4H7MA

The x-ray crystal structure of the trichoderma harzianum endoglucanase 3 from family gh12
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
EAEAEFQTSCEQYAVFSGGNGYSVSNNLWGQSAGSGFGCITVNSLNSAASWHADWQWSGGQNNVKSYPNVQIAIPQKRIVNSIGSMPTTASWSYTGSNLRADVAYDLFTASNPNHVTYSGDYELMIWLARYGDIGPIGSAQGTVTINGQSWTLYYGFNGAMQVYSFVAPSTVTNWSGDVKNFFNYLRDNKGYPASSQYVLSYQFGTEPFTGSGTLNVNSWTASINV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structure and Molecular Dynamics Simulations of Endoglucanase 3 from Trichoderma harzianum: Structural Organization and Substrate Recognition by Endoglucanases That Lack Cellulose Binding Module.
pubmed doi rcsb
source organism Trichoderma harzianum
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
total genus 56
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4h7mA00
1ENXA 3EXUA 2DFCA 1OLRA 4XPVA 3VZJA 1IGOA 1UKRA 2DCYA 4HKOA 3VL9A 3HD8B 3MFCA 3VHOA 1XNBA 3RI9A 1XYPA 3WY6A 2D98A 4XQWA 4XQDA 2VUJA 3WQ7A 2DFBA 1HIXA 1XYNA 1XNDA 3VL8A 3WQ0A 1QH7A 1HV1A 3AKSA 3AMHA 4S2HA 4HKLA 2NQYA 3AMMA 3WP4A 1TE1B 2B46X 2C1FA 3MFAA 1OA3A 3VZLA 2BW8A 1XNCA 2VGDA 1H8VA 3WT3A 1H4HA 1F5JA 3LGRA 3AMQA 2D97A 2NLRA 3AKPA 3AKQA 1BVVA 2DCKA 3AMNA 3AKRA 3AKTA 5K7PA 1REDA 1PVXA 3M4FA 1OA2A 1NLRA 4NPRA 1UU4A 2QZ2A 2JENA 3WQ1A 2BWCA 1OLQA 1M4WA 3WP5A 1BK1A 2DCZA 3B5LB 2B42B 3MF6A 4HK8A 2QZ3A 3WP6A 4IXLA 3VZNA 1XXNA 1KS5A 4XQ4A 3B7MA 4S2GA 1UU5A 3MF9A 3VGIA 1OA4A 5EJ3A 1BCXA 1C5HA 3AMPA 1C5IA 3ZSEA 2VG9A 3LB9A 3O7OA 3VZOA 1H4GA 1W2UA 3WP3A 3VZMA 1H1AA 3RI8A 2F6BA 5HXVA 3VLBB 2Z79A 1KS4A 1REEA 1XYOA 1REFA 2VULA 3WR0A 5K9YA 1H0BA 2JICA 3WXPA 3VHNA 4H7MA 2BVVA 1HV0A 1QH6A 2B45X 3VHPA 1AXKA 1T6GC 1YNAA 1UU6A 4S2DA 4S2FA 3WX5A 4HK9A 2BWAA 2DCJA 1XNKA 3VZKA 2JEMA 4HKWA
chains in the Genus database with same CATH superfamily
3LE0A 4D6QA 2JE9A 4HPKA 4NWWA 5A1LA 4E4DX 2DFCA 5IYYA 1MEC1 3RS6A 5ISLA 2VNRA 5CIRA 2WT0A 1QF3A 4FPOB 1MACA 2RS32 1QJX3 3BYWA 3MFCA 4CXYA 4XF1A 1SEFA 2F4LA 2X09A 3MIFA 3IB3A 5GZEA 3WQ7A 2DFBA 1H2LA 1XYNA 3AP5A 5IAVA 3NL1A 1ENSA 1YI9A 4Z2WA 1VRH3 2W3JA 5EYXA 1JYXA 4XAAA 1TME1 3ZFFA 3AKSA 5E6HA 1QOSA 4HKLA 1VBD2 3E6BA 3DYOA 2YC0A 4YZ1A 1C8M1 2P37A 2WFF3 3K2OA 2JG9A 1PNFA 4GB31 5FY9A 1IHMA 1SDDB 1SLCA 1UW8A 2C1FA 5LCWL 1WW6A 2BW8A 1OOPA 1O3SA 1DGLA 3JBG2 4ZXEA 1POV3 3UV9A 2C9AA 1RUE3 4BM8A 4Z1VA 1VP6A 3GXUA 5FZ3A 1W0OA 4CP2A 2YGLA 3BGAA 3RYRA 1G9CA 2NYYA 1O3RA 5A3PA 2R0FA 3GZAA 1I3HA 1RVF1 2VUDA 1PO23 1RJ8A 5BNQA 1Y4WA 2VBDA 5JR7B 1SLBA 1WCSA 3AB0A 2BVBA 1LHUA 3MUZ1 2B4KA 1RMU2 5I93A 1VIWB 2Y6GA 4AHZA 5J98B 1EV13 4HN0A 3NNMA 1GNZA 2YB7A 2ZTNA 3FHIB 4NIGA 3QD6A 4R9BA 3D8CA 4CDQC 2J1UA 5HPOA 2VZ1A 4QHOA 2B42B 3N9QA 3OBZA 2Y60A 1LHNA 2AH2A 3ZMNA 1G86A 4KWUA 5A3OA 5FUPA 3I59B 4FI9A 1DQ6A 1UAIA 2K0GA 4JQTA 4OMCA 3UKNA 2VZ3A 3LQCA 1ONAA 4JRLA 4SLIA 1FOD1 4YLZA 3NV2A 2JECA 1PO22 4JDMA 3KWVA 5A33B 4IV3B 2W08A 3K77A 4HVQA 3BUCA 1W8UA 5HCFA 1K45A 3JB8A 2JDNA 2BU9A 4CUBA 1AHSA 4C1XA 2PHXA 4FXGB 4A7KA 4COZA 1W8TA 3ITQA 1MZ5A 4YYOA 3QBQA 3PUSA 4I02A 1LOEA 5FZFA 1SLAA 4EN9B 1G6NA 1WD3A 1I9RA 3B3QE 4XF9A 4EWEA 2Z42A 2PLV3 1CGPA 5JIAA 2RJLA 1IQDC 1EUUA 3BTAA 1E5IA 5TSWA 5K8SA 2I2SA 3WNMA 3Q8BA 3J7LA 2DUOA 4XUOA 4AI8A 2RR11 1JHJA 2WL1A 4EE2A 3WR0A 3M3CA 1WLCA 4Q4V2 1AYM1 2DV9A 3K51A 1OXCA 1UX7A 3ME2A 3OD0A 1ZYBA 3IZOA 4P9GA 4Y22A 2VCMA 5FWEA 4XUNA 3FL7A 2JB4A 3A23A 4DO0A 1OOPB 1T6GC 3KV6A 4JVAA 1BEV2 2WUHA 3UK9A 1RUF2 3RYPA 4AYUA 4YFWA 3I2JA 1I1EA 2OT7A 1X9PA 1U12A 4PBOA 4I0BA 2FDHA 2LRPA 2BWAA 4WVZA 1JH5A 3BOPA 4IV3C 2R30A 1JW6A 1HKDA 1VMHA 4CU7A 2OZJA 2Y6LA 3ZR5A 3LCPA 4HKOA 4YVWB 4AQTA 2EXHA 2PHTA 2WC2A 4CCKA 4Y5Z0 1VB4A 1VR3A 3GHMA 1RUI2 1V6OA 4M00A 4QDSA 2HLEA 3HNMA 3WINE 1S4CA 1N1YA 5A33A 3SXWA 2JDMA 2O1QA 1R082 3IIAA 4LBQA 1HV1A 4GWNA 5FZ1A 1AYN3 3TAYA 1RVF2 1W28A 4GMP0 2QQIA 2B9VA 2Z4FA 3ACHA 1CZSA 1EP0A 3AYAA 1GFF2 1WLWA 2XQRA 1W6MA 3A22A 1JYTA 1EPZA 1DYOA 4O9GA 5GZDA 3B9CA 3O0XA 4GH4C 1S2BA 3PIGA 1C28A 3ALQA 2G9FA 2ORZA 1N1SA 5J09A 4D0QA 4TZDA 2D5FA 2CTVA 4IEOA 4AGVA 3SLIA 1ZX5A 1GP4A 1OD5A 1POV0 2GMEA 3INAA 4WV8A 4G3YC 3BN6A 3W21A 4E2GA 5JXGA 5CNAA 4L9BA 4INDA 1WW4A 4NO4A 1OA2A 1WKYA 4YGCA 5IAXA 2ZXQA 1UU4A 2WWUA 1FPN3 1W6NA 2JENA 2WQZC 4WM8B 3H8XA 3OUIA 2FCVA 4CDWA 1HQWA 1MS5A 3B5LB 4QXKA 2DVFA 2R073 4XJWA 1YO8A 4NOTA 3R05A 3VDBA 1RUF3 1V6IA 1QXJA 1MS8A 4FCAA 2WA4A 3U4XA 4QPIA 3CNAA 5LBEA 1X8MA 3WF3A 1RHI2 1W04A 1ZRFA 3WDYA 2HWE3 3K4ZA 3PTYA 1JU4A 5CFDA 3VGIA 5T5LA 3N9NA 2ZEXA 5FZHA 4DUVA 3V0BA 4WVMB 4YM0A 5SV5A 1C4RA 2LW8A 5LY1A 3HQRA 4MV2A 3HN3A 5B2GB 1ZRRA 2KM2A 4Q0PA 1ULEA 2XG3A 4Q8KA 3ZKYA 1AYN1 4G4FA 2DYCA 4Y33A 2QKDA 4U2AA 3T3YA 1IS3A 1SLTA 5JXJA 3NAPB 4NAMA 4RQPA 3PDQA 3WNLA 4HZFA 4AVSA 4RR3A 3VD5A 3DECA 3NJVA 4M0NA 1PZ8A 4PQQA 1HJGA 4QHBA 4NIIA 1ULPA 4HSJA 2D3RA 3A4UA 2OS2A 2Y6KA 4Q4X2 1SQ4A 2E33A 2P34A 2WA3A 1LHWA 5LBFA 1NY72 3U10A 3T4HB 1WMEA 2BDRA 1RUI3 3AC0A 3RMXA 1PK6C 4CEWB 2W91A 2NP0A 3V65A 1PMJX 4LA2A 5EJ1B 3MICA 3DF0A 4AR2A 4JDNA 4LULA 1KJRA 2R0HA 1DLLA 1IS6A 2ILMA 2FDIA 2FZ1A 4MXWA 5FV3A 3ST7A 2R49A 4Y4YA 1HJFA 3J9SA 4S2FA 1VAKA 3WF4A 4QXBA 