4H9NC

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9nC00
4H9RC 4H9OC 4HGAA 4H9QC 4H9PC 4H9NC 4H9SE 5KDMC
chains in the Genus database with same CATH superfamily
3MK7C 3L39A 2NWBA 5L3GB 3LG7A 4L0RA 4V1Av 4ISSA 2DHRA 3KV5A 3AEBA 2N2NA 1T7SA 1H7CA 3V5UA 3ZYKA 5ADXL 4JLEA 3D0TA 4IDPA 1QLBA 4YY3T 2JQQA 1EZ3A 2E8IA 2RA1A 1HR0T 3Q5WA 1WCRA 3AA6B 2ZM8A 2XTLA 4GOUA 4I43B 3PUAA 2V26A 4PFPA 2LSKA 4IHJE 2NW8A 5HWXA 1ZV4X 4JUYA 3Q2MA 4H63V 3OKQA 2RP4A 2BVMA 3TLWA 4QXHB 3RRCA 4PJNA 5CB4E 3ZLIA 4X5TA 5FY7A 4ZI3C 3WAKA 1KFYA 2YOEA 3CX8B 3N9QA 3ZYMA 5LGNB 2LHNA 1MIVA 2J47A 2Q9QA 4TWDA 4ZZBA 2EHOB 3T1YT 4DR5T 2H89A 3Q9DA 4WNKA 4OK0A 2K48A 4F8HA 2IDOB 3RIAA 4CXWA 3UQ4A 1IJ5A 4H9SE 3C4XA 4HWCA 3X1DA 2WS3A 1X9BA 3FXDB 2W0GA 5J2TE 5AQQB 1HG2A 5FL0A 1LVKA 2C0SA 4H9RC 2VVNA 4HKAA 4U7IA 4YLHA 4A56A 3K3QC 4UVCB 3WAJA 4X62T 2XPKA 2X0HA 4UV8B 3PDYA 5AQVB 3CQCB 3KBUA 2DLRA 2CA5A 1Z0PA 4I50E 3RX6A 1OEDA 4EB6E 2CEAA 4KMCA 3I9WA 4K0KT 3N9LA 2LOSA 5JREA 2J1DG 5CA0E 2LSJA 1LRZA 2W61A 2XUEA 2IW5B 2A3DA 3P50A 4GYSA 5AQHB 2WWVA 1XNQT 2K9AA 2MAWA 2WDVA 2YN6A 5GONE 4AI6A 1B7TA 3FZLB 4QH4A 3CQXC 1AJ3A 4MHCA 2X9YA 5F8PA 2LRKA 4X20E 4YJ2E 2BS3A 2WQYA 2HN1A 2OLTA 5ABFA 2JMKA 3L8RA 1YKHB 3MJXA 3H37A 3WI3A 5AQLB 2UU9T 1YQ3A 2CXFA 2E9XB 2QYWA 2V8SV 2WZIA 5EK3A 2FJBA 5EK4A 4DMWA 2J62A 4YSZA 3L3PA 2M67A 4PFOA 2YU2A 4ZI3D 4X65T 4DV4T 5L47A 3C98B 3RKOA 2SPCA 2V7IA 4PAGA 3I0OA 5HCJA 1W9RA 1SA0E 2VKDA 1VOMA 3KBTA 3DJBA 3SFEA 2KLQA 3KVAA 3RKGA 5LNKA 1U5PA 2CBIA 2BG9A 3ZT6A 2H7OA 1WLXA 3EUHA 3OYXA 3UU4A 3KINB 4YHHT 4O2BE 5M4YA 4IDOA 1HTJF 4ANJA 4AISA 1SE7A 4O4JE 5F5WA 1HS7A 2C5IT 3EABA 2ZMAA 3P8CD 3EAMA 2UXXB 5HEJA 5L3EB 3RYCE 4UVAB 2E9XA 1Y64B 1XDPA 4AKLA 4B6XA 4O8SA 3ONXA 5FXVA 4IL9A 1BR4A 5FVKA 4IE5A 4P09A 5J2UE 3VR8A 5LHGB 2PFVA 3P4PA 3FXEB 4A98A 4AKGA 1D0XA 5BR8T 3N2KE 3N2OA 4YT0A 1KNRA 1SUMB 4PK6A 3O1JA 2VWAA 2XAQB 4BJNA 3O1HA 4MALA 4XAXB 3RF1A 3ZC1A 4JEUB 3A8YC 1T98A 2Q9QB 3HR0A 4HEAA 3ZJ1A 4BAYB 4YSXA 3LFMA 2ZM6T 4JI0T 3RYHE 3B57A 2LM2A 4EZHA 3ESLA 2WBLA 4QH1A 4UVBB 3UUXB 1WRDA 5BMVE 2YDRA 2L3LA 1M62A 2IMLA 4X1KE 1IJ6A 3LBXB 3HKDE 5JTGA 2B76A 4HFDA 2AXDS 3N9OA 2ODUA 1NWMX 1W0AA 3O4XE 3OVUA 2X0YA 3JCFA 1BR2A 2WMNA 3JAFA 4ISTA 3AAIA 5FY0A 5AQGB 5TAOA 5CFBA 1IBLT 1LVFA 3PV0F 3FZMB 4FI5A 5C3JA 1NEKA 2NW7A 4UR9A 2VQET 3QB5A 2ACZA 5FNVE 2BBJA 2LSYA 4NPPA 2JJ9A 1UX5A 2A72A 2W63A 2XQ6A 3AAAB 2VK9A 3BK9A 2B1EA 3K8PC 4KX6A 4HWHA 4YXDA 4LFBT 2WP9A 2D0UA 3F31A 3PUSA 4HGAA 2NR4A 2OV9A 2YDSA 2V1DB 2UXCT 3H3AA 3IA3A 3PUWF 4DMVA 3O1IA 2VKOA 3NBXX 3B5MA 1XZYA 2BKNA 2WAUA 4QHOA 5FVLA 4PJLA 3VR9A 4NXNT 2PBIA 4QX7B 4CN4A 5EK2A 1YKEB 2D5UA 4YJ3E 2UUBT 1N32T 5HEUA 4HFHA 4DR1T 3VKGA 3FZHB 3CMLA 2KWIB 5KMGP 4P1NA 2C5KT 1BR1A 3ZSTA 2IC6A 2UUAT 1ZOYA 2NTXA 4C91A 1ZP0A 4N78D 1ZKEA 3FZFB 4HFVA 3C64A 3AE3A 4U72A 5ABGA 4YTPA 2P9BA 2GK9A 3ZYLA 4TN7B 4A97A 1Y01A 2PJQA 2RPAA 1SHZC 4JI2T 4Q25A 2XJ7A 2WM9A 3C4WA 2FJAA 3ZSSA 3NRYA 5KXJA 4XBFB 4ERRA 3R84B 3EDUA 1G73A 3AE8A 1XMQT 2UXDT 5AFUL 3RC3A 2I0MA 1QSDA 4QXBB 1MNDA 2V6YA 5E0OA 4DV6T 2DWKA 2ACXA 4LF9T 4DR7T 5HXCA 3EHZA 4Z8XA 2H7VC 4LMLA 2HH7A 2H88A 5A1LA 4HWIB 3AEAA 3AEDA 3EI0A 4DV0T 2WZHA 5LHIB 3MKDA 2H3RA 4LF8T 3RQUA 3CVRA 4LF7T 3ZMTB 5HXRA 3N2GE 5HCMA 3LJCA 5J0ZA 3LDQB 5LBMA 3AA0B 5JRCB 4WW0A 3ZN0B 3IBPA 3W15B 2BG9C 4HWDA 2ZM0A 3U3IA 4TZ4C 4B3TT 2NTYA 2JQ9A 4Z90A 3ZN1B 4ZXLA 5LG3A 1V9DA 4TNWA 2VL0A 3J9X1 2BS2A 2XQ7A 2KXPB 4Z91A 4CZZB 2E5VA 3TLUA 4FJOA 3NKZA 3RLFF 2W66A 4EYUA 4LF6T 1MIYA 1NENA 3ETVA 1XMOT 2CLYC 1KNZA 4ILAA 3K3NA 5HXHA 5HYAA 3HI2A 3DTOA 4KI0F 3CK6A 1FEWA 1OWAA 3CPZA 2YDQA 5ABHA 2FJEA 5JDGA 2FUPA 3ZT5A 4H9PC 2LJLA 2HHHT 2W4XA 3AE6A 2HN2A 2LKGA 3T1HT 4JI8T 1WR0A 1KEYA 2WU2A 5IYZE 2J4GA 5JDQA 1GQEA 4MLKA 3PJAA 4NUVA 4GYRA 3J7Yq 4LF5T 4UELA 2KSRA 2JMHA 2V7LA 4MBQA 2PTFA 5AQOB 5ETWA 3SFDA 3C4ZA 4DR6T 4B3MT 3QC9A 4UIGA 5LGUB 1IAPA 3OJAA 5JVDE 3LBXA 1IBKT 2LKHA 2N1GA 1T72A 2XQ4A 3K1SA 3UT5E 1BR0A 3PU3A 3TLSA 4OX9T 2EHOC 3S4UA 4CN6A 3CIRA 3G06A 4TV9E 3LK2B 2E2AA 4IE0A 3QUJA 4U2YA 4YHJA 2CWYA 4AKRB 2YEVC 4I55E 2XM2A 4LFAT 3BQIA 3KV6A 4H9NC 4WBOA 2VASA 3KDSE 1M7KA 3FBLA 4CI3B 2EHOA 4IDQA 4XZCA 1OEDB 4E7ZA 4EV6A 2M6BA 1WFDA 3CWZB 5LJNA 