4H9NC

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
molecule tags Dna binding protein/apoptosis
source organism Homo sapiens
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9nC00
4H9PC 4HGAA 4H9QC 4H9RC 4H9OC 4H9NC 5KDMC 4H9SE
chains in the Genus database with same CATH superfamily
3AECA 5HWXA 3CIRA 4PW8A 5FNVE 4YXDA 2F4VT 2WU5A 1IZNB 4GK0E 4ASKA 3LG7A 4MHCA 4YTMA 3PUZF 2VKJA 5JR9B 5CJ5A 2E9XA 3VKGA 4V1Av 3ETUA 2CEAA 3PUSA 4HEAA 4YTPA 2VL8A 2VASA 3AEAA 5HXCA 1XDOA 2XUEA 4TUYE 3SS1A 2YK0A 2XQAA 4AQGA 4IDNA 4CN4A 4EXTA 5KDMC 2C5IT 2NW9A 1YW0A 2PBIA 1MMDA 1UGOA 1QSDA 2CHNA 3QUJA 4ZHQE 2HHHT 2SPCA 4DR7T 4LF8T 4P09A 5ABGA 5LJMA 2UXBT 2KSRA 3AE5A 3EUHA 1S94A 2FJBA 2IMLA 3ZMVB 4EAHA 1SHZC 3V5UA 1CHUA 5ABEA 3GMIA 3RIAA 1LVFA 4M1PA 2MTQA 5AQLB 1WR6A 5FY7A 1HFAA 2QA7A 3QOFA 4DV2T 4JYAT 3AAAB 3BQLA 4C91A 3A5XA 2YINA 4TWFA 1YD8G 2JQHA 3KBUA 3PDYA 4NIQA 3S4UA 3CPZA 4DV0T 4H9PC 4I4TE 2UUBT 3RH3A 4H9NC 2HPLA 4CXXA 3WAJA 5H6QB 1KNPA 4K0UA 3NZQA 1T72A 4H9QC 2XQ7A 2RP4A 5FMNA 5AQRB 2JJ9A 5AQVB 5L3CB 2W67A 3RIUA 3HR0A 4HFBA 3VR9A 4JI6T 2V8SV 1E1HB 3TLTA 3P4WA 3L8RA 4U72A 1YQ4A 2K24A 3MA9A 2FBWA 4H63V 1U4QA 4MBQA 2Z6EA 3IF8B 5J0ZA 5LA6E 4YJ3E 1OEDC 2XPKA 4CXWA 2LRKA 4JI0T 2DL1A 5CB4E 1SA0E 2BS4A 2XSAA 4I0UA 5L4HA 3T1YT 2XSBA 3I1AA 2PFVA 1E7PA 4IGUA 4IDZA 3PU8A 4ZS3A 2UXNB 2H7VC 3DP7A 1WR0A 2JMHA 3HL6A 3P50A 2WMNA 3KV9A 2Q9QC 4PJNA 4JI1T 1N36T 4EYYR 1HX8A 5JREA 1BR2A 2ES0A 1E2AA 3HA4A 5J1GA 5AQGB 5LB7B 4O4LE 4HKAA 1IJ5A 2N9DA 3UT5E 1VRBA 4TZ4C 3TLVA 1KFYA 3FZHB 4QX8B 1G8XA 4JI2T 3TLUA 2X66A 2GK9A 4NXMT 4YHHT 2CE7A 2JRKA 2XASB 1T98A 2LLYA 2WBLA 2YN6A 3PJAA 3QK6A 5LCYA 4HWHA 5JDLA 4AKHA 4BA9A 5FXVA 4U2ZA 2WWUA 4JUYA 2X0LB 3F57A 2JPFA 2YDSA 2UU9T 3LDQB 1SUMB 2W63A 3N9QA 2LJLA 3LK2B 4Z90A 5FYMA 3UU6A 3TKLB 5KMGP 3OKQA 2LSYA 1BR4A 2QVAA 4UV8B 3VHLA 4A56A 4O2AE 3E0ZA 2XAJB 4ZEYA 2R6GF 3UUMA 3B5MA 4AISA 1SE7A 2XHEB 3ONLC 3ZT5A 2CPTA 2ZM8A 3P4PA 4I50E 2JQKA 1MNDA 1HG5A 1VOMA 2LT3A 1X9BA 3A7MA 2BVLA 3RI5A 3UU5A 4B6XA 1GQEA 1XNRT 4LFBT 2I59A 1HX1B 2W66A 3CX6B 4NUVA 4ZI2D 5FL0A 5AQMB 5JDGA 2YU2A 4GYSA 4P0BA 1Y64B 3CKDA 5AQHB 3FXDB 3RLFF 1CUNA 4U3CA 2NP9A 3OVUA 5LBQB 4LFCT 4GOUA 4BAYB 1UURA 1HCIA 4UVAB 3U78A 3AEEA 3EAMA 4I55E 1OEDE 2V6XA 3ZLIA 5LGNB 3Q9DA 4HTEA 4ERRA 3GWHA 5DQVA 2I6HA 4AQFA 2VKDA 4UIGA 4DVDA 2CBIA 5AQFB 1WYBA 1Z0PA 3MK7C 3FBLA 3ZYLA 4PFPA 2M6BA 1W09A 2LSJA 4UF0B 1WRDA 2E5VA 3QNUA 3PUXF 1T8BA 4AQYT 4IE7A 1EZ3A 4H63H 3ZC0A 2ODVA 3O1HA 4P1NA 5ADXL 5LHIB 3JC6C 5LJNA 2EHOC 3V5SA 2BDEA 2LM9A 2XTLA 3IEEA 3C4ZA 1MNEA 4Q25A 3SOLA 3OBVE 4GIWA 2KWHA 2KMFA 1WFDA 2X9WA 2WZIA 3K3QC 2X0HA 2V6YA 4UXNB 5HCJA 3ZJ2A 3CQGB 3JCFA 5LNKA 4TNVA 2X0YA 2WDQA 1HG2A 5CFBA 3CK6A 2XJ7A 4JBWF 2IHR1 3KBTA 2E2AA 2UUCT 2JQ9A 3IA3A 5FY0A 4IDPA 4B3MT 2D9DA 2V5CA 5LOVE 5GONE 2M67A 4KHZF 2KZ7B 1R8IA 2WS3A 2W00A 4U33A 4WYVA 5AQJB 4COFA 2KWIB 2BG9C 4LFAT 3NRXA 4HGAA 5FKYA 2ZM0A 5HXHA 2LSIA 3PJAJ 3N9NA 3ZC1A 5JDQA 1KF6A 2CLYC 1YKHB 5AQSB 4PFOA 3K3OA 3ZCJA 3SFDA 2WQYA 1MIYA 2DNXA 3B13A 4EGWA 4EYUA 2Q9QB 3FZLB 3AXJB 1MMGA 2G0UA 1B7TA 4B3RT 4U2YA 2H7OA 4IHJE 3L3PA 1VCSA 3AA7B 1D1AA 4DV1T 2XAHB 5HEOA 2WAUA 3EDUA 3O1IA 5AQUB 4TN7B 4QXHB 4JI8T 1ZV4X 2KINB 5L47A 2WU2A 2RPAA 3AE2A 4HFVA 4IIJE 3RQUA 2BBJA 4ZZCA 4UVBB 5JVDE 4DMVA 2H3RA 4IT4A 1NWMX 2PG8A 2VURA 2XQ3A 3C51A 1XWMA 2CWYA 3AAEB 3NZPA 2Q9QD 4ILBA 2ZM2A 3M3ZB 4UEMA 2WM9A 3RRCA 3RYCE 3ZEFB 1FIOA 3KVAA 3AEBA 4A97A 4EIWA 3Q5WA 4AXPA 2LM2A 5DABA 3ZPOA 4OYJA 4PK5A 1HNZT 1XDPA 5LBMA 2V7MA 3ZN0B 3CWZB 3IBPA 4JEUB 1HF8A 2K9AA 3K3NA 4TNWA 2UXDT 4ISSA 4NPPA 4Z91A 3UU8A 4ISTA 5L3GB 2WB5A 4DV4T 2OV9A 1OEDA 1OWAA 1D1BA 3KV6A 3O4XE 3T8OA 2W0GA 4OYKA 4PK4A 4MFRA 4NUUA 4PJLA 3L09A 5H6RB 5FL1A 4JI3T 2UXXB 2DI4A 3OJAA 4CXYA 4HWCA 4O8SA 3TLSA 3LJCA 4JLEA 1HNWT 1AJ3A 4OHFA 2CCQA 3R84B 3AE1A 3ZKRA 4KHPT 1W0AA 1ZEEA 2BZBA 3NRYA 3AEDA 2MOZA 3NVOA 3RKOA 3ZYMA 1FMWA 2ACXA 4GYRA 4CN6A 4TWDA 4QX7B 3ZMSB 1UK5A 2DHRA 2M6IA 3I9WA 4DBQA 4MLKA 2V26A 4UR9A 5E0OA 4C90A 4YJ2E 2XQ8A 3G06A 5CA0E 2BBHA 1UX4A 1NEKA 3ESLA 3PTRB 4HN9A 5HXRA 5CA1E 2CXDA 2J4GA 5J2TE 4B3ST 3ZMUB 4HE8A 2WDVA 2B76A 4CI2B 3N9OA 4PK6A 2A2FX 1X79A 4DV3T 1LRZA 4UV9B 4DR3T 2E9XD 3SWHA 3OYZA 1H7CA 2BS3A 