4H9NC

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9nC00
4H9OC 4H9QC 4H9SE 4H9RC 4H9NC 4H9PC 4HGAA 5KDMC
chains in the Genus database with same CATH superfamily
2VQFT 2YDQA 2PJQA 5LCYA 5CJ5A 1HX1B 2K48A 3AE5A 4IE4A 3AXJA 1BR0A 3LK3B 3QB5K 5JTGA 3LBXB 4COFA 2JQQA 2AXDS 1OEDE 4CN6A 1MIWA 3AA0B 3UUMA 2VKDA 2JMHA 2XY8B 4ILAA 2M67A 3AE7A 5C2TA 4WNKA 1DU2A 2IIUA 1LVFA 4DV6T 4GK5E 3ZKRA 2X9YA 3QC9A 2V26A 2VKHA 3RI5A 2L3LA 3ZMSB 3N2GE 2FBWA 1IJ5A 4UVAB 5HXRA 3UQ4A 4TV8E 1SUMB 3J9X1 1WRDA 2QA7A 3BK9A 2DNXA 5CB4E 1YKEB 3PJAJ 1US7B 4LMLA 1IZNB 3Q9DA 4H63V 1HS7A 3EAMA 2LJLA 4QX7B 4HFDA 4GYRA 3UULA 3RH3A 5DJQC 2LHRA 3I0OA 4DV1T 2VVNA 4X65T 1O3XA 2FJDA 3RIUA 3DJBA 2LRKA 3EUHA 3MKDA 4J2CA 1WYCA 2DWGA 3TLTA 1JNZA 3UU5A 1QLBA 3AAIA 3LK42 1CUNA 3ZN0B 4MBQA 1N34T 4CXYA 2WU2A 4DV2T 4EEDA 2VL0A 1X9BA 1HG2A 3TLVA 2D5UA 2BG9A 4YSYA 4UF0A 4PJNA 5AQNB 2CPTA 4IDPA 2DLRA 3ZLIA 3N9PA 2E5LT 1IAPA 4ZI2D 1G8XA 3NWIA 1T98A 4M1PA 2VASA 2WDRA 5LNKA 4H9QC 2WCAA 3PV0F 5L3GB 1D0ZA 2BS4A 5LBQB 2ACXA 5FXWA 4U7IA 4AKRB 2N9DA 2CA5A 3HR0A 4I4TE 2IUBA 4DR7T 5M4YA 5JDNA 2XSAA 3UFGA 2J1DG 4KX6A 4Z91A 4A5XA 2E9XC 2RP4A 2E2AA 5LXTE 2K3WA 3Q5WA 4DR3T 3B5MA 4TWFA 3E22E 5IYZE 1XWMA 4QWNB 3ZCIA 4DR4T 2Q9QC 2V7MA 3L3PA 3IF8B 3OYZA 2X67A 3HKCE 4MLKA 3EABA 2WWVA 4DUYT 3WAJA 4TX5A 3CKDA 4MALA 5HWYA 2X0HA 5LMNT 5LA6E 3AE3A 2CHOA 3CX6B 3KDSE 2W0GA 5AQVB 5FXVA 3AEFA 1WR0A 3P4SA 5JRCA 1OEDC 4E7SA 3OKQA 4EV6A 5L3DB 1HTJF 2Q9QB 5AQMB 5F5WA 1YQ3A 4TUYE 2A72A 3KBTA 2H3RA 2BZBA 1J5WA 2E9XA 3GWHA 4I50E 5JR9C 2J4GA 3SOLA 1KF6A 3TLUA 2MYSA 2RPAA 5AQOB 2NTXA 2IAKA 4MFRA 4DNDA 3NBXX 4TV9E 3ZC0A 5ETWA 2W62A 5AQUB 4C91A 2IC6A 1OEDB 3ZJ1A 4P0AA 5ABGA 4JI6T 2I59A 3PUZF 5L3EB 4JBWF 2LT3A 2D0TA 4IHJE 4A56A 3UU3A 2PBIA 4LF7T 4P0BA 4IE6A 5JR9B 1NWMX 3UQ7A 1BR4A 1R8IA 3CMLA 2AE9A 2LSGA 2QRXA 4AQFA 4LF4T 2V5CA 4AKHA 3O1HA 4PJLA 1WCRA 3UFEA 1D1BA 5ABHA 4GOUA 4O4HE 5E0OA 3CQCB 3DP7A 3JADA 4O2AE 4NPPA 1LKXA 2FUPA 5FYMA 4K0UA 5JDMA 2EHOD 3TKLB 4H63H 2LE8A 2E5VA 2BBHA 3A8YC 3VKHA 1MMNA 2X9HA 1G73A 4IE0A 5JDHA 3RRCA 4X62T 1D1AA 2CEAA 1HX8A 4HWCA 3HKBE 1OXZA 4OYJA 4B3MT 2M6IA 4CXWA 2OLTA 3CK6A 3RQWA 2VL8A 4PJMA 3F2EA 3CQGB 2K9AA 4JYAT 2WZIA 4U72A 4GIWA 1IBLT 3I0QA 4ILBA 4LMKA 3GN5B 4UVBB 2XASB 3I9YA 3PUAA 2KWHA 3AVRA 4DMWA 3AEEA 3AE9A 3SFDA 4DR2T 3ZCJA 2NW7A 4TNVA 4Z8XA 5CA0E 5A1LA 3KV6A 3U3IA 2DCFA 3NZQA 3JAFA 3L09A 5AQHB 5LB7B 4CQIA 2LOPA 4YJ3E 3SWHA 2ZMAA 1N36T 4AKGA 2W4XA 5ABFB 2YK0A 3FHNA 5CA1E 3V5SA 2VURA 5LOVE 2YDRA 1MIYA 2WY2A 2WU5A 4QKNA 5HCJA 4JI0T 2W66A 4QH5A 4ADZA 4DR1T 5AQTB 3Q5DA 3K3NA 4ILUA 2X9XA 3LSVA 3UUXB 4O4IE 2PFVA 3PUVF 4LMJA 2BKOA 2NR4A 3OYXA 1MMAA 2BKNA 4DUZT 1HNWT 4L9IA 3MACA 4X1KE 5L4HA 4X64T 4TZ4C 2NOXA 1FIOA 2JQKA 2NW9A 3B13A 4OX9T 1N32T 3ZMZB 5L4EA 1X79A 2OV9A 3N9MA 3RYHE 1KK7A 1S94A 3CVRA 4F6RC 5KX5E 4DBQA 4AXPA 3ZJ2A 3N5LA 5DQWA 3PUXF 3H3MA 2LEHA 2EHOC 2CXLA 2YDSA 5LHGB 5JH7E 4DMVA 4XZCA 4YTNA 5TAOA 3C64A 2ZM2A 2XAFB 4LF5T 3BQKA 1VCSA 2C5IT 5HXCA 3OTOT 3FB2A 4DVDA 3ETUA 4CZZB 4PAGA 2B1EA 3ZT6A 1W9RA 3C50A 4YJ2E 5FNVE 2CRBA 5HEJA 1HF8A 3HL6A 3PUWF 3PU8A 2EHOB 3RIAA 2HHHT 2LOSA 2KWIB 3AA7B 4YSZA 3ONXA 4TNWA 2XHEB 3N9NA 3AE6A 5L3CB 3LBXA 3ZYKA 1Z8UA 4Q25A 5FY7A 4JI7T 4PK6A 2J62A 1ZKEA 3FZHB 2W2UA 2KXPB 2IHR1 1VRBA 3IHRA 2LKGA 5J1GA 4XAXB 2YEVC 2J47A 2B76A 5JDLA 2C0SA 4JEHB 5LBMA 2JQHA 2CCQA 3HI2A 5AQQB 3I9WA 2A3DA 4JI5T 4WBNE 1D0YA 3LK2B 3RLFF 2X9WA 2UUBT 4UELA 3Q5EA 4B3RT 2X66A 3O9XA 4U2YA 4WW0A 4P09A 4ZHQE 1U4QA 2PTFA 4PK4A 3PUGA 3H37A 4OYKA 4DR6T 3F57A 2V7JA 5FXXA 2H89A 1MMDA 5H6RB 4IGUA 2LM2A 1XZYA 5C8YE 4CN4A 5L2LA 4G2AA 3IA3A 3WAKA 1Y01A 5IUXA 3LFMA 3ANWB 5LJMA 3HA4A 3VU7H 2N1GA 3CX8B 2XAQB 1J5ET 5LP6E 1BR2A 3A5XA 3QNUA 2CLYC 1T8BA 3G06A 3CIRA 1MNDA 5LGTB 1W0AA 2CBJA 1SHZC 3MK7C 5AQPB 4EGWA 5L47A 4ISSA 5HEGA 1FJGT 3AEBA 2VWAA 2CM0A 2C5KT 2NW8A 4OFZA 3ZSSA 3KFWX 3ZEFB 2CLYB 4ZEYA 4HGAA 4QXCB 5AQSB 1T7SA 3MXZA 5LG3A 4CN1A 4I43B 2V6YB 4U33A 3EHZA 3VKGA 4I0UA 5FMNA 4TN7B 1FMWA 1YXRA 2UXDT 1FEWA 4IL9A 1KFYA 2HH7A 3PU3A 2LSJA 2CE7A 2LHNA 4YHHT 5FY1A 3P4QA 4EYYR 4KHZF 3RKGA 3UU8A 5CGMA 3NKZA 2YINA 3T8OA 4X1IE 2KSRA 1UX4A 1E7PA 2IC9A 4KHPT 4UR9A 2KT9A 5IHYA 1ZEEA 5C3JA 3PJAA 