3JQXA 5FMDA 4DEQA 1GZWB 5FJKA 2ZJCA 2JEMA 1PM4A 4WM7C 4F3JA 2Q8CA 3O1UA 3VBFC 3Q8EA 4XEZA 4RQPB 4ET7A 2B7YA 5LRRA 3FMGA 2OIIA 1NT0A 4IGQA 4AI3A 2YC4A 1SZBA 1YJLA 1QNYA 4NMIA 3MV01 1HX6A 4LOTA 2CSGA 3ZN6B 1KXGA 3NV4A 4RR3C 4E8DA 1IPSA 5FDBA 3KV9A 4NHYA 1PO11 3M2MA 4JHTA 1JHNA 3ZXGA 3JBG3 1JOPA 2PN5A 3VBUB 2BOIA 4J25A 4KWKA 3TN92 3S6PA 5CB7A 1SFYA 2YXSA 3M7AA 2UYAA 5CADA 1ACCA 2WFF2 1OBNA 1YFWA 3BI3A 1CPMA 2JIJA 2XJUA 3D0JA 3ZDVA 2FQPA 4DZGA 1H8VA 1XBFA 1POV1 1FOD3 3OBTA 5A6XA 5CFDC 5IVEA 4CUCA 5CKMA 3KD4A 4XJ9A 3AKQA 3AYCA 2XOMA 2TEPA 4HG6B 2DBIA 1UZYA 4JTNA 4D7TA 5JCTA 2GMMA 3NKGA 2ZCWA 1W39A 4D69A 1UZZA 1JODA 4LIVA 5CEHA 1AL0G 3V64A 4CEWA 2E7QA 2VMCA 3W9AA 3AYEA 4AOCA 4N53C 4ZPIA 2FHRA 4IW3A 3NNLA 2EAKA 1OF4A 3KMHA 4CP0A 2RR12 1EV11 2VZSA 4H55A 4XFBA 1UYZA 3ZXJA 4DS0A 1W2NA 1ZM1A 2QQLA 2VUAA 4XJ8A 2GZWA 3WEZA 2V4VA 4AGGA 4IETA 2X05A 1CAWA 3C7HA 5L19A 2WNOA 1H30A 2QQUA 2ZACA 3K3OA 1VJ2A 5FXVA 1JMUB 1KS5A 4J6GA 2VMIA 4NHXA 1V6JA 1LEMA 4F7ZA 5DUVA 4DIQA 2ZA9A 3DL3A 2V4AA 5KXCA 4QMAA 3AP4A 1DQ2A 3I49A 1ALYA 3ZDSA 1QKQA 1DP0A 1F8VA 4YW6A 1RUE2 5DAQA 3TNPB 5AC91 3VD4A 1LJ7A 2W2IA 3CMGA 3FZ3A 4ONUA 4XZUG 2VOVA 3NV3A 1W6PB 1YC61 5BXXA 3C7OA 4P00B 2W1SA 4C1WA 4RHV3 4ZZ5A 1J3RA 3UJQA 5J7MA 1GANA 4M3CF 2J1VA 2ZABA 4WVMA 1Q5OA 3T4VA 5FMOL 4FAGA 1UWWA 4FFGA 4M3CE 2AGSA 1J1LA 1XYOA 4EN6B 3KB5A 1RUH1 1L7QA 4GULA 1V6KA 3DN7A 3WXPA 5ANNA 5EZWA 3JD73 2RS13 3SH3A 4IE7A 3FHAA 4XFAA 2HWF1 2VOTA 1GNYA 1PIV1 4CTEA 2H6BA 2ZGLA 2CGNA 4BISA 1R64A 2IXIA 2R063 3CJXA 3KGLA 3TEWA 1HRV3 2OZ6A 4OZOA 3PUAA 2HWB3 4CEWC 4YNIA 4O61A 2DCJA 1A6CA 1PO12 2GN3A 2EAAA 3KF5A 1KGYA 3O0WA 2A3YA 4NRPA 4TLGA 2JDPA 4JRAA 5H9PA 3THTA 4YG0A 1V9U3 1VALA 2D44A 1ZBE1 2X8KA 3B01A 4JKLA 3VDCA 4A7ZA 1AX0A 1RUD2 5EIYB 3R4UA 4ITCA 2Q30A 4A41A 2D93A 1XU1A 3VV1A 2GNDA 3ZN6A 2XJVA 4B3NA 1HXS1 5C5TA 5A7OA 2VNGA 3NRUA 5EHDA 5I0UA 3I8TA 2QQVA 4M0HA 4KGGA 4QX5A 1XNDA 1JZ7A 5C3QA 2BNOA 2YGMA 1COV2 4UOJA 2DVBA 3B93A 3UKVA 5DMYA 3VBSB 1D4VB 1MVQA 5F3EA 2IXCA 4DY5A 1AYM2 1FI2A 3MDPA 4OUEA 4AEJA 2F17A 2ZHLA 3DXTA 3RJRA 3K3NA 2EVXA 1OA3A 2D6KA 3HEIA 5F3CA 1FYUA 3MEPA 1Y7BA 4NHKA 3H1MA 1PGW2 3PMEA 5A1FA 5F1RA 2ZAHA 1PGSA 3O1RA 1BBT1 1GOHA 1LOCA 1Q56A 2VMDA 2ZX2A 2PHWA 2EIBA 3BIWE 2VVDA 3JU9A 4FOYA 5FMBA 5FZ0A 4AG4A 1AR62 3VN4A 1UZVA 1F15A 3VBFA 2XLAA 3GF6A 1D2QA 3ZX7A 1FT9A 3PVOA 3O12A 5FLIA 3ZSLA 4CDQA 2GC3A 4LO6B 3M4FA 1O8PA 4NHMA 2XJTA 1QU0A 3ZFEC 2CL2A 5F5AA 1W3XA 3ROUA 4MSVA 3BU0A 3WDTA 4BH9A 1CAWB 1VBE3 5FTTC 4Z92B 4Y3OA 4JC1A 4XJAA 3I3DA 1RUI1 3B94A 1AR73 3U78A 4QD2A 2ZGKA 2R32A 4MGYE 1L3JA 1SFPA 2GH2A 3ZFGC 1LOBA 1R081 5LASA 3I2OA 2Q4SA 1H2KA 1B09A 1ULCA 5A6ZA 4QQHA 5LEKA 4EROA 3AM2A 5SV8A 4Q5OA 3NQHA 2HKXA 4FPKA 1LOFA 1OURA 2UY9A 1D2SA 1GWLA 5JVVA 3RZGA 1V0AA 5FQ0A 3RJ2X 1OSGA 4Q4V3 5JIUA 1O59A 2A3WA 3GM8A 4IESA 2WLQA 5F39A 2E26A 2JDZA 3J8F3 4K40A 4Q26A 2YDEA 1UKGA 3N7MA 3UESA 2RS52 1IS4A 1WMXA 2WABA 3ZSMA 4LT5A 2VMGA 3A21A 4Q1RA 4F83A 4XOGA 5M0TA 4KH9A 1S0DA 2J1TA 2WT1A 5J36A 5ACA3 5F6LB 4RGAA 3RG0A 1FX5A 1DCSA 2ET1A 4LR4A 3ZYJB 1DGWA 1ZZ9A 4LPLA 1J83A 5FBJA 3K4AA 3BCWA 2D7FA 4LBMA 1JZ2A 4GWJA 3POSA 5DUUA 4RFRB 1UY1A 2WS93 4H7LA 3WUDA 5FREA 2YROA 2K9ZA 3IDEA 4QPIC 3LSEA 1LR5A 5K9YA 1N3OA 4MGZE 2UYBA 1GOFA 3J7MA 4TSVA 4ATEA 1TG7A 5T3NA 4TN7A 1EAH3 3NMBA 2PAMA 1B35A 5FP9A 5K0UC 4GJZA 3H7YA 3WD5A 4RA0A 4PIZA 5IW0A 4V1PA 1H6XA 5FPVA 2ETEA 1ODMA 2A1XA 2VH9A 4LJHA 5FRAA 2E7AA 4UFIA 5IVYA 3RWKX 3VKMA 4MHRA 4B1MA 4ES9A 3T2PA 3WX5A 5GZCA 5FMCA 4HKWA 4KQ7A 4NRQA 5FOJB 4IGPA 4IEUA 5E88A 2D3PA 4OI1A 2FDGA 2GAUA 4B4PA 5JR2A 3VBUC 1NCRB 2ID4A 3HBZA 5D8AA 5EJZB 1NLQA 4MGIE 3Q8CA 2R16A 5FXZA 5FP7A 1SCRA 4UAPA 3POFA 5FZIA 2AACA 2G9ZA 3WZ1A 1RUJ3 1W05A 4L11A 2ZBJA 1BBT2 1Z7S1 1GV9A 3TBDA 3W58A 4I3PA 3MIDA 1WWYA 4D3WA 5FZLA 3HPNA 2RHPA 4XF3A 2WN3A 3T2TA 4O65A 1E5HA 4DRVA 4Y1YA 1VAVA 3C7GA 1BYHA 3MW3A 1XE8A 4QPGB 5HI0A 1SBDA 4BQ5A 3D6EA 1AR81 1G9FA 1W03A 3SEEA 1W9YA 2FMDA 3EJKA 1NA1C 3SKVA 5IK5A 2W9XA 5L7OA 1VRH2 1F31A 1JYNA 3H9AA 2Y34A 1BVVA 2FMYA 5T50A 1G8WA 1A78A 5ABJB 3AMNA 3RZZA 4CXWA 3IDCB 5K7PA 1LGNA 5HXMA 2NN8A 2RS33 4X6RB 5KXDA 2PQSA 3AZZA 4LHLA 1PVXA 5C8CB 4NUBA 1VE0A 5AVAA 4ASKA 1U5ZA 5G04L 1CONA 4Q4Y3 2XLGA 2RMU3 1QQP3 4RD7A 2ZGOA 2QQWA 1YIPA 4AEDB 2B5HA 2C6SA 4QU1A 3FE5A 1LCLA 2TUNA 2X5IB 4MGKE 3AXEA 4KGQA 3CF6E 4Q4W1 2WLPA 1UMZA 3ON7A 3ZXEA 1X9TA 1LNSA 1UYYA 4FFIA 4QB1A 4UXAA 5BNNC 1E57A 2ZHNA 1TMF2 1U5IA 2P6CA 2XL9A 3KCCA 2H0BA 3DKWA 2XONA 4K1ZA 3N3HA 4OFGA 4C90A 3VBHA 5AFEA 1O4TA 1VLNA 4XCBA 2JD9A 4AEMA 1NZIA 1RXGA 4FQ4A 3GNEA 5FYZA 4LO7A 4NIDA 2VC9A 4LO8A 2EIDA 3D0SA 3RPQA 3VZOA 3ZXFA 2HBUA 2RM22 1STMA 3ZFEB 3KVBA 4AQ6A 4DFSA 3RZHA 5LA0A 4CSWA 2XWJB 3IT8A 4XILA 2WYFA 4MZUA 1D0GA 4LE3A 1YQ8A 4MX3A 3BTXA 1ZVFA 5FPLA 1LB2A 2VD7A 5FOBB 4FVVA 4CDXC 4MADA 4AI1A 4DUWA 3ACLA 1MS4A 1FMD2 3IAQA 3I3QA 2EIEA 5A7NA 4ZY9A 1CN1A 3J7HA 2JXAA 1LODA 1CESA 1PGW1 3FX3A 3HMYA 5A7WB 2WNUA 1XB9A 3FJSA 2GNTA 1LAJA 1VB2A 4G9SB 3VHPA 4MHUA 4AVVA 4OVEA 2UWBA 3WDWA 4EN8B 5F8PA 4NRMA 2ZEYA 4META 4S2DA 1EAH1 4HLTA 4R8HA 4AFAA 4PDWC 2YYOA 4XC9A 4FOVA 1W06A 