4H9NC

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9nC00
4H9RC 4H9QC 4H9NC 4H9PC 4H9OC 4HGAA 5KDMC 4H9SE
chains in the Genus database with same CATH superfamily
5JDGA 2E8IA 4UVAB 3B57A 2KLQA 3I9YA 3N9OA 2JIWA 3AA1B 2V6YA 2BS3A 2XAJB 2Q9QD 1HFAA 5FXWA 5F5WA 5A1LA 5HXCA 2HN1A 4DBRA 3NRXA 3J9X1 2IUBA 5LHGB 2JQKA 3KVAA 5C2TA 1XDOA 4PJMA 4IDOA 4EXTA 2PG8A 4LMLA 2JJ9A 4WW0A 3JCFA 2XTLA 5JR9A 3JC6D 2V1DB 3CWZB 2WY2A 2IMLA 1L0VA 3ZSTA 4EEDA 5AQVB 4XBFB 2ODVA 4X65T 3PJAA 3KV9A 2WSSV 4ZOLE 4KMCA 4LFBT 2LOSA 1EZ3A 4DVDA 3OJAA 4YFSA 2ZM0A 5AQQB 1IZNB 1IBKT 4ZI2C 3AE3A 4NPPA 2A2FX 2KMFA 4CI3B 5L3GB 4YHJA 3W15B 2KT9A 3IF8B 3AA6B 4GK0E 4Z8XA 2V7MA 4ZEYA 5M4YA 4QKNA 3QOFA 5HEHA 2RA1A 3GN5A 4GYRA 5L4HA 1WR0A 4L9IA 2VKDA 5LA6E 4O2BE 5JDLA 3O4XE 4NUVA 2I0MA 3NWIA 1WYCA 5DQWA 3RIUA 2LRKA 3L39A 5CGMA 2DLRA 3PU3A 3AECA 3ETUA 3RYFE 4BAYB 2PBIA 4E7ZA 4AKHA 4JI5T 5HWYA 3BQLA 2QYWA 2VASA 5HEJA 5AFUL 3MA9A 3JC6C 3TKLB 3KBUA 3MZKB 1E1HB 2WDQA 1LKXA 1XZYA 4L0RA 2D0UA 3DP7A 2XQ9A 4HFEA 3AE5A 3OTOT 4P0AA 2BG9A 4KHPT 2CRBA 5JR9C 1YQ3A 1W0BA 3ZCIA 4IE5A 2H89A 2LSJA 3RIAA 4CQIA 2BKPA 2XSAA 2WM9A 5KMGP 1WRDA 3ZN1B 1R8IA 3BQIA 3JAFA 4LFAT 1HTJF 5E0OA 3A5XA 2VKOA 2CCQA 3PU8A 2CE7A 5BR8T 4KHZF 2XPKA 3Q5XA 3MKDA 3WI3A 4DR4T 3AVSA 3RGLA 3HKBE 1YKHB 2W00A 4IREA 4B3TT 1MIYA 4PK5A 2K24A 3LJCA 2V7KA 2V6XA 1XMOT 3ESLA 3FXDB 4ILBA 2IW5B 1CHUA 5EK2A 3ZT7A 4DV7T 4QH1A 3O1IA 3PUXF 4KBMB 2ACXA 1IAPA 5HWXA 2LRLA 3MK7C 4DMWA 4UXNB 2UXBT 5AQNB 2W4XA 2CLYB 1VOMA 4HWIB 3UUNA 4H9QC 5AQUB 4JBWF 2W0GA 5HAXA 1HX8A 4WBOA 3T8OA 2YK0A 2BBJA 4O4JE 3ZYMA 1MNEA 3PURA 2K48A 3OYXA 4U72A 5JQGE 2OLTA 2VVNA 1OEDB 3E08A 2L3LA 5HEGA 2XQ6A 1UX5A 5FY1A 3CKDA 2LT3A 2WZIA 4CN4A 4DIDB 5AQTB 3N9MA 4YHHT 4AXPA 2V8SV 5AQFB 4FI5A 3ZYKA 2JQHA 2XHEB 1DU2A 4A97A 5LBMA 4ILCA 2J4GA 4AQFA 2NR4A 4U3CA 