3BQIA 3UU4A 2CM0A 1W9RA 5FXWA 2HH7A 4ZS2A 4QXCB 2ODUA 4BJNA 4ZZBA 2J62A 3HI2A 4LMJA 3BQKA 4LF4T 1ZP0A 2KNDA 3NBXX 4O2BE 2WMOA 4IE5A 5JDMA 4G2AA 2IC6A 3FZKB 4F6RC 3RIUC 3DTOA 1MIWA 2LE8A 2MBGA 3RKGA 4EOZB 3O1JA 1MMAA 1IBLT 4XZCA 4DNDA 3EVYA 2BG9B 2PJQA 2X67A 2P9BA 4G63A 3LSVA 2E9XC 1V9DA 4YTNA 3EHZA 5ETWA 4ZI7E 4CI1B 1M7KA 1ZHCA 5HXEA 3HKEE 3SRZA 5C2TA 3CQXC 3ZMZB 4LF5T 4AQFC 2XY8B 4QHOA 2L9QA 1XZYA 2V7KA 4ZXLA 5HEJA 3UFGA 4LMKA 5M4YA 4XAXB 5C3JA 3FXEB 4YY3T 4HFDA 4KP3C 4JV5T 3ZT7A 1KEYA 2NR4A 5HEGA 4OK0A 1J5WA 3UUBA 4YSYA 3ZYKA 5BR8T 1YQ3A 2EHOD 1G73A 3AE9A 4DR4T 4X20E 1XMQT 3PUGA 1IJ6A 5HWYA 1YKEB 2QGSA 4PJJA 4UELA 3AEGA 3TLWA 2XQ9A 4X62T 2NTYA 4U7IA 4X66T 4DMWA 5AQPB 4QH1A 3J7Yq 4JI5T 3GN5A 2VB6A 5FXZA 4OFZA 2K3WA 2WZHA 4QXBB 3F31A 2IC9A 2VQET 3ABVA 3E08A 3VR8A 2W62A 4L0RA 1W0BA 4IE4A 4X1KE 1D0YA 4TX5A 3UQ4A 5FY1A 3RGLA 4OX9T 2ZM6T 1UX5A 2YU1A 3AE4A 2H89A 3RYIE 4YT0A 4U31A 2XAGB 2XQ5A 1L0VA 2NW7A 2KXPB 4KI0F 4AKLA 3RC3A 3O9XA 5EK4A 1UUSA 2AE9A 2I0MA 2XM1A 3KVBA 3MZKB 2A72A 2K48A 2LRLA 4QH5A 4HWFA 3UFEA 4EV6A 4GKJT 2WY2A 3E22E 3MACA 4IE0A 4A5XA 5HEUA 3X1DA 5IUXA 4DR5T 3AA1B 4HWIB 5J2UE 5JR9C 4JEHB 2ZLYA 4Z8XA 2X51A 2J47A 2LSKA 4L5GA 2K5BB 5HEHA 2YKSA 4XBFB 4H9OC 1NENA 2D5UA 2FJEA 2QRXA 2OA5A 1VCTA 3CX8B 2WWVA 2E9XB 3JAFA 5JH7E 5JR9A 2VKHA 3ZSSA 5LYJE 4EEBA 2Y6XA 2JIWA 5HXSA 3B57A 2VVNA 2WP9A 2LKHA 3H37A 5BMVE 3Q5EA 3J9X1 2D0UA 2QYWA 1YXRA 4QWNB 4AIUA 3MKDA 5JRCA 3ONXA 2IDOB 2L3LA 1XMOT 2ACZA 2B1EA 5JDFA 2V7LA 4O4IE 3OYXA 4KBMB 3RHWA 3I9YA 4A98A 2XZEA 5FVLA 1LKXA 3QB5K 3HKCE 4BJMA 2XAQB 3C64A 4O4HE 1IAPA 2NWBA 2X9XA 3AE6A 4YSXA 4CQIA 2XQ4A 1BR1A 5HYAA 1M62A 2AXDS 5LGTB 2DCFA 3FZFB 3P4RA 4YFSA 3UUXB 2BS2A 3H3AA 3PUQA 3CX7B 4CI3B 2V5DA 3N5LA 3QC9A 3UTKA 2MPKA 3AA0B 3FBZA 3WAKA 4IDQA 4HFEA 3C4XA 5L3BB 1JNRA 3KV5A 1LVKA 3AA6B 3AE3A 2X9YA 1IBKT 2EHOB 3CMLA 2XQYA 2W61A 3CQCB 2N1GA 3M65A 5F3JA 1D0XA 3EABA 3PE0A 4KUMB 4TV9E 4EB6E 4J2CA 3KDSE 2VVSA 3I0OA 3ZMTB 5HAXA 2YOEA 1D1CA 4O4JE 2KT9A 4FJOA 2H88A 1US7B 2LHNA 2PTFA 4X5TA 4LMLA 4ANJA 3Q2MA 5ABFA 1HR0T 3LBXB 3ZJ1A 2A9UA 3FZMB 5HCMA 5LP6E 3MXZA 2UXCT 3RX6A 5AQNB 1D0ZA 4KMCA 4HFCA 2LSGA 5CGMA 3OTOT 4DR2T 2HPJA 2VL0A 4AI6A 5F8PA 4DBRA 2V7IA 2MYSA 2V1DB 3PUAA 3P7IA 2BG9E 2CLYB 3C4WA 2D2SA 3RQWA 4B3TT 1N32T 4WBNE 1N33T 1U5PA 3L39A 5LMNT 5DQWA 5L4EA 3NWIA 1FMVA 1KNRA 2HN2A 5JDNA 2LEHA 4IE6A 4WNKA 4ILUA 2VK9A 2X9HA 4PJMA 1WYCA 2DWGA 3N2KE 2BVMA 3PV0F 4U7YA 2CHOA 2CXFA 2XAFB 2BKNA 3AXJA 3GN5B 3N9LA 2YDRA 5IWAT 1N34T 2Q9QA 2VQFT 5IHYA 2J1DG 3RIFA 3T1HT 2CMRA 5EK3A 2ZMAA 4AKGA 5FXXA 4ZI2C 4TV8E 2W2UA 1KNZA 3VRBA 1HNXT 3HKDE 3I0QA 3FB2A 3VU7H 3EI0A 4L9IA 4YHJA 4K0KT 2D0TA 5AQKB 3A8YC 4KX6A 3LK3B 1KK7A 2FJDA 5LXTE 4X1YE 1QUUA 3U3IA 4AKIA 3P4SA 2CBJA 1DU2A 1UCUA 3BK9A 4YLHA 2E8IA 3Q5XA 4NXNT 1I6ZA 2N2NA 2V6YB 3IHRA 2IUBA 3JAEA 4ADZA 2C5KT 3LFMA 2BKOA 3NKZA 4DUZT 1QLBA 2C0SA 2L8KA 1WLXA 3GA8A 3MJXA 3PUYF 5JTGA 5JRCB 4H9RC 1OXZA 2CWOA 4IL9A 1Z8UA 4GK5E 3KFWX 3RF1A 3EDVA 4DV5T 5LHHB 3ONJA 3N2OA 4MALA 4WW0A 4AKRB 2CRBA 4EZ4A 4LF7T 5JDHA 2Y8DA 3H3MA 4FI5A 1OEDB 5F5WA 2DWKA 5AQQB 3FHNA 4X1IE 3VKHA 4CN1A 1Y01A 4HFHA 2UUAT 2A3DA 4E7SA 3K1SA 5JQGE 3W15B 5L2LA 3ZN1B 4DV7T 5LMUT 5IYZE 5AFUL 3AE8A 3SFEA 4ZI3D 5A1LA 2XQ6A 3ANWB 4GKKT 2DLRA 3AAIA 2RA1A 3D0TA 4EEDA 3CVRA 3LK42 5LGUB 2LHRA 1O3XA 4X64T 3N9PA 3P8CD 3ZCIA 3QB5A 4U74A 2JQQA 4HFIA 5LG3A 2W4XA 4DO0A 1FEWA 4X65T 2LKGA 4PAGA 4ZI3C 4PNIA 3RYHE 5L3FB 1I94T 4IREA 1JNZA 3ETVA 3OPCA 2KLQA 4IL4A 5EZYE 5AQOB 1MMNA 2Y48B 2IIUA 3JADA 4TWHA 4E7ZA 4DV6T 3N9MA 1WCRA 3JC6D 5EK2A 4QKNA 4DR6T 4YSZA 1ZKEA 3Q5DA 4H9SE 4UVCB 4WBOA 5AQTB 3KINB 3UULA 3AVSA 3WI3A 4DIDB 5C8YE 2WSSV 1IBMT 3UUNA 3UU3A 1T7SA 1HS7A 2MAWA 5FVKA 3VRAA 2YDQA 3AEFA 2IW5B 3RPUA 3PURA 3P4QA 2YEVC 3R6NA 2OLTA 1FJGT 3PUWF 2WDRA 4ILAA 5L3DB 2EHOA 3F2EA 3KV4A 2LOPA 2HN1A 3RYFE 1S35A 3AVRA 4JI4T 2VKOA 2C5JA 2X68A 3AB3B 2XM2A 5ABHA 1ZOYA 2JMKA 2VWAA 3ZSTA 3RRWA 4LF9T 3PUVF 3C98B 4CZZB 1NAFA 3RC8A 4IDOA 3K8PC 4LF6T 4ILCA 5TAOA 4EZHA 5KXJA 4WZXA 4F8HA 2FUPA 5LG4A 2CXLA 4N78D 3LBXA 3ZT6A 2FJAA 2CA5A 2BG9A 3HKBE 5ABFB 3UQ7A 1BR0A 2NTXA 2IAKA 4QH4A 5LHGB 1J5ET 4P0AA 2V7JA 2LOSA 3PU3A 1XNQT 2NOXA 3DJBA 5DJQC 2WCAA 5L3EB 2BKPA 1HTJF 5AQIB 5KX5E 4DUYT 1J1JA 4ZOLE 4DR1T 4JI7T 3AE7A 3ANWA 4I43B 4HWDA 4UF0A 5FP3A 1MIVA 2E5LT 3C50A 3N2GE 2NW8A