1SDWA 4OULA 4OI2A 1RUE1 4AQ2A 3I3BA 3ZYGA 5DAPA 4XJZA 5A3TA 5HBAA 4ISQA 1XRUA 1D0HA 4CDXA 2RDRA 2DCYA 4XTMA 4R4XA 3GBGA 3S5AA 1AJOA 1XYPA 1H9WA 1SBEA 1IS5A 1UY2A 2QVSB 4UW3A 1SFNA 2E9QA 2VUJA 2DTYA 2WNUC 5C5UA 2R1BA 1CR7A 4PLOA 5D1IA 5I0TA 2FDFA 3T0DA 5FYVA 1DZTA 1WCQA 2CAVA 3T08A 3AJYA 2PMWB 3D3AA 4FXKB 4IEPA 2BYVE 3SC7X 1Y9GA 2ZGMA 3LZZA 1QJX1 2SLIA 5GKAC 3AVRA 3CIHA 2A7AA 4IE5A 4QGLA 2WZR2 4LEJA 5FP3A 5CA6A 2RS53 3RSJA 5A32A 5I0DA 1ZBA2 1W2TA 1AR92 1E5RA 3WNXA 3ZVXA 4FFFA 1R1ZA 4BQ3A 4DUXA 2IVJA 2PHLA 5FUNA 4AI2A 5IK7A 1V6MA 5JOYA 2VZPA 4YW4A 1AR71 1OC1A 5FY4A 1T2XA 5HV0A 1K3IA 1REDA 1ZBE2 5LA9A 4XJUA 4QGMA 1VBE1 1AR91 3LWCA 2WN2A 2IXHA 3H3LA 2E53A 4QKDA 1RINA 3DEMA 5JDBA 3RZKA 3WNPA 2BWCA 1DIWA 2IXLA 1M4WA 3ZFFB 5FYSA 4YW3A 3WCRA 3THPA 1AR72 1D7PM 4IL7A 5F5QA 1QJEA 2DVGA 2EIGA 3P6BA 4P9IA 3E5UA 2KD7A 1MPXA 1KFUL 1ZZ8A 4LHKA 3E1F1 5C8CC 4ZKTB 5CFCA 1WCDJ 3SH5A 3WW1A 1NLSA 3MUY1 2HYXA 1NA1A 4DOUA 1JZ6A 1R091 3ZKUA 3M3EA 2VQTA 2Q8DA 3J4UH 4GH4B 3ZSEA 2QQPA 4ZU7A 2VG9A 1TEIA 1OI6A 1VBA3 2XVLA 4P9YA 1PVC3 3FFZA 3KQ4B 2CDOA 3TWIA 2PAEA 4CP1A 4Y4RA 3NJXA 5ANQA 4K3UA 5C3RA 2QCSB 3ZR6A 3E5QA 1A34A 2ORXA 3OUJA 4BB3A 5FJHA 5FXXA 5L7OC 3WG4A 3ZXAC 1YEWA 5D8AC 1DFQA 1GLHA 2HYKA 3M3OA 2HEVF 4RS5C 5C9AC 1COV3 4XIOA 3W59A 1WMDA 2GC2A 1AL23 3DGTA 4CP9A 1GR3A 2VW2A 2VOKA 4W6YA 3I97A 1H0BA 2VBPA 3PJYA 4QX2A 3O5SA 5CG8A 2X10A 4LMFA 3AX4A 2ZHKA 1GBGA 2HWB1 2WZEA 1G7YA 3T0AA 5CFDB 2YU2A 3CJIA 2OXBA 2WNVA 3IMNA 1VPHA 2BVVA 2DBNA 5CKQA 3E6DA 2W47A 3MLKA 4AW7A 5H9RA 5I8YA 1YNAA 3AJZA 1Z7S3 2DF7A 4JHZA 3NV1A 5DG2A 3EMRA 4CYDA 3DPRC 3KCYA 4LK6A 1XSRA 3SMHA 1HRV2 4QX7A 3MPPG 4LLFA 4Q4Y2 3SITA 3EXUA 4ATFA 4YPJA 2RS51 2J42A 4IEVA 4PF1A 1GUIA 2ZZJA 4JGZB 1R1A2 4KU7A 3ZO0B 4H3WA 2XBO3 4Q27A 1SMVA 4O7XA 5L7OB 4NPMA 4Q8LA 4AWDA 2WYSA 1X50A 2OX0A 2ZX0A 4FFHA 3UGFA 1HIXA 5EP9A 5K0UA 2XVGA 3I2GA 4LORA 1CJPA 2XJRA 3ILRA 4D7SA 2EICA 4NHLA 1J3QA 4RHV2 4XUTA 3VUOA 3NJYA 2QUOA 1DF0A 3TRSB 1EUTA 4TLFA 1S0FA 4W6XA 2R042 1D4M1 2AEYA 2RM23 3U11A 4P9XA 3WT3A 2LALA 2Y6HA 3PTRB 4CVUA 2ZOEB 1S2KA 4Y1VA 2JD4A 4BZ4A 4NIAA 5LK5A 1ULFA 2D97A 4XIKA 4IEYA 2XR4A 3RFRA 4MG2A 4GJYA 5C4WA 2Q8EA 4FPHA 5BV6A 4H14A 2O8OA 2X29A 4BLJA 3Q9OA 3M70A 1R1A3 1ULGA 3E5XA 2XKPA 3AYDA 4XFHA 4PDWA 5IK8A 2A6ZA 1Z78A 5FYYA 4K7JA 4CDUB 1OQDA 5DDJ3 1XE7A 3UL2A 2QQKA 2XDVA 3WQ1A 4EN7B 3WP5A 4QQLA 5KC6A 4YW7A 5DAWA 4Y5SA 1OF3A 2KR2A 4N7UA 4C91A 1GOGA 2CY6A 4Q4V1 3OGRA 1W8NA 4XDOA 5CAZA 2FBEA 3OPWA 3POYA 1MZFA 2OUHA 2EXIA 5J48A 1DZRA 4DPNA 3PU3A 2DDUA 5I0RA 1Y3TA 1YFYA 5FZCA 1BEV1 1BHGA 2WZ8A 1WCUA 5CYYA 1KDMA 1C5HA 3AMPA 5EJ3A 1DZQA 3S7IA 3SQOA 1YUDA 5HCAA 3EO6A 1ENQA 2WS92 1JS9A 2PHFA 3ZFEA 2RG4A 3GALA 5FPXA 1UZ0A 5DAVA 4YM3A 3H8UA 2P2KA 2I45A 3JBG1 4XE9A 2ERFA 3O7OA 3PLQA 5L9BA 5DUXA 1I6XA 2P3KA 3FLRA 2VTXJ 2D6NA 1Q8OA 1W6PA 4QQPA 3AVSA 2IFWA 1DYPA 3USUA 2JX9A 1CX4A 1H1AA 3KV5A 4UW4A 4MYEA 1LTEA 1HQLA 4Z2AA 3VBSC 5DAXA 1BJQA 3VKFC 5FZEA 2PTMA 4U36A 2BERA 1KS4A 4FTBA 2VW1A 3C2UA 4E9KA 3KQRA 4FO9A 2IZWA 5T55A 2VZTA 5L73A 2RMU1 4UWDA 3NJZA 5A1AA 2C5DA 3LF7A 3VHRA 1BQPA 3UGGA 5J1XA 2HEWF 2W87A 3RZMA 4PI2A 5FIXA 2BUKA 4GD4A 4D7YA 4LXLA 1UOJA 1CQ9A 4XFFA 4W6WA 2WWJA 3WF0A 1R093 2EA7A 2YC2A 3T2QA 5KHHA 5F6KA 3AZXA 2P3YA 1V6NA 2O0OA 3RZLA 3BKZA 3LA7A 1DYKA 1H8TC 1VMFA 1A3KA 4E4ZA 1HDKA 3RYKA 1GKBA 4BDVB 1URXA 4QPWA 2RJKA 2LM3A 1K42A 2ZS6B 3VHOA 2BFUS 1HQNA 3RI9A 2W46A 3RNSA 2D6LX 4OUMA 2GC1A 3DXUA 3POIA 3DPRB 1W0PA 1W6QA 3B00A 4Z82A 2ZGRA 3O1MA 5IATA 3Q8AA 2YMZA 1PIV3 3AMHA 1YQ2A 1MEC2 4JX0A 4NPLA 5IJRA 1TE1B 1DQ1A 3BPZA 4GMP3 1O8SA 3PNAA 3DCQA 2XQXA 5L36A 1ND2A 1OKOA 3UNPA 4XF0A 4B8EA 3OEAA 1NG0A 3WW2A 3NAPA 4FPLA 2WNEA 2YBSA 3OJBA 4L92A 3NW4A 5FYTA 3DYMA 5LRSA 5CKNA 5JOXA 4HVOA 2WQ8A 4R9DA 2ZX4A 2ADDA 5F32A 2H0VA 4DXRA 4BQYA 1RUC3 1GP6A 3O1VA 2VW0A 5EPAA 2AUYA 3PUHA 4AGRA 3V0BB 3HNBM 4YZ3A 3GZEA 1W6OB 1OQ1A 1PHMA 3QOPA 1OLQA 1LGBA 1OLMA 2GP3A 3VBOC 3WLUA 2J22A 4N53A 5FZBA 3VBUA 1HB1A 2HWB2 4CEYA 4AL9A 5ERLA 3N9OA 1H1IA 1NCQA 4YM2A 1FPN2 1RGSA 3GJBA 1AF9A 4AHYA 2A6XA 2CDPA 2DURA 5CU1A 4YGEA 5J96B 5JZGC 4FPGA 4HT1T 5T52A 3LPGA 5K4LA 3THCA 1B35B 2FD8A 2D6OX 2XPJA 4Q0SA 1OA4A 2J7MA 1OUSA 3KSCA 2OUJA 2LTNA 4YZ4A 1PMIA 1ZBA1 4AAXA 1TZOA 1UMHA 5IK4A 1GQPA 5IFTA 4ARYA 1W0NA 4HOOA 3I3MA 3MIGA 2O14A 2XUEA 3USUB 2OQ6A 3POJA 2XVKA 2WIIB 4NVPA 2GDFA 3GZTB 2VZVA 2ZMKA 4Q1PA 5JI9A 4DY3A 5JUVA 2ARXA 1JBCA 4HPKB 2V5YA 4ES8A 4AVAA 4EWDA 2EXJA 1WA6X 3POGA 3OBRA 2F6BA 1OH4A 1R083 3HT2A 4IV1C 4NJ4A 2NMNA 4PIYA 5HXVA 5LEJA 1NZCA 1WGPA 2QQJA 5FYUA 4M3CB 4WZCA 5F37A 1G9BA 3F95A 3VKLA 3UT0A 3ETQA 4FAHA 2HH9A 4WVWA 1H2MA 4C0HA 4QPGC 4XMIA 1NXMA 5LA1A 1ZREA 1QDOA 1GICA 3ZXKA 1V9U2 5EXOA 3MIHA 3LIHA 1HV0A 2FDJA 4Q0QA 5F5CA 3W20A 2UWCA 1AXKA 2IFRA 1RHI1 3OF1A 1PO13 4HVRA 3IDAA 1E5SA 2XL7A 4JGZC 1UF2C 5FZGA 4AVTA 1W90A 3WDXA 1EPWA 4CEYB 3H42B 1PK6A 1U0AA 2XHNA 5A7QA 2RR13 4WM7A 1QXPA 2F4PA 4XPVA 4R4ZA 3ZFGA 3FLPA 2D6MA 5IVCA 1W3VA 1ZA4A 1QHDA 3VDDC 3QH6A 4DRRA 3JB4C 3JD72 4HETA 4QXCA 4HL0A 5FFOC 3FBMA 4HN1A 3FFQA 4GB32 4HANA 1N1VA 4XQDA 2AYHA 4XABA 4IV1B 2Q8OA 3ZOIA 1XQNA 