5HXEA 1HG5A 4JI1T 3O1JA 2WMNA 4H9OC 5FP3A 2WSSV 2UXCT 3GA8A 4GKKT 5JVDE 2ODVA 3P4WA 2K5BB 4NUVA 4HN9A 5HEUA 5HCMA 2YN6A 2XM1A 3K3OA 2LSIA 4FI5A 3AECA 4KI0F 2DI4A 2X0YA 1XDPA 2Q9QA 2UXBT 4ZS3A 2R6GF 2XTLA 3JC6D 3N9QA 4EOZB 4HEAA 4G63A 2LSYA 2W67A 2X0LB 5IWAT 1XNRT 1KEYA 2X68A 2W61A 2WBLA 4H9SE 4ZI2C 3N2KE 3ZMTB 3FZFB 4TWHA 1OEDA 2XUEA 2XQ3A 4JI8T 2SPCA 4QXBB 5AFUL 3N9LA 3S4UA 3E0ZA 1QUUA 1CHUA 5AQJB 3RX6A 4P1NA 5J0ZA 5JR9A 1UUSA 5HEOA 2ZLYA 3F31A 5AQIB 3CQXC 3UT5E 2L8KA 4EB6E 2VKOA 3RHWA 4NIQA 4AIUA 2XQ6A 3MJXA 4L5GA 3NVOA 4YHJA 3QUJA 5LYJE 1D0XA 4JLEA 4XBFB 2QYWA 3OPCA 2DWKA 3PDYA 5KMGP 2BG9E 2WP9A 3OBVE 2NTYA 3O1IA 2XQ9A 5GONE 5HXSA 4ERRA 2ODUA 2KZ7B 5KDMC 3L8RA 3ZPOA 3ETVA 3EDVA 3ZMVB 4YLHA 4HWFA 4LFAT 4BA9A 3VR8A 4HE8A 4A97A 5JQGE 4PJJA 2MTQA 4N78D 4JEUB 5DQVA 3C4ZA 1ZV4X 4HKAA 3GN5A 2XPKA 5J2UE 5LGUB 3L39A 2WZHA 4AKLA 4JI4T 2HPJA 4LFBT 3R84B 3IBPA 3MA9A 3T1YT 4LF8T 3P8CD 3CWZB 3JC6C 4IDQA 4ZI3D 3ZN1B 5JDGA 4OHFA 4O8SA 2C5JA 5ABFA 2WDQA 2XAHB 3LDQB 4IL4A 1BR1A 3QB5A 3FBZA 3P4RA 2YU1A 2D2SA 1Y64B 1I6ZA 3CPZA 3QK6A 2H7VC 2WQYA 4BJNA 3PURA 1IJ6A 2H88A 2CHNA 2KINB 2UXXB 3SFEA 4EZHA 4H9RC 4NXNT 4QX8B 1V9DA 2FJAA 4YSXA 4EIWA 3TLWA 1E1HB 4B3ST 4HWHA 2V7KA 4Z90A 4LF6T 5BR8T 2HN1A 4KP3C 3EI0A 3AE2A 4U31A 3KVAA 3AXJB 3FZKB 3ZSTA 4U3CA 3RF1A 1WR6A 4U74A 3UU6A 1LRZA 2LKHA 2BBJA 4C90A 4IDNA 1YD8G 2LM9A 4QH1A 5BMVE 4ZI7E 4X5TA 3I1AA 4EEBA 4DV7T 4YT0A 5L3BB 3D0TA 3RC8A 1HCIA 3C4WA 4BJMA 4OK0A 1SA0E 3E08A 2CWYA 3RIUC 2EHOA 2WB5A 3EDUA 1UGOA 1IBMT 2ACZA 3KV4A 4EYUA 3MZKB 2RA1A 1YQ4A 3O4XE 3UUNA 2XAGB 3Q5XA 2E9XD 1M7KA 3A7MA 3AE8A 2ZM6T 1KNZA 3U78A 3AB3B 3FZLB 4ILCA 2M6BA 3KV9A 4IREA 3UU4A 2Q9QD 2NWBA 4ZI3C 5HXHA 2YKSA 4YY3T 2V1DB 3RIFA 4HFBA 1FMVA 2BG9C 1GQEA 3WI3A 2Y6XA 4ZS2A 4CI2B 1ZOYA 4DIDB 1U5PA 4HFEA 5JDQA 3ABVA 3M3ZB 3N2OA 3VRAA 2D0UA 3C98B 3ESLA 3X1DA 3V5UA 1D1CA 2OA5A 3KINB 4X66T 3NRXA 4B6XA 5JREA 2BG9B 3C4XA 3NZPA 4UF0B 3UTKA 3RRWA 4F8HA 2XJ7A 4JI3T 5AQGB 1AJ3A 2JQ9A 1XMOT 4MHCA 4E7ZA 2VK9A 2CXFA 4IT4A 2UUCT 3CX7B 2XQ7A 1M62A 4YTMA 3FXDB 5AQLB 3OJAA 2Y8DA 3ANWA 5LG4A 2JJ9A 4QXHB 5F3JA 1SE7A 5AQRB 1XDOA 2MPKA 2UUAT 2MBGA 4DO0A 2YOEA 3FXEB 4LFCT 5FKYA 3ZYLA 2A9UA 1ZP0A 2W00A 2LSKA 3RPUA 1LVKA 4EXTA 2CXDA 4ZOLE 2MOZA 3ZC1A 2HPLA 4DV0T 4CXXA 3RYCE 2XQ5A 1J1JA 2JIWA 5KXJA 3RGLA 3BQLA 4NUUA 4HTEA 2V6XA 2YU2A 2ES0A 4IDZA 1NENA 4HWIB 2KMFA 3HKDE 3KV5A 5HWXA 2E8IA 4QH4A 2LRLA 5EK3A 2GK9A 2V6YA 2XQAA 4K0KT 2UU9T 4GKJT 4PW8A 3RQUA 1OWAA 4IIJE 2XSBA 3AAEB 5F8PA 1WFDA 5JDFA 2BKPA 4HWDA 1W0BA 4IE5A 3B57A 5FVLA 2ZM0A 5JRCB 4JI2T 5HYAA 2KNDA 5FVKA 3GMIA 5FXZA 4A98A 3PUQA 4UV8B 4GYSA 4B3TT 5EZYE 2Z6EA 2WM9A 4UVCB 4HFHA 1L0VA 4I55E 2E9XB 4JUYA 2KLQA 4YTPA 2N2NA 3ZT5A 1YKHB 5FL0A 4IDOA 3VHLA 1HNZT 1Z0PA 3HKEE 2V8SV 2VVSA 4ASKA 3VR9A 4AQFC 4HFVA 1H7CA 4PFOA 5DABA 4X20E 1VOMA 2BS3A 3K8PC 4AISA 3RYFE 5FY0A 2VKJA 4KBMB 2V5DA 4ISTA 1UCUA 1WYBA 4AKIA 4BAYB 4WBOA 3C51A 3SS1A 4KMCA 3AA6B 2FJEA 3FBLA 4EZ4A 3ONJA 2WS3A 3QOFA 5FL1A 2PG8A 1B7TA 3K1SA 2P9BA 3OVUA 2JMKA 2V7LA 2I0MA 4DR5T 3RC3A 5ADXL 3AE4A 2A2FX 2XM2A 4KUMB 3PUYF 4YXDA 2CMRA 1UX5A 2DHRA 2F4VT 3ZYMA 2D9DA 1HFAA 4LF9T 4DBRA 1I94T 2JPFA 2WDVA 1HNXT 2MAWA 4HFIA 4IE7A 3IEEA 3JCFA 4DV3T 4L0RA 4WZXA 3K3QC 1T72A 2IDOB 3T1HT 4TWDA 2XAJB 4HFCA 4UIGA 4O2BE 2WMOA 5EK4A 1MMGA 3AA1B 4AI6A 1YW0A 2DL1A 3LG7A 3DTOA 4V1Av 4PFPA 1MNEA 2K24A 4ZZBA 4WYVA 4UV9B 1KNPA 2UXNB 1IBKT 4UXNB 3AEDA 1KNRA 2LLYA 2I6HA 4UEMA 3ZMUB 3H3AA 4H9PC 3AVSA 5H6QB 5L3FB 5LHIB 3PTRB 2Y48B 3R6NA 4ZZCA 2WAUA 3RKOA 2FJBA 3BQIA 4DV5T 2VB6A 3LJCA 4O4LE 3J7Yq 1E2AA 3P50A 3VRBA 2BS2A 4JV5T 1MIVA 4PNIA 2X51A 2NP9A 1WLXA 4DV4T 3RYIE 3EVYA 2V7IA 3Q2MA 1XMQT 3FZMB 3W15B 2QGSA 3AEAA 1UK5A 2JRKA 3N9OA 3TLSA 1HR0T 2WWUA 2IMLA 4U2ZA 2XQ4A 1QSDA 2XQYA 1VCTA 5EK2A 4CI1B 5HAXA 3AEGA 5AQKB 5AQFB 3KVBA 1S35A 3JAEA 5ABEA 1UURA 2XZEA 3UUBA 2W63A 2H7OA 4FJOA 2BDEA 4O4JE 3P7IA 4AQYT 2VQET 4EAHA 2BVMA 1NEKA 5LHHB 2G0UA 3ONLC 2IW5B 1ZHCA 4H9NC 4X1YE 3M65A 1NAFA 1JNRA 2CWOA 3P4PA 1W09A 5CFBA 1EZ3A 1XNQT 4QHOA 3KBUA 2L9QA 5LMUT 5J2TE 2BVLA 5HEHA 4PK5A 4YFSA 1N33T 4U7YA 2HN2A 2ZM8A 3SRZA 3AE1A 3PUSA 4NXMT 3ZT7A 5LGNB 4CI3B 2CBIA 2QVAA 2XQ8A 4ZXLA 4ANJA 5LJNA 3PE0A 4GK0E 3NRYA 3AAAB 4AQGA