2IUBA 1HX8A 3ZMSB 2D0TA 2WCAA 2XASB 3JC6C 1UX4A 3PTRB 4KHPT 1WYBA 3ZJ2A 2XQ9A 2KINB 2VL8A 4NXMT 1OEDE 2LSIA 4M1PA 1MMDA 2XAHB 5JDNA 4ZS2A 1J5ET 5HEGA 4EEDA 5LMUT 2ES0A 1D0ZA 1OEDC 2I59A 4J2CA 1US7B 2VKJA 2IC9A 3AXJB 4PJJA 1N36T 1N33T 4DUYT 4L5GA 3UFGA 1HFAA 1XDOA 4OHFA 2CRBA 5LG4A 3RYIE 1HX1B 1MMAA 4IIJE 3AEEA 3PU8A 2X9XA 4KUMB 4IDNA 4PK4A 4PJMA 3V5SA 3I0QA 1J1JA 1UCUA 2VKHA 4CXXA 5AQMB 4TNVA 4AXPA 4DR2T 2W2UA 2LT3A 4B3ST 2CM0A 2X67A 5JDFA 2X0LB 5CGMA 3M65A 4X1YE 1JNRA 1E7PA 2X66A 3RPUA 4B3RT 2E5LT 3LSVA 3PJAJ 3RYFE 4IE4A 4JV5T 3C50A 1UK5A 3CX7B 2MOZA 2WWUA 3AAEB 4CN1A 1W09A 4WBNE 2Y6XA 4OFZA 3SS1A 2ZM2A 5ABEA 3NRXA 4EXTA 2A9UA 2JQKA 4CI1B 4YTMA 4CXYA 3UUBA 4MFRA 3IF8B 4O4IE 2V5DA 3VKHA 4K0UA 4JI5T 3NZQA 5LOVE 1S94A 2KWHA 3TLTA 4AQFA 2D2SA 3KVBA 4UV9B 2L8KA 4QXCB 3UU5A 3PUQA 2XQ3A 5LBQB 2V7KA 3A7MA 4KHZF 5DQWA 3ZPOA 5F3JA 2WSSV 2DL1A 3ZCJA 3RC8A 4AKHA 3AA7B 4EOZB 3HKEE 1QUUA 2MTQA 2CLYB 3KV9A 4AQFC 2UXBT 4U3CA 5KDMC 1KK7A 4AQYT 4JBWF 3FBZA 4GK0E 2JIWA 4E7SA 5C8YE 2BDEA 2DI4A 3EDVA 3NVOA 3F2EA 3P4RA 3ONLC 2OA5A 4TV8E 3N9NA 5HWYA 3TLVA 3C51A 5LMNT 2XQAA 3AE4A 3P7IA 5L3DB 1IZNB 4EZ4A 3LK3B 3QB5K 2M6IA 4BJMA 3HA4A 5L4EA 3TKLB 3P4QA 4H9OC 1HG5A 4H9QC 3AE1A 3SOLA 3UULA 1FIOA 1D1CA 2MYSA 3JC6D 4ZS3A 3ONJA 3ZT7A 3RQWA 2VB6A 4HWFA 1G8XA 4BA9A 5L3FB 3UQ7A 2JRKA 5AQFB 4DR4T 3PUXF 2WMOA 4ZZCA 4HTEA 1D1BA 3E22E 3JAEA 5FXXA 2VURA 4A5XA 1X79A 2BZBA 3ZEFB 2XSAA 2MPKA 3NWIA 5JR9B 2X68A 1IBMT 2XZEA 2LOPA 2NOXA 4I4TE 4AKIA 3M3ZB 1Z8UA 2X9WA 3AEFA 2CE7A 4TUYE 3AVSA 5FY1A 1MMGA 2E9XD 2UXNB 2KMFA 3CQGB 3AE7A 2VQFT 1HNXT 2LM9A 3EVYA 3CX6B 5EZYE 5HXEA 3ZMZB 1JNZA 1L0VA 4I0UA 5L3BB 1HF8A 1CHUA 1KNPA 2XAFB 1D1AA 3MZKB 4DV3T 3RIFA 5AQPB 5JDMA 4DV7T 2V7JA 1ZEEA 1UUSA 2HPLA 3AE9A 3E0ZA 3GA8A 5AQTB 2WY2A 5FP3A 5FKYA 3AE2A 3I1AA 3ZMVB 4COFA 2I6HA 5JR9C 2UUCT 4KP3C 2CWOA 2FBWA 3HL6A 5LGTB 3K3OA 3QK6A 1WR6A 5LA6E 3F57A 4JI7T 2BS4A 4JEHB 2LRLA 3RGLA 3AEGA 2CXLA 3B13A 1I94T 3OPCA 1FMVA 4P0BA 2YK0A 4L9IA 4TWFA 4WZXA 4IL4A 5FXZA 5HAXA 3RI5A 4P0AA 3PUGA 1HNZT 3GN5A 3N9MA 5LB7B 1VRBA 2W00A 4AQGA 2XHEB 4IE6A 3ABVA 3ANWA 3ZKRA 2KZ7B 2IAKA 2X51A 2YINA 3N5LA 4OYKA 3UU3A 3OTOT 4LFCT 2X9HA 1YW0A 4KBMB 3H3MA 4O2AE 4IGUA 3N9PA 3QOFA 4HE8A 1UGOA 4JI3T 4NIQA 2QRXA 3AA1B 2CXDA 4G63A 2YKSA 3RH3A 5JDLA 2A2FX 3GWHA 3UTKA 4EYYR 4LMJA 3AVRA 2V6YB 2K3WA 4QKNA 4ZOLE 3I9YA 4DVDA 4DBRA 2DNXA 3PE0A 5DQVA 4GKKT 2CMRA 2Y48B 1HCIA 3U78A 5FL1A 4X64T 2ODVA 3LK42 2VVSA 4IREA 2JQHA 3MA9A 2V6XA 3R6NA 1MIWA 3Q5DA 5L4HA 4DBQA 2QA7A 2XY8B 1VCTA 2KT9A 2BKPA 3IEEA 4DV1T 3UU8A 2Q9QC 5H6RB 4YTNA 3SWHA 5C2TA 1ZHCA 2W67A 5AQSB 1KF6A 1T8BA 2FJDA 3FHNA 3UUMA 4DV2T 2WDQA 1UURA 2IHR1 3HKBE 3OBVE 4HFIA 4QWNB 4U2ZA 4ZI2D 5LJMA 3VHLA 1HNWT 3UUNA 3RIUC 2EHOD 3IHRA 1I6ZA 3Q5XA 4JI4T 3E08A 2HPJA 3GMIA 4C90A 4CQIA 5FMNA 5H6QB 4U31A 2QVAA 5AQRB 3JADA 3VU7H 4H63H 4ADZA 1FMWA 5LYJE 4ILBA 3BQKA 4X1IE 3RIUA 4DNDA 2LHRA 4DV5T 4HFCA 2BBHA 2K24A 4YFSA 3RRWA 3UFEA 3ZMUB 2K5BB 4HN9A 1O3XA 4IDZA 4ZEYA 2V7MA 4U7YA 4EAHA 4EIWA 4UF0A 5DABA 4DO0A 5CA1E 5LP6E 4DR3T 5LHHB 2G0UA 2LLYA 1MMNA 3RHWA 3P4WA 4DUZT 1OXZA 1R8IA 1U4QA 2CBJA 2NW9A 3BQLA 2W62A 5LCYA 5AQJB 5IWAT 3O9XA 5AQKB 1YXRA 2BG9E 4U33A 3OYZA 3DP7A 1E1HB 4ILUA 3PUYF 4HFBA 3L09A 2DWGA 5FYMA 3UU6A 2PG8A 3MACA 5HEOA 1VCSA 4ZI7E 1XWMA 4JI6T 1DU2A 3NZPA 5AQUB 2XSBA 1MNEA 2Q9QD 4TX5A 2CHOA 5HEHA 4LMKA 5ABFB 4TWHA 4CI2B 4JI1T 3PUZF 1FJGT 4X66T 2CCQA 5KX5E 3PURA 1S35A 5IHYA 5LXTE 4QH5A 5HXSA 2N9DA 2AE9A 2WDRA 3MXZA 3QNUA 5JR9A 4ZHQE 4NUUA 2LSGA 4LF4T 2DCFA 3CKDA 4HFEA 3T8OA 4ASKA 3AECA 4DIDB 3FZKB 4YSYA 4ZI2C 2WB5A 1NAFA 2XQ5A 2D9DA 4O4LE 2BKOA 4PNIA 5AQNB 3P4SA 3ZCIA 5DJQC 5AQIB 5JDHA 2IIUA 2E9XC 4F6RC 1LKXA 3Q5EA 3VRAA 1YD8G 2F4VT 2XAJB 2Y8DA 3PUVF 1E2AA 4ILCA 2L9QA 2MBGA 3SRZA 5L3CB 3ZC0A 1N34T 3KFWX 3A5XA 2V5CA 2XAGB 3AE5A 4IT4A 4GK5E 4U74A 2C5JA 4EEBA 2KNDA 4G2AA 4PW8A 5JQGE 2CPTA 5CJ5A 1W0BA 3AXJA 3HKCE 4UEMA 2R6GF 2YU1A 3FB2A 2LE8A 3ANWB 3ETUA 2CHNA 4O4HE 1XNRT 3AB3B 4JYAT 5JH7E 2JPFA 1WYCA 2WU5A 1YQ4A 4IE7A 2XM1A 2ZLYA 3GN5B 4UXNB 2XQYA 3VRBA 2LEHA 1J5WA 1CUNA 4OYJA 5FXWA 2BVLA 2BG9B 4WYVA 2QGSA 1D0YA 5J1GA 5IUXA 4GKJT 5JRCA 2XQ8A 5L2LA 4GIWA 4AIUA 3KV4A 4QX8B 4EGWA 2Z6EA 4UF0B 2NP9A 4PK5A