chains in the Genus database with same CATH topology
5HWXA 4PW8A 5FNVE 1IZNB 4GK0E 4ASKA 3LG7A 4MHCA 2VKJA 5JR9B 2E9XA 3VKGA 4V1Av 3ETUA 2CEAA 3PUSA 4HEAA 2VL8A 2VASA 4AQGA 5HXCA 2XUEA 4TUYE 3SS1A 2YK0A 4EXTA 5J2TE 2C5IT 2NW9A 1YW0A 2PBIA 1MMDA 3QUJA 1QSDA 4ZHQE 2SPCA 4P09A 5LJMA 3EUHA 1S94A 3ZMVB 4EAHA 1SHZC 3V5UA 3GMIA 1LVFA 4M1PA 2MTQA 1WR6A 5FY7A 1HFAA 2QA7A 3AAAB 3BQLA 4C91A 3A5XA 2YINA 1YD8G 3KBUA 3PDYA 3S4UA 3CPZA 4H9PC 4I4TE 3RH3A 4H9NC 2HPLA 4CXXA 3WAJA 5H6QB 4K0UA 3NZQA 4H9QC 2RP4A 2JJ9A 5L3CB 3HR0A 1E1HB 4U72A 5TAOA 5FMNA 2K24A 3MA9A 4H63V 4MBQA 1U4QA 2Z6EA 3IF8B 5LA6E 4YJ3E 4CXWA 5CB4E 1SA0E 3I1AA 4IGUA 2PFVA 4ZS3A 3RC8A 4IDZA 3PU8A 3UUMA 2UXNB 2H7VC 3DP7A 2JMHA 3HL6A 2WMNA 3KV9A 2Q9QC 4PJNA 4EYYR 1HX8A 5JREA 1BR2A 2ES0A 5J1GA 3HA4A 4O4LE 4HKAA 1IJ5A 2N9DA 3UT5E 1VRBA 4TZ4C 4QX8B 1G8XA 2X66A 2GK9A 2CE7A 2JRKA 2XASB 1T98A 5LCYA 2WBLA 3QK6A 5JDLA 4AKHA 4BA9A 5FXVA 2WWUA 4JUYA 2X0LB 3F57A 2JPFA 2W63A 3N9QA 2LJLA 3LK2B 5FYMA 5KMGP 3TKLB 3OKQA 2LSYA 1BR4A 3VHLA 4UV8B 4A56A 4O2AE 3E0ZA 2XAJB 2XHEB 2ZM8A 4I50E 1MNDA 1HG5A 1VOMA 2LT3A 2BVLA 4B6XA 2I59A 3CX6B 4NUVA 4ZI2D 5JDGA 2YU2A 4GYSA 4P0BA 1Y64B 3CKDA 3FXDB 1CUNA 5LBQB 2NP9A 4GOUA 4BAYB 1HCIA 4UVAB 3U78A 4I55E 3ZLIA 5LGNB 3Q9DA 4HTEA 4ERRA 3GWHA 5DQVA 4DVDA 4AQFA 2VKDA 4UIGA 1WYBA 1Z0PA 3MK7C 3FBLA 3ZYLA 4PFPA 4UF0B 2LSJA 1WRDA 4IE7A 1EZ3A 4H63H 3ZC0A 2ODVA 3O1HA 5ADXL 5LHIB 3JC6C 5LJNA 2EHOC 3V5SA 2BDEA 2LM9A 2XTLA 3IEEA 3C4ZA 1MNEA 3SOLA 3OBVE 4GIWA 2KWHA 2KMFA 2X9WA 3K3QC 3ZJ2A 4UXNB 3CQGB 5LNKA 1HG2A 3KBTA 5FY0A 5LOVE 5GONE 2M67A 2KZ7B 2W00A 2KWIB 3NRXA 4HGAA 2ZM0A 5HXHA 2LSIA 3ZC1A 3N9NA 5JDQA 2CLYC 1YKHB 4PFOA 3K3OA 3ZCJA 4EYUA 1MIYA 2DNXA 3B13A 2Q9QB 1MMGA 2G0UA 1B7TA 2H7OA 4IHJE 3L3PA 3AA7B 1D1AA 2XAHB 2WAUA 3EDUA 3O1IA 4TN7B 4QXHB 1ZV4X 2KINB 4HFVA 4IIJE 4UVBB 5JVDE 4DMVA 2H3RA 1NWMX 2PG8A 3C51A 3NZPA 2CWYA 3AAEB 2Q9QD 4UEMA 2ZM2A 3RRCA 3RYCE 2WM9A 3ZEFB 5M4YA 1FIOA 3KVAA 4EIWA 3Q5WA 4AXPA 5DABA 3ZPOA 4OYJA 4PK5A 3ZN0B 5LBMA 2V7MA 3CWZB 3IBPA 4JEUB 1HF8A 2K9AA 3K3NA 4ISSA 4ISTA 5L3GB 1OWAA 1D1BA 3KV6A 3O4XE 3T8OA 2W0GA 4OYKA 4PK4A 4MFRA 4NUUA 4PJLA 3L09A 5H6RB 2UXXB 2DI4A 3OJAA 4CXYA 4O8SA 3LJCA 4JLEA 4OHFA 2CCQA 3R84B 2BZBA 1ZEEA 3NRYA 3RKOA 3ZYMA 2MOZA 1FMWA 2ACXA 4GYRA 4QX7B 3ZMSB 4DBQA 2DHRA 3I9WA 4MLKA 2V26A 4YJ2E 5E0OA 4C90A 5CA0E 3ESLA 1UX4A 3PTRB 4HN9A 5HXRA 5CA1E 2CXDA 3ZMUB 4HE8A 4CI2B 3N9OA 4PK6A 2A2FX 1X79A 1LRZA 4UV9B 2E9XD 3SWHA 3OYZA 1H7CA 3BQIA 2CM0A 5FXWA 2HH7A 4ZS2A 4QXCB 2ODUA 4BJNA 3HI2A 3BQKA 2KNDA 3NBXX 4O2BE 2WMOA 4IE5A 5JDMA 4G2AA 2IC6A 4F6RC 3DTOA 1MIWA 2LE8A 2MBGA 4EOZB 3O1JA 1MMAA 4XZCA 4DNDA 3EVYA 2X67A 2PJQA 2P9BA 4G63A 4ZI7E 2E9XC 1V9DA 4CI1B 5KDMC 5ETWA 5HXEA 1ZHCA 3HKEE 3SRZA 3CQXC 3ZMZB 4AQFC 4QHOA 2L9QA 2V7KA 4XAXB 3FXEB 4KP3C 4OK0A 3ZYKA 2EHOD 1G73A 4X20E 3PUGA 1IJ6A 5HWYA 1YKEB 2QGSA 4PJJA 4UELA 2NTYA 4DMWA 3J7Yq 3GN5A 2VB6A 5FXZA 4OFZA 4QXBB 3F31A 2IC9A 3E08A 2W62A 4L0RA 4IE4A 4X1KE 1D0YA 4TX5A 5FY1A 1UX5A 2YU1A 3RYIE 2XAGB 2NW7A 2KXPB 4AKLA 3RC3A 3O9XA 5EK4A 3MZKB 3KVBA 2A72A 2K48A 3UFEA 4IE0A 3E22E 3MACA 3AA1B 5JR9C 5J2UE 4JEHB 2ZLYA 4Z8XA 2X51A 2LSKA 4L5GA 2K5BB 4XBFB 4H9OC 2D5UA 4WBNE 2OA5A 3CX8B 5JH7E 2E9XB 5LYJE 5JR9A 2VKHA 2Y6XA 5HXSA 3B57A 3H37A 5BMVE 3J9X1 2D0UA 4QWNB 3MKDA 5JRCA 3ONXA 2L3LA 2B1EA 5JDFA 2V7LA 4O4IE 3OYXA 4KBMB 3I9YA 1LKXA 3HKCE 4BJMA 2XAQB 3C64A 4O4HE 1IAPA 2NWBA 2X9XA 5HYAA 4CQIA 1BR1A 5LGTB 2DCFA 4YFSA 4CI3B 3UUXB 3H3AA 3PUQA 3CX7B 3N5LA 3QC9A 3UTKA 3AA0B 3FBZA 3WAKA 3C4XA 5L3BB 3KV5A 1LVKA 3AA6B 2X9YA 2EHOB 3CMLA 2XQYA 2W61A 3CQCB 2N1GA 3M65A 5F3JA 1D0XA 3PE0A 4KUMB 4TV9E 4EB6E 4J2CA 3KDSE 3I0OA 3ZMTB 5HAXA 1D1CA 4O4JE 2KT9A 4FJOA 1US7B 2LHNA 4ANJA 3Q2MA 3LBXB 3ZJ1A 5LP6E 3MXZA 3RX6A 1D0ZA 4KMCA 2LSGA 2HPJA 4AI6A 5F8PA 4DBRA 2V7IA 2MYSA 2V1DB 3PUAA 3P7IA 2CLYB 3C4WA 2D2SA 1U5PA 5DQWA 1FMVA 5JDNA 2LEHA 4IE6A 4WNKA 4ILUA 2VK9A 2X9HA 4PJMA 1WYCA 2DWGA 3N2KE 2BVMA 2CXFA 2XAFB 3GN5B 3N9LA 2Q9QA 5IHYA 2J1DG 2CMRA 5EK3A 2ZMAA 4AKGA 5FXXA 4ZI2C 4TV8E 1KNZA 3HKDE 3I0QA 3FB2A 3VU7H 4L9IA 4YHJA 2D0TA 3LK3B 