chains in the Genus database with same CATH topology
4HN9A 1AJ3A 3GN5B 4MHCA 4UVBB 2XASB 3I9YA 2PJQA 4E7ZA 2VK9A 3PUAA 2CXFA 2KWHA 3AVRA 4DMWA 5LCYA 3CX7B 3K3OA 2LSIA 2K48A 4FI5A 4IE4A 1BR0A 3ZCJA 3LK3B 3FXDB 2DI4A 2NW7A 4Z8XA 2Q9QA 5CA0E 3OJAA 3LBXB 5A1LA 2Y8DA 3ANWA 4ZS3A 2JQQA 3KV6A 3U3IA 5LG4A 2DCFA 2XTLA 2JJ9A 3JC6D 4QXHB 5F3JA 3NZQA 1MIWA 3AA0B 3N9QA 4EOZB 3L09A 3UUMA 2VKDA 2MBGA 4DO0A 4HEAA 4G63A 2JMHA 3FXEB 2LSYA 2M67A 2X0LB 4CQIA 4WNKA 3ZYLA 2LOPA 2X68A 4YJ3E 3SWHA 2W61A 2WBLA 2ZMAA 4H9SE 4AKGA 1LVFA 2W00A 2LSKA 3RPUA 2YK0A 4ZI2C 1LVKA 3N2KE 4EXTA 3ZMTB 2CXDA 4ZOLE 3FHNA 5CA1E 3V5SA 4GK5E 2X9YA 3QC9A 5LOVE 2V26A 2VKHA 2XUEA 2MOZA 3ZC1A 2L3LA 3ZMSB 1MIYA 2SPCA 2HPLA 3N2GE 4CXXA 4QXBB 5AFUL 3N9LA 4QKNA 3RYCE 1IJ5A 3S4UA 3E0ZA 1QUUA 4UVAB 3RX6A 5HXRA 4ADZA 4TV8E 5JR9A 3BQLA 4NUUA 3J9X1 4HTEA 3K3NA 1WRDA 4ILUA 2QA7A 2X9XA 3BK9A 2DNXA 2YU2A 2ES0A 4O4IE 3UUXB 2PFVA 2ZLYA 5CB4E 4IDZA 1YKEB 3F31A 2KMFA 1US7B 3HKDE 3KV5A 5HWXA 2E8IA 1IZNB 3Q9DA 3CQXC 5EK3A 3UT5E 2GK9A 4H63V 1HS7A 2L8KA 4EB6E 2LJLA 2VKOA 3OYXA 1MMAA 4QX7B 4GYRA 3UULA 3RH3A 4L9IA 3MACA 4X1KE 5DJQC 4PW8A 2LHRA 1OWAA 4IIJE 3AAEB 3I0OA 4TZ4C 5F8PA 2NOXA 1FIOA 3MJXA 4L5GA 5JDFA 1O3XA 2NW9A 3DJBA 4YHJA 3QUJA 3B13A 5LYJE 3ZMZB 4IE5A 3B57A 1X79A 1D0XA 3N9MA 2ZM0A 3EUHA 4JLEA 3RYHE 4XBFB 5JRCB 1KK7A 1S94A 2DWKA 3PDYA 3CVRA 4F6RC 5HYAA 2KNDA 3MKDA 5KX5E 5KMGP 3GMIA 5FXZA 4AXPA 4DBQA 3PUQA 3ZJ2A 3N5LA 3OBVE 4GYSA 4J2CA 4UV8B 5DQWA 5EZYE 2NTYA 3O1IA 1WYCA 2LEHA 2DWGA 2EHOC 2Z6EA 2WM9A 4UVCB 5GONE 2CXLA 5HXSA 3AAIA 4ERRA 2ODUA 2KZ7B 2E9XB 4I55E 4JUYA 3LK42 5KDMC 3ZPOA 5LHGB 2KLQA 3ETVA 1CUNA 5JH7E 3ZN0B 4DMVA 4XZCA 3EDVA 5TAOA 4MBQA 2N2NA 1YKHB 3C64A 4CXYA 3ZMVB 2ZM2A 4YLHA 3VHLA 2XAFB 1Z0PA 3BQKA 4BA9A 2C5IT 4HE8A 3HKEE 5HXCA 1HG2A 3FB2A 2D5UA 3ETUA 4DVDA 4CZZB 5JQGE 4PAGA 2B1EA 4PJJA 4ASKA 2MTQA 4UF0A 3C50A 4AQFC 4HFVA 4PJNA 1H7CA 5FNVE 4YJ2E 4N78D 4PFOA 4JEUB 5DABA 4X20E 5DQVA 1HF8A 1VOMA 3K8PC 3C4ZA 3RYFE 1ZV4X 4HKAA 3GN5A 3HL6A 2DLRA 3ZLIA 3N9PA 5FY0A 3PU8A 5J2UE 2EHOB 1IAPA 2VKJA 4KBMB 2LOSA 5LGUB 4ZI2D 2KWIB 4ISTA 1UCUA 3AA7B 1G8XA 1WYBA 4AKLA 4AKIA 1T98A 3ONXA 2HPJA 4BAYB 2XHEB 4WBOA 4M1PA 2VASA 3N9NA 3R84B 5LNKA 5L3CB 4H9QC 3LBXA 3C51A 3ZYKA 3IBPA 3SS1A 4KMCA 3AA6B 5FY7A 3MA9A 5L3GB 4PK6A 3FBLA 4EZ4A 1ZKEA 1D0ZA 3P8CD 3CWZB 2KXPB 3JC6C 2PG8A 1B7TA 2P9BA 1VRBA 2JMKA 2V7LA 3IHRA 5LBQB 5J1GA 3RC3A 2ACXA 4ZI3D 5ADXL 2A2FX 4XAXB 4KUMB 5FXWA 3ZN1B 4AKRB 5JDGA 2YEVC 4OHFA 2N9DA 2CA5A 3HR0A 2CMRA 4O8SA 1UX5A 2C5JA 4I4TE 2DHRA 3ZYMA 5JDLA 2C0SA 1HFAA 4JEHB 4DBRA 5LBMA 5M4YA 2XAHB 2JPFA 5JDNA 2J1DG 1BR1A 2CCQA 3FBZA 4IE7A 3HI2A 2YU1A 2E9XC 2RP4A 2D2SA 3I9WA 1Y64B 3IEEA 3CPZA 4L0RA 5LXTE 3QK6A 2A3DA 2H7VC 3Q5WA 4BJNA 4WBNE 1D0YA 3K3QC 3LK2B 3PURA 1IJ6A 2X9WA 2XAJB 3E22E 5IYZE 4UIGA 4QWNB 4O2BE 4UELA 3ZCIA 2KINB 2UXXB 2WMOA 2X66A 3O9XA 5EK4A 2Q9QC 2V7MA 3L3PA 3IF8B 1MMGA 3OYZA 4H9RC 2X67A 4EZHA 4WW0A 3HKCE 4QX8B 4MLKA 3AA1B 4AI6A 1YW0A 4P09A 1V9DA 3LG7A 4ZHQE 3DTOA 4V1Av 3WAJA 1U4QA 4PFPA 4TX5A 3CKDA 4PK4A 1MNEA 3PUGA 2K24A 4MALA 3H37A 5HWYA 4EIWA 4OYKA 1E1HB 3F57A 5LA6E 4UV9B 2V7JA 2UXNB 2V7KA 4UXNB 5FXXA 3CX6B 3KDSE 2W0GA 1MMDA 4KP3C 5FXVA 5H6RB 4IGUA 4UEMA 5JRCA 3ZMUB 5C8YE 5L2LA 4G2AA 3H3AA 3KVAA 4H9PC 3WAKA 4E7SA 3AVSA 5H6QB 3OKQA 5L3FB 3PTRB 2Y48B 3R6NA 5LHIB 5L3DB 1HTJF 2Q9QB 1WR6A 4U74A 2WAUA 3LFMA 3RKOA 1LRZA 4TUYE 2A72A 3ANWB 3KBTA 5LJMA 3BQIA 3HA4A 3VU7H 2H3RA 2VB6A 3LJCA 2N1GA 3CX8B 4O4LE 2BZBA 4C90A 3J7Yq 2XAQB 1YD8G 2E9XA 3GWHA 2LM9A 4I50E 5JR9C 5LP6E 1BR2A 3A5XA 3SOLA 2CLYC 5BMVE 4ZI7E 1MIVA 3I1AA 5L3BB 4PNIA 2X51A 2MYSA 2NP9A 1WLXA 2IAKA 2NTXA 3D0TA 1MNDA 4MFRA 4DNDA 3RC8A 1HCIA 3NBXX 4TV9E 3ZC0A 3C4WA 3RYIE 5LGTB 3EVYA 5ETWA 2V7IA 3Q2MA 2W62A 4C91A 2IC6A 1SHZC 3W15B 3MK7C 4BJMA 2QGSA 4OK0A 3ZJ1A 2JRKA 1SA0E 3N9OA 4P0AA 2WWUA 3E08A 4ISSA 2I59A 5L3EB 2LT3A 2CWYA 2D0TA 2EHOA 4IHJE 4A56A 2VWAA 1QSDA 2XQYA 2PBIA 2CM0A 5EK2A 4CI1B 2C5KT 5HAXA 2NW8A 3EDUA 4P0BA 4OFZA 3KV4A 4IE6A 1NWMX 4EYUA 5JR9B 3MZKB 1BR4A 2RA1A 3KFWX 3ZEFB 3O4XE 3UUNA 3KVBA 2CLYB 2XAGB 1S35A 3CMLA 4HGAA 4QXCB 3Q5XA 3MXZA 2E9XD 4I43B 2LSGA 2W63A 2H7OA 4FJOA 2BDEA 4O4JE 3P7IA 