4TWFA 5BMVE 1KF6A 2VURA 4HFDA 1VCTA 2RPAA 2X9WA 2UXNB 4F6RC 2E9XB 4YJ2E 5J1GA 3Q5DA 2LEHA 2LLYA 3PJAJ 3KDSE 4B3RT 5LNKA 3RRWA 2VL8A 2A9UA 5CJ5A 2BS2A 4EGWA 4K0KT 2VL0A 4TV8E 1BR2A 3EI0A 3NZQA 3EDUA 3ZYLA 1UUSA 1D1BA 2LSIA 3GWHA 1IJ6A 1MNDA 3CX7B 4X5TA 2CLYC 5HXEA 1VRBA 5GONE 4JI6T 4IL4A 2CXFA 3RLFF 3O1JA 3VRAA 3C4XA 4DUYT 5J0ZA 3MJXA 3ONXA 4H9RC 4KX6A 3B13A 4ZZBA 3ZJ1A 5AQMB 3K3NA 3UULA 4EB6E 2NW7A 2WU5A 4X20E 2WZHA 2BKOA 4AQFC 2IC6A 3SRZA 3PUGA 2K9AA 3A8YC 5ABEA 5LJMA 4EIWA 1ZEEA 2V7IA 2HHHT 1SHZC 1GQEA 2EHOB 4MHCA 4X64T 1HCIA 4M1PA 3QK6A 3EHZA 4HWHA 3OVUA 2YDQA 3RI5A 1FMWA 2ZMAA 4CXXA 1D1AA 4ZS2A 3ZMZB 2UUBT 4AQYT 5FL0A 4ISSA 2WU2A 3LDQB 3UFEA 4HFCA 2JQQA 3IEEA 5L2LA 3F2EA 4O4HE 4IDPA 3RYCE 3TLUA 4IDNA 4UF0A 2CWYA 3K3QC 3U78A 3F31A 2UXDT 3ZSSA 1HNZT 4OK0A 1D1CA 4A5XA 2QRXA 2X9YA 3AEGA 1HNWT 3QB5K 3TLWA 2CBIA 4UV8B 3RF1A 4ZI7E 5LCYA 4CXWA 4PJLA 2M6IA 3DTOA 3UUXB 1X79A 2JMHA 5FXXA 2MPKA 3Q5EA 4QH4A 4BJMA 3ZMVB 4GOUA 3SWHA 3VKGA 3FZHB 4HE8A 4YXDA 4C91A 2X0HA 3SFEA 5FY0A 5ADXL 2C5JA 4IE7A 2FJEA 3L3PA 4IDQA 4DMVA 1KEYA 2ES0A 4YTNA 5HXHA 4COFA 2X67A 4ZI2D 1KFYA 3AE4A 3C50A 4JUYA 2IIUA 2WAUA 5KX5E 4YLHA 4DR2T 3VKHA 1U4QA 3O1HA 4IHJE 3AXJB 1Y64B 2DL1A 2SPCA 5HEOA 4ZZCA 3FZMB 4QXCB 4UELA 2CMRA 3P4SA 3VHLA 2PTFA 1E7PA 5L47A 4LFCT 2HH7A 3PUQA 2H88A 3V5UA 4DR6T 3AE6A 4P09A 3E22E 3PDYA 3X1DA 5HXSA 2ZM8A 2VVSA 1KK7A 4A98A 3ONLC 3P4RA 5LB7B 2UU9T 3PUSA 4PAGA 2ZM2A 3ZC1A 2AE9A 2QGSA 3UU4A 4GYSA 3N2GE 4YSXA 2XQ7A 4JV5T 3TLVA 3AAAB 2V7JA 2X0YA 2Z6EA 4MBQA 3IHRA 4ZS3A 5JH7E 4OYJA 2CHOA 4ERRA 4HKAA 4TNVA 3AE1A 5LJNA 4JLEA 4AKLA 3AB3B 2D0TA 1G73A 2YN6A 5HXRA 3HI2A 2ODUA 2XM2A 3GN5B 2XQ4A 4V1Av 3OKQA 5TAOA 3UTKA 3RRCA 1ZP0A 1HG2A 2YINA 1M7KA 4F8HA 3LSVA 1V9DA 2VKHA 2Y6XA 1ZOYA 4DV1T 1MMDA 4TWHA 3FZLB 1QUUA 1U5PA 3QB5A 2X9HA 1M62A 4DV3T 1FJGT 