1KK7A 5LXTE 4X1YE 1QUUA 3U3IA 4AKIA 1UCUA 3BK9A 4YLHA 2E8IA 3Q5XA 2N2NA 3IHRA 4ADZA 2C5KT 3LFMA 2C0SA 2L8KA 1WLXA 3GA8A 3MJXA 5JRCB 4H9RC 1OXZA 2CWOA 4GK5E 3KFWX 3EDVA 5LHHB 4EZ4A 3N2OA 4MALA 4WW0A 4AKRB 5JDHA 2Y8DA 4FI5A 3VKHA 2DWKA 3FHNA 4X1IE 2A3DA 4E7SA 5JQGE 3W15B 5L2LA 3ZN1B 5IYZE 5AFUL 4ZI3D 5A1LA 3ANWB 2DLRA 3AAIA 2RA1A 3D0TA 5LGUB 3CVRA 3LK42 2LHRA 1O3XA 3N9PA 3P8CD 3ZCIA 4U74A 2JQQA 4DO0A 1FEWA 4PAGA 4ZI3C 4PNIA 3RYHE 5L3FB 3ETVA 2KLQA 5EZYE 1MMNA 2Y48B 4E7ZA 3N9MA 3JC6D 5EK2A 4QKNA 1ZKEA 4H9SE 4UVCB 4WBOA 1AJ3A 3KINB 3UULA 3AVSA 3WI3A 5C8YE 1HS7A 2WSSV 3UUNA 2IW5B 3RPUA 3PURA 2YEVC 3R6NA 5L3DB 2EHOA 3F2EA 3KV4A 2LOPA 3RYFE 1S35A 3AVRA 2VKOA 2C5JA 3AB3B 2X68A 2JMKA 2VWAA 3RRWA 3C98B 4CZZB 1NAFA 3K8PC 5LG4A 4EZHA 2CXLA 4N78D 3LBXA 1BR0A 2CA5A 3HKBE 2NTXA 2IAKA 4P0AA 5LHGB 2V7JA 2LOSA 3PU3A 2NOXA 3DJBA 5DJQC 5L3EB 1HTJF 5KX5E 4ZOLE 3ANWA 4I43B 4UF0A 5FP3A 1MIVA 3C50A 3N2GE 2NW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P C;  4HGA A;  4H9Q C;  4H9R C;  4H9O C;  4H9N C;  5KDM C;  4H9S E; 
#chains in the Genus database with same CATH topology
 3AEC A;  5HWX A;  3CIR A;  4PW8 A;  5FNV E;  4YXD A;  2F4V T;  2WU5 A;  1IZN B;  4GK0 E;  4ASK A;  3LG7 A;  4MHC A;  4YTM A;  3PUZ F;  2VKJ A;  5JR9 B;  5CJ5 A;  2E9X A;  3VKG A;  4V1A v;  3ETU A;  2CEA A;  3PUS A;  4HEA A;  4YTP A;  2VL8 A;  2VAS A;  3AEA A;  5HXC A;  1XDO A;  2XUE A;  4TUY E;  3SS1 A;  2YK0 A;  2XQA A;  4AQG A;  4IDN A;  4CN4 A;  4EXT A;  5KDM C;  2C5I T;  2NW9 A;  1YW0 A;  2PBI A;  1MMD A;  1UGO A;  1QSD A;  2CHN A;  3QUJ A;  4ZHQ E;  2HHH T;  2SPC A;  4DR7 T;  4LF8 T;  4P09 A;  5ABG A;  5LJM A;  2UXB T;  2KSR A;  3AE5 A;  3EUH A;  1S94 A;  2FJB A;  2IML A;  3ZMV B;  4EAH A;  1SHZ C;  3V5U A;  1CHU A;  5ABE A;  3GMI A;  3RIA A;  1LVF A;  4M1P A;  2MTQ A;  5AQL B;  1WR6 A;  5FY7 A;  1HFA A;  2QA7 A;  3QOF A;  4DV2 T;  4JYA T;  3AAA B;  3BQL A;  4C91 A;  3A5X A;  2YIN A;  4TWF A;  1YD8 G;  2JQH A;  3KBU A;  3PDY A;  4NIQ A;  3S4U A;  3CPZ A;  4DV0 T;  4H9P C;  4I4T E;  2UUB T;  3RH3 A;  4H9N C;  2HPL A;  4CXX A;  3WAJ A;  5H6Q B;  1KNP A;  4K0U A;  3NZQ A;  1T72 A;  4H9Q C;  2XQ7 A;  2RP4 A;  5FMN A;  5AQR B;  2JJ9 A;  5AQV B;  5L3C B;  2W67 A;  3RIU A;  3HR0 A;  4HFB A;  3VR9 A;  4JI6 T;  2V8S V;  1E1H B;  3TLT A;  3P4W A;  3L8R A;  4U72 A;  1YQ4 A;  2K24 A;  3MA9 A;  2FBW A;  4H63 V;  1U4Q A;  4MBQ A;  2Z6E A;  3IF8 B;  5J0Z A;  5LA6 E;  4YJ3 E;  1OED C;  2XPK A;  4CXW A;  2LRK A;  4JI0 T;  2DL1 A;  5CB4 E;  1SA0 E;  2BS4 A;  2XSA A;  4I0U A;  5L4H A;  3T1Y T;  2XSB A;  3I1A A;  2PFV A;  1E7P A;  4IGU A;  4IDZ A;  3PU8 A;  4ZS3 A;  2UXN B;  2H7V C;  3DP7 A;  1WR0 A;  2JMH A;  3HL6 A;  3P50 A;  2WMN A;  3KV9 A;  2Q9Q C;  4PJN A;  4JI1 T;  1N36 T;  4EYY R;  1HX8 A;  5JRE A;  1BR2 A;  2ES0 A;  1E2A A;  3HA4 A;  5J1G A;  5AQG B;  5LB7 B;  4O4L E;  4HKA A;  1IJ5 A;  2N9D A;  3UT5 E;  1VRB A;  4TZ4 C;  3TLV A;  1KFY A;  3FZH B;  4QX8 B;  1G8X A;  4JI2 T;  3TLU A;  2X66 A;  2GK9 A;  4NXM T;  4YHH T;  2CE7 A;  2JRK A;  2XAS B;  1T98 A;  2LLY A;  2WBL A;  2YN6 A;  3PJA A;  3QK6 A;  5LCY A;  4HWH A;  5JDL A;  4AKH A;  4BA9 A;  5FXV A;  4U2Z A;  2WWU A;  4JUY A;  2X0L B;  3F57 A;  2JPF A;  2YDS A;  2UU9 T;  3LDQ B;  1SUM B;  2W63 A;  3N9Q A;  2LJL A;  3LK2 B;  4Z90 A;  5FYM A;  3UU6 A;  3TKL B;  5KMG P;  3OKQ A;  2LSY A;  1BR4 A;  2QVA A;  4UV8 B;  3VHL A;  4A56 A;  4O2A E;  3E0Z A;  2XAJ B;  4ZEY A;  2R6G F;  3UUM A;  3B5M A;  4AIS A;  1SE7 A;  2XHE B;  3ONL C;  3ZT5 A;  2CPT A;  2ZM8 A;  3P4P A;  4I50 E;  2JQK A;  1MND A;  1HG5 A;  1VOM A;  2LT3 A;  1X9B A;  3A7M A;  2BVL A;  3RI5 A;  3UU5 A;  4B6X A;  1GQE A;  1XNR T;  4LFB T;  2I59 A;  1HX1 B;  2W66 A;  3CX6 B;  4NUV A;  4ZI2 D;  5FL0 A;  5AQM B;  5JDG A;  2YU2 A;  4GYS A;  4P0B A;  1Y64 B;  3CKD A;  5AQH B;  3FXD B;  3RLF F;  1CUN A;  4U3C A;  2NP9 A;  3OVU A;  5LBQ B;  4LFC T;  4GOU A;  4BAY B;  1UUR A;  1HCI A;  4UVA B;  3U78 A;  3AEE A;  3EAM A;  4I55 E;  1OED E;  2V6X A;  3ZLI A;  5LGN B;  3Q9D A;  4HTE A;  4ERR A;  3GWH A;  5DQV A;  2I6H A;  4AQF A;  2VKD A;  4UIG A;  4DVD A;  2CBI A;  5AQF B;  1WYB A;  1Z0P A;  3MK7 