chains in the Genus database with same CATH topology
3MK7C 2NWBA 5L3GB 3LG7A 4L0RA 4V1Av 4ISSA 2DHRA 3KV5A 3ZYKA 2N2NA 1H7CA 3V5UA 5ADXL 4JLEA 3D0TA 2JQQA 1EZ3A 2E8IA 2RA1A 3Q5WA 3AA6B 2ZM8A 2XTLA 4GOUA 4I43B 3PUAA 2V26A 4PFPA 2LSKA 4IHJE 2NW8A 1ZV4X 4JUYA 3Q2MA 4H63V 3OKQA 2RP4A 2BVMA 4QXHB 3RRCA 4PJNA 5CB4E 3ZLIA 5FY7A 4ZI3C 3WAKA 3N9QA 3ZYMA 3CX8B 5LGNB 2LHNA 1MIVA 2Q9QA 2EHOB 3Q9DA 4WNKA 4OK0A 2K48A 4CXWA 1IJ5A 4H9SE 3C4XA 3FXDB 5J2TE 2W0GA 1HG2A 1LVKA 2C0SA 4H9RC 4HKAA 4YLHA 4AKHA 4A56A 3WAJA 3K3QC 4UVCB 4UV8B 3PDYA 3CQCB 3KBUA 2DLRA 2CA5A 1Z0PA 4I50E 3RX6A 4EB6E 2CEAA 4KMCA 3I9WA 3N9LA 2LOSA 5JREA 2J1DG 5CA0E 2LSJA 1LRZA 2W61A 2XUEA 2IW5B 2A3DA 4GYSA 4AI6A 2K9AA 5GONE 1B7TA 3CQXC 1AJ3A 4MHCA 2X9YA 5F8PA 4X20E 4YJ2E 2JMKA 3WI3A 1YKHB 3MJXA 3H37A 2CXFA 2E9XB 4DMWA 5EK3A 5EK4A 3L3PA 2M67A 4PFOA 2YU2A 4ZI3D 3C98B 3RKOA 2SPCA 2V7IA 4PAGA 3I0OA 2VKDA 1SA0E 3KBTA 1VOMA 3DJBA 2KLQA 3KVAA 5LNKA 1U5PA 2H7OA 1WLXA 3EUHA 3OYXA 3KINB 4O2BE 5M4YA 1HTJF 4ANJA 4O4JE 1HS7A 2C5IT 2ZMAA 3P8CD 2UXXB 5L3EB 3RYCE 4UVAB 2E9XA 1Y64B 4AKLA 4B6XA 4O8SA 3ONXA 5FXVA 1BR4A 4IE5A 4P09A 5J2UE 5LHGB 2PFVA 3FXEB 4AKGA 1D0XA 3N2KE 3N2OA 4PK6A 3O1JA 2VWAA 2XAQB 4BJNA 3O1HA 4MALA 4XAXB 3ZC1A 4JEUB 1T98A 2Q9QB 3HR0A 4HEAA 3ZJ1A 4BAYB 3LFMA 3RYHE 3B57A 3ESLA 2WBLA 4UVBB 3UUXB 1WRDA 5BMVE 2L3LA 4X1KE 1IJ6A 3LBXB 3HKDE 3N9OA 3O4XE 2ODUA 1NWMX 4H63H 5HXCA 1BR2A 2WMNA 4ISTA 5FY0A 3AAIA 5TAOA 1LVFA 4FI5A 2NW7A 5FNVE 2LSYA 3BK9A 1UX5A 2A72A 2JJ9A 2W63A 3AAAB 2VK9A 3K8PC 2B1EA 4PK5A 5L3BB 3PUSA 2D0UA 3F31A 4HGAA 2V1DB 3H3AA 4DMVA 3O1IA 2VKOA 3NBXX 2WAUA 4QHOA 4PJLA 2PBIA 4QX7B 5EK2A 1YKEB 2D5UA 4YJ3E 3VKGA 3CMLA 2KWIB 5KMGP 2C5KT 1BR1A 2IC6A 2NTXA 4C91A 4N78D 1ZKEA 4HFVA 3C64A 4U72A 2P9BA 2GK9A 3ZYLA 4TN7B 3ZC0A 2PJQA 1SHZC 3C4WA 2WM9A 3NRYA 4XBFB 4ERRA 3R84B 3EDUA 1G73A 5AFUL 3RC3A 1QSDA 4QXBB 1MNDA 5E0OA 2DWKA 2ACXA 4Z8XA 2H7VC 2HH7A 5A1LA 5LHIB 3MKDA 2H3RA 3CVRA 3ZMTB 5HXRA 3N2GE 3LJCA 5LBMA 3AA0B 5JRCB 4WW0A 3ZN0B 3IBPA 3W15B 2ZM0A 3U3IA 4TZ4C 2NTYA 3ZN1B 1V9DA 3J9X1 4CZZB 2KXPB 4EYUA 4FJOA 1MIYA 3ETVA 2CLYC 1KNZA 3K3NA 5HXHA 5HYAA 3HI2A 3DTOA 1FEWA 1OWAA 3CPZA 5JDGA 4H9PC 2LJLA 5IYZE 5JDQA 4MLKA 4NUVA 4GYRA 3J7Yq 4UELA 2JMHA 2V7LA 4MBQA 5ETWA 3C4ZA 3QC9A 4UIGA 5LGUB 1IAPA 3OJAA 5JVDE 3LBXA 1BR0A 2N1GA 3UT5E 3PU3A 2EHOC 3S4UA 4TV9E 3LK2B 4IE0A 4AKRB 3QUJA 4YHJA 2CWYA 2YEVC 4I55E 3BQIA 3KV6A 4H9NC 4WBOA 2VASA 3KDSE 3FBLA 4CI3B 2EHOA 4XZCA 4E7ZA 3CWZB 5LJNA 1HX8A 3ZMSB 2XASB 2D0TA 3PTRB 3JC6C 1UX4A 1WYBA 3ZJ2A 2KINB 2VL8A 2LSIA 4M1PA 1MMDA 2XAHB 5JDNA 4ZS2A 2ES0A 1D0ZA 2I59A 4J2CA 4PJJA 1US7B 2VKJA 2IC9A 3RH3A 4L5GA 5LG4A 1HFAA 4OHFA 3RYIE 1MMAA 4IIJE 3PU8A 4KUMB 2X9XA 4PK4A 3V5SA 4PJMA 3I0QA 1UCUA 2VKHA 4CXXA 4AXPA 2LT3A 2CM0A 2X67A 5JDFA 2X0LB 3M65A 4X1YE 2X66A 3RPUA 3RYFE 4IE4A 3C50A 3CX7B 4WBNE 2MOZA 2WWUA 3AAEB 2Y6XA 4OFZA 3SS1A 2ZM2A 3NRXA 4EXTA 4CI1B 4CXYA 4MFRA 3IF8B 4O4IE 3VKHA 4K0UA 3NZQA 5LOVE 1S94A 2KWHA 4AQFA 2D2SA 3KVBA 4UV9B 2L8KA 4QXCB 3PUQA 5LBQB 2V7KA 5DQWA 3ZPOA 5F3JA 2WSSV 3ZCJA 3RC8A 3AA7B 4EOZB 3HKEE 1QUUA 2MTQA 2CLYB 3KV9A 4AQFC 5KDMC 1KK7A 3FBZA 4GK0E 4E7SA 5C8YE 2BDEA 2DI4A 3EDVA 4TV8E 3F2EA 2OA5A 5HWYA 3N9NA 3C51A 3P7IA 5L3DB 1IZNB 4EZ4A 3LK3B 4BJMA 3HA4A 3TKLB 3SOLA 4H9OC 1HG5A 4H9QC 3UULA 1FIOA 1D1CA 2MYSA 3JC6D 4ZS3A 5L3FB 2VB6A 1G8XA 4BA9A 2JRKA 2WMOA 4HTEA 1D1BA 3E22E 5FXXA 3ZEFB 1X79A 2BZBA 5JR9B 2X68A 2LOPA 2NOXA 4I4TE 4AKIA 2X9WA 5FY1A 2CE7A 4TUYE 3AVSA 1MMGA 2E9XD 2UXNB 2KMFA 3CQGB 2LM9A 3EVYA 3CX6B 5EZYE 5HXEA 3ZMZB 1HF8A 2XAFB 3MZKB 1D1AA 5JDMA 2V7JA 1ZEEA 2HPLA 3E0ZA 5HWXA 3GA8A 5FP3A 3ZMVB 5JR9C 3I1AA 4KP3C 2CWOA 3HL6A 5LGTB 3K3OA 3QK6A 1WR6A 5LA6E 3F57A 4JEHB 2CXLA 3B13A 1FMVA 4P0BA 2YK0A 4L9IA 5FXZA 5HAXA 4P0AA 3PUGA 3GN5A 3N9MA 1VRBA 2W00A 4AQGA 2XHEB 4IE6A 5CA1E 3ANWA 2KZ7B 2IAKA 2X51A 2YINA 3N5LA 4OYKA 2X9HA 1YW0A 4KBMB 4O2AE 4IGUA 3N9PA 4HE8A 3AA1B 5JDLA 2CXDA 4G63A 2A2FX 3GWHA 3UTKA 4EYYR 3AVRA 4DBRA 4ZOLE 4QKNA 4DVDA 3I9YA 2DNXA 3PE0A 5DQVA 2CMRA 2Y48B 1HCIA 3U78A 2ODVA 3LK42 3MA9A 3R6NA 1MIWA 4DBQA 2QA7A 2KT9A 3IEEA 2Q9QC 5H6RB 3SWHA 1ZHCA 3FHNA 3UUMA 3OBVE 3HKBE 4QWNB 4ZI2D 5LJMA 3VHLA 3UUNA 