3VKGA 1KNZA 3U78A 3AB3B 4AQFA 5FMNA 4EAHA 2BVMA 4TN7B 3KV9A 3O1HA 4PJLA 4AKHA 1FMWA 5LHHB 3UFEA 2Q9QD 1FEWA 1D1BA 2G0UA 2NWBA 4GOUA 4O4HE 5E0OA 3CQCB 4ZI3C 2IW5B 1ZHCA 2HH7A 5HXHA 2V1DB 3PU3A 2LSJA 2CE7A 2LHNA 4H9NC 4X1YE 3DP7A 3M65A 1FMVA 1NAFA 4O2AE 1LKXA 2CWOA 3WI3A 5FY1A 2Y6XA 5FYMA 1EZ3A 4ZS2A 4K0UA 4CI2B 4EYYR 4QHOA 5JDMA 1U5PA 2EHOD 2L9QA 3KBUA 5JDQA 2YINA 3TKLB 5J2TE 4H63H 2BVLA 2LE8A 3T8OA 3VKHA 1MMNA 2X9HA 4X1IE 1G73A 1UX4A 4IE0A 5JDHA 3RRCA 4PK5A 2IC9A 1D1AA 2CEAA 1HX8A 4YFSA 3N2OA 2D0UA 2KT9A 3HKBE 5IHYA 1ZEEA 1OXZA 2ZM8A 3C98B 4OYJA 5HXEA 3ESLA 4CXWA 1HG5A 3V5UA 1D1CA 2VL8A 2OA5A 3KINB 4PJMA 3SRZA 3F2EA 3NRXA 3O1JA 3CQGB 2WMNA 2K9AA 3PUSA 4B6XA 5LGNB 4H9OC 4CI3B 5FP3A 2WSSV 5JREA 3GA8A 4U72A 4GIWA 3C4XA 3NZPA 5JVDE 4UF0B 3UTKA 3RRWA 2ODVA 3I0QA 4ANJA 5LJNA 2K5BB 4NUVA 3PE0A 4GK0E 3NRYA 3AAAB 4AQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O C;  4H9Q C;  4H9S E;  4H9R C;  4H9N C;  4H9P C;  4HGA A;  5KDM C; 
#chains in the Genus database with same CATH topology
 2VQF T;  2YDQ A;  2PJQ A;  5LCY A;  5CJ5 A;  1HX1 B;  2K48 A;  3AE5 A;  4IE4 A;  3AXJ A;  1BR0 A;  3LK3 B;  3QB5 K;  5JTG A;  3LBX B;  4COF A;  2JQQ A;  2AXD S;  1OED E;  4CN6 A;  1MIW A;  3AA0 B;  3UUM A;  2VKD A;  2JMH A;  2XY8 B;  4ILA A;  2M67 A;  3AE7 A;  5C2T A;  4WNK A;  1DU2 A;  2IIU A;  1LVF A;  4DV6 T;  4GK5 E;  3ZKR A;  2X9Y A;  3QC9 A;  2V26 A;  2VKH A;  3RI5 A;  2L3L A;  3ZMS B;  3N2G E;  2FBW A;  1IJ5 A;  4UVA B;  5HXR A;  3UQ4 A;  4TV8 E;  1SUM B;  3J9X 1;  1WRD A;  2QA7 A;  3BK9 A;  2DNX A;  5CB4 E;  1YKE B;  3PJA J;  1US7 B;  4LML A;  1IZN B;  3Q9D A;  4H63 V;  1HS7 A;  3EAM A;  2LJL A;  4QX7 B;  4HFD A;  4GYR A;  3UUL A;  3RH3 A;  5DJQ C;  2LHR A;  3I0O A;  4DV1 T;  2VVN A;  4X65 T;  1O3X A;  2FJD A;  3RIU A;  3DJB A;  2LRK A;  3EUH A;  3MKD A;  4J2C A;  1WYC A;  2DWG A;  3TLT A;  1JNZ A;  3UU5 A;  1QLB A;  3AAI A;  3LK4 2;  1CUN A;  3ZN0 B;  4MBQ A;  1N34 T;  4CXY A;  2WU2 A;  4DV2 T;  4EED A;  2VL0 A;  1X9B A;  1HG2 A;  3TLV A;  2D5U A;  2BG9 A;  4YSY A;  4UF0 A;  4PJN A;  5AQN B;  2CPT A;  4IDP A;  2DLR A;  3ZLI A;  3N9P A;  2E5L T;  1IAP A;  4ZI2 D;  1G8X A;  3NWI A;  1T98 A;  4M1P A;  2VAS A;  2WDR A;  5LNK A;  4H9Q C;  2WCA A;  3PV0 F;  5L3G B;  1D0Z A;  2BS4 A;  5LBQ B;  2ACX A;  5FXW A;  4U7I A;  4AKR B;  2N9D A;  2CA5 A;  3HR0 A;  4I4T E;  2IUB A;  4DR7 T;  5M4Y A;  5JDN A;  2XSA A;  3UFG A;  2J1D G;  4KX6 A;  4Z91 A;  4A5X A;  2E9X C;  2RP4 A;  2E2A A;  5LXT E;  2K3W A;  3Q5W A;  4DR3 T;  3B5M A;  4TWF A;  3E22 E;  5IYZ E;  1XWM A;  4QWN B;  3ZCI A;  4DR4 T;  2Q9Q C;  2V7M A;  3L3P A;  3IF8 B;  3OYZ A;  2X67 A;  3HKC E;  4MLK A;  3EAB A;  2WWV A;  4DUY T;  3WAJ A;  4TX5 A;  3CKD A;  4MAL A;  5HWY A;  2X0H A;  5LMN T;  5LA6 E;  3AE3 A;  2CHO A;  3CX6 B;  3KDS E;  2W0G A;  5AQV B;  5FXV A;  3AEF A;  1WR0 A;  3P4S A;  5JRC A;  1OED C;  4E7S A;  3OKQ A;  4EV6 A;  5L3D B;  1HTJ F;  2Q9Q B;  5AQM B;  5F5W A;  1YQ3 A;  4TUY E;  2A72 A;  3KBT A;  2H3R A;  2BZB A;  1J5W A;  2E9X A;  3GWH A;  4I50 E;  5JR9 C;  2J4G A;  3SOL A;  1KF6 A;  3TLU A;  2MYS A;  2RPA A;  5AQO B;  2NTX A;  2IAK A;  4MFR A;  4DND A;  3NBX X;  4TV9 E;  3ZC0 A;  5ETW A;  2W62 A;  5AQU B;  4C91 A;  2IC6 A;  1OED B;  3ZJ1 A;  4P0A A;  5ABG A;  4JI6 T;  2I59 A;  3PUZ F;  5L3E B;  4JBW F;  2LT3 A;  2D0T A;  4IHJ E;  4A56 A;  3UU3 A;  2PBI A;  4LF7 T;  4P0B A;  4IE6 A;  5JR9 B;  1NWM X;  3UQ7 A;  1BR4 A;  1R8I A;  3CML A;  2AE9 A;  2LSG A;  2QRX A;  4AQF A;  4LF4 T;  2V5C A;  4AKH A;  3O1H A;  4PJL A;  1WCR A;  3UFE A;  1D1B A;  5ABH A;  4GOU A;  4O4H E;  5E0O A;  3CQC B;  3DP7 A;  3JAD A;  4O2A E;  4NPP A;  1LKX A;  2FUP A;  5FYM A;  4K0U A;  5JDM A;  2EHO D;  3TKL B;  4H63 H;  2LE8 A;  2E5V A;  2BBH A;  3A8Y C;  3VKH A;  1MMN A;  2X9H A;  1G73 A;  4IE0 A;  5JDH A;  3RRC A;  4X62 T;  1D1A A;  2CEA A;  1HX8 A;  4HWC A;  3HKB E;  1OXZ A;  4OYJ A;  4B3M T;  2M6I A;  4CXW A;  2OLT A;  3CK6 A;  3RQW A;  2VL8 A;  4PJM A;  3F2E A;  3CQG B;  2K9A A;  4JYA T;  2WZI A;  4U72 A;  4GIW A;  1IBL T;  3I0Q A;  4ILB A;  4LMK A;  3GN5 B;  4UVB B;  2XAS B;  3I9Y A;  3PUA A;  2KWH