C;  3FBL A;  3ZYL A;  4PFP A;  2M6B A;  1W09 A;  2LSJ A;  4UF0 B;  1WRD A;  2E5V A;  3QNU A;  3PUX F;  1T8B A;  4AQY T;  4IE7 A;  1EZ3 A;  4H63 H;  3ZC0 A;  2ODV A;  3O1H A;  4P1N A;  5ADX L;  5LHI B;  3JC6 C;  5LJN A;  2EHO C;  3V5S A;  2BDE A;  2LM9 A;  2XTL A;  3IEE A;  3C4Z A;  1MNE A;  4Q25 A;  3SOL A;  3OBV E;  4GIW A;  2KWH A;  2KMF A;  1WFD A;  2X9W A;  2WZI A;  3K3Q C;  2X0H A;  2V6Y A;  4UXN B;  5HCJ A;  3ZJ2 A;  3CQG B;  3JCF A;  5LNK A;  4TNV A;  2X0Y A;  2WDQ A;  1HG2 A;  5CFB A;  3CK6 A;  2XJ7 A;  4JBW F;  2IHR 1;  3KBT A;  2E2A A;  2UUC T;  2JQ9 A;  3IA3 A;  5FY0 A;  4IDP A;  4B3M T;  2D9D A;  2V5C A;  5LOV E;  5GON E;  2M67 A;  4KHZ F;  2KZ7 B;  1R8I A;  2WS3 A;  2W00 A;  4U33 A;  4WYV A;  5AQJ B;  4COF A;  2KWI B;  2BG9 C;  4LFA T;  3NRX A;  4HGA A;  5FKY A;  2ZM0 A;  5HXH A;  2LSI A;  3PJA J;  3N9N A;  3ZC1 A;  5JDQ A;  1KF6 A;  2CLY C;  1YKH B;  5AQS B;  4PFO A;  3K3O A;  3ZCJ A;  3SFD A;  2WQY A;  1MIY A;  2DNX A;  3B13 A;  4EGW A;  4EYU A;  2Q9Q B;  3FZL B;  3AXJ B;  1MMG A;  2G0U A;  1B7T A;  4B3R T;  4U2Y A;  2H7O A;  4IHJ E;  3L3P A;  1VCS A;  3AA7 B;  1D1A A;  4DV1 T;  2XAH B;  5HEO A;  2WAU A;  3EDU A;  3O1I A;  5AQU B;  4TN7 B;  4QXH B;  4JI8 T;  1ZV4 X;  2KIN B;  5L47 A;  2WU2 A;  2RPA A;  3AE2 A;  4HFV A;  4IIJ E;  3RQU A;  2BBJ A;  4ZZC A;  4UVB B;  5JVD E;  4DMV A;  2H3R A;  4IT4 A;  1NWM X;  2PG8 A;  2VUR A;  2XQ3 A;  3C51 A;  1XWM A;  2CWY A;  3AAE B;  3NZP A;  2Q9Q D;  4ILB A;  2ZM2 A;  3M3Z B;  4UEM A;  2WM9 A;  3RRC A;  3RYC E;  3ZEF B;  1FIO A;  3KVA A;  3AEB A;  4A97 A;  4EIW A;  3Q5W A;  4AXP A;  2LM2 A;  5DAB A;  3ZPO A;  4OYJ A;  4PK5 A;  1HNZ T;  1XDP A;  5LBM A;  2V7M A;  3ZN0 B;  3CWZ B;  3IBP A;  4JEU B;  1HF8 A;  2K9A A;  3K3N A;  4TNW A;  2UXD T;  4ISS A;  4NPP A;  4Z91 A;  3UU8 A;  4IST A;  5L3G B;  2WB5 A;  4DV4 T;  2OV9 A;  1OED A;  1OWA A;  1D1B A;  3KV6 A;  3O4X E;  3T8O A;  2W0G A;  4OYK A;  4PK4 A;  4MFR A;  4NUU A;  4PJL A;  3L09 A;  5H6R B;  5FL1 A;  4JI3 T;  2UXX B;  2DI4 A;  3OJA A;  4CXY A;  4HWC A;  4O8S A;  3TLS A;  3LJC A;  4JLE A;  1HNW T;  1AJ3 A;  4OHF A;  2CCQ A;  3R84 B;  3AE1 A;  3ZKR A;  4KHP T;  1W0A A;  1ZEE A;  2BZB A;  3NRY A;  3AED A;  2MOZ A;  3NVO A;  3RKO A;  3ZYM A;  1FMW A;  2ACX A;  4GYR A;  4CN6 A;  4TWD A;  4QX7 B;  3ZMS B;  1UK5 A;  2DHR A;  2M6I A;  3I9W A;  4DBQ A;  4MLK A;  2V26 A;  4UR9 A;  5E0O A;  4C90 A;  4YJ2 E;  2XQ8 A;  3G06 A;  5CA0 E;  2BBH A;  1UX4 A;  1NEK A;  3ESL A;  3PTR B;  4HN9 A;  5HXR A;  5CA1 E;  2CXD A;  2J4G A;  5J2T E;  4B3S T;  3ZMU B;  4HE8 A;  2WDV A;  2B76 A;  4CI2 B;  3N9O A;  4PK6 A;  2A2F X;  1X79 A;  4DV3 T;  1LRZ A;  4UV9 B;  4DR3 T;  2E9X D;  3SWH A;  3OYZ A;  1H7C A;  2BS3 A;  3BQI A;  3UU4 A;  2CM0 A;  1W9R A;  5FXW A;  2HH7 A;  4ZS2 A;  4QXC B;  2ODU A;  4BJN A;  4ZZB A;  2J62 A;  3HI2 A;  4LMJ A;  3BQK A;  4LF4 T;  1ZP0 A;  2KND A;  3NBX X;  4O2B E;  2WMO A;  4IE5 A;  5JDM A;  4G2A A;  2IC6 A;  3FZK B;  4F6R C;  3RIU C;  3DTO A;  1MIW A;  2LE8 A;  2MBG A;  3RKG A;  4EOZ B;  3O1J A;  1MMA A;  1IBL T;  4XZC A;  4DND A;  3EVY A;  2BG9 B;  2PJQ A;  2X67 A;  2P9B A;  4G63 A;  3LSV A;  2E9X C;  1V9D A;  4YTN A;  3EHZ A;  5ETW A;  4ZI7 E;  4CI1 B;  1M7K A;  1ZHC A;  5HXE A;  3HKE E;  3SRZ A;  5C2T A;  3CQX C;  3ZMZ B;  4LF5 T;  4AQF C;  2XY8 B;  4QHO A;  2L9Q A;  1XZY A;  2V7K A;  4ZXL A;  5HEJ A;  3UFG A;  4LMK A;  5M4Y A;  4XAX B;  5C3J A;  3FXE B;  4YY3 T;  4HFD A;  4KP3 C;  4JV5 T;  3ZT7 A;  1KEY A;  2NR4 A;  5HEG A;  4OK0 A;  1J5W A;  3UUB A;  4YSY A;  3ZYK A;  5BR8 T;  1YQ3 A;  2EHO D;  1G73 A;  3AE9 A;  4DR4 T;  4X20 E;  1XMQ T;  3PUG A;  1IJ6 A;  5HWY A;  1YKE B;  2QGS A;  4PJJ A;  4UEL A;  3AEG A;  3TLW A;  2XQ9 A;  4X62 T;  2NTY A;  4U7I A;  4X66 T;  4DMW A;  5AQP B;  4QH1 A;  3J7Y q;  4JI5 T;  3GN5 A;  2VB6 A;  5FXZ A;  4OFZ A;  2K3W A;  2WZH A;  4QXB B;  3F31 A;  2IC9 A;  2VQE T;  3ABV A;  3E08 A;  3VR8 A;  2W62 A;  4L0R A;  1W0B A;  4IE4 A;  4X1K E;  1D0Y A;  4TX5 A;  3UQ4 A;  5FY1 A;  3RGL A;  4OX9 T;  2ZM6 T;  1UX5 A;  2YU1 A;  3AE4 A;  2H89 A;  3RYI E;  4YT0 A;  4U31 A;  2XAG B;  2XQ5 A;  1L0V A;  2NW7 A;  2KXP