2EHOD 3IHRA 3Q5XA 3E08A 2HPJA 3GMIA 4C90A 4CQIA 5FMNA 5H6QB 3VU7H 4ADZA 1FMWA 5LYJE 3BQKA 4X1IE 4DNDA 2LHRA 4YFSA 2K24A 3RRWA 3UFEA 3ZMUB 2K5BB 4HN9A 1O3XA 4IDZA 2V7MA 4EAHA 4EIWA 4UF0A 5DABA 4DO0A 5LP6E 5LHHB 2G0UA 1MMNA 1OXZA 2NW9A 1U4QA 3BQLA 2W62A 5LCYA 3O9XA 3OYZA 3DP7A 1E1HB 4ILUA 5FYMA 3L09A 2DWGA 2PG8A 3MACA 4ZI7E 3NZPA 1MNEA 2Q9QD 4TX5A 4CI2B 2CCQA 5KX5E 3PURA 1S35A 5IHYA 5LXTE 5HXSA 2N9DA 3MXZA 5JR9A 4ZHQE 4NUUA 2LSGA 2DCFA 3CKDA 3T8OA 4ZI2C 4ASKA 1NAFA 4O4LE 4PNIA 3ZCIA 5DJQC 5JDHA 2E9XC 4F6RC 1LKXA 1YD8G 2XAJB 2Y8DA 3SRZA 5L3CB 2L9QA 2MBGA 3KFWX 3A5XA 2XAGB 4GK5E 4U74A 2C5JA 2KNDA 4G2AA 4PW8A 5JQGE 3HKCE 4UEMA 2YU1A 3FB2A 2LE8A 3ANWB 3ETUA 4O4HE 3AB3B 5JH7E 2JPFA 1WYCA 4IE7A 4UXNB 3GN5B 2ZLYA 2XQYA 2LEHA 1CUNA 4OYJA 5FXWA 2BVLA 2QGSA 1D0YA 5J1GA 5JRCA 5L2LA 4GIWA 3KV4A 4QX8B 4EZHA 2Z6EA 4UF0B 2NP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R C;  4H9O C;  4HGA A;  4H9Q C;  4H9P C;  4H9N C;  4H9S E;  5KDM C; 
#chains in the Genus database with same CATH topology
 3MK7 C;  3L39 A;  2NWB A;  5L3G B;  3LG7 A;  4L0R A;  4V1A v;  4ISS A;  2DHR A;  3KV5 A;  3AEB A;  2N2N A;  1T7S A;  1H7C A;  3V5U A;  3ZYK A;  5ADX L;  4JLE A;  3D0T A;  4IDP A;  1QLB A;  4YY3 T;  2JQQ A;  1EZ3 A;  2E8I A;  2RA1 A;  1HR0 T;  3Q5W A;  1WCR A;  3AA6 B;  2ZM8 A;  2XTL A;  4GOU A;  4I43 B;  3PUA A;  2V26 A;  4PFP A;  2LSK A;  4IHJ E;  2NW8 A;  5HWX A;  1ZV4 X;  4JUY A;  3Q2M A;  4H63 V;  3OKQ A;  2RP4 A;  2BVM A;  3TLW A;  4QXH B;  3RRC A;  4PJN A;  5CB4 E;  3ZLI A;  4X5T A;  5FY7 A;  4ZI3 C;  3WAK A;  1KFY A;  2YOE A;  3CX8 B;  3N9Q A;  3ZYM A;  5LGN B;  2LHN A;  1MIV A;  2J47 A;  2Q9Q A;  4TWD A;  4ZZB A;  2EHO B;  3T1Y T;  4DR5 T;  2H89 A;  3Q9D A;  4WNK A;  4OK0 A;  2K48 A;  4F8H A;  2IDO B;  3RIA A;  4CXW A;  3UQ4 A;  1IJ5 A;  4H9S E;  3C4X A;  4HWC A;  3X1D A;  2WS3 A;  1X9B A;  3FXD B;  2W0G A;  5J2T E;  5AQQ B;  1HG2 A;  5FL0 A;  1LVK A;  2C0S A;  4H9R C;  2VVN A;  4HKA A;  4U7I A;  4YLH A;  4A56 A;  3K3Q C;  4UVC B;  3WAJ A;  4X62 T;  2XPK A;  2X0H A;  4UV8 B;  3PDY A;  5AQV B;  3CQC B;  3KBU A;  2DLR A;  2CA5 A;  1Z0P A;  4I50 E;  3RX6 A;  1OED A;  4EB6 E;  2CEA A;  4KMC A;  3I9W A;  4K0K T;  3N9L A;  2LOS A;  5JRE A;  2J1D G;  5CA0 E;  2LSJ A;  1LRZ A;  2W61 A;  2XUE A;  2IW5 B;  2A3D A;  3P50 A;  4GYS A;  5AQH B;  2WWV A;  1XNQ T;  2K9A A;  2MAW A;  2WDV A;  2YN6 A;  5GON E;  4AI6 A;  1B7T A;  3FZL B;  4QH4 A;  3CQX C;  1AJ3 A;  4MHC A;  2X9Y A;  5F8P A;  2LRK A;  4X20 E;  4YJ2 E;  2BS3 A;  2WQY A;  2HN1 A;  2OLT A;  5ABF A;  2JMK A;  3L8R A;  1YKH B;  3MJX A;  3H37 A;  3WI3 A;  5AQL B;  2UU9 T;  1YQ3 A;  2CXF A;  2E9X B;  2QYW A;  2V8S V;  2WZI A;  5EK3 A;  2FJB A;  5EK4 A;  4DMW A;  2J62 A;  4YSZ A;  3L3P A;  2M67 A;  4PFO A;  2YU2 A;  4ZI3 D;  4X65 T;  4DV4 T;  5L47 A;  3C98 B;  3RKO A;  2SPC A;  2V7I A;  4PAG A;  3I0O A;  5HCJ A;  1W9R A;  1SA0 E;  2VKD A;  1VOM A;  3KBT A;  3DJB A;  3SFE A;  2KLQ A;  3KVA A;  3RKG A;  5LNK A;  1U5P A;  2CBI A;  2BG9 A;  3ZT6 A;  2H7O A;  1WLX A;  3EUH A;  3OYX A;  3UU4 A;  3KIN B;  4YHH T;  4O2B E;  5M4Y A;  4IDO A;  1HTJ F;  4ANJ A;  4AIS A;  1SE7 A;  4O4J E;  5F5W A;  1HS7 A;  2C5I T;  3EAB A;  2ZMA A;  3P8C D;  3EAM A;  2UXX B;  5HEJ A;  5L3E B;  3RYC E;  4UVA B;  2E9X A;  1Y64 B;  1XDP A;  4AKL A;  4B6X A;  4O8S A;  3ONX A;  5FXV A;  4IL9 A;  1BR4 A;  5FVK A;  4IE5 A;  4P09 A;  5J2U E;  3VR8 A;  5LHG B;  2PFV A;  3P4P A;  3FXE B;  4A98 A;  4AKG A;  1D0X A;  5BR8 T;  3N2K E;  3N2O A;  4YT0 A;  1KNR A;  1SUM B;  4PK6 A;  3O1J A;  2VWA A;  2XAQ B;  4BJN A;  3O1H A;  4MAL A;  4XAX B;  3RF1 A;  3ZC1 A;  4JEU B;  3A8Y C;  1T98 A;  2Q9Q B;  3HR0 A;  4HEA A;  3ZJ1 A;  4BAY B;  4YSX A;  3LFM A;  2ZM6 T;  4JI0 T;  3RYH E;  3B57 A;  2LM2 A;  4EZH A;  3ESL A;  2WBL A;  4QH1 A;  4UVB B;  3UUX B;  1WRD A;  5BMV E;  2YDR A;  2L3L A;  1M62 A;  2IML A;  4X1K E;  1IJ6 A;  3LBX B;  3HKD E;  5JTG A;  2B76 A;  4HFD A;  2AXD S;  3N9O A;  2ODU A;  1NWM X;  1W0A A;  3O4X E;  3OVU A;  2X0Y A;  3JCF A;  1BR2 A;  2WMN A;  3JAF A;  4IST A;  3AAI A;  5FY0 A;  5AQG B;  5TAO A;  5CFB A;  1IBL T;  1LVF A;  3PV0 