4EZHA 1JXNA 3E6CC 5FCCA 3MO4A 3LFMA 2QBXA 2XHKA 4QPGA 3FWEA 1JOBA 4UYBA 3USSA 2QFEA 5KWRA 4BOWA 3PIJA 1S0JA 2OA2A 2DWRA 1C3HA 1GQGA 1NY71 1J3PA 5FZ9A 4BQWA 3BU7A 3LOIA 2V73A 5IVBA 3H50A 5JOWA 1XNCA 3W5MA 4UFLA 1PX3A 1TME2 5T5PA 4IE0A 4GWMA 4Y26A 1F5JA 1ZA7A 4N53B 4AXOA 3AMQA 4L99A 1RUJ2 1XOYA 3GJAA 3R0RA 5FZDA 5KHJA 1W6QB 5KR7A 4LE4A 4P08A 5T5OA 2HWC2 3MI8A 3H0OA 1HRV1 2ZGPA 3NNJA 4N8MA 5FZ4A 2R061 1GMMA 1W9WA 3ZYPA 3H8OA 4P9WA 1V70A 1X8EA 4OZXA 4GKXA 2N7GA 2Y0IA 5FZOB 3V0AA 5KC5A 2HWD2 2HWF3 2W1WA 4CDWC 1RUJ1 1GU3A 2E63A 2MNGA 1ZRIA 5FY5A 4DINB 1UQXA 1BK1A 4ASMB 1C1LA 4UW6A 2X5IA 2VCCA 4W4ZA 1OLME 1UOBA 4M4PA 1PO21 2VOWA 4QDRA 4AAPA 1ZZ7A 4LBQD 3AP9A 2HWF2 1XXNA 2YBPA 3VB9A 5C3PA 1DQ0A 5A3NA 3VBHB 4CU6A 4UBGA 4XQ4A 1RB8G 1UU5A 1H1MA 4JGYC 1LU2A 4YARA 4W65A 5A3MA 1J59A 5FZKA 3VBOB 5A3UA 1ST8A 2DU1A 1ULDA 2QQNA 5EV7A 2VQAA 2ENRA 5AC93 1LENA 4Y5TA 1JOJA 2ZAAA 5T54A 2CAUA 1FOD2 1TME3 2CU5A 4QPYA 2Y64A 1LHOA 4N9IA 4DB5A 1NCQB 1H4GA 4M4RA 4XHXA 2JE7A 5I91A 2E31A 4UFHA 5IFPA 5ACA2 1JZ3A 3S0MA 2UWAA 5FZAA 5ABJC 2VVEA 4GH4A 3RI8A 1UXZA 4CPBA 2P3IA 4CDWB 1J84A 1K5JA 2YHJA 4KI5M 2W0XA 1WZXA 2JB8A 4LBQB 4C0BA 3KLSA 1XC6A 5LW9A 3LEIA 1FATA 1MZ6A 4CDQB 5ACA1 4X6QB 4I0AA 3WCSA 1GWMA 4CPBD 1VBC2 3BVCA 2WAAA 5A7WA 4A7YA 4D94A 5LWBA 5I8SA 2GP5A 2ARAA 2YUEA 1O4YA 1QJZA 3IN9A 2A75A 4JTOA 4KG8A 3QH7A 5FZ7A 1NUKA 4QB6A 4A6SA 3MLLA 1S0CA 2GC0A 4AFMA 4FPFA 1VBB2 2CV6A 4UFKA 1ZNPA 5CBLA 5A80A 2Z69A 3CEWA 4IV3A 1QWRA 1H8TA 2PQQA 4XUPA 3ILFA 2FZ2A 2PFWA 1SCSA 2IXKA 5KBFA 1I5PA 2Y33A 1DGWX 4LBOA 1LRHA 1Q8VA 4MXVA 3WY6A 3HAGA 2QDRA 1VBB1 4RYDA 3IDBB 4XQWA 5FPUA 5F3IA 4OHZA 2Q1ZB 1O6UA 5DG1A 4YRDA 4ARXA 1AX2A 4RN5A 1MS1A 3B9IA 3L2YA 3VL8A 3Q8FA 3LD8A 3B02A 1GP5A 3WSOA 1KDKA 4OHXA 1HRI3 1O7FA 1UO9A 2C24A 2EF6A 2HWC1 4WZFA 1KD7A 4R9CA 5LA2A 1IQAA 3K4DA 3U14A 5BNNA 3M1HA 2E51A 4XBNA 4Z07A 5B4NA 3KCXA 1AYM3 1QJY2 1MR5A 2VGDA 3MW4A 3OY8B 3S7EA 5HCHA 1QY4A 1H4HA 5HV4A 2VMFA 4ZS3A 3ASIA 4QU2A 2W52A 4CCNA 1FNYA 2XUMA 4K9SA 1ZZCA 1OVPA 4Q29A 3OPZA 3T09A 3WVJA 2Y8KA 1ENRA 1YIFA 4Y24A 1NE6A 4QAWA 5D2AA 1N3PA 1QJU3 4YGDA 3KF3A 3P3NA 3TB0A 1Q8SA 3T30A 3AKRA 5F2SA 5LBBA 4LNVA 5D8AB 2B8MA 1S0IA 1BKZA 3WG2A 2VBBA 1RUNA 2VZRA 1NLRA 4NPRA 4PIXA 2AREA 5LZ6A 2QZ2A 2WBKA 5FYBA 1OVSA 4XURA 3ACFA 1VBB3 4NWVA 5JSPA 2W1UA 3PMSA 4AFDA 5FP4A 5CG9A 3H1WA 4JKKA 1J1TA 1BEV3 2BBVA 1MQTB 3NO8A 2KA3A 1W9SA 3J7NA 1OQEA 4LA3A 4IE4A 1YFUA 2RS12 3TYJA 5BY5A 1POQA 4Y1XA 4E27A 4LOSA 1LGCA 1BMV1 3N7LA 1EY2A 4A6OA 3UJOA 1C5IA 4RQPC 3H3UA 3CDZB 5KXEA 4UF0A 2WR9A 4LBLA 1QJFA 3ZM8A 1HRI1 1YHFA 5EWSA 1CD3G 4DXZA 1QJY3 2PLV2 2BQPA 2VCAA 3HR9A 4OYUA 1W2UA 1AZDA 3GZUC 1WMFA 1RUH3 4PCRA 4YVSC 4BQ4A 5AVPA 5C4WC 4BA6A 2Q0AA 1CZTA 2HWE1 2YFZA 1G9AA 1RVF3 1TVGA 3N9PA 1N3QA 1U5YA 1HRI2 3I54A 3I2IA 5DXDA 3NVCA 4AHWA 5IHRA 4XETA 3O14A 5K0UB 5AC92 4PHZA 2JG9C 2R071 1NAEA 5FPBA 1PZ9A 1UCXA 1F2NA 3ZFFC 1FPN1 1LOGA 1OT5A 2YPDA 4PBPA 4YG3A 2DCTA 4LHNA 3LKJA 1XJAA 3CZUA 4MUVA 5GALA 4DXTA 1BZWA 1VRH1 1WD4A 3BALA 4K1YA 1WW5A 4F8AA 4Q0UA 3OYWB 3ZYRA 4COWA 2AZ5A 2XBO1 3I4IA 5JZGA 1JYIA 1F5FA 1IKPA 1M06G 1W6NB 4WM8A 3H8RA 1AX1A 1RC6A 5DPNA 1IGOA 4FP3A 1RYYA 3HD8B 1ZRCA 4XZPA 4QM8A 1HB3A 2HEYF 3SCGA 4BU2A 4HONA 4XXAA 1VBC3 2G19A 1RUG2 3IKWA 2IWGB 2WINB 5FZ8A 4RS5B 3WDVA 1C1FA 3CJIC 1WBLA 2BZDA 4P9LA 1Z0HA 4B7KA 1W8OA 1CJDA 1QH7A 4IGOA 3IWZA 4D6RA 5JWPA 1GZ9A 1CAXB 4BYYA 2Y26A 4QKBA 4BQ1A 1YCIA 1XSQA 3IBMA 2JKBA 3AMMA 3A7QA 3N7KA 4XMAA 3X29B 3U37A 3VZLA 1FNZA 1NX9A 3TN93 5C9AA 1DDLA 5FO8B 2FCUA 3WV6A 3JUUA 5C70A 5DN2A 1ND2C 3CO2A 4P14A 1LECA 1AL21 1UD1A 3FLTA 2NLRA 5I0SA 1RUOA 5BUVA 2DCKA 5LK7B 2W92A 3MIBA 2UURA 3IMMA 4E2SA 1BVP1 4K20A 3IPVB 3HOBA 4L0PA 3POBA 2WSVA 1DU3D 4CCCA 2R1DA 1SBFA 4URTA 3MZHA 4AVBA 3VBFB 3C7FA 5GJ6A 3MGUA 5A3LA 5DZFA 3MIEA 1MS9A 3I59A 2D5HA 4UBHA 4BLIA 4LKEA 5LY2A 4A45A 4CZSA 5JSOA 3CJIB 4DXSA 5F9TA 2RDQA 3HT1A 3ZYFA 3W5NA 4HK8A 1W6OA 1EV12 3ZSJA 1JUIA 3M8LA 1RMU3 2PLV1 5DZEA 1UL9A 1VBD1 2PAKA 3RVHA 2FDKA 4LO5B 5A6YA 2YPJA 4S2GA 1JZ5A 5IT6A 5H9QA 3AL5A 3B69A 3H7JA 1CIYA 2I07B 2ZGNA 3G6JB 1Q3EA 3L2HA 4GIQA 3A0NA 4BHPA 5GLZA 1K5MB 4JDOA 4GAZA 4IEZA 4Q4X3 2GNBA 4R52A 4PT6A 4TXWA 3LOBA 1RIRA 2VO5A 3LA2A 5FYMA 3S57A 2ZEZA 3OD4A 4RGKA 3ILNA 2JDHA 2DVAA 1PNGA 2R043 3OGGA 3WP3A 3ZYIB 4QXHA 4BMEA 3TNQA 1LESA 5FBZA 1RUH2 4B4RA 5GLVA 1VBD3 2LUWA 2W1QA 2BOJA 4GZ9A 3WF1A 4EN0A 3VBSA 4BXSV 1YQ6A 1HB2A 1XPWA 3C8XA 1BMV2 4CRQA 3RGBA 1KQRA 2BTVC 1REFA 3MHZA 4LUMA 2V72A 4QX1A 4YSFA 3C3VA 1DLCA 2JICA 2XBO2 5FK8A 1F35A 3OPTA 1QJX2 2OW4A 5FUIA 2Y38A 4ZU4A 1RHI3 1S55A 1SLIA 1YQ5A 2ZMNA 2WO3A 2GNMA 5C9AB 4Q4W2 5C8WA 4YW1A 1N1TA 1RUD1 2ZGTA 2ZX1A 4CA9A 1UY4A 4EQVA 3AP7A 2C26A 3IM0A 2ADEA 3R6SA 1YJKA 1QXRA 3DV8A 2W5FA 2ZGUA 4IERA 3TN91 3OUHA 1UKRA 4XCAA 5F3GA 3N7JA 1RL3A 1RUC2 3GHNA 3V0AB 3OGJA 3HIFA 2PHDA 5KHGA 5FLJA 1QJU2 1ZZBA 1SG3A 1HN1A 5ABJA 4YFZA 4A42A 4MLOA 2O8QA 3AK0A 3OG2A 4FQZA 3ZFGB 5C3SA 2NM1A 1W6MB 4YZ2A 4AK3A 4JV4A 1RUC1 3WG1A 3ECQA 3GDBA 5JZGB 3UKTA 4PF5A 1VBC1 2R6QA 1FMD1 3RMYA 3ZPYA 3HN1A 1QOOA 1MEC3 1F9KA 1AYN2 5EQUA 1W8WA 2DTWA 4TYSA 2SBAA 