B;  4KI0 F;  4AKL A;  3RC3 A;  3O9X A;  5EK4 A;  1UUS A;  2AE9 A;  2I0M A;  2XM1 A;  3KVB A;  3MZK B;  2A72 A;  2K48 A;  2LRL A;  4QH5 A;  4HWF A;  3UFE A;  4EV6 A;  4GKJ T;  2WY2 A;  3E22 E;  3MAC A;  4IE0 A;  4A5X A;  5HEU A;  3X1D A;  5IUX A;  4DR5 T;  3AA1 B;  4HWI B;  5J2U E;  5JR9 C;  4JEH B;  2ZLY A;  4Z8X A;  2X51 A;  2J47 A;  2LSK A;  4L5G A;  2K5B B;  5HEH A;  2YKS A;  4XBF B;  4H9O C;  1NEN A;  2D5U A;  2FJE A;  2QRX A;  2OA5 A;  1VCT A;  3CX8 B;  2WWV A;  2E9X B;  3JAF A;  5JH7 E;  5JR9 A;  2VKH A;  3ZSS A;  5LYJ E;  4EEB A;  2Y6X A;  2JIW A;  5HXS A;  3B57 A;  2VVN A;  2WP9 A;  2LKH A;  3H37 A;  5BMV E;  3Q5E A;  3J9X 1;  2D0U A;  2QYW A;  1YXR A;  4QWN B;  4AIU A;  3MKD A;  5JRC A;  3ONX A;  2IDO B;  2L3L A;  1XMO T;  2ACZ A;  2B1E A;  5JDF A;  2V7L A;  4O4I E;  3OYX A;  4KBM B;  3RHW A;  3I9Y A;  4A98 A;  2XZE A;  5FVL A;  1LKX A;  3QB5 K;  3HKC E;  4BJM A;  2XAQ B;  3C64 A;  4O4H E;  1IAP A;  2NWB A;  2X9X A;  3AE6 A;  4YSX A;  4CQI A;  2XQ4 A;  1BR1 A;  5HYA A;  1M62 A;  2AXD S;  5LGT B;  2DCF A;  3FZF B;  3P4R A;  4YFS A;  3UUX B;  2BS2 A;  3H3A A;  3PUQ A;  3CX7 B;  4CI3 B;  2V5D A;  3N5L A;  3QC9 A;  3UTK A;  2MPK A;  3AA0 B;  3FBZ A;  3WAK A;  4IDQ A;  4HFE A;  3C4X A;  5L3B B;  1JNR A;  3KV5 A;  1LVK A;  3AA6 B;  3AE3 A;  2X9Y A;  1IBK T;  2EHO B;  3CML A;  2XQY A;  2W61 A;  3CQC B;  2N1G A;  3M65 A;  5F3J A;  1D0X A;  3EAB A;  3PE0 A;  4KUM B;  4TV9 E;  4EB6 E;  4J2C A;  3KDS E;  2VVS A;  3I0O A;  3ZMT B;  5HAX A;  2YOE A;  1D1C A;  4O4J E;  2KT9 A;  4FJO A;  2H88 A;  1US7 B;  2LHN A;  2PTF A;  4X5T A;  4LML A;  4ANJ A;  3Q2M A;  5ABF A;  1HR0 T;  3LBX B;  3ZJ1 A;  2A9U A;  3FZM B;  5HCM A;  5LP6 E;  3MXZ A;  2UXC T;  3RX6 A;  5AQN B;  1D0Z A;  4KMC A;  4HFC A;  2LSG A;  5CGM A;  3OTO T;  4DR2 T;  2HPJ A;  2VL0 A;  4AI6 A;  5F8P A;  4DBR A;  2V7I A;  2MYS A;  2V1D B;  3PUA A;  3P7I A;  2BG9 E;  2CLY B;  3C4W A;  2D2S A;  3RQW A;  4B3T T;  1N32 T;  4WBN E;  1N33 T;  1U5P A;  3L39 A;  5LMN T;  5DQW A;  5L4E A;  3NWI A;  1FMV A;  1KNR A;  2HN2 A;  5JDN A;  2LEH A;  4IE6 A;  4WNK A;  4ILU A;  2VK9 A;  2X9H A;  4PJM A;  1WYC A;  2DWG A;  3N2K E;  2BVM A;  3PV0 F;  4U7Y A;  2CHO A;  2CXF A;  2XAF B;  2BKN A;  3AXJ A;  3GN5 B;  3N9L A;  2YDR A;  5IWA T;  1N34 T;  2Q9Q A;  2VQF T;  5IHY A;  2J1D G;  3RIF A;  3T1H T;  2CMR A;  5EK3 A;  2ZMA A;  4AKG A;  5FXX A;  4ZI2 C;  4TV8 E;  2W2U A;  1KNZ A;  3VRB A;  1HNX T;  3HKD E;  3I0Q A;  3FB2 A;  3VU7 H;  3EI0 A;  4L9I A;  4YHJ A;  4K0K T;  2D0T A;  5AQK B;  3A8Y C;  4KX6 A;  3LK3 B;  1KK7 A;  2FJD A;  5LXT E;  4X1Y E;  1QUU A;  3U3I A;  4AKI A;  3P4S A;  2CBJ A;  1DU2 A;  1UCU A;  3BK9 A;  4YLH A;  2E8I A;  3Q5X A;  4NXN T;  1I6Z A;  2N2N A;  2V6Y B;  3IHR A;  2IUB A;  3JAE A;  4ADZ A;  2C5K T;  3LFM A;  2BKO A;  3NKZ A;  4DUZ T;  1QLB A;  2C0S A;  2L8K A;  1WLX A;  3GA8 A;  3MJX A;  3PUY F;  5JTG A;  5JRC B;  4H9R C;  1OXZ A;  2CWO A;  4IL9 A;  1Z8U A;  4GK5 E;  3KFW X;  3RF1 A;  3EDV A;  4DV5 T;  5LHH B;  3ONJ A;  3N2O A;  4MAL A;  4WW0 A;  4AKR B;  2CRB A;  4EZ4 A;  4LF7 T;  5JDH A;  2Y8D A;  3H3M A;  4FI5 A;  1OED B;  5F5W A;  2DWK A;  5AQQ B;  3FHN A;  4X1I E;  3VKH A;  4CN1 A;  1Y01 A;  4HFH A;  2UUA T;  2A3D A;  4E7S A;  3K1S A;  5JQG E;  3W15 B;  5L2L A;  3ZN1 B;  4DV7 T;  5LMU T;  5IYZ E;  5AFU L;  3AE8 A;  3SFE A;  4ZI3 D;  5A1L A;  2XQ6 A;  3ANW B;  4GKK T;  2DLR A;  3AAI A;  2RA1 A;  3D0T A;  4EED A;  3CVR A;  3LK4 2;  5LGU B;  2LHR A;  1O3X A;  4X64 T;  3N9P A;  3P8C D;  3ZCI A;  3QB5 A;  4U74 A;  2JQQ A;  4HFI A;  5LG3 A;  2W4X A;  4DO0 A;  1FEW A;  4X65 T;  2LKG A;  4PAG A;  4ZI3 C;  4PNI A;  3RYH E;  5L3F B;  1I94 T;  4IRE A;  1JNZ A;  3ETV A;  3OPC A;  2KLQ A;  4IL4 A;  5EZY E;  5AQO B;  1MMN A;  2Y48 B;  2IIU A;  3JAD A;  4TWH A;  4E7Z A;  4DV6 T;  3N9M A;  1WCR A;  3JC6 D;  5EK2 A;  4QKN A;  4DR6 T;  4YSZ A;  1ZKE A;  3Q5D A;  4H9S E;  4UVC B;  4WBO A;  5AQT B;  3KIN B;  3UUL A;  3AVS A;  3WI3 A;  4DID B;  5C8Y E;  2WSS V;  1IBM T;  3UUN A;  3UU3 A;  1T7S A;  1HS7 A;  2MAW A;  5FVK A;  3VRA A;  2YDQ A;  3AEF A;  2IW5 B;  3RPU A;  3PUR A;  3P4Q A;  2YEV C;  3R6N