F;  3FZM B;  4FI5 A;  5C3J A;  1NEK A;  2NW7 A;  4UR9 A;  2VQE T;  3QB5 A;  2ACZ A;  5FNV E;  2BBJ A;  2LSY A;  4NPP A;  2JJ9 A;  1UX5 A;  2A72 A;  2W63 A;  2XQ6 A;  3AAA B;  2VK9 A;  3BK9 A;  2B1E A;  3K8P C;  4KX6 A;  4HWH A;  4YXD A;  4LFB T;  2WP9 A;  2D0U A;  3F31 A;  3PUS A;  4HGA A;  2NR4 A;  2OV9 A;  2YDS A;  2V1D B;  2UXC T;  3H3A A;  3IA3 A;  3PUW F;  4DMV A;  3O1I A;  2VKO A;  3NBX X;  3B5M A;  1XZY A;  2BKN A;  2WAU A;  4QHO A;  5FVL A;  4PJL A;  3VR9 A;  4NXN T;  2PBI A;  4QX7 B;  4CN4 A;  5EK2 A;  1YKE B;  2D5U A;  4YJ3 E;  2UUB T;  1N32 T;  5HEU A;  4HFH A;  4DR1 T;  3VKG A;  3FZH B;  3CML A;  2KWI B;  5KMG P;  4P1N A;  2C5K T;  1BR1 A;  3ZST A;  2IC6 A;  2UUA T;  1ZOY A;  2NTX A;  4C91 A;  1ZP0 A;  4N78 D;  1ZKE A;  3FZF B;  4HFV A;  3C64 A;  3AE3 A;  4U72 A;  5ABG A;  4YTP A;  2P9B A;  2GK9 A;  3ZYL A;  4TN7 B;  4A97 A;  1Y01 A;  2PJQ A;  2RPA A;  1SHZ C;  4JI2 T;  4Q25 A;  2XJ7 A;  2WM9 A;  3C4W A;  2FJA A;  3ZSS A;  3NRY A;  5KXJ A;  4XBF B;  4ERR A;  3R84 B;  3EDU A;  1G73 A;  3AE8 A;  1XMQ T;  2UXD T;  5AFU L;  3RC3 A;  2I0M A;  1QSD A;  4QXB B;  1MND A;  2V6Y A;  5E0O A;  4DV6 T;  2DWK A;  2ACX A;  4LF9 T;  4DR7 T;  5HXC A;  3EHZ A;  4Z8X A;  2H7V C;  4LML A;  2HH7 A;  2H88 A;  5A1L A;  4HWI B;  3AEA A;  3AED A;  3EI0 A;  4DV0 T;  2WZH A;  5LHI B;  3MKD A;  2H3R A;  4LF8 T;  3RQU A;  3CVR A;  4LF7 T;  3ZMT B;  5HXR A;  3N2G E;  5HCM A;  3LJC A;  5J0Z A;  3LDQ B;  5LBM A;  3AA0 B;  5JRC B;  4WW0 A;  3ZN0 B;  3IBP A;  3W15 B;  2BG9 C;  4HWD A;  2ZM0 A;  3U3I A;  4TZ4 C;  4B3T T;  2NTY A;  2JQ9 A;  4Z90 A;  3ZN1 B;  4ZXL A;  5LG3 A;  1V9D A;  4TNW A;  2VL0 A;  3J9X 1;  2BS2 A;  2XQ7 A;  2KXP B;  4Z91 A;  4CZZ B;  2E5V A;  3TLU A;  4FJO A;  3NKZ A;  3RLF F;  2W66 A;  4EYU A;  4LF6 T;  1MIY A;  1NEN A;  3ETV A;  1XMO T;  2CLY C;  1KNZ A;  4ILA A;  3K3N A;  5HXH A;  5HYA A;  3HI2 A;  3DTO A;  4KI0 F;  3CK6 A;  1FEW A;  1OWA A;  3CPZ A;  2YDQ A;  5ABH A;  2FJE A;  5JDG A;  2FUP A;  3ZT5 A;  4H9P C;  2LJL A;  2HHH T;  2W4X A;  3AE6 A;  2HN2 A;  2LKG A;  3T1H T;  4JI8 T;  1WR0 A;  1KEY A;  2WU2 A;  5IYZ E;  2J4G A;  5JDQ A;  1GQE A;  4MLK A;  3PJA A;  4NUV A;  4GYR A;  3J7Y q;  4LF5 T;  4UEL A;  2KSR A;  2JMH A;  2V7L A;  4MBQ A;  2PTF A;  5AQO B;  5ETW A;  3SFD A;  3C4Z A;  4DR6 T;  4B3M T;  3QC9 A;  4UIG A;  5LGU B;  1IAP A;  3OJA A;  5JVD E;  3LBX A;  1IBK T;  2LKH A;  2N1G A;  1T72 A;  2XQ4 A;  3K1S A;  3UT5 E;  1BR0 A;  3PU3 A;  3TLS A;  4OX9 T;  2EHO C;  3S4U A;  4CN6 A;  3CIR A;  3G06 A;  4TV9 E;  3LK2 B;  2E2A A;  4IE0 A;  3QUJ A;  4U2Y A;  4YHJ A;  2CWY A;  4AKR B;  2YEV C;  4I55 E;  2XM2 A;  4LFA T;  3BQI A;  3KV6 A;  4H9N C;  4WBO A;  2VAS A;  3KDS E;  1M7K A;  3FBL A;  4CI3 B;  2EHO A;  4IDQ A;  4XZC A;  1OED B;  4E7Z A;  4EV6 A;  2M6B A;  1WFD A;  3CWZ B;  5LJN A;  2IUB A;  1HX8 A;  3ZMS B;  2D0T A;  2WCA A;  2XAS B;  3JC6 C;  1UX4 A;  3PTR B;  4KHP T;  1WYB A;  3ZJ2 A;  2XQ9 A;  2KIN B;  2VL8 A;  4NXM T;  1OED E;  2LSI A;  4M1P A;  1MMD A;  2XAH B;  5JDN A;  4ZS2 A;  1J5E T;  5HEG A;  4EED A;  5LMU T;  2ES0 A;  1D0Z A;  1OED C;  2I59 A;  4J2C A;  1US7 B;  2VKJ A;  2IC9 A;  3AXJ B;  4PJJ A;  1N36 T;  1N33 T;  4DUY T;  4L5G A;  3UFG A;  1HFA A;  1XDO A;  4OHF A;  2CRB A;  5LG4 A;  3RYI E;  1HX1 B;  1MMA A;  4IIJ E;  3AEE A;  3PU8 A;  2X9X A;  4KUM B;  4IDN A;  4PK4 A;  4PJM A;  3V5S A;  3I0Q A;  1J1J A;  1UCU A;  2VKH A;  4CXX A;  5AQM B;  4TNV A;  4AXP A;  4DR2 T;  2W2U A;  2LT3 A;  4B3S T;  2CM0 A;  2X67 A;  5JDF A;  2X0L B;  5CGM A;  3M65 A;  4X1Y E;  1JNR A;  1E7P A;  2X66 A;  3RPU A;  4B3R T;  2E5L T;  3LSV A;  3PJA J;  3RYF E;  4IE4 A;  4JV5 T;  3C50 A;  1UK5 A;  3CX7 B;  2MOZ A;  2WWU A;  3AAE B;  4CN1 A;  1W09 A;  4WBN E;  2Y6X A;  4OFZ A;  3SS1 A;  2ZM2 A;  5ABE A;  3NRX A;  4EXT A;  2A9U A;  2JQK A;  4CI1 B;  4YTM A;  4CXY A;  3UUB A;  4MFR A;  3IF8 B;  4O4I E;  2V5D A;  3VKH A;  4K0U A;  4JI5 T;  3NZQ A;  5LOV E;  1S94 A;  2KWH A;  3TLT A;  4AQF A;  2D2S A;  3KVB A;  4UV9 B;  2L8K A;  4QXC B;  3UU5 A;  3PUQ A;  2XQ3 A;  5LBQ B;  2V7K A;  3A7M A;  4KHZ F;  5DQW A;  3ZPO A;  5F3J A;  2WSS V;  