A;  3AVR A;  4DMW A;  3AEE A;  3AE9 A;  3SFD A;  4DR2 T;  3ZCJ A;  2NW7 A;  4TNV A;  4Z8X A;  5CA0 E;  5A1L A;  3KV6 A;  3U3I A;  2DCF A;  3NZQ A;  3JAF A;  3L09 A;  5AQH B;  5LB7 B;  4CQI A;  2LOP A;  4YJ3 E;  3SWH A;  2ZMA A;  1N36 T;  4AKG A;  2W4X A;  5ABF B;  2YK0 A;  3FHN A;  5CA1 E;  3V5S A;  2VUR A;  5LOV E;  2YDR A;  1MIY A;  2WY2 A;  2WU5 A;  4QKN A;  5HCJ A;  4JI0 T;  2W66 A;  4QH5 A;  4ADZ A;  4DR1 T;  5AQT B;  3Q5D A;  3K3N A;  4ILU A;  2X9X A;  3LSV A;  3UUX B;  4O4I E;  2PFV A;  3PUV F;  4LMJ A;  2BKO A;  2NR4 A;  3OYX A;  1MMA A;  2BKN A;  4DUZ T;  1HNW T;  4L9I A;  3MAC A;  4X1K E;  5L4H A;  4X64 T;  4TZ4 C;  2NOX A;  1FIO A;  2JQK A;  2NW9 A;  3B13 A;  4OX9 T;  1N32 T;  3ZMZ B;  5L4E A;  1X79 A;  2OV9 A;  3N9M A;  3RYH E;  1KK7 A;  1S94 A;  3CVR A;  4F6R C;  5KX5 E;  4DBQ A;  4AXP A;  3ZJ2 A;  3N5L A;  5DQW A;  3PUX F;  3H3M A;  2LEH A;  2EHO C;  2CXL A;  2YDS A;  5LHG B;  5JH7 E;  4DMV A;  4XZC A;  4YTN A;  5TAO A;  3C64 A;  2ZM2 A;  2XAF B;  4LF5 T;  3BQK A;  1VCS A;  2C5I T;  5HXC A;  3OTO T;  3FB2 A;  4DVD A;  3ETU A;  4CZZ B;  4PAG A;  2B1E A;  3ZT6 A;  1W9R A;  3C50 A;  4YJ2 E;  5FNV E;  2CRB A;  5HEJ A;  1HF8 A;  3HL6 A;  3PUW F;  3PU8 A;  2EHO B;  3RIA A;  2HHH T;  2LOS A;  2KWI B;  3AA7 B;  4YSZ A;  3ONX A;  4TNW A;  2XHE B;  3N9N A;  3AE6 A;  5L3C B;  3LBX A;  3ZYK A;  1Z8U A;  4Q25 A;  5FY7 A;  4JI7 T;  4PK6 A;  2J62 A;  1ZKE A;  3FZH B;  2W2U A;  2KXP B;  2IHR 1;  1VRB A;  3IHR A;  2LKG A;  5J1G A;  4XAX B;  2YEV C;  2J47 A;  2B76 A;  5JDL A;  2C0S A;  4JEH B;  5LBM A;  2JQH A;  2CCQ A;  3HI2 A;  5AQQ B;  3I9W A;  2A3D A;  4JI5 T;  4WBN E;  1D0Y A;  3LK2 B;  3RLF F;  2X9W A;  2UUB T;  4UEL A;  3Q5E A;  4B3R T;  2X66 A;  3O9X A;  4U2Y A;  4WW0 A;  4P09 A;  4ZHQ E;  1U4Q A;  2PTF A;  4PK4 A;  3PUG A;  3H37 A;  4OYK A;  4DR6 T;  3F57 A;  2V7J A;  5FXX A;  2H89 A;  1MMD A;  5H6R B;  4IGU A;  2LM2 A;  1XZY A;  5C8Y E;  4CN4 A;  5L2L A;  4G2A A;  3IA3 A;  3WAK A;  1Y01 A;  5IUX A;  3LFM A;  3ANW B;  5LJM A;  3HA4 A;  3VU7 H;  2N1G A;  3CX8 B;  2XAQ B;  1J5E T;  5LP6 E;  1BR2 A;  3A5X A;  3QNU A;  2CLY C;  1T8B A;  3G06 A;  3CIR A;  1MND A;  5LGT B;  1W0A A;  2CBJ A;  1SHZ C;  3MK7 C;  5AQP B;  4EGW A;  5L47 A;  4ISS A;  5HEG A;  1FJG T;  3AEB A;  2VWA A;  2CM0 A;  2C5K T;  2NW8 A;  4OFZ A;  3ZSS A;  3KFW X;  3ZEF B;  2CLY B;  4ZEY A;  4HGA A;  4QXC B;  5AQS B;  1T7S A;  3MXZ A;  5LG3 A;  4CN1 A;  4I43 B;  2V6Y B;  4U33 A;  3EHZ A;  3VKG A;  4I0U A;  5FMN A;  4TN7 B;  1FMW A;  1YXR A;  2UXD T;  1FEW A;  4IL9 A;  1KFY A;  2HH7 A;  3PU3 A;  2LSJ A;  2CE7 A;  2LHN A;  4YHH T;  5FY1 A;  3P4Q A;  4EYY R;  4KHZ F;  3RKG A;  3UU8 A;  5CGM A;  3NKZ A;  2YIN A;  3T8O A;  4X1I E;  2KSR A;  1UX4 A;  1E7P A;  2IC9 A;  4KHP T;  4UR9 A;  2KT9 A;  5IHY A;  1ZEE A;  5C3J A;  3PJA A;  5HXE A;  1HG5 A;  4JI1 T;  3O1J A;  2WMN A;  4H9O C;  5FP3 A;  2WSS V;  2UXC T;  3GA8 A;  4GKK T;  5JVD E;  2ODV A;  3P4W A;  2K5B B;  4NUV A;  4HN9 A;  5HEU A;  5HCM A;  2YN6 A;  2XM1 A;  3K3O A;  2LSI A;  4FI5 A;  3AEC A;  4KI0 F;  2DI4 A;  2X0Y A;  1XDP A;  2Q9Q A;  2UXB T;  4ZS3 A;  2R6G F;  2XTL A;  3JC6 D;  3N9Q A;  4EOZ B;  4HEA A;  4G63 A;  2LSY A;  2W67 A;  2X0L B;  5IWA T;  1XNR T;  1KEY A;  2X68 A;  2W61 A;  2WBL A;  4H9S E;  4ZI2 C;  3N2K E;  3ZMT B;  3FZF B;  4TWH A;  1OED A;  2XUE A;  2XQ3 A;  4JI8 T;  2SPC A;  4QXB B;  5AFU L;  3N9L A;  3S4U A;  3E0Z A;  1QUU A;  1CHU A;  5AQJ B;  3RX6 A;  4P1N A;  5J0Z A;  5JR9 A;  1UUS A;  5HEO A;  2ZLY A;  3F31 A;  5AQI B;  3CQX C;  3UT5 E;  2L8K A;  4EB6 E;  2VKO A;  3RHW A;  4NIQ A;  4AIU A;  2XQ6 A;  3MJX A;  4L5G A;  3NVO A;  4YHJ A;  3QUJ A;  5LYJ E;  1D0X A;  4JLE A;  4XBF B;  2QYW A;  3OPC A;  2DWK A;  3PDY A;  5KMG P;  2BG9 E;  2WP9 A;  3OBV E;  2NTY A;  3O1I A;  2XQ9 A;  5GON E;  5HXS A;  4ERR A;  2ODU A;  2KZ7 B;  5KDM C;  3L8R A;  3ZPO A;  3ETV A;  3EDV A;  3ZMV B;  4YLH A;  4HWF A;  4LFA T;  4BA9 A;  3VR8 A;  4HE8 A;  4A97 A;  5JQG E;  4PJJ A;  2MTQ A;  4N78 D;  4JEU B;  5DQV A;  3C4Z A;  1ZV4 X;  4HKA A;  3GN5 A;  2XPK A;  5J2U E;  5LGU B;  3L39 A;  2WZH A;  4AKL A;  4JI4 T;  