5ABFB 2VB6A 3MXZA 2J47A 3KV5A 2H7VC 4YJ3E 2UUAT 3AAIA 4JI8T 2W62A 4LF4T 1I6ZA 4X1KE 4DUZT 3QUJA 3RX6A 5JDMA 3KFWX 4JYAT 4YT0A 2IC9A 2LJLA 2JPFA 1Z0PA 2WWVA 4JI1T 3ZKRA 5FY7A 4OX9T 2FBWA 2ACZA 4ZXLA 3ZMUB 2K5BB 5H6QB 3LBXB 5F8PA 3ZLIA 1WFDA 2MOZA 3I1AA 2KINB 2CXDA 3HR0A 4DR7T 2KWHA 2CHNA 3ZC0A 2GK9A 4AQGA 3S4UA 4CXYA 4QX7B 4MFRA 4PJNA 4EOZB 3UT5E 2K3WA 4WNKA 2N9DA 3KV6A 1OEDE 1Z8UA 2KSRA 4LF7T 3ZEFB 2D9DA 1X9BA 2H3RA 2DNXA 3WAJA 4PFOA 2L9QA 4LF5T 5AQPB 4DR5T 3PUWF 4JI4T 1WLXA 4TX5A 4PW8A 3VRBA 4YTPA 3KINB 3RC3A 3EVYA 3KV4A 4NXNT 5J2TE 3ANWA 2WBLA 1KNPA 1FEWA 1G8XA 2DCFA 3PUYF 4X1YE 5EZYE 5LG4A 5JDQA 2WCAA 2NW9A 5L3BB 2FJDA 4I0UA 5AQHB 3L8RA 3RHWA 5LHIB 3T1YT 4Q25A 2XQ5A 5JRCB 2D5UA 2IHR1 5HCMA 3ZCJA 4EZ4A 3SFDA 2XASB 4OFZA 1N32T 1XDPA 2CA5A 1W0AA 3ZN0B 3UQ7A 3AAEB 1KNRA 4TWDA 4JI7T 5JREA 4O8SA 4G63A 4AIUA 4IGUA 3RYHE 4CI1B 4G2AA 2XUEA 2DWGA 4Z91A 2KNDA 5LYJE 1AJ3A 2P9BA 4U2YA 1LVKA 4UV9B 3AE9A 5LXTE 1JNZA 3RYIE 2E9XA 2DWKA 1YXRA 4YSYA 2W67A 5LGTB 2C5IT 3AEAA 1B7TA 5AQOB 5LBQB 2PFVA 3MACA 3R6NA 2XQ3A 5KXJA 2C0SA 2E9XD 5LMUT 3CQXC 4QXHB 2XSBA 3C51A 1NEKA 1YW0A 4CN6A 2FUPA 4H9SE 5L3FB 2V5DA 2Y48B 4DNDA 1LRZA 3N9NA 5AQGB 1XWMA 3H3AA 1OEDC 4IE4A 1T8BA 4NUUA 3UU8A 1HS7A 1QLBA 4HFBA 5HYAA 4CN1A 2BVMA 3LK3B 4LMJA 2WMNA 4H9OC 2XQ8A 2WP9A 3VR9A 4I4TE 3C64A 4O4LE 1T72A 2CPTA 2Y8DA 3G06A 3P4WA 4IE6A 2I6HA 2MAWA 1D0XA 4DR1T 1NENA 3IBPA 2FJAA 2YDRA 4KP3C 2ZM6T 3ETVA 4LF6T 3BK9A 4DR3T 4AKRB 4GK5E 4LF9T 4LMKA 4GIWA 2E9XC 4TV9E 3RQUA 3P7IA 3OBVE 4IDZA 4ZHQE 5L4EA 3H37A 2YKSA 5FXVA 1WCRA 4HTEA 5IYZE 2JRKA 2NW8A 1S94A 2M6BA 4FJOA 4HWDA 3N2OA 4O4IE 1IBMT 5IUXA 3EUHA 1MMNA 2I59A 1XMQT 3PE0A 4IL9A 3VR8A 5FVLA 3Q9DA 4B3MT 5L3CB 2YDSA 4U7IA 2OV9A 3AE2A 4DV4T 3SS1A 1MMGA 2KWIB 3AVRA 4MLKA 2BS4A 5FP3A 3A7MA 1OWAA 4H9NC 2W2UA 5KDMC 1D0ZA 5FKYA 3C4ZA 