4WBBA 3KZ4C 1PVC2 4AEDA 3VD3A 1H2NA 1WW7A 2AENA 3GBWA 4CCOA 4URAA 3M3QA 4I2OA 1KJLA 3AKPA 2P3JA 4Y22B 2YU1A 4WVVA 3NNGA 5A3WA 4WM8C 3TOJA 1G9DA 3APBA 2Z2SB 4O9EA 4QHZA 3PURA 2VZOA 4JQRA 5BNPA 1UIJA 1W2AX 2RVAA 5FY1A 2IC1A 4R9AA 3O1OA 3HQUA 2JG8C 3BPSA 2IUWA 3E97A 1IG0A 4LTAA 1L7LA 2VVFA 3BODA 1DG6A 1QEXA 3UETA 1IZ3A 4KWLA 2CWSA 1US2A 3LAGA 4I01A 4LLOA 4N43C 4V2VA 4XYXA 4B1LA 2RV9A 2YBKA 2MEV2 5BNOC 3FUQA 1QOTA 3R4DB 2BGCA 3EBRA 4BMBA 3WP6A 4B4QA 2VZQA 1SACA 4FPEA 1CAUA 1CIWA 3CL1A 3D82A 5C3OA 1DQ4A 4N9HA 5LATA 5FK7A 1DGRN 3CHXA 1W8FA 1XNTA 5FP8A 1QJY1 2VTXA 2G9GA 5C4WB 3KM5A 3OB8A 5GLUA 2BNNA 4YVSA 2MHFA 2NPIA 4Y1UA 1CZVA 4FOWA 4Q4Y1 4GA9A 1NCRA 3T1LA 1W8HA 2OVUA 4LHSA 2C4XA 2OPKA 4KL1A 5A6QA 2WZR3 4CCEA 1QNWA 2VR4A 4AF9A 4QQ2A 5L9RA 1UYPA 3HBKA 4TTGA 3VZMA 2BJSA 2BGPA 3HQXA 1GSLA 4GKYA 4PLNA 1PIV2 3ORJA 1BK0A 3OBAA 5FKCA 4L97A 4NROA 1TQ5A 3VBRA 1SLLA 1LOAA 4CU9A 2A5ZA 2Q1FA 3AFGA 4FT8A 4QX8A 4YWAA 2ES3A 2XLFA 4ASLA 2A71A 1RXFA 4KBZA 1OKQA 1W8ZA 3V56A 3KT1A 4CXXA 4QKNA 3MBWA 1D4M2 3FHQA 3BOWA 5I8TA 1QH6A 1O5UA 2B45X 3C7EA 4AEKA 3WUCA 4AZZA 3ENRA 1UU6A 1V6LA 1QJU1 2LS6A 2OPWA 5BYNA 3PU8A 4NIHA 1JU3A 1U5XA 5E1RA 1WLDA 2Q5TA 3VLBB 5C8CA 3VD9A 2W95A 1HLCA 1NOVA 4FP2A 2JDKA 5C33A 4J1XA 1V00A 3SNMA 2HWD3 4KMQA 3OGVA 4NN0A 1JZ4A 4XFIA 4IV1A 2E7TA 2XH6A 4BJ0A 2OYZA 2Z5WA 3WNKA 4UF0B 3SHRA 2HWC3 4PQ9A 2CNAA 4QT6A 1IKQA 2TNFA 4PI0A 1YI7A 5A7SA 1AR82 4X8NA 2XJQA 4ORFA 1OPOA 3EYPA 4A3XA 4E2QA 1YYNA 2VCBA 1AR61 2PA7A 3HJRA 5FQ0B 3S30A 3CU7A 4A2UA 5BNNB 1MS0A 2GH8A 4S2HA 2VXRA 1AJKA 3G7DA 4LUKA 2RDNA 3AZYA 2P17A 2ZGQA 3ZXDA 5FY7A 4D8MA 4Y1ZA 2QQMA 3D4KA 4QQOA 5IWFA 4QPIB 5J3UA 4JGYB 5FLHA 2P6HA 2YZ4A 4FPCA 1ND3B 4K6BA 4JKMA 3KS7A 3LIGA 4RSUA 2EALA 3ZSKA 2WS91 2C9KA 1S1AA 1OD3A 3LGRA 3L9JT 4YM1A 1A8MA 1KEXA 1UOFA 4BPZA 3AFKA 2ZGSA 4GB33 4OCTA 1C8M3 1LKNA 1N47A 2MEV1 1TMF3 2IVIB 3AKTA 3FBYA 5FO9B 4LKSA 1CAUB 2B9UA 3ES1A 3ZLIA 4BCUA 1AXYA 3K48A 4CEYC 3VBOA 5J37A 1MZEA 2GU9A 1JUHA 3FUOA 2E32A 3J8F1 4PJYA 1RUG1 2XKOA 4HBNA 4UFMA 3VDDB 4P02B 3NNFA 4NE9A 3UGHA 5FAXA 4CU8A 3MLJA 3H3ZA 3UYJA 3ELNA 4J1WA 5DDJ2 4IQPA 5JXHA 2QZ3A 4CDUC 3MYXA 1UYXA 3HWJA 3ZIWA 4MGTA 4PLMA 1X33A 5DUWA 1CX1A 1JI6A 1APNA 1RITA 3GCXA 2GALA 1ND3C 5JI7A 1BCXA 5D21A 1KITA 3LEKA 2DU0A 1S2EA 1GNHA 1OH3A 1AL22 5FZ6A 3LB9A 4YVWC 4BK5A 2ZMLA 3U1XA 1MVEA 2WO1A 1QMJA 2GMPA 2VY0A 1GWKA 3SCHA 3F2ZA 3PL0A 5APAA 3T1MA 4ZS2A 1K5MC 5JMCA 2WRAA 4E4HA 1JN2P 2A6YA 1COV1 3CLPA 4JGYA 1IOAA 4AI0A 1EYBA 2KXLA 2ZZQA 3LDRA 3ZXLA 2G1MA 1BBT3 2EXKA 3N9MA 1ODNA 2IXJA 2E6VA 1CAVA 1WCKA 3WNOA 1JZ8A 1REEA 2Q1MA 4I0WB 4HXCA 1ASJ3 3EQEA 5FYHA 5FMOS 2X5IC 4YW5A 1PVC1 5C7GA 1FV3A 5FZMA 4ZHNA 2BFUL 3VBHC 1GZTA 5AFBA 2D3SA 3OY8A 3POWA 5G05L 4OI4A 1UZWA 3OOXA 4QB2A 4IDZA 1A8DA 2DUQA 1CWPA 1OFNA 4HK9A 2XGXA 1T6BX 1HXS3 1Z7S2 3AP6A 4ISRA 3MW2A 4KBBA 2C0ZA 3QLQA 4UFJA 4NAOA 3M3IA 1ZBE3 2ZX3A 3VL9A 4DQAA 4AI9A 2BNMA 2CWMA 3IPVA 5FKBA 2BPA2 3RZJA 3EHKA 3NKTA 4LBNA 4MOAA 1K5MA 3ACIA 2NZ9A 1CAVB 2FCTA 1XE0A 1AR93 1YRZA 3ZMOA 5GZFA 4NR1A 2W94A 3PVNA 4XACA 3VKNA 3WQ0A 1PGL1 5DABA 4BE3A 3LDKA 4QDQA 3U75A 2JDYA 1NQDA 5CVRA 4CP9B 1ZZ6A 1GZCA 3WW3A 3URFA 3MFAA 3PVEA 3I2FA 4XVHA 2BRTA 5IVFA 1O3TA 4XXPA 2JG8B 1VBA2 3TEZA 2WAOA 3VDDA 1OPMA 3J8F2 4IEWA 4LO4B 1UN1A 2JIGA 2JWPA 1XU2A 2TBVA 2VM9A 3JXSA 1S0EA 4HSLA 4AQSA 3JCIA 1AVBA 4EJRA 4RHV1 3ATGA 2JJ6A 4CCDA 3N9LA 3KGZA 3H1YA 3HVDA 4JGZA 3O1TA 4W50A 4BK4A 3S5QA 3JQWA 5BNOB 5C6CA 1J58A 2JG9B 3LFIA 4ZU5A 1K12A 5GLWA 1HXS2 1NE4A 1PK6B 3GGLA 3CKHA 3RWNA 4ZZ8A 4YG6A 5JXIA 5C71A 2OKXA 1UNBA 5JPMB 1MQTA 2WNUB 4LBJA 4XDPA 1Q43A 1R092 2Y6FA 1SPPB 1VBE2 4CDUA 1S0GA 2WWSA 3IIIA 2CHHA 4GALA 2VMHA 3GYDA 2BV4A 3VZNA 1CVNA 3I3EA 4KNCA 4OHVA 3RQ0A 4H2AA 3B7MA 3PHMA 5CZKA 3MF9A 2HBTA 2JDUA 1ULOA 4OLLA 2BBAA 1ASJ2 4WM7B 1FMD3 1CPNA 4EWAA 2X53S 4M3CA 1VRBA 3WHTA 4M01A 2VOXA 5FPAA 1FAYA 4I09A 2MPFA 1ZBA3 4TWTA 2J1RA 3THDA 1Y9MA 5A70A 1F4HA 3PUQA 2XJSA 5FY8A 2VL4A 1UOGA 4IUGA 3AXDA 2P5BA 3HNYM 2UU8A 3DUIA 2PYTA 4GXLA 1YLLA 1OMIA 4X8PA 3OYWA 1H9PA 1HN0A 3ACGA 3GCWA 1W99A 5FZOA 5FPZA 4BXFA 4XUQA 4N7IA 3GBFA 1NCQC 2ZKNA 1IPJA 3MV11 1Q8QA 1RTVA 3KV4A 1MQTC 3ZPOA 2A73B 4E4SA 3O1PA 2YY1A 4FPJA 1RUD3 3VHNA 3VKOA 1O91A 3DPRA 2J1AA 3POEA 3CBNA 2I74A 4SBVA 2J1SA 5H9SA 4CDXB 2BP6A 2VU9A 3NWKA 1LOFC 4EV0A 2WT2A 1UMIA 4MH0E 4EZ4A 3OCPA 1XNKA 2RMU2 3I2KA 1US3A 4Q4W3 5LBCA 4LITA 4W8JA 1ENXA 2NMOA 2G4IA 5A7PA 4CCJA 3VZJA 2HWD1 4XHBA 3OEBA 1PZ7A 3SKJE 1LU1A 3NAPC 3JZVA 3RDIA 3LEGA 3ZYHA 4GMP1 4RS5A 4KWJA 5F7UA 3QACA 4JZRA 3ZYBA 1W9TA 3VDAA 5KHKA 2P1BA 2D98A 1JYVA 1QIQA 4YVSB 1DQ5A 1YXWA 3FN9A 3SEPA 1L7RA 2QDNA 3LPFA 1JYCA 2R041 2DVDA 1NQJA 2A6WA 2VNVA 3RRDA 1HW5A 5FYIA 1X7NA 1IPKA 2CGPA 1NA1B 3J26N 3ABZA 3AZVA 1LHVA 2QNKA 1UPSA 2ZKLA 3PUIA 3WP4A 4ZONA 4LBKA 1FV2A 2H6CA 4K8FA 1ZRDA 4LQRA 2XB6C 4UI9L 1O3QA 4RFT0 4XAEA 2VQ0A 3WF2A 4FOQA 3WNNA 3BTZA 2WNVB 1AR83 5CFCC 1JYWA 2DUPA 4CCLA 1YFXA 4FPYA 1UPIA 1GQHA 4IEXA 4IE6A 4LKDA 4A44A 4DNYA 5BNOA 3NSTA 4JCKA 4OUSA 1QQP1 1X82A 2WSUA 3BTYA 1C8NA 4LK7A 4N90A 3VD7A 5GZGA 4Q2FA 4FBFA 4B7EA 2K46A 4JAAA 4K8RB 1ASJ1 3ZN5A 5DZGA 2RS31 4ZXKA 2JG8A 5FO7B 4QX0A 3P5BA 5A32B 1YQCA 3SCFA 2VAUA 3DYPA 3KHBA 3A0KA 3I2DA 4XBQA 2BGOA 1JTZX 2WO2A 2PHRA 2RDSA 2AEZA 4YW2A 2AR6A 4AHXA 4BWOA 5LB6A 4EYUA 4N43A 1EAH2 3FC0A 2UY8A 4AFCA 2WQ4A 3DKQA 4AEDC 2QJVA 1DGRA 2GN7A 5T5JA 1RUF1 2JDAA 4XDQA 3VBRB 1DHKB 1C8M2 1H8TB 4LIUA 3BIEA 3ZIXA 4B29A 2K2SA 3R4SA 3T2OA 4OI0A 5JPNB 1NXD1 4AFBA 4OQ9A 3WW4A 1XNAA 1ND2B 3TEXA 3U07A 5BNPC 1QDCA 1UX6A 2YV8A 1BLZA 3PVBB 1X36A 4COVA 2A70A 4AVCA 5JMOA 5CISA 4I3GA 3CZJA 2RJ2A 4L8QA 1PGL2 4YGBA 1PM7A 2BEOA 4C8DA 4OHYA 4P9JA 2ZHMA 2L9LA 3O0VA 2VUCA 4P5HA 4CUAA 2VULA 1PX4A 1RUG3 4FTEA 1IG3A 5FWJA 3KT7A 2XXZA 2WFPA 1TNFA 2VTFA 4UT5A 4MO3M 5DDJ1 2B39A 3LA3A 2CYFA 4OMDA 2JKXA 4QM9A 4YVWA 3LDBA 4CE8A 2V5DA 4H7MA 3WOGA 5JSRA 1UIKA 2YFUA 2ZEWA 4XFGA 5FXWA 1R1A1 2J1EA 1ND3A 1RJ7A 1TMF1 2MEV3 5FR3A 2ARCA 3TEYA 4YZ5A 1VMJA 2A6VA 4RGGA 3QCWA 1KRIA 2WJSA 1LULA 2VPVA 3K46A 5JLVA 1LEDA 3VZKA 5KXBA 3AZWA 4MGSA 1F4AA 4UW5A 4LKFA 4MVTA 4Z8BA 3O1SA 1S0BA 4GQ7A 4RL7A 5BNPB 4XFCA 1OLRA 1MS3A 1WA4A 1D4M3 2QQOA 2RM21 3EB7A 4OQ8A 3ZN4A 5IVVA 2WO7A 1XNBA 2VMEA 4GWIA 1UXXX 4HFSA 3OTFA 2W68A 3PJQA 4N43B 2W39A 4PDWB 4QX3A 3WHUA 4P5YA 2WZPP 3K75B 4K21A 4D6SA 5IVJA 3I2HA 2RE9A 1AR63 1NKGA 3WDUA 1O4ZA 5DQ0A 1KFXL 1AXZA 1GZWA 2NQYA 3P3PA 1P8JA 4I30A 5KHIA 2VE1A 2B46X 4XW3A 5IUQA 4FTSA 2PELA 2VJXA 3SH4A 4QKFA 2VNOA 5E16A 1TNRA 3ES4A 4A4AA 4MXWB 4RR3B 1Q8PA 4KG0A 4DMIA 2PHUA 2VQUA 4MGQA 5F5IA 4DEVA 1Y9QA 4E8CA 1OHFA 2WKKA 3T0BA 4Y20B 2R7EB 1YWKA 4OHWA 4KU8A 3LEMA 1I5ZA 2AC1A 3OSDA 5GLTA 3KVAA 4IEQA 1GYKA 2HWE2 2QE3A 3WQBA 5L9VA 4CCMA 2Y0OA 3KT4A 4Q4X1 5E8AA 2XMLA 5FY0A 2WNVC 5CFCB 1OFSA 2DCZA 2R072 3SISA 1UY3A 1HB4A 2Y6JA 1Y43B 4BQXA 1OUXA 1WUVA 2R062 3MF6A 3U4SA 2D43A 1WLTA 2D6PA 4IXLA 3U0ZA 1RMU1 2P4EA 4BIOA 2GSYA 2XJPA 5B4XA 3N36A 5GM0A 4FSJA 2WZR1 1UY0A 4XBLA 1H6YA 2LROA 4V2WA 4AE2A 1VBA1 3LSDA 1W2OA 1SHWB 2D40A 1WBFA 4Q0VA 5BPXA 1NCRC 3MPBA 1BXHA 1NYWA 2ATFA 3OGSA 2XWBB 1W9FA 4HMZA 2OQ7A 5EYYA 4BQ2A 4A3ZA 4BIFA 3P1IA 5JAXA 3N4MA 2PXJA 2VECA 3VBRC 3AL6A 2ET7A 1CAXA 3N35A 4XF4A 1OOPC 2Z79A 5F2WA 2A3XA 1V9U1 3WG3A 5FYCA 2QTWB 1C57A 3KHCA 4XTPA 5HCBA 1FXZA 3CQOA 4COYA 5EFUA 2VXJA 4Y20A 2VZUA 4COUA 3D5OA 1O5LA 2WFF1 5E89A 3I7DA 1QGLA 2ZPXA 2CGOA 1AUYA 3IAPA 1SPPA 2ARBA 4CUGA 2YG0A 3BB6A 1PMHX 1VAMA 1B35C 1DBNA 3ETPA 2JE8A 2RS11 2V09A 2WDBA 3JD71 4QWNA 5JOZA 4QGNA 1QQP2 4L2NA 2HJIA
chains in the Genus database with same CATH topology
2JE9A 4HPKA 4NWWA 4E4DX 2DFCA 1MEC1 3RS6A 2VNRA 5CIRA 2WT0A 1QF3A 4FPOB 1MACA 2RS32 1QJX3 3MFCA 4XF1A 1SEFA 3MIFA 5GZEA 3WQ7A 2DFBA 1H2LA 1XYNA 3AP5A 3NL1A 1ENSA 1YI9A 4Z2WA 1VRH3 5EYXA 1TME1 3ZFFA 3AKSA 1QOSA 4HKLA 1VBD2 3E6BA 4YZ1A 2YC0A 1C8M1 2P37A 2WFF3 2JG9A 1PNFA 4GB31 1IHMA 1SLCA 1UW8A 2C1FA 1WW6A 2BW8A 1OOPA 1O3SA 1DGLA 3JBG2 4Z1VA 1POV3 3UV9A 2C9AA 1RUE3 1VP6A 4CP2A 1W0OA 2YGLA 3RYRA 1G9CA 2NYYA 1O3RA 2R0FA 3GZAA 1I3HA 1RVF1 1PO23 1RJ8A 5BNQA 5JR7B 1SLBA 1WCSA 3AB0A 2BVBA 1LHUA 1RMU2 5I93A 1VIWB 4AHZA 5J98B 1EV13 4HN0A 1GNZA 2ZTNA 3FHIB 3QD6A 4R9BA 3D8CA 4CDQC 2B42B 1LHNA 2AH2A 3ZMNA 1G86A 3ZFEB 3I59B 1DQ6A 1UAIA 2K0GA 3UKNA 1ONAA 4JRLA 4SLIA 1FOD1 4YLZA 3NV2A 2JECA 1PO22 4JDMA 5A33B 4IV3B 2W08A 4HVQA 5HCFA 3JB8A 1AHSA 4C1XA 2PHXA 4FXGB 4A7KA 4COZA 1MZ5A 4YYOA 3QBQA 4I02A 1LOEA 1SLAA 4EN9B 1G6NA 1WD3A 1I9RA 3B3QE 4XF9A 4EWEA 2Z42A 2PLV3 1CGPA 5JIAA 2RJLA 3BTAA 5TSWA 5K8SA 2I2SA 2DUOA 4AI8A 2RR11 2WL1A 3WR0A 3M3CA 1WLCA 4Q4V2 1AYM1 2DV9A 3K51A 3ME2A 3OD0A 1ZYBA 4Y22A 4P9GA 1OOPB 1T6GC 4JVAA 3UK9A 1BEV2 4AYUA 1RUF2 3RYPA 4YFWA 1I1EA 1U12A 4PBOA 4I0BA 2BWAA 4WVZA 1JH5A 3BOPA 4IV3C 2R30A 1JW6A 1HKDA 2OZJA 4AQTA 3LCPA 4HKOA 4YVWB 2EXHA 2PHTA 2WC2A 4Y5Z0 1VB4A 1VR3A 3GHMA 1RUI2 1V6OA 4M00A 3WINE 1N1YA 5A33A 3SXWA 3IIAA 2O1QA 1R082 4LBQA 1HV1A 4GWNA 1AYN3 3TAYA 1RVF2 4GMP0 1EP0A 3AYAA 1GFF2 1WLWA 1W6MA 1EPZA 4O9GA 5GZDA 3B9CA 3O0XA 4GH4C 1S2BA 1C28A 3ALQA 2G9FA 1N1SA 5J09A 4TZDA 2D5FA 2CTVA 4IEOA 4AGVA 3SLIA 1ZX5A 1OD5A 1POV0 2GMEA 3INAA 4WV8A 4G3YC 4E2GA 5CNAA 4L9BA 4INDA 1WW4A 4NO4A 1OA2A 4YGCA 1UU4A 1FPN3 1W6NA 2JENA 2WQZC 4WM8B 4CDWA 1HQWA 1MS5A 3B5LB 4QXKA 2DVFA 2R073 4XJWA 1YO8A 4NOTA 3R05A 1RUF3 1V6IA 1QXJA 1MS8A 4FCAA 2WA4A 3U4XA 4QPIA 3CNAA 1X8MA 1ZRFA 1RHI2 3WDYA 2HWE3 3PTYA 5CFDA 3VGIA 5T5LA 3V0BA 4WVMB 4YM0A 5SV5A 1C4RA 4MV2A 5B2GB 1ZRRA 2KM2A 4Q0PA 1ULEA 2XG3A 4Q8KA 1AYN1 4G4FA 2DYCA 2QKDA 4U2AA 1IS3A 1SLTA 3NAPB 4RQPA 4HZFA 4AVSA 4RR3A 4QHBA 4M0NA 1PZ8A 4HSJA 2D3RA 3A4UA 4Q4X2 1SQ4A 2P34A 2WA3A 1LHWA 3U10A 1NY72 1WMEA 3RMXA 1RUI3 4CEWB 1PK6C 2NP0A 3V65A 4LA2A 3MICA 3DF0A 4JDNA 4LULA 1KJRA 2R0HA 1DLLA 1IS6A 2ILMA 2FZ1A 4MXWA 3ST7A 2R49A 4Y4YA 3J9SA 4S2FA 1VAKA 3JQXA 1GZWB 2ZJCA 2JEMA 4F3JA 4WM7C 3VBFC 4XEZA 4RQPB 2B7YA 5LRRA 3FMGA 2OIIA 4AI3A 1YJLA 1QNYA 1HX6A 3ZN6B 1KXGA 3NV4A 4RR3C 5FDBA 1PO11 3M2MA 3ZXGA 1JHNA 3JBG3 3VBUB 2PN5A 4KWKA 3TN92 3S6PA 5CB7A 1SFYA 2YXSA 3M7AA 2UYAA 5CADA 2WFF2 1YFWA 1CPMA 2XJUA 3D0JA 4DZGA 2FQPA 1H8VA 1POV1 1FOD3 3OBTA 5CFDC 3KD4A 4XJ9A 3AKQA 3AYCA 2TEPA 4JTNA 1UZYA 4D7TA 5JCTA 2GMMA 3NKGA 2ZCWA 1W39A 4D69A 1UZZA 1AL0G 3V64A 4CEWA 