2HPJ A;  4LFB T;  3R84 B;  3IBP A;  3MA9 A;  3T1Y T;  4LF8 T;  3P8C D;  3CWZ B;  3JC6 C;  4IDQ A;  4ZI3 D;  3ZN1 B;  5JDG A;  4OHF A;  4O8S A;  2C5J A;  5ABF A;  2WDQ A;  2XAH B;  3LDQ B;  4IL4 A;  1BR1 A;  3QB5 A;  3FBZ A;  3P4R A;  2YU1 A;  2D2S A;  1Y64 B;  1I6Z A;  3CPZ A;  3QK6 A;  2H7V C;  2WQY A;  4BJN A;  3PUR A;  1IJ6 A;  2H88 A;  2CHN A;  2KIN B;  2UXX B;  3SFE A;  4EZH A;  4H9R C;  4NXN T;  4QX8 B;  1V9D A;  2FJA A;  4YSX A;  4EIW A;  3TLW A;  1E1H B;  4B3S T;  4HWH A;  2V7K A;  4Z90 A;  4LF6 T;  5BR8 T;  2HN1 A;  4KP3 C;  3EI0 A;  3AE2 A;  4U31 A;  3KVA A;  3AXJ B;  3FZK B;  3ZST A;  4U3C A;  3RF1 A;  1WR6 A;  4U74 A;  3UU6 A;  1LRZ A;  2LKH A;  2BBJ A;  4C90 A;  4IDN A;  1YD8 G;  2LM9 A;  4QH1 A;  5BMV E;  4ZI7 E;  4X5T A;  3I1A A;  4EEB A;  4DV7 T;  4YT0 A;  5L3B B;  3D0T A;  3RC8 A;  1HCI A;  3C4W A;  4BJM A;  4OK0 A;  1SA0 E;  3E08 A;  2CWY A;  3RIU C;  2EHO A;  2WB5 A;  3EDU A;  1UGO A;  1IBM T;  2ACZ A;  3KV4 A;  4EYU A;  3MZK B;  2RA1 A;  1YQ4 A;  3O4X E;  3UUN A;  2XAG B;  3Q5X A;  2E9X D;  1M7K A;  3A7M A;  3AE8 A;  2ZM6 T;  1KNZ A;  3U78 A;  3AB3 B;  3FZL B;  4ILC A;  2M6B A;  3KV9 A;  4IRE A;  3UU4 A;  2Q9Q D;  2NWB A;  4ZI3 C;  5HXH A;  2YKS A;  4YY3 T;  2V1D B;  3RIF A;  4HFB A;  1FMV A;  2BG9 C;  1GQE A;  3WI3 A;  2Y6X A;  4ZS2 A;  4CI2 B;  1ZOY A;  4DID B;  1U5P A;  4HFE A;  5JDQ A;  3ABV A;  3M3Z B;  3N2O A;  3VRA A;  2D0U A;  3C98 B;  3ESL A;  3X1D A;  3V5U A;  1D1C A;  2OA5 A;  3KIN B;  4X66 T;  3NRX A;  4B6X A;  5JRE A;  2BG9 B;  3C4X A;  3NZP A;  4UF0 B;  3UTK A;  3RRW A;  4F8H A;  2XJ7 A;  4JI3 T;  5AQG B;  1AJ3 A;  2JQ9 A;  1XMO T;  4MHC A;  4E7Z A;  2VK9 A;  2CXF A;  4IT4 A;  2UUC T;  3CX7 B;  2XQ7 A;  1M62 A;  4YTM A;  3FXD B;  5AQL B;  3OJA A;  2Y8D A;  3ANW A;  5LG4 A;  2JJ9 A;  4QXH B;  5F3J A;  1SE7 A;  5AQR B;  1XDO A;  2MPK A;  2UUA T;  2MBG A;  4DO0 A;  2YOE A;  3FXE B;  4LFC T;  5FKY A;  3ZYL A;  2A9U A;  1ZP0 A;  2W00 A;  2LSK A;  3RPU A;  1LVK A;  4EXT A;  2CXD A;  4ZOL E;  2MOZ A;  3ZC1 A;  2HPL A;  4DV0 T;  4CXX A;  3RYC E;  2XQ5 A;  1J1J A;  2JIW A;  5KXJ A;  3RGL A;  3BQL A;  4NUU A;  4HTE A;  2V6X A;  2YU2 A;  2ES0 A;  4IDZ A;  1NEN A;  4HWI B;  2KMF A;  3HKD E;  3KV5 A;  5HWX A;  2E8I A;  4QH4 A;  2LRL A;  5EK3 A;  2GK9 A;  2V6Y A;  2XQA A;  4K0K T;  2UU9 T;  4GKJ T;  4PW8 A;  3RQU A;  1OWA A;  4IIJ E;  2XSB A;  3AAE B;  5F8P A;  1WFD A;  5JDF A;  2BKP A;  4HWD A;  1W0B A;  4IE5 A;  3B57 A;  5FVL A;  2ZM0 A;  5JRC B;  4JI2 T;  5HYA A;  2KND A;  5FVK A;  3GMI A;  5FXZ A;  4A98 A;  3PUQ A;  4UV8 B;  4GYS A;  4B3T T;  5EZY E;  2Z6E A;  2WM9 A;  4UVC B;  4HFH A;  1L0V A;  4I55 E;  2E9X B;  4JUY A;  2KLQ A;  4YTP A;  2N2N A;  3ZT5 A;  1YKH B;  5FL0 A;  4IDO A;  3VHL A;  1HNZ T;  1Z0P A;  3HKE E;  2V8S V;  2VVS A;  4ASK A;  3VR9 A;  4AQF C;  4HFV A;  1H7C A;  4PFO A;  5DAB A;  4X20 E;  1VOM A;  2BS3 A;  3K8P C;  4AIS A;  3RYF E;  5FY0 A;  2VKJ A;  4KBM B;  2V5D A;  4IST A;  1UCU A;  1WYB A;  4AKI A;  4BAY B;  4WBO A;  3C51 A;  3SS1 A;  4KMC A;  3AA6 B;  2FJE A;  3FBL A;  4EZ4 A;  3ONJ A;  2WS3 A;  3QOF A;  5FL1 A;  2PG8 A;  1B7T A;  3K1S A;  2P9B A;  3OVU A;  2JMK A;  2V7L A;  2I0M A;  4DR5 T;  3RC3 A;  5ADX L;  3AE4 A;  2A2F X;  2XM2 A;  4KUM B;  3PUY F;  4YXD A;  2CMR A;  1UX5 A;  2DHR A;  2F4V T;  3ZYM A;  2D9D A;  1HFA A;  4LF9 T;  4DBR A;  1I94 T;  2JPF A;  2WDV A;  1HNX T;  2MAW A;  4HFI A;  4IE7 A;  3IEE A;  3JCF A;  4DV3 T;  4L0R A;  4WZX A;  3K3Q C;  1T72 A;  2IDO B;  3T1H T;  4TWD A;  2XAJ B;  4HFC A;  4UIG A;  4O2B E;  2WMO A;  5EK4 A;  1MMG A;  3AA1 B;  4AI6 A;  1YW0 A;  2DL1 A;  3LG7 A;  3DTO A;  4V1A v;  4PFP A;  1MNE A;  2K24 A;  4ZZB A;  4WYV A;  4UV9 B;  1KNP A;  2UXN B;  1IBK T;  4UXN B;  3AED A;  1KNR A;  2LLY A;  2I6H A;  4UEM A;  3ZMU B;  3H3A A;  4H9P C;  3AVS A;  5H6Q B;  5L3F B;  5LHI B;  3PTR B;  2Y48 B;  3R6N A;  4ZZC A;  2WAU A;  3RKO A;  2FJB A;  3BQI A;  4DV5 T;  2VB6 A;  3LJC A;  4O4L E;  3J7Y q;  1E2A A;  3P50 A;  3VRB A;  2BS2 A;  4JV5 T;  1MIV A;  4PNI A;  2X51 A;  2NP9 A;  1WLX A;  4DV4 T;  3RYI E;  3EVY A;  2V7I A;  3Q2M A;  1XMQ T;  3FZM B;  