2DL1 A;  3ZCJ A;  3RC8 A;  4AKH A;  3AA7 B;  4EOZ B;  3HKE E;  1QUU A;  2MTQ A;  2CLY B;  3KV9 A;  4AQF C;  2UXB T;  4U3C A;  5KDM C;  1KK7 A;  4AQY T;  4JBW F;  3FBZ A;  4GK0 E;  2JIW A;  4E7S A;  5C8Y E;  2BDE A;  2DI4 A;  3EDV A;  3NVO A;  3F2E A;  3P4R A;  3ONL C;  2OA5 A;  4TV8 E;  3N9N A;  5HWY A;  3TLV A;  3C51 A;  5LMN T;  2XQA A;  3AE4 A;  3P7I A;  5L3D B;  1IZN B;  4EZ4 A;  3LK3 B;  3QB5 K;  2M6I A;  4BJM A;  3HA4 A;  5L4E A;  3TKL B;  3P4Q A;  4H9O C;  1HG5 A;  4H9Q C;  3AE1 A;  3SOL A;  3UUL A;  1FIO A;  1D1C A;  2MYS A;  3JC6 D;  4ZS3 A;  3ONJ A;  3ZT7 A;  3RQW A;  2VB6 A;  4HWF A;  1G8X A;  4BA9 A;  5L3F B;  3UQ7 A;  2JRK A;  5AQF B;  4DR4 T;  3PUX F;  2WMO A;  4ZZC A;  4HTE A;  1D1B A;  3E22 E;  3JAE A;  5FXX A;  2VUR A;  4A5X A;  1X79 A;  2BZB A;  3ZEF B;  2XSA A;  2MPK A;  3NWI A;  5JR9 B;  2X68 A;  1IBM T;  2XZE A;  2LOP A;  2NOX A;  4I4T E;  4AKI A;  3M3Z B;  1Z8U A;  2X9W A;  3AEF A;  2CE7 A;  4TUY E;  3AVS A;  5FY1 A;  1MMG A;  2E9X D;  2UXN B;  2KMF A;  3CQG B;  3AE7 A;  2VQF T;  1HNX T;  2LM9 A;  3EVY A;  3CX6 B;  5EZY E;  5HXE A;  3ZMZ B;  1JNZ A;  1L0V A;  4I0U A;  5L3B B;  1HF8 A;  1CHU A;  1KNP A;  2XAF B;  1D1A A;  3MZK B;  4DV3 T;  3RIF A;  5AQP B;  5JDM A;  4DV7 T;  2V7J A;  1ZEE A;  1UUS A;  2HPL A;  3AE9 A;  3E0Z A;  3GA8 A;  5AQT B;  2WY2 A;  5FP3 A;  5FKY A;  3AE2 A;  3I1A A;  3ZMV B;  4COF A;  2I6H A;  5JR9 C;  2UUC T;  4KP3 C;  2CWO A;  2FBW A;  3HL6 A;  5LGT B;  3K3O A;  3QK6 A;  1WR6 A;  5LA6 E;  3F57 A;  4JI7 T;  2BS4 A;  4JEH B;  2LRL A;  3RGL A;  3AEG A;  2CXL A;  3B13 A;  1I94 T;  3OPC A;  1FMV A;  4P0B A;  2YK0 A;  4L9I A;  4TWF A;  4WZX A;  4IL4 A;  5FXZ A;  5HAX A;  3RI5 A;  4P0A A;  3PUG A;  1HNZ T;  3GN5 A;  3N9M A;  5LB7 B;  1VRB A;  2W00 A;  4AQG A;  2XHE B;  4IE6 A;  3ABV A;  3ANW A;  3ZKR A;  2KZ7 B;  2IAK A;  2X51 A;  2YIN A;  3N5L A;  4OYK A;  3UU3 A;  3OTO T;  4LFC T;  2X9H A;  1YW0 A;  4KBM B;  3H3M A;  4O2A E;  4IGU A;  3N9P A;  3QOF A;  4HE8 A;  1UGO A;  4JI3 T;  4NIQ A;  2QRX A;  3AA1 B;  2CXD A;  4G63 A;  2YKS A;  3RH3 A;  5JDL A;  2A2F X;  3GWH A;  3UTK A;  4EYY R;  4LMJ A;  3AVR A;  2V6Y B;  2K3W A;  4QKN A;  4ZOL E;  3I9Y A;  4DVD A;  4DBR A;  2DNX A;  3PE0 A;  5DQV A;  4GKK T;  2CMR A;  2Y48 B;  1HCI A;  3U78 A;  5FL1 A;  4X64 T;  2ODV A;  3LK4 2;  2VVS A;  4IRE A;  2JQH A;  3MA9 A;  2V6X A;  3R6N A;  1MIW A;  3Q5D A;  5L4H A;  4DBQ A;  2QA7 A;  2XY8 B;  1VCT A;  2KT9 A;  2BKP A;  3IEE A;  4DV1 T;  3UU8 A;  2Q9Q C;  5H6R B;  4YTN A;  3SWH A;  5C2T A;  1ZHC A;  2W67 A;  5AQS B;  1KF6 A;  1T8B A;  2FJD A;  3FHN A;  3UUM A;  4DV2 T;  2WDQ A;  1UUR A;  2IHR 1;  3HKB E;  3OBV E;  4HFI A;  4QWN B;  4U2Z A;  4ZI2 D;  5LJM A;  3VHL A;  1HNW T;  3UUN A;  3RIU C;  2EHO D;  3IHR A;  1I6Z A;  3Q5X A;  4JI4 T;  3E08 A;  2HPJ A;  3GMI A;  4C90 A;  4CQI A;  5FMN A;  5H6Q B;  4U31 A;  2QVA A;  5AQR B;  3JAD A;  3VU7 H;  4H63 H;  4ADZ A;  1FMW A;  5LYJ E;  4ILB A;  3BQK A;  4X1I E;  3RIU A;  4DND A;  2LHR A;  4DV5 T;  4HFC A;  2BBH A;  2K24 A;  4YFS A;  3RRW A;  3UFE A;  3ZMU B;  2K5B B;  4HN9 A;  1O3X A;  4IDZ A;  4ZEY A;  2V7M A;  4U7Y A;  4EAH A;  4EIW A;  4UF0 A;  5DAB A;  4DO0 A;  5CA1 E;  5LP6 E;  4DR3 T;  5LHH B;  2G0U A;  2LLY A;  1MMN A;  3RHW A;  3P4W A;  4DUZ T;  1OXZ A;  1R8I A;  1U4Q A;  2CBJ A;  2NW9 A;  3BQL A;  2W62 A;  5LCY A;  5AQJ B;  5IWA T;  3O9X A;  5AQK B;  1YXR A;  2BG9 E;  4U33 A;  3OYZ A;  3DP7 A;  1E1H B;  4ILU A;  3PUY F;  4HFB A;  3L09 A;  2DWG A;  5FYM A;  3UU6 A;  2PG8 A;  3MAC A;  5HEO A;  1VCS A;  4ZI7 E;  1XWM A;  4JI6 T;  1DU2 A;  3NZP A;  5AQU B;  2XSB A;  1MNE A;  2Q9Q D;  4TX5 A;  2CHO A;  5HEH A;  4LMK A;  5ABF B;  4TWH A;  4CI2 B;  4JI1 T;  3PUZ F;  1FJG T;  4X66 T;  2CCQ A;  5KX5 E;  3PUR A;  1S35 A;  5IHY A;  5LXT E;  4QH5 A;  5HXS A;  2N9D A;  2AE9 A;  2WDR A;  3MXZ A;  3QNU A;  5JR9 A;  4ZHQ E;  4NUU A;  2LSG A;  4LF4 T;  2DCF A;  3CKD A;  4HFE A;  3T8O A;  4ASK A;  3AEC A;  4DID B;  3FZK B;  4YSY A;  4ZI2 C;  2WB5 A;  1NAF A;  2XQ5 A;  2D9D A;  4O4L E;  2BKO A;  4PNI A;  5AQN B;  3P4S A;  3ZCI A;  5DJQ C;  5AQI B;  5JDH A;  2IIU A;  