2E7QA 3W9AA 3AYEA 4N53C 2FHRA 2EAKA 3KMHA 4CP0A 2RR12 1EV11 4XFBA 4H55A 3ZXJA 4DS0A 1ZM1A 2VUAA 4XJ8A 2GZWA 4AGGA 4IETA 1CAWA 5L19A 1H30A 2ZACA 1VJ2A 1KS5A 4J6GA 2VMIA 1V6JA 1LEMA 4F7ZA 5DUVA 5KXCA 2ZA9A 3DL3A 4QMAA 3AP4A 1DQ2A 1ALYA 3ZDSA 1QKQA 1F8VA 1RUE2 3TNPB 5AC91 1LJ7A 3FZ3A 4ONUA 2VOVA 3NV3A 1W6PB 5BXXA 4C1WA 4RHV3 5J7MA 1J3RA 3UJQA 1GANA 4M3CF 2ZABA 4WVMA 1Q5OA 4FAGA 5FMOL 4M3CE 2AGSA 1J1LA 1XYOA 4EN6B 3KB5A 1RUH1 4GULA 1V6KA 3DN7A 3WXPA 5EZWA 3JD73 2RS13 3SH3A 4XFAA 2HWF1 1PIV1 4CTEA 2H6BA 2ZGLA 2CGNA 2R063 3CJXA 2IXIA 3KGLA 1HRV3 2OZ6A 2HWB3 4CEWC 4YNIA 2DCJA 1A6CA 1PO12 2EAAA 2GN3A 3O0WA 2A3YA 5H9PA 3ZMOA 4JRAA 3THTA 4YG0A 1V9U3 1VALA 3B01A 1ZBE1 2D44A 2X8KA 4A7ZA 1AX0A 1RUD2 3R4UA 4ITCA 2Q30A 2D93A 1XU1A 3VV1A 2GNDA 3ZN6A 2XJVA 4B3NA 1HXS1 2VNGA 5I0UA 3I8TA 4M0HA 4KGGA 4QX5A 1XNDA 2BNOA 2YGMA 1COV2 2DVBA 3B93A 3UKVA 3VBSB 1D4VB 1MVQA 2IXCA 4DY5A 1AYM2 1FI2A 3MDPA 4AEJA 2ZHLA 3RJRA 2EVXA 1OA3A 2D6KA 1FYUA 3MEPA 1Y7BA 4NHKA 3H1MA 1PGW2 3PMEA 5F1RA 2ZAHA 1PGSA 1BBT1 1LOCA 1Q56A 3BIWE 2ZX2A 2PHWA 3JU9A 1AR62 2VVDA 4FOYA 4AG4A 3VN4A 3VBFA 2XLAA 3GF6A 1D2QA 3ZX7A 1FT9A 3PVOA 3O12A 5FLIA 3ZSLA 4CDQA 2GC3A 4LO6B 3M4FA 3ZFEC 4NHMA 2XJTA 1QU0A 2CL2A 3ROUA 4MSVA 3WDTA 4BH9A 1CAWB 1VBE3 5FTTC 4Z92B 4JC1A 4XJAA 1RUI1 3B94A 1AR73 4QD2A 2ZGKA 2R32A 4MGYE 1L3JA 2GH2A 3ZFGC 1LOBA 1R081 2Q4SA 1H2KA 1B09A 1ULCA 5LEKA 4QQHA 4EROA 3AM2A 5SV8A 2HKXA 4FPKA 1LOFA 2UY9A 1D2SA 5JVVA 5FQ0A 3RJ2X 1OSGA 4Q4V3 5JIUA 2A3WA 4IESA 2WLQA 2JDZA 3J8F3 4K40A 4Q26A 2YDEA 1UKGA 3N7MA 2RS52 1IS4A 4LT5A 3ZSMA 2VMGA 4Q1RA 4F83A 4XOGA 4KH9A 1S0DA 2WT1A 5J36A 5ACA3 5F6LB 4RGAA 3RG0A 1FX5A 2ET1A 4LR4A 3ZYJB 1DGWA 1ZZ9A 3BCWA 2D7FA 4LBMA 3POSA 5DUUA 2WS93 4H7LA 3WUDA 5FREA 2YROA 2K9ZA 3IDEA 4QPIC 3LSEA 1LR5A 5K9YA 1N3OA 4MGZE 2UYBA 4TSVA 4ATEA 5T3NA 1EAH3 2PAMA 1B35A 5K0UC 3WD5A 3H7YA 4RA0A 4PIZA 4V1PA 4BM8A 2ETEA 2VH9A 1BMV2 5FRAA 2E7AA 4ES9A 3VKMA 3WX5A 5GZCA 4HKWA 4KQ7A 5FOJB 4IEUA 5E88A 2D3PA 4OI1A 2GAUA 4B4PA 3VBUC 1NCRB 3HBZA 5D8AA 4MGIE 2R16A 1SCRA 3WZ1A 1RUJ3 4L11A 2ZBJA 1BBT2 1Z7S1 1GV9A 3TBDA 3W58A 4I3PA 3MIDA 4D3WA 3T2TA 4XF3A 2RHPA 4DRVA 4Y1YA 1VAVA 5HI0A 1BYHA 3MW3A 1XE8A 4QPGB 1SBDA 3D6EA 1AR81 1G9FA 2FMDA 3EJKA 1NA1C 5IK5A 5L7OA 1VRH2 1F31A 3H9AA 1BVVA 2FMYA 5T50A 1G8WA 1A78A 5ABJB 3AMNA 3RZZA 3IDCB 5K7PA 1LGNA 2NN8A 2RS33 4X6RB 5KXDA 4LHLA 3AZZA 1PVXA 5C8CB 5AVAA 1U5ZA 1CONA 4Q4Y3 2XLGA 2RMU3 1QQP3 4RD7A 2ZGOA 1YIPA 4AEDB 2B5HA 3FE5A 1LCLA 2TUNA 2X5IB 4MGKE 3AXEA 4KGQA 3CF6E 4Q4W1 2WLPA 1UMZA 3ZXEA 4UXAA 5BNNC 1E57A 2ZHNA 1TMF2 1U5IA 2XL9A 3KCCA 2H0BA 3DKWA 4K1ZA 3N3HA 4OFGA 4C90A 3VBHA 5AFEA 1O4TA 1VLNA 4AEMA 4FQ4A 3GNEA 4LO7A 4LO8A 3ZXFA 3RPQA 3D0SA 3VZOA 2RM22 4AQ6A 4DFSA 2XWJB 3IT8A 4XILA 4MZUA 1D0GA 4LE3A 4MX3A 1ZVFA 1LB2A 5FOBB 4FVVA 4CDXC 4AI1A 3ACLA 1MS4A 1FMD2 1CN1A 2JXAA 1LODA 1CESA 1PGW1 3FX3A 3HMYA 2WNUA 3FJSA 2GNTA 1VB2A 4G9SB 3VHPA 4AVVA 4OVEA 2UWBA 3WDWA 4EN8B 4S2DA 4META 4AFAA 1EAH1 4HLTA 4R8HA 4PDWC 2YYOA 4FOVA 1SDWA 4OULA 4OI2A 1RUE1 4AQ2A 3ZYGA 4XJZA 5HBAA 4ISQA 1XRUA 1D0HA 4CDXA 2DCYA 4XTMA 4R4XA 3GBGA 1AJOA 1XYPA 1H9WA 1SBEA 1IS5A 2QVSB 4UW3A 1SFNA 2E9QA 2VUJA 2DTYA 2WNUC 2R1BA 1CR7A 4PLOA 5D1IA 5I0TA 1DZTA 2CAVA 3AJYA 4FXKB 4IEPA 2BYVE 2ZGMA 3LZZA 1QJX1 2SLIA 5GKAC 4QGLA 2A7AA 2WZR2 4LEJA 5CA6A 2RS53 3RSJA 5A32A 1ZBA2 1AR92 3WNXA 3ZVXA 1R1ZA 2PHLA 4AI2A 5IK7A 1V6MA 5JOYA 4YW4A 1AR71 1REDA 1ZBE2 4XJUA 4QGMA 1VBE1 1AR91 3LWCA 2IXHA 2E53A 5JDBA 1RINA 2BWCA 1DIWA 2IXLA 1M4WA 3ZFFB 4YW3A 3WCRA 3THPA 1AR72 4IL7A 5F5QA 2DVGA 2EIGA 4P9IA 3E5UA 1ZZ8A 1KFUL 4LHKA 5C8CC 5CFCA 4ZKTB 1WCDJ 3SH5A 3WW1A 1NLSA 1NA1A 4DOUA 1R091 3M3EA 3J4UH 4GH4B 3ZSEA 2QQPA 4ZU7A 2VG9A 1TEIA 1OI6A 1VBA3 2XVLA 4P9YA 1PVC3 3FFZA 3TWIA 4CP1A 2PAEA 4K3UA 2QCSB 3E5QA 5L7OC 3WG4A 3ZXAC 5D8AC 1DFQA 1GLHA 2HYKA 3M3OA 2HEVF 4RS5C 5C9AC 1COV3 4XIOA 3W59A 1WMDA 2GC2A 1AL23 3DGTA 1GR3A 2VW2A 2VOKA 4W6YA 1H0BA 5CG8A 3PJYA 3O5SA 3AX4A 2ZHKA 1GBGA 2HWB1 1G7YA 5CFDB 3CJIA 2WNVA 3IMNA 2BVVA 3E6DA 3MLKA 4AW7A 5H9RA 5I8YA 1YNAA 3AJZA 1Z7S3 2DF7A 5DG2A 3NV1A 4CYDA 3DPRC 3KCYA 3SMHA 1HRV2 3MPPG 4LLFA 4Q4Y2 3SITA 3EXUA 4ATFA 2RS51 4IEVA 2ZZJA 4JGZB 1R1A2 4KU7A 3ZO0B 4H3WA 2XBO3 4Q27A 1SMVA 5L7OB 4AWDA 4Q8LA 1X50A 2ZX0A 1HIXA 5K0UA 2XVGA 1CJPA 2XJRA 3ILRA 4D7SA 4NHLA 1J3QA 4RHV2 3VUOA 2QUOA 1DF0A 3TRSB 4TLFA 1S0FA 4W6XA 2R042 1D4M1 2RM23 3U11A 4P9XA 3WT3A 2LALA 2ZOEB 1S2KA 4Y1VA 2JD4A 4BZ4A 5LK5A 1ULFA 2D97A 4XIKA 4IEYA 5C4WA 4FPHA 5BV6A 4H14A 2O8OA 2X29A 4BLJA 3Q9OA 3M70A 1R1A3 1ULGA 3E5XA 2XKPA 3AYDA 4XFHA 4PDWA 5IK8A 2A6ZA 1Z78A 4K7JA 4CDUB 1OQDA 5DDJ3 1XE7A 3UL2A 3WQ1A 4EN7B 3WP5A 4QQLA 5KC6A 4N7UA 4C91A 2CY6A 4Q4V1 5CAZA 2FBEA 3POYA 1MZFA 2OUHA 2EXIA 5J48A 1DZRA 4DPNA 5I0RA 1Y3TA 1YFYA 1BEV1 5EJ3A 3S7IA 1KDMA 1C5HA 3AMPA 1DZQA 1YUDA 5HCAA 3EO6A 1ENQA 2WS92 2PHFA 3ZFEA 3GALA 5FPXA 4YM3A 3H8UA 2P2KA 2I45A 3JBG1 4XE9A 2ERFA 3O7OA 3PLQA 5DUXA 1I6XA 2P3KA 3FLRA 2D6NA 1Q8OA 1W6PA 4QQPA 2IFWA 1DYPA 3USUA 2JX9A 1CX4A 1H1AA 4UW4A 4MYEA 1LTEA 1HQLA 3VBSC 1BJQA 3VKFC 2PTMA 4U36A 1KS4A 4FTBA 2VW1A 3C2UA 4E9KA 3KQRA 4FO9A 