3W15 B;  2QGS A;  3AEA A;  1UK5 A;  2JRK A;  3N9O A;  3TLS A;  1HR0 T;  2WWU A;  2IML A;  4U2Z A;  2XQ4 A;  1QSD A;  2XQY A;  1VCT A;  5EK2 A;  4CI1 B;  5HAX A;  3AEG A;  5AQK B;  5AQF B;  3KVB A;  1S35 A;  3JAE A;  5ABE A;  1UUR A;  2XZE A;  3UUB A;  2W63 A;  2H7O A;  4FJO A;  2BDE A;  4O4J E;  3P7I A;  4AQY T;  2VQE T;  4EAH A;  2BVM A;  1NEK A;  5LHH B;  2G0U A;  3ONL C;  2IW5 B;  1ZHC A;  4H9N C;  4X1Y E;  3M65 A;  1NAF A;  1JNR A;  2CWO A;  3P4P A;  1W09 A;  5CFB A;  1EZ3 A;  1XNQ T;  4QHO A;  3KBU A;  2L9Q A;  5LMU T;  5J2T E;  2BVL A;  5HEH A;  4PK5 A;  4YFS A;  1N33 T;  4U7Y A;  2HN2 A;  2ZM8 A;  3SRZ A;  3AE1 A;  3PUS A;  4NXM T;  3ZT7 A;  5LGN B;  4CI3 B;  2CBI A;  2QVA A;  2XQ8 A;  4ZXL A;  4ANJ A;  5LJN A;  3PE0 A;  4GK0 E;  3NRY A;  3AAA B;  4AQG A; 
#chains in the Genus database with same CATH homology
 4HN9 A;  1AJ3 A;  3GN5 B;  4MHC A;  4UVB B;  2XAS B;  3I9Y A;  2PJQ A;  4E7Z A;  2VK9 A;  3PUA A;  2CXF A;  2KWH A;  3AVR A;  4DMW A;  5LCY A;  3CX7 B;  3K3O A;  2LSI A;  2K48 A;  4FI5 A;  4IE4 A;  1BR0 A;  3ZCJ A;  3LK3 B;  3FXD B;  2DI4 A;  2NW7 A;  4Z8X A;  2Q9Q A;  5CA0 E;  3OJA A;  3LBX B;  5A1L A;  2Y8D A;  3ANW A;  4ZS3 A;  2JQQ A;  3KV6 A;  3U3I A;  5LG4 A;  2DCF A;  2XTL A;  2JJ9 A;  3JC6 D;  4QXH B;  5F3J A;  3NZQ A;  1MIW A;  3AA0 B;  3N9Q A;  4EOZ B;  3L09 A;  3UUM A;  2VKD A;  2MBG A;  4DO0 A;  4HEA A;  4G63 A;  2JMH A;  3FXE B;  2LSY A;  2M67 A;  2X0L B;  4CQI A;  4WNK A;  3ZYL A;  2LOP A;  2X68 A;  4YJ3 E;  3SWH A;  2W61 A;  2WBL A;  2ZMA A;  4H9S E;  4AKG A;  1LVF A;  2W00 A;  2LSK A;  3RPU A;  2YK0 A;  4ZI2 C;  1LVK A;  3N2K E;  4EXT A;  3ZMT B;  2CXD A;  4ZOL E;  3FHN A;  5CA1 E;  3V5S A;  4GK5 E;  2X9Y A;  3QC9 A;  5LOV E;  2V26 A;  2VKH A;  2XUE A;  2MOZ A;  3ZC1 A;  2L3L A;  3ZMS B;  1MIY A;  2SPC A;  2HPL A;  3N2G E;  4CXX A;  4QXB B;  5AFU L;  3N9L A;  4QKN A;  3RYC E;  1IJ5 A;  3S4U A;  3E0Z A;  1QUU A;  4UVA B;  3RX6 A;  5HXR A;  4ADZ A;  4TV8 E;  5JR9 A;  3BQL A;  4NUU A;  3J9X 1;  4HTE A;  3K3N A;  1WRD A;  4ILU A;  2QA7 A;  2X9X A;  3BK9 A;  2DNX A;  2YU2 A;  2ES0 A;  4O4I E;  3UUX B;  2PFV A;  2ZLY A;  5CB4 E;  4IDZ A;  1YKE B;  3F31 A;  2KMF A;  1US7 B;  3HKD E;  3KV5 A;  5HWX A;  2E8I A;  1IZN B;  3Q9D A;  3CQX C;  5EK3 A;  3UT5 E;  2GK9 A;  4H63 V;  1HS7 A;  2L8K A;  4EB6 E;  2LJL A;  2VKO A;  3OYX A;  1MMA A;  4QX7 B;  4GYR A;  3UUL A;  3RH3 A;  4L9I A;  3MAC A;  4X1K E;  5DJQ C;  4PW8 A;  2LHR A;  1OWA A;  4IIJ E;  3AAE B;  3I0O A;  4TZ4 C;  5F8P A;  2NOX A;  1FIO A;  3MJX A;  4L5G A;  5JDF A;  1O3X A;  2NW9 A;  3DJB A;  4YHJ A;  3QUJ A;  3B13 A;  5LYJ E;  3ZMZ B;  4IE5 A;  3B57 A;  1X79 A;  1D0X A;  3N9M A;  2ZM0 A;  3EUH A;  4JLE A;  3RYH E;  4XBF B;  5JRC B;  1KK7 A;  1S94 A;  2DWK A;  3PDY A;  3CVR A;  4F6R C;  5HYA A;  2KND A;  3MKD A;  5KX5 E;  5KMG P;  3GMI A;  5FXZ A;  4AXP A;  4DBQ A;  3PUQ A;  3ZJ2 A;  3N5L A;  3OBV E;  4GYS A;  4J2C A;  4UV8 B;  5DQW A;  5EZY E;  2NTY A;  3O1I A;  1WYC A;  2LEH A;  2DWG A;  2EHO C;  2Z6E A;  2WM9 A;  4UVC B;  5GON E;  2CXL A;  5HXS A;  3AAI A;  4ERR A;  2ODU A;  2KZ7 B;  2E9X B;  4I55 E;  4JUY A;  3LK4 2;  5KDM C;  3ZPO A;  5LHG B;  2KLQ A;  3ETV A;  1CUN A;  5JH7 E;  3ZN0 B;  4DMV A;  4XZC A;  3EDV A;  5TAO A;  4MBQ A;  2N2N A;  1YKH B;  3C64 A;  4CXY A;  3ZMV B;  2ZM2 A;  4YLH A;  3VHL A;  2XAF B;  1Z0P A;  3BQK A;  4BA9 A;  2C5I T;  4HE8 A;  3HKE E;  5HXC A;  1HG2 A;  3FB2 A;  2D5U A;  3ETU A;  4DVD A;  4CZZ B;  5JQG E;  4PAG A;  2B1E A;  4PJJ A;  4ASK A;  2MTQ A;  4UF0 A;  3C50 A;  4AQF C;  4HFV A;  4PJN A;  1H7C A;  5FNV E;  4YJ2 E;  4N78 D;  4PFO A;  4JEU B;  5DAB A;  4X20 E;  5DQV A;  1HF8 A;  1VOM A;  3K8P C;  3C4Z A;  3RYF E;  1ZV4 X;  4HKA A;  3GN5 A;  3HL6 A;  2DLR A;  3ZLI A;  3N9P A;  5FY0 A;  3PU8 A;  5J2U E;  2EHO B;  1IAP A;  2VKJ A;  4KBM B;  2LOS A;  5LGU B;  4ZI2 D;  2KWI B;  4IST A;  1UCU A;  3AA7 B;  1G8X A;  1WYB A;  4AKL A;  4AKI A;  1T98 A;  3ONX A;  2HPJ A;  4BAY B;  2XHE B;  4WBO A;  4M1P A;  2VAS A;  3N9N A;  3R84 B;  5LNK A;  5L3C B;  4H9Q C;  3LBX A;  3C51 A;  3ZYK A;  3IBP A;  3SS1 A;  4KMC A;  3AA6 B;  5FY7 