2E9X C;  4F6R C;  1LKX A;  3Q5E A;  3VRA A;  1YD8 G;  2F4V T;  2XAJ B;  2Y8D A;  3PUV F;  1E2A A;  4ILC A;  2L9Q A;  2MBG A;  3SRZ A;  5L3C B;  3ZC0 A;  1N34 T;  3KFW X;  3A5X A;  2V5C A;  2XAG B;  3AE5 A;  4IT4 A;  4GK5 E;  4U74 A;  2C5J A;  4EEB A;  2KND A;  4G2A A;  4PW8 A;  5JQG E;  2CPT A;  5CJ5 A;  1W0B A;  3AXJ A;  3HKC E;  4UEM A;  2R6G F;  2YU1 A;  3FB2 A;  2LE8 A;  3ANW B;  3ETU A;  2CHN A;  4O4H E;  1XNR T;  3AB3 B;  4JYA T;  5JH7 E;  2JPF A;  1WYC A;  2WU5 A;  1YQ4 A;  4IE7 A;  2XM1 A;  2ZLY A;  3GN5 B;  4UXN B;  2XQY A;  3VRB A;  2LEH A;  1J5W A;  1CUN A;  4OYJ A;  5FXW A;  2BVL A;  2BG9 B;  4WYV A;  2QGS A;  1D0Y A;  5J1G A;  5IUX A;  4GKJ T;  5JRC A;  2XQ8 A;  5L2L A;  4GIW A;  4AIU A;  3KV4 A;  4QX8 B;  4EGW A;  2Z6E A;  4UF0 B;  2NP9 A;  4PK5 A; 
#chains in the Genus database with same CATH homology
 3MK7 C;  2NWB A;  5L3G B;  3LG7 A;  4L0R A;  4V1A v;  4ISS A;  2DHR A;  3KV5 A;  3ZYK A;  2N2N A;  1H7C A;  3V5U A;  5ADX L;  4JLE A;  3D0T A;  2JQQ A;  1EZ3 A;  2E8I A;  2RA1 A;  3Q5W A;  3AA6 B;  2ZM8 A;  2XTL A;  4GOU A;  4I43 B;  3PUA A;  2V26 A;  4PFP A;  2LSK A;  4IHJ E;  2NW8 A;  1ZV4 X;  4JUY A;  3Q2M A;  4H63 V;  3OKQ A;  2RP4 A;  2BVM A;  4QXH B;  3RRC A;  4PJN A;  5CB4 E;  3ZLI A;  5FY7 A;  4ZI3 C;  3WAK A;  3N9Q A;  3ZYM A;  3CX8 B;  5LGN B;  2LHN A;  1MIV A;  2Q9Q A;  2EHO B;  3Q9D A;  4WNK A;  4OK0 A;  2K48 A;  4CXW A;  1IJ5 A;  4H9S E;  3C4X A;  3FXD B;  5J2T E;  2W0G A;  1HG2 A;  1LVK A;  2C0S A;  4H9R C;  4HKA A;  4YLH A;  4AKH A;  4A56 A;  3WAJ A;  3K3Q C;  4UVC B;  4UV8 B;  3PDY A;  3CQC B;  3KBU A;  2DLR A;  2CA5 A;  1Z0P A;  4I50 E;  3RX6 A;  4EB6 E;  2CEA A;  4KMC A;  3I9W A;  3N9L A;  2LOS A;  5JRE A;  2J1D G;  5CA0 E;  2LSJ A;  1LRZ A;  2W61 A;  2XUE A;  2IW5 B;  2A3D A;  4GYS A;  4AI6 A;  2K9A A;  5GON E;  1B7T A;  3CQX C;  1AJ3 A;  4MHC A;  2X9Y A;  5F8P A;  4X20 E;  4YJ2 E;  2JMK A;  3WI3 A;  1YKH B;  3MJX A;  3H37 A;  2CXF A;  2E9X B;  4DMW A;  5EK3 A;  5EK4 A;  3L3P A;  2M67 A;  4PFO A;  2YU2 A;  4ZI3 D;  3C98 B;  3RKO A;  2SPC A;  2V7I A;  4PAG A;  3I0O A;  2VKD A;  1SA0 E;  3KBT A;  1VOM A;  3DJB A;  2KLQ A;  3KVA A;  5LNK A;  1U5P A;  2H7O A;  1WLX A;  3EUH A;  3OYX A;  3KIN B;  4O2B E;  5M4Y A;  1HTJ F;  4ANJ A;  4O4J E;  1HS7 A;  2C5I T;  2ZMA A;  3P8C D;  2UXX B;  5L3E B;  3RYC E;  4UVA B;  2E9X A;  1Y64 B;  4AKL A;  4B6X A;  4O8S A;  3ONX A;  5FXV A;  1BR4 A;  4IE5 A;  4P09 A;  5J2U E;  5LHG B;  2PFV A;  3FXE B;  4AKG A;  1D0X A;  3N2K E;  3N2O A;  4PK6 A;  3O1J A;  2VWA A;  2XAQ B;  4BJN A;  3O1H A;  4MAL A;  4XAX B;  3ZC1 A;  4JEU B;  1T98 A;  2Q9Q B;  3HR0 A;  4HEA A;  3ZJ1 A;  4BAY B;  3LFM A;  3RYH E;  3B57 A;  3ESL A;  2WBL A;  4UVB B;  3UUX B;  1WRD A;  5BMV E;  2L3L A;  4X1K E;  1IJ6 A;  3LBX B;  3HKD E;  3N9O A;  3O4X E;  2ODU A;  1NWM X;  4H63 H;  5HXC A;  1BR2 A;  2WMN A;  4IST A;  5FY0 A;  3AAI A;  5TAO A;  1LVF A;  4FI5 A;  2NW7 A;  5FNV E;  2LSY A;  3BK9 A;  1UX5 A;  2A72 A;  2JJ9 A;  2W63 A;  3AAA B;  2VK9 A;  3K8P C;  2B1E A;  4PK5 A;  5L3B B;  3PUS A;  2D0U A;  3F31 A;  4HGA A;  2V1D B;  3H3A A;  4DMV A;  3O1I A;  2VKO A;  3NBX X;  2WAU A;  4QHO A;  4PJL A;  2PBI A;  4QX7 B;  5EK2 A;  1YKE B;  2D5U A;  4YJ3 E;  3VKG A;  3CML A;  2KWI B;  5KMG P;  2C5K T;  1BR1 A;  2IC6 A;  2NTX A;  4C91 A;  4N78 D;  1ZKE A;  4HFV A;  3C64 A;  4U72 A;  2P9B A;  2GK9 A;  3ZYL A;  4TN7 B;  3ZC0 A;  2PJQ A;  1SHZ C;  3C4W A;  2WM9 A;  3NRY A;  4XBF B;  4ERR A;  3R84 B;  3EDU A;  1G73 A;  5AFU L;  3RC3 A;  1QSD A;  4QXB B;  1MND A;  5E0O A;  2DWK A;  2ACX A;  4Z8X A;  2H7V C;  2HH7 A;  5A1L A;  5LHI B;  3MKD A;  2H3R A;  3CVR A;  3ZMT B;  5HXR A;  3N2G E;  3LJC A;  5LBM A;  3AA0 B;  5JRC B;  4WW0 A;  3ZN0 B;  3IBP A;  3W15 B;  2ZM0 A;  3U3I A;  4TZ4 C;  2NTY A;  3ZN1 B;  1V9D A;  3J9X 1;  4CZZ B;  2KXP B;  4EYU A;  4FJO A;  1MIY A;  3ETV A;  2CLY C;  1KNZ A;  3K3N A;  5HXH A;  5HYA A;  3HI2 A;  3DTO A;  1FEW A;  1OWA A;  3CPZ A;  5JDG A;  4H9P C;  2LJL A;  5IYZ E;  5JDQ A;  4MLK A;  4NUV A;  4GYR A;  3J7Y q;  4UEL A;  2JMH A;  2V7L A;  4MBQ A;  5ETW A;  3C4Z A;  3QC9 A;  4UIG A;  5LGU