2IZWA 5T55A 5L73A 2RMU1 3NJZA 2C5DA 3VHRA 1BQPA 2HEWF 2BUKA 4D7YA 1CQ9A 4XFFA 4W6WA 1R093 2EA7A 5KHHA 5F6KA 3AZXA 1V6NA 2O0OA 3LA7A 1DYKA 1H8TC 1A3KA 4E4ZA 1HDKA 3RYKA 1GKBA 1URXA 2RJKA 2LM3A 2ZS6B 3VHOA 2BFUS 1HQNA 3RI9A 3RNSA 2D6LX 4OUMA 2GC1A 3DPRB 1W0PA 1W6QA 3B00A 4Z82A 2ZGRA 2YMZA 1PIV3 3AMHA 1MEC2 1TE1B 1DQ1A 3BPZA 4GMP3 3PNAA 5L36A 1ND2A 4XF0A 4B8EA 3WW2A 1NG0A 3NAPA 4FPLA 2WNEA 3OJBA 4L92A 3NW4A 5LRSA 5JOXA 4HVOA 4R9DA 2ZX4A 2H0VA 1RUC3 2VW0A 2AUYA 4AGRA 3V0BB 4YZ3A 1W6OB 1OQ1A 1PHMA 3QOPA 1OLQA 1LGBA 3WLUA 3VBOC 4CEYA 4N53A 3VBUA 2HWB2 1H1IA 1NCQA 4YM2A 1FPN2 1RGSA 1AF9A 4AHYA 2A6XA 2DURA 5CU1A 4YGEA 5J96B 5JZGC 4FPGA 4HT1T 5T52A 1B35B 2D6OX 2XPJA 4Q0SA 1OA4A 3KSCA 2OUJA 2LTNA 4YZ4A 1PMIA 1ZBA1 5IK4A 3MIGA 3USUB 2XVKA 2WIIB 4NVPA 2GDFA 3GZTB 2ZMKA 4Q1PA 5JI9A 4DY3A 2ARXA 1JBCA 4HPKB 2V5YA 4ES8A 4AVAA 4EWDA 2EXJA 3OBRA 2F6BA 1R083 3HT2A 4IV1C 4PIYA 5HXVA 2NMNA 5LEJA 1NZCA 1WGPA 4M3CB 4WZCA 1G9BA 3VKLA 3ETQA 4FAHA 4WVWA 1H2MA 4C0HA 4QPGC 4XMIA 1NXMA 1ZREA 1QDOA 1GICA 3ZXKA 1V9U2 5EXOA 3MIHA 1HV0A 4Q0QA 2UWCA 1AXKA 1RHI1 2IFRA 3OF1A 1PO13 4HVRA 2XL7A 4JGZC 1UF2C 4CEYB 4AVTA 3WDXA 1EPWA 1PK6A 1U0AA 2RR13 4WM7A 1QXPA 2F4PA 4XPVA 4R4ZA 3ZFGA 3FLPA 2D6MA 1ZA4A 1QHDA 3VDDC 3QH6A 4DRRA 3JB4C 3JD72 4HETA 4HL0A 5FFOC 3FBMA 4HN1A 3FFQA 4GB32 4HANA 1N1VA 4XQDA 2AYHA 2Q8OA 4IV1B 3E6CC 1XQNA 1JXNA 5FCCA 4QPGA 2XHKA 3USSA 3FWEA 5KWRA 2QFEA 4BOWA 1S0JA 2OA2A 2DWRA 1C3HA 1GQGA 1NY71 1J3PA 5JOWA 3BU7A 3LOIA 2V73A 3H50A 1XNCA 1TME2 5T5PA 4GWMA 4Y26A 1F5JA 4AXOA 4N53B 3AMQA 4L99A 1RUJ2 3R0RA 5KHJA 1W6QB 4LE4A 5T5OA 2HWC2 3MI8A 3H0OA 1HRV1 2ZGPA 5GLWA 3ZYPA 2R061 4P9WA 1V70A 1X8EA 4OZXA 4GKXA 2N7GA 2Y0IA 3V0AA 5KC5A 2HWD2 2HWF3 4CDWC 1RUJ1 2E63A 2MNGA 4DINB 1BK1A 4ASMB 1C1LA 4UW6A 2X5IA 1PO21 2VOWA 1ZZ7A 4LBQD 3AP9A 2HWF2 1XXNA 1DQ0A 3VBHB 4UBGA 4XQ4A 1RB8G 1UU5A 1H1MA 4JGYC 1LU2A 4YARA 4W65A 5A3MA 1J59A 3VBOB 2DU1A 1ULDA 5EV7A 2VQAA 2ENRA 5AC93 1LENA 1JOJA 2ZAAA 5T54A 2CAUA 1FOD2 1TME3 4QPYA 1LHOA 4N9IA 4DB5A 1NCQB 1H4GA 5I91A 4XHXA 2JE7A 3S0MA 5ACA2 2UWAA 5ABJC 2VVEA 4GH4A 3RI8A 2P3IA 4CDWB 2YHJA 2W0XA 4LBQB 4C0BA 3KLSA 1FATA 1MZ6A 4CDQB 5ACA1 4X6QB 4I0AA 3WCSA 1VBC2 4A7YA 4D94A 5I8SA 2YUEA 1O4YA 1QJZA 3IN9A 2A75A 4JTOA 4KG8A 3QH7A 3MLLA 1S0CA 2GC0A 4AFMA 4FPFA 1VBB2 2CV6A 1ZNPA 5CBLA 2Z69A 3CEWA 4IV3A 1QWRA 1H8TA 2PQQA 3ILFA 2FZ2A 2PFWA 1SCSA 2IXKA 5KBFA 1DGWX 4LBOA 1LRHA 1Q8VA 4MXVA 3WY6A 3HAGA 2QDRA 1VBB1 4XQWA 3IDBB 4OHZA 2Q1ZB 5DG1A 4YRDA 1AX2A 3VL8A 1MS1A 3B9IA 3L2YA 3B02A 1KDKA 4OHXA 1HRI3 1O7FA 2EF6A 2HWC1 4WZFA 1KD7A 4R9CA 1IQAA 3M1HA 2E51A 4XBNA 4Z07A 3KCXA 1AYM3 1QJY2 1MR5A 2VGDA 3MW4A 3OY8B 3S7EA 1QY4A 1H4HA 3ASIA 4QU2A 2W52A 1FNYA 2XUMA 4K9SA 1ZZCA 4Q29A 3OPZA 3WVJA 1ENRA 1YIFA 4Y24A 1NE6A 1N3PA 1QJU3 4YGDA 3TB0A 3P3NA 1Q8SA 3AKRA 4LNVA 5D8AB 2B8MA 1S0IA 1BKZA 3WG2A 1RUNA 1NLRA 4NPRA 4PIXA 2AREA 2QZ2A 1VBB3 4NWVA 5JSPA 3PMSA 4AFDA 5CG9A 3H1WA 1J1TA 1BEV3 2BBVA 1MQTB 3NO8A 2KA3A 1OQEA 4LA3A 1YFUA 2RS12 3TYJA 5BY5A 4Y1XA 4E27A 1LGCA 1BMV1 3N7LA 1EY2A 3UJOA 1C5IA 4RQPC 3H3UA 5KXEA 4LBLA 1HRI1 1YHFA 5EWSA 1CD3G 4DXZA 1QJY3 2PLV2 2BQPA 3HR9A 1W2UA 1AZDA 3GZUC 1WMFA 1RUH3 4PCRA 4YVSC 5C4WC 5AVPA 4BA6A 2Q0AA 2HWE1 1G9AA 1RVF3 1N3QA 1U5YA 1HRI2 3I54A 5DXDA 3NVCA 4AHWA 4XETA 3O14A 5K0UB 5AC92 2JG9C 2R071 1PZ9A 1UCXA 1F2NA 3ZFFC 1FPN1 1LOGA 4PBPA 4YG3A 2DCTA 4LHNA 3LKJA 4MUVA 5GALA 1BZWA 1VRH1 1WD4A 3BALA 4K1YA 1WW5A 4F8AA 4Q0UA 3OYWB 3ZYRA 4COWA 2AZ5A 2XBO1 3I4IA 5JZGA 1JYIA 1F5FA 1IKPA 1M06G 1W6NB 4WM8A 1AX1A 1RC6A 1IGOA 4FP3A 3HD8B 1ZRCA 4XZPA 4QM8A 2HEYF 3SCGA 4XXAA 1VBC3 1RUG2 3IKWA 2IWGB 2WINB 4RS5B 3WDVA 1C1FA 3CJIC 1WBLA 4P9LA 4B7KA 1Z0HA 1CJDA 1QH7A 3IWZA 5JWPA 1GZ9A 1CAXB 4BYYA 2Y26A 4BQ1A 1YCIA 3IBMA 2JKBA 3AMMA 3N7KA 4XMAA 3X29B 3VZLA 1FNZA 3TN93 5C9AA 1DDLA 5FO8B 3WV6A 3JUUA 1ND2C 3CO2A 4P14A 1LECA 1AL21 1UD1A 3FLTA 2NLRA 5I0SA 1RUOA 5BUVA 2DCKA 5LK7B 3MIBA 2UURA 4E2SA 1BVP1 4K20A 3IPVB 3MZHA 2WSVA 1DU3D 2R1DA 1SBFA 4URTA 4AVBA 3VBFB 5GJ6A 3MGUA 5A3LA 5DZFA 3MIEA 1MS9A 3I59A 2D5HA 4UBHA 4BLIA 4CZSA 5JSOA 3CJIB 5F9TA 3HT1A 4HK8A 1W6OA 1EV12 3ZSJA 1JUIA 3M8LA 1RMU3 2PLV1 5DZEA 1UL9A 1VBD1 2PAKA 4LO5B 2YPJA 4S2GA 5IT6A 5H9QA 3B69A 3H7JA 2I07B 2ZGNA 3G6JB 1Q3EA 3L2HA 4GIQA 3A0NA 4BHPA 5GLZA 1K5MB 4JDOA 4IEZA 4Q4X3 2GNBA 4R52A 3LOBA 1RIRA 3LA2A 3OD4A 3ILNA 2R043 2DVAA 1PNGA 3OGGA 3WP3A 3ZYIB 4BMEA 3TNQA 1LESA 5FBZA 1RUH2 4B4RA 5GLVA 1VBD3 2LUWA 4EN0A 3VBSA 4CRQA 1KQRA 2BTVC 1REFA 4LUMA 4YSFA 3C3VA 2JICA 2XBO2 1QJX2 2OW4A 2Y38A 4ZU4A 1RHI3 1S55A 1SLIA 2ZMNA 2GNMA 5C9AB 4Q4W2 5C8WA 4YW1A 1N1TA 1RUD1 2ZGTA 2ZX1A 3AP7A 3IM0A 3R6SA 1YJKA 1QXRA 3DV8A 2ZGUA 4IERA 3TN91 1UKRA 3N7JA 1RL3A 1RUC2 3GHNA 3V0AB 3OGJA 3HIFA 2PHDA 5KHGA 5FLJA 1QJU2 1ZZBA 5ABJA 4YFZA 4MLOA 2O8QA 3AK0A 4FQZA 3ZFGB 2NM1A 1W6MB 4YZ2A 4AK3A 4JV4A 1RUC1 3WG1A 3ECQA 5JZGB 3UKTA 4PF5A 1VBC1 2R6QA 1FMD1 3RMYA 3ZPYA 3HN1A 1QOOA 1MEC3 1F9KA 1AYN2 2DTWA 4TYSA 2SBAA 4WBBA 3KZ4C 1PVC2 4AEDA 1H2NA 1WW7A 2AENA 3GBWA 3M3QA 4I2OA 1KJLA 3AKPA 2P3JA 4Y22B 4WVVA 4WM8C 3TOJA 1G9DA 3APBA 2Z2SB 4O9EA 5BNPA 4JQRA 1UIJA