A;  3MA9 A;  5L3G B;  4PK6 A;  3FBL A;  4EZ4 A;  1ZKE A;  1D0Z A;  3P8C D;  3CWZ B;  2KXP B;  3JC6 C;  2PG8 A;  1B7T A;  2P9B A;  1VRB A;  2JMK A;  2V7L A;  3IHR A;  5LBQ B;  5J1G A;  3RC3 A;  2ACX A;  4ZI3 D;  5ADX L;  2A2F X;  4XAX B;  4KUM B;  5FXW A;  3ZN1 B;  4AKR B;  5JDG A;  2YEV C;  4OHF A;  2N9D A;  2CA5 A;  3HR0 A;  2CMR A;  4O8S A;  1UX5 A;  2C5J A;  4I4T E;  2DHR A;  3ZYM A;  5JDL A;  2C0S A;  1HFA A;  4JEH B;  4DBR A;  5LBM A;  5M4Y A;  2XAH B;  2JPF A;  5JDN A;  2J1D G;  1BR1 A;  2CCQ A;  3FBZ A;  4IE7 A;  3HI2 A;  2YU1 A;  2E9X C;  2RP4 A;  2D2S A;  3I9W A;  1Y64 B;  3IEE A;  3CPZ A;  4L0R A;  5LXT E;  3QK6 A;  2A3D A;  2H7V C;  3Q5W A;  4BJN A;  4WBN E;  1D0Y A;  3K3Q C;  3LK2 B;  3PUR A;  1IJ6 A;  2X9W A;  2XAJ B;  3E22 E;  5IYZ E;  4UIG A;  4QWN B;  4O2B E;  4UEL A;  3ZCI A;  2KIN B;  2UXX B;  2WMO A;  2X66 A;  3O9X A;  5EK4 A;  2Q9Q C;  2V7M A;  3L3P A;  3IF8 B;  1MMG A;  3OYZ A;  4H9R C;  2X67 A;  4EZH A;  4WW0 A;  3HKC E;  4QX8 B;  4MLK A;  3AA1 B;  4AI6 A;  1YW0 A;  4P09 A;  1V9D A;  3LG7 A;  4ZHQ E;  3DTO A;  4V1A v;  3WAJ A;  1U4Q A;  4PFP A;  4TX5 A;  3CKD A;  4PK4 A;  1MNE A;  3PUG A;  2K24 A;  4MAL A;  3H37 A;  5HWY A;  4EIW A;  4OYK A;  1E1H B;  3F57 A;  5LA6 E;  4UV9 B;  2V7J A;  2UXN B;  2V7K A;  4UXN B;  5FXX A;  3CX6 B;  3KDS E;  2W0G A;  1MMD A;  4KP3 C;  5FXV A;  5H6R B;  4IGU A;  4UEM A;  5JRC A;  3ZMU B;  5C8Y E;  5L2L A;  4G2A A;  3H3A A;  3KVA A;  4H9P C;  3WAK A;  4E7S A;  3AVS A;  5H6Q B;  3OKQ A;  5L3F B;  3PTR B;  2Y48 B;  3R6N A;  5LHI B;  5L3D B;  1HTJ F;  2Q9Q B;  1WR6 A;  4U74 A;  2WAU A;  3LFM A;  3RKO A;  1LRZ A;  4TUY E;  2A72 A;  3ANW B;  3KBT A;  5LJM A;  3BQI A;  3HA4 A;  3VU7 H;  2H3R A;  2VB6 A;  3LJC A;  2N1G A;  3CX8 B;  4O4L E;  2BZB A;  4C90 A;  3J7Y q;  2XAQ B;  1YD8 G;  2E9X A;  3GWH A;  2LM9 A;  4I50 E;  5JR9 C;  5LP6 E;  1BR2 A;  3A5X A;  3SOL A;  2CLY C;  5BMV E;  4ZI7 E;  1MIV A;  3I1A A;  5L3B B;  4PNI A;  2X51 A;  2MYS A;  2NP9 A;  1WLX A;  2IAK A;  2NTX A;  3D0T A;  1MND A;  4MFR A;  4DND A;  3RC8 A;  1HCI A;  3NBX X;  4TV9 E;  3ZC0 A;  3C4W A;  3RYI E;  5LGT B;  3EVY A;  5ETW A;  2V7I A;  3Q2M A;  2W62 A;  4C91 A;  2IC6 A;  1SHZ C;  3W15 B;  3MK7 C;  4BJM A;  2QGS A;  4OK0 A;  3ZJ1 A;  2JRK A;  1SA0 E;  3N9O A;  4P0A A;  2WWU A;  3E08 A;  4ISS A;  2I59 A;  5L3E B;  2LT3 A;  2CWY A;  2D0T A;  2EHO A;  4IHJ E;  4A56 A;  2VWA A;  1QSD A;  2XQY A;  2PBI A;  2CM0 A;  5EK2 A;  4CI1 B;  2C5K T;  5HAX A;  2NW8 A;  3EDU A;  4P0B A;  4OFZ A;  3KV4 A;  4IE6 A;  1NWM X;  4EYU A;  5JR9 B;  3MZK B;  1BR4 A;  2RA1 A;  3KFW X;  3ZEF B;  3O4X E;  3UUN A;  3KVB A;  2CLY B;  2XAG B;  1S35 A;  3CML A;  4HGA A;  4QXC B;  3Q5X A;  3MXZ A;  2E9X D;  4I43 B;  2LSG A;  2W63 A;  2H7O A;  4FJO A;  2BDE A;  4O4J E;  3P7I A;  3VKG A;  1KNZ A;  3U78 A;  3AB3 B;  4AQF A;  5FMN A;  4EAH A;  2BVM A;  4TN7 B;  3KV9 A;  3O1H A;  4PJL A;  4AKH A;  1FMW A;  5LHH B;  3UFE A;  2Q9Q D;  1FEW A;  1D1B A;  2G0U A;  2NWB A;  4GOU A;  4O4H E;  5E0O A;  3CQC B;  4ZI3 C;  2IW5 B;  1ZHC A;  2HH7 A;  5HXH A;  2V1D B;  3PU3 A;  2LSJ A;  2CE7 A;  2LHN A;  4H9N C;  4X1Y E;  3DP7 A;  3M65 A;  1FMV A;  1NAF A;  4O2A E;  1LKX A;  2CWO A;  3WI3 A;  5FY1 A;  2Y6X A;  5FYM A;  1EZ3 A;  4ZS2 A;  4K0U A;  4CI2 B;  4EYY R;  4QHO A;  5JDM A;  1U5P A;  2EHO D;  2L9Q A;  3KBU A;  5JDQ A;  2YIN A;  3TKL B;  5J2T E;  4H63 H;  2BVL A;  2LE8 A;  3T8O A;  3VKH A;  1MMN A;  2X9H A;  4X1I E;  1G73 A;  1UX4 A;  4IE0 A;  5JDH A;  3RRC A;  4PK5 A;  2IC9 A;  1D1A A;  2CEA A;  1HX8 A;  4YFS A;  3N2O A;  2D0U A;  2KT9 A;  3HKB E;  5IHY A;  1ZEE A;  1OXZ A;  2ZM8 A;  3C98 B;  4OYJ A;  5HXE A;  3ESL A;  4CXW A;  1HG5 A;  3V5U A;  1D1C A;  2VL8 A;  2OA5 A;  3KIN B;  4PJM A;  3SRZ A;  3F2E A;  3NRX A;  3O1J A;  3CQG B;  2WMN A;  2K9A A;  3PUS A;  4B6X A;  5LGN B;  4H9O C;  4CI3 B;  5FP3 A;  2WSS V;  5JRE A;  3GA8 A;  4U72 A;  4GIW A;  3C4X A;  3NZP A;  5JVD E;  4UF0 B;  3UTK A;  3RRW A;  2ODV A;  3I0Q A;  4ANJ A;  5LJN A;  2K5B B;  4NUV A;  3PE0 A;  4GK0 E;  3NRY A;  3AAA B;  4AQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...