A;  2OLT A;  1FJG T;  3PUW F;  2WDR A;  4ILA A;  5L3D B;  2EHO A;  3F2E A;  3KV4 A;  2LOP A;  2HN1 A;  3RYF E;  1S35 A;  3AVR A;  4JI4 T;  2VKO A;  2C5J A;  2X68 A;  3AB3 B;  2XM2 A;  5ABH A;  1ZOY A;  2JMK A;  2VWA A;  3ZST A;  3RRW A;  4LF9 T;  3PUV F;  3C98 B;  4CZZ B;  1NAF A;  3RC8 A;  4IDO A;  3K8P C;  4LF6 T;  4ILC A;  5TAO A;  4EZH A;  5KXJ A;  4WZX A;  4F8H A;  2FUP A;  5LG4 A;  2CXL A;  4N78 D;  3LBX A;  3ZT6 A;  2FJA A;  2CA5 A;  2BG9 A;  3HKB E;  5ABF B;  3UQ7 A;  1BR0 A;  2NTX A;  2IAK A;  4QH4 A;  5LHG B;  1J5E T;  4P0A A;  2V7J A;  2LOS A;  3PU3 A;  1XNQ T;  2NOX A;  3DJB A;  5DJQ C;  2WCA A;  5L3E B;  2BKP A;  1HTJ F;  5AQI B;  5KX5 E;  4DUY T;  1J1J A;  4ZOL E;  4DR1 T;  4JI7 T;  3AE7 A;  3ANW A;  4I43 B;  4HWD A;  4UF0 A;  5FP3 A;  1MIV A;  2E5L T;  3C50 A;  3N2G E;  2NW8 A; 
#chains in the Genus database with same CATH homology
 5HWX A;  4PW8 A;  5FNV E;  1IZN B;  4GK0 E;  4ASK A;  3LG7 A;  4MHC A;  2VKJ A;  5JR9 B;  2E9X A;  3VKG A;  4V1A v;  3ETU A;  2CEA A;  3PUS A;  4HEA A;  2VL8 A;  2VAS A;  4AQG A;  5HXC A;  2XUE A;  4TUY E;  3SS1 A;  2YK0 A;  4EXT A;  5J2T E;  2C5I T;  2NW9 A;  1YW0 A;  2PBI A;  1MMD A;  3QUJ A;  1QSD A;  4ZHQ E;  2SPC A;  4P09 A;  5LJM A;  3EUH A;  1S94 A;  3ZMV B;  4EAH A;  1SHZ C;  3V5U A;  3GMI A;  1LVF A;  4M1P A;  2MTQ A;  1WR6 A;  5FY7 A;  1HFA A;  2QA7 A;  3AAA B;  3BQL A;  4C91 A;  3A5X A;  2YIN A;  1YD8 G;  3KBU A;  3PDY A;  3S4U A;  3CPZ A;  4H9P C;  4I4T E;  3RH3 A;  4H9N C;  2HPL A;  4CXX A;  3WAJ A;  5H6Q B;  4K0U A;  3NZQ A;  4H9Q C;  2RP4 A;  2JJ9 A;  5L3C B;  3HR0 A;  1E1H B;  4U72 A;  5TAO A;  5FMN A;  2K24 A;  3MA9 A;  4H63 V;  4MBQ A;  1U4Q A;  2Z6E A;  3IF8 B;  5LA6 E;  4YJ3 E;  4CXW A;  5CB4 E;  1SA0 E;  3I1A A;  4IGU A;  2PFV A;  4ZS3 A;  3RC8 A;  4IDZ A;  3PU8 A;  3UUM A;  2UXN B;  2H7V C;  3DP7 A;  2JMH A;  3HL6 A;  2WMN A;  3KV9 A;  2Q9Q C;  4PJN A;  4EYY R;  1HX8 A;  5JRE A;  1BR2 A;  2ES0 A;  5J1G A;  3HA4 A;  4O4L E;  4HKA A;  1IJ5 A;  2N9D A;  3UT5 E;  1VRB A;  4TZ4 C;  4QX8 B;  1G8X A;  2X66 A;  2GK9 A;  2CE7 A;  2JRK A;  2XAS B;  1T98 A;  5LCY A;  2WBL A;  3QK6 A;  5JDL A;  4AKH A;  4BA9 A;  5FXV A;  2WWU A;  4JUY A;  2X0L B;  3F57 A;  2JPF A;  2W63 A;  3N9Q A;  2LJL A;  3LK2 B;  5FYM A;  5KMG P;  3TKL B;  3OKQ A;  2LSY A;  1BR4 A;  3VHL A;  4UV8 B;  4A56 A;  4O2A E;  3E0Z A;  2XAJ B;  2XHE B;  2ZM8 A;  4I50 E;  1MND A;  1HG5 A;  1VOM A;  2LT3 A;  2BVL A;  4B6X A;  2I59 A;  3CX6 B;  4NUV A;  4ZI2 D;  5JDG A;  2YU2 A;  4GYS A;  4P0B A;  1Y64 B;  3CKD A;  3FXD B;  1CUN A;  5LBQ B;  2NP9 A;  4GOU A;  4BAY B;  1HCI A;  4UVA B;  3U78 A;  4I55 E;  3ZLI A;  5LGN B;  3Q9D A;  4HTE A;  4ERR A;  3GWH A;  5DQV A;  4DVD A;  4AQF A;  2VKD A;  4UIG A;  1WYB A;  1Z0P A;  3MK7 C;  3FBL A;  3ZYL A;  4PFP A;  4UF0 B;  2LSJ A;  1WRD A;  4IE7 A;  1EZ3 A;  4H63 H;  3ZC0 A;  2ODV A;  3O1H A;  5ADX L;  5LHI B;  3JC6 C;  5LJN A;  2EHO C;  3V5S A;  2BDE A;  2LM9 A;  2XTL A;  3IEE A;  3C4Z A;  1MNE A;  3SOL A;  3OBV E;  4GIW A;  2KWH A;  2KMF A;  2X9W A;  3K3Q C;  3ZJ2 A;  4UXN B;  3CQG B;  5LNK A;  1HG2 A;  3KBT A;  5FY0 A;  5LOV E;  5GON E;  2M67 A;  2KZ7 B;  2W00 A;  2KWI B;  3NRX A;  4HGA A;  2ZM0 A;  5HXH A;  2LSI A;  3ZC1 A;  3N9N A;  5JDQ A;  2CLY C;  1YKH B;  4PFO A;  3K3O A;  3ZCJ A;  4EYU A;  1MIY A;  2DNX A;  3B13 A;  2Q9Q B;  1MMG A;  2G0U A;  1B7T A;  2H7O A;  4IHJ E;  3L3P A;  3AA7 B;  1D1A A;  2XAH B;  2WAU A;  3EDU A;  3O1I A;  4TN7 B;  4QXH B;  1ZV4 X;  2KIN B;  4HFV A;  4IIJ E;  4UVB B;  5JVD E;  4DMV A;  2H3R A;  1NWM X;  2PG8 A;  3C51 A;  3NZP A;  2CWY A;  3AAE B;  2Q9Q D;  4UEM A;  2ZM2 A;  3RRC A;  3RYC E;  2WM9 A;  3ZEF B;  5M4Y A;  1FIO A;  3KVA A;  4EIW A;  3Q5W A;  4AXP A;  5DAB A;  3ZPO A;  4OYJ A;  4PK5 A;  3ZN0 B;  5LBM A;  2V7M A;  3CWZ B;  3IBP A;  4JEU B;  1HF8 A;  2K9A A;  3K3N A;  4ISS A;  4IST A;  5L3G B;  1OWA A;  1D1B A;  3KV6 A;  3O4X E;  3T8O A;  2W0G A;  4OYK A;  4PK4 A;  4MFR A;  4NUU A;  4PJL A;  3L09 A;  5H6R B;  2UXX B;  2DI4 A;  3OJA A;  4CXY A;  4O8S A;  3LJC A;  4JLE A;  4OHF A;  2CCQ A;  3R84 B;  2BZB A;  1ZEE A;  3NRY A;  3RKO A;  3ZYM A;  2MOZ A;  1FMW A;  2ACX A;  4GYR A;  4QX7 B;  3ZMS B;  4DBQ A;  2DHR A;  3I9W A;  4MLK A;  2V26 A;  4YJ2 E;  5E0O A;  4C90 A;  5CA0 E;  3ESL A;  1UX4 A;  3PTR B;  4HN9 A;  5HXR A;  5CA1 E;  2CXD A;  3ZMU B;  4HE8 A;  4CI2 B;  3N9O A;  4PK6 A;  2A2F X;  1X79 A;  1LRZ A;  4UV9 B;  2E9X D;  3SWH A;  3OYZ A;  1H7C A;  3BQI A;  2CM0 A;  5FXW A;  2HH7 A;  4ZS2 A;  4QXC B;  2ODU A;  4BJN A;  3HI2 A;  3BQK A;  2KND A;  3NBX X;  4O2B E;  2WMO A;  4IE5 A;  5JDM A;  4G2A A;  2IC6 A;  4F6R C;  3DTO A;  1MIW A;  2LE8 A;  2MBG A;  4EOZ B;  3O1J A;  1MMA A;  4XZC A;  4DND A;  3EVY A;  2X67 A;  2PJQ A;  2P9B A;  4G63 A;  4ZI7 E;  2E9X C;  1V9D A;  4CI1 B;  5KDM C;  5ETW A;  5HXE A;  1ZHC A;  3HKE E;  3SRZ A;  3CQX C;  3ZMZ B;  4AQF C;  4QHO A;  2L9Q A;  2V7K A;  4XAX B;  3FXE B;  4KP3 C;  4OK0 A;  3ZYK A;  2EHO D;  1G73 A;  4X20 E;  3PUG A;  1IJ6 A;  5HWY A;  1YKE B;  2QGS A;  4PJJ A;  4UEL A;  2NTY A;  4DMW A;  3J7Y q;  3GN5 A;  2VB6 A;  5FXZ A;  4OFZ A;  4QXB B;  3F31 A;  2IC9 A;  3E08 A;  2W62 A;  4L0R A;  4IE4 A;  4X1K E;  1D0Y A;  4TX5 A;  5FY1 A;  1UX5 A;  2YU1 A;  3RYI E;  2XAG B;  2NW7 A;  2KXP B;  4AKL A;  3RC3 A;  3O9X A;  5EK4 A;  3MZK B;  3KVB A;  2A72 A;  2K48 A;  3UFE A;  4IE0 A;  3E22 E;  3MAC A;  3AA1 B;  5JR9 C;  5J2U E;  4JEH B;  2ZLY A;  4Z8X A;  2X51 A;  2LSK A;  4L5G A;  2K5B B;  4XBF B;  4H9O C;  2D5U A;  4WBN E;  2OA5 A;  3CX8 B;  5JH7 E;  2E9X B;  5LYJ E;  5JR9 A;  2VKH A;  2Y6X A;  5HXS A;  3B57 A;  3H37 A;  5BMV E;  3J9X 1;  2D0U A;  4QWN B;  3MKD A;  5JRC A;  3ONX A;  2L3L A;  2B1E A;  5JDF A;  2V7L A;  4O4I E;  3OYX A;  4KBM B;  3I9Y A;  1LKX A;  3HKC E;  4BJM A;  2XAQ B;  3C64 A;  4O4H E;  1IAP A;  2NWB A;  2X9X A;  5HYA A;  4CQI A;  1BR1 A;  5LGT B;  2DCF A;  4YFS A;  4CI3 B;  3UUX B;  3H3A A;  3PUQ A;  3CX7 B;  3N5L A;  3QC9 A;  3UTK A;  3AA0 B;  3FBZ A;  3WAK A;  3C4X A;  5L3B B;  3KV5 A;  1LVK A;  3AA6 B;  2X9Y A;  2EHO B;  3CML A;  2XQY A;  2W61 A;  3CQC B;  2N1G A;  3M65 A;  5F3J A;  1D0X A;  3PE0 A;  4KUM B;  4TV9 E;  4EB6 E;  4J2C A;  3KDS E;  3I0O A;  3ZMT B;  5HAX A;  1D1C A;  4O4J E;  2KT9 A;  4FJO A;  1US7 B;  2LHN A;  4ANJ A;  3Q2M A;  3LBX B;  3ZJ1 A;  5LP6 E;  3MXZ A;  3RX6 A;  1D0Z A;  4KMC A;  2LSG A;  2HPJ A;  4AI6 A;  5F8P A;  4DBR A;  2V7I A;  2MYS A;  2V1D B;  3PUA A;  3P7I A;  2CLY B;  3C4W A;  2D2S A;  1U5P A;  5DQW A;  1FMV A;  5JDN A;  2LEH A;  4IE6 A;  4WNK A;  4ILU A;  2VK9 A;  2X9H A;  4PJM A;  1WYC A;  2DWG A;  3N2K E;  2BVM A;  2CXF A;  2XAF B;  3GN5 B;  3N9L A;  2Q9Q A;  5IHY A;  2J1D G;  2CMR A;  5EK3 A;  2ZMA A;  4AKG A;  5FXX A;  4ZI2 C;  4TV8 E;  1KNZ A;  3HKD E;  3I0Q A;  3FB2 A;  3VU7 H;  4L9I A;  4YHJ A;  2D0T A;  3LK3 B;  1KK7 A;  5LXT E;  4X1Y E;  1QUU A;  3U3I A;  4AKI A;  1UCU A;  3BK9 A;  4YLH A;  2E8I A;  3Q5X A;  2N2N A;  3IHR A;  4ADZ A;  2C5K T;  3LFM A;  2C0S A;  2L8K A;  1WLX A;  3GA8 A;  3MJX A;  5JRC B;  4H9R C;  1OXZ A;  2CWO A;  4GK5 E;  3KFW X;  3EDV A;  5LHH B;  4EZ4 A;  3N2O A;  4MAL A;  4WW0 A;  4AKR B;  5JDH A;  2Y8D A;  4FI5 A;  3VKH A;  2DWK A;  3FHN A;  4X1I E;  2A3D A;  4E7S A;  5JQG E;  3W15 B;  5L2L A;  3ZN1 B;  5IYZ E;  5AFU L;  4ZI3 D;  5A1L A;  3ANW B;  2DLR A;  3AAI A;  2RA1 A;  3D0T A;  5LGU B;  3CVR A;  3LK4 2;  2LHR A;  1O3X A;  3N9P A;  3P8C D;  3ZCI A;  4U74 A;  2JQQ A;  4DO0 A;  1FEW A;  4PAG A;  4ZI3 C;  4PNI A;  3RYH E;  5L3F B;  3ETV A;  2KLQ A;  5EZY E;  1MMN A;  2Y48 B;  4E7Z A;  3N9M A;  3JC6 D;  5EK2 A;  4QKN A;  1ZKE A;  4H9S E;  4UVC B;  4WBO A;  1AJ3 A;  3KIN B;  3UUL A;  3AVS A;  3WI3 A;  5C8Y E;  1HS7 A;  2WSS V;  3UUN A;  2IW5 B;  3RPU A;  3PUR A;  2YEV C;  3R6N A;  5L3D B;  2EHO A;  3F2E A;  3KV4 A;  2LOP A;  3RYF E;  1S35 A;  3AVR A;  2VKO A;  2C5J A;  3AB3 B;  2X68 A;  2JMK A;  2VWA A;  3RRW A;  3C98 B;  4CZZ B;  1NAF A;  3K8P C;  5LG4 A;  4EZH A;  2CXL A;  4N78 D;  3LBX A;  1BR0 A;  2CA5 A;  3HKB E;  2NTX A;  2IAK A;  4P0A A;  5LHG B;  2V7J A;  2LOS A;  3PU3 A;  2NOX A;  3DJB A;  5DJQ C;  5L3E B;  1HTJ F;  5KX5 E;  4ZOL E;  3ANW A;  4I43 B;  4UF0 A;  5FP3 A;  1MIV A;  3C50 A;  3N2G E;  2NW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...