VB4A 2BNOA 3KQRA 4AVBA 4WVZA 4BA6A 4Y20A 1LRHA 1V70A 3BALA 1EAH1 1H0BA 2YV8A 2WLQA 4HPKB 2PTMA 4HBNA 5GALA 2EA7A 3MW2A 4C0HA 5H9RA 4WM8A 2XLGA 3H7JA 3NL1A 2D93A 5BNQA 2HWD3 3B9IA 4OHYA 3ZYJB 1PVC2 1DU3D 1HRI3 4MGIE 2R16A 4QM9A 5KHKA 1PK6C 4K21A 4YW5A 3VHRA 3M4FA 1HLCA 3B94A 4Y1XA 1OPOA 1LTEA 4QD2A 3QD6A 4HANA 3I8TA 2MNGA 4D7SA 3AZXA 3JD72 1LB2A 4PCRA 1SMVA 1FOD3 3SISA 2QNKA 3B01A 1ND3A 1QJX1 4LR4A 4Y1VA 2VQAA 2XKOA 3B02A 1RHI3 2ZZQA 3Q9OA 2HYKA 2D3RA 4I0WB 4UBGA 2IXCA 4GWNA 4GB31 2WC2A 1PZ9A 5ABJB 2G4IA 4EWDA 1U5XA 4YFZA 2RMU2 4CEYB 3C3VA 4XXPA 5E88A 4LBQA 4AK3A 4P9JA 1MVQA 1SDWA 3GZAA 3OD4A 2EVXA 1AL0G 4I0BA 4YG3A 5F6KA 4H14A 1Q8VA 4LE3A 1RUC2 4RR3B 4AVCA 2XJVA 1LOEA 4Q4X2 2ZJCA 4Q4Y1 1N3QA 2W08A 1PO23 4RSUA 3I59B 1PGW1 5EXOA 3CJIC 3WX5A 5IT6A 4A2UA 3ZO0B 3POWA 1X8MA 2RR13 1LEDA 1R1A3 1VBB2 2SLIA 2ZGTA 3L2YA 2DCYA 1B35C 3W58A 2JG8C 4PLOA 3VZOA 4K20A 5JSRA 2JXAA 5I0UA 2LM3A 3GNEA 4BZ4A 4IEOA 4BLIA 1C8NA 1R1A2 3KLSA 3KSCA 1S55A 2D7FA 4I09A 3PVBB 1WW4A 4Y1ZA 1QXRA 1IZ3A 1MQTA 1QF3A 4ITCA 4YSFA 1BEV2 1NCQA 2EXKA 2WFF2 2PHFA 2BNMA 2A6VA 3PVOA 1JHNA 1SLLA 5KXCA 4HFSA 5HCBA 1RIRA 4FSJA 4Q0VA 3RYRA 1YI7A 3AKTA 4M3CA 3RMXA 4COUA 1KFXL