B;  1IAP A;  3OJA A;  5JVD E;  3LBX A;  1BR0 A;  2N1G A;  3UT5 E;  3PU3 A;  2EHO C;  3S4U A;  4TV9 E;  3LK2 B;  4IE0 A;  4AKR B;  3QUJ A;  4YHJ A;  2CWY A;  2YEV C;  4I55 E;  3BQI A;  3KV6 A;  4H9N C;  4WBO A;  2VAS A;  3KDS E;  3FBL A;  4CI3 B;  2EHO A;  4XZC A;  4E7Z A;  3CWZ B;  5LJN A;  1HX8 A;  3ZMS B;  2XAS B;  2D0T A;  3PTR B;  3JC6 C;  1UX4 A;  1WYB A;  3ZJ2 A;  2KIN B;  2VL8 A;  2LSI A;  4M1P A;  1MMD A;  2XAH B;  5JDN A;  4ZS2 A;  2ES0 A;  1D0Z A;  2I59 A;  4J2C A;  4PJJ A;  1US7 B;  2VKJ A;  2IC9 A;  3RH3 A;  4L5G A;  5LG4 A;  1HFA A;  4OHF A;  3RYI E;  1MMA A;  4IIJ E;  3PU8 A;  4KUM B;  2X9X A;  4PK4 A;  3V5S A;  4PJM A;  3I0Q A;  1UCU A;  2VKH A;  4CXX A;  4AXP A;  2LT3 A;  2CM0 A;  2X67 A;  5JDF A;  2X0L B;  3M65 A;  4X1Y E;  2X66 A;  3RPU A;  3RYF E;  4IE4 A;  3C50 A;  3CX7 B;  4WBN E;  2MOZ A;  2WWU A;  3AAE B;  2Y6X A;  4OFZ A;  3SS1 A;  2ZM2 A;  3NRX A;  4EXT A;  4CI1 B;  4CXY A;  4MFR A;  3IF8 B;  4O4I E;  3VKH A;  4K0U A;  3NZQ A;  5LOV E;  1S94 A;  2KWH A;  4AQF A;  2D2S A;  3KVB A;  4UV9 B;  2L8K A;  4QXC B;  3PUQ A;  5LBQ B;  2V7K A;  5DQW A;  3ZPO A;  5F3J A;  2WSS V;  3ZCJ A;  3RC8 A;  3AA7 B;  4EOZ B;  3HKE E;  1QUU A;  2MTQ A;  2CLY B;  3KV9 A;  4AQF C;  5KDM C;  1KK7 A;  3FBZ A;  4GK0 E;  4E7S A;  5C8Y E;  2BDE A;  2DI4 A;  3EDV A;  4TV8 E;  3F2E A;  2OA5 A;  5HWY A;  3N9N A;  3C51 A;  3P7I A;  5L3D B;  1IZN B;  4EZ4 A;  3LK3 B;  4BJM A;  3HA4 A;  3TKL B;  3SOL A;  4H9O C;  1HG5 A;  4H9Q C;  3UUL A;  1FIO A;  1D1C A;  2MYS A;  3JC6 D;  4ZS3 A;  5L3F B;  2VB6 A;  1G8X A;  4BA9 A;  2JRK A;  2WMO A;  4HTE A;  1D1B A;  3E22 E;  5FXX A;  3ZEF B;  1X79 A;  2BZB A;  5JR9 B;  2X68 A;  2LOP A;  2NOX A;  4I4T E;  4AKI A;  2X9W A;  5FY1 A;  2CE7 A;  4TUY E;  3AVS A;  1MMG A;  2E9X D;  2UXN B;  2KMF A;  3CQG B;  2LM9 A;  3EVY A;  3CX6 B;  5EZY E;  5HXE A;  3ZMZ B;  1HF8 A;  2XAF B;  3MZK B;  1D1A A;  5JDM A;  2V7J A;  1ZEE A;  2HPL A;  3E0Z A;  5HWX A;  3GA8 A;  5FP3 A;  3ZMV B;  5JR9 C;  3I1A A;  4KP3 C;  2CWO A;  3HL6 A;  5LGT B;  3K3O A;  3QK6 A;  1WR6 A;  5LA6 E;  3F57 A;  4JEH B;  2CXL A;  3B13 A;  1FMV A;  4P0B A;  2YK0 A;  4L9I A;  5FXZ A;  5HAX A;  4P0A A;  3PUG A;  3GN5 A;  3N9M A;  1VRB A;  2W00 A;  4AQG A;  2XHE B;  4IE6 A;  5CA1 E;  3ANW A;  2KZ7 B;  2IAK A;  2X51 A;  2YIN A;  3N5L A;  4OYK A;  2X9H A;  1YW0 A;  4KBM B;  4O2A E;  4IGU A;  3N9P A;  4HE8 A;  3AA1 B;  5JDL A;  2CXD A;  4G63 A;  2A2F X;  3GWH A;  3UTK A;  4EYY R;  3AVR A;  4DBR A;  4ZOL E;  4QKN A;  4DVD A;  3I9Y A;  2DNX A;  3PE0 A;  5DQV A;  2CMR A;  2Y48 B;  1HCI A;  3U78 A;  2ODV A;  3LK4 2;  3MA9 A;  3R6N A;  1MIW A;  4DBQ A;  2QA7 A;  2KT9 A;  3IEE A;  2Q9Q C;  5H6R B;  3SWH A;  1ZHC A;  3FHN A;  3UUM A;  3OBV E;  3HKB E;  4QWN B;  4ZI2 D;  5LJM A;  3VHL A;  3UUN A;  2EHO D;  3IHR A;  3Q5X A;  3E08 A;  2HPJ A;  3GMI A;  4C90 A;  4CQI A;  5FMN A;  5H6Q B;  3VU7 H;  4ADZ A;  1FMW A;  5LYJ E;  3BQK A;  4X1I E;  4DND A;  2LHR A;  4YFS A;  2K24 A;  3RRW A;  3UFE A;  3ZMU B;  2K5B B;  4HN9 A;  1O3X A;  4IDZ A;  2V7M A;  4EAH A;  4EIW A;  4UF0 A;  5DAB A;  4DO0 A;  5LP6 E;  5LHH B;  2G0U A;  1MMN A;  1OXZ A;  2NW9 A;  1U4Q A;  3BQL A;  2W62 A;  5LCY A;  3O9X A;  3OYZ A;  3DP7 A;  1E1H B;  4ILU A;  5FYM A;  3L09 A;  2DWG A;  2PG8 A;  3MAC A;  4ZI7 E;  3NZP A;  1MNE A;  2Q9Q D;  4TX5 A;  4CI2 B;  2CCQ A;  5KX5 E;  3PUR A;  1S35 A;  5IHY A;  5LXT E;  5HXS A;  2N9D A;  3MXZ A;  5JR9 A;  4ZHQ E;  4NUU A;  2LSG A;  2DCF A;  3CKD A;  3T8O A;  4ZI2 C;  4ASK A;  1NAF A;  4O4L E;  4PNI A;  3ZCI A;  5DJQ C;  5JDH A;  2E9X C;  4F6R C;  1LKX A;  1YD8 G;  2XAJ B;  2Y8D A;  3SRZ A;  5L3C B;  2L9Q A;  2MBG A;  3KFW X;  3A5X A;  2XAG B;  4GK5 E;  4U74 A;  2C5J A;  2KND A;  4G2A A;  4PW8 A;  5JQG E;  3HKC E;  4UEM A;  2YU1 A;  3FB2 A;  2LE8 A;  3ANW B;  3ETU A;  4O4H E;  3AB3 B;  5JH7 E;  2JPF A;  1WYC A;  4IE7 A;  4UXN B;  3GN5 B;  2ZLY A;  2XQY A;  2LEH A;  1CUN A;  4OYJ A;  5FXW A;  2BVL A;  2QGS A;  1D0Y A;  5J1G A;  5JRC A;  5L2L A;  4GIW A;  3KV4 A;  4QX8 B;  4EZH A;  2Z6E A;  4UF0 B;  2NP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...