3N9QA 4C90A 2PJQA 2MYSA 3J7Yq 5HEUA 4N78D 1D0YA 2A3DA 2N2NA 4YY3T 3JADA 3CQGB 3HKDE 3H3MA 2Q9QB 1O3XA 1I94T 2XAHB 4I50E 1NAFA 3AEDA 5AQSB 1SE7A 2X68A 4EYUA 4X62T 2V6YB 2EHOC 2WDRA 2A72A 3RH3A 3AXJA 4HEAA 2CXLA 1HG5A 2QVAA 2E5LT 4CI2B 3KVBA 5L3DB 5EK4A 4PFPA 5C8YE 2LHRA 1MMAA 3I9WA 1VCSA 4PK4A 4EZHA 2M67A 3BQKA 4DBQA 2AXDS 2KXPB 5JVDE 3M65A 4OHFA 2HN2A 2F4VT 1WYBA 5LHHB 3EAMA 5FNVE 3UU3A 1KNZA 2X9XA 3GMIA 2YEVC 5JR9B 1MIVA 3ZPOA 3CPZA 4IE0A 1HR0T 3LG7A 3R84B 3V5SA 5JDNA 2WQYA 2X0LB 4GKJT 2DI4A 3AEBA 2CBJA 3AEFA 5C3JA 2LM9A 2V7LA 4P0BA 3QC9A 4QX8B 3O9XA 2DHRA 2YU2A 5DQVA 2R6GF 4NIQA 3AA0B 5F3JA 2NOXA 2CEAA 4B3ST 2BG9E 4YSZA 1IJ5A 4EAHA 1YKEB 3PUVF 3NZPA 2HPLA 4I43B 2OA5A 4CZZB 3HL6A 3AA7B 3P4QA 2H7OA 2Q9QC 4H63V 2LKGA 5JTGA 1BR4A 2KZ7B 4UR9A 2VKJA 2X66A 3NVOA 2WMOA 4Z90A 3WAKA 5J2UE 1FMVA 3RQWA 1J5ET 4ASKA 1J1JA 4A56A 2V26A 1T98A 2NTXA 2C5KT 3FB2A 2BG9B 1BR1A 5ABFA 3AE8A 3EABA 3ABVA 3CK6A 1UX4A 2VQET 2WS3A 3CQCB 2BKNA 4KUMB 5AQLB 1ZV4X 2N1GA 4YTMA 3PUZF 3I0OA 1YQ4A 4X1IE 1US7B 4ADZA 4DO0A 2JQ9A 2JMKA 4L5GA 4O2AE 1W9RA 4AISA 2BBHA 4DV5T 4HWCA 3LBXA 4QHOA 1IBLT 5CA1E 3Q2MA 5DABA 1E2AA 2J62A 3JAEA 1ZKEA 3P50A 4J2CA 3D0TA 3IA3A 2FJBA 2BVLA 4TUYE 3FXEB 5FVKA 1FIOA 4EYYR 3PTRB 2RP4A 4EV6A 3FZKB 2CWOA 3FHNA 3K3OA 3P4PA 3RIUC 1HNXT 2YOEA 4HWFA 2LSYA 2BZBA 3SOLA 1W09A 2D2SA 4HGAA 4ISTA 2XJ7A 2UXCT 2YU1A 4U33A 3LK2B 4ZI3D 5HCJA 3CX6B 5L3EB 1SUMB 4AI6A 3ANWB 4LF8T 2E2AA 4ILAA 4MALA 5AQJB 1OXZA 2X51A 5CA0E 1BR0A 2BG9C 5FXZA 2VK9A 3RKGA 2XY8B 4XAXB 4XZCA 2UUCT 4IIJE 5AQKB 4I55E 3ZT5A 2QA7A 5LP6E 4HFHA 3K1SA 1JNRA 2IAKA 2L8KA 3CX8B 1OEDA 1HX1B 1UCUA 2LKHA 5DJQC 4NXMT 5JRCA 2W61A 2XQAA 3VU7H 3AEEA 3ZJ2A 3HA4A 3CIRA 2LHNA 4DV2T 1YD8G 3UQ4A 1Y01A 3ONJA 3N9PA 3DJBA 2NTYA 4AKIA 3F57A 3Q5WA 5ABHA 1QSDA 4U74A 2HPJA 2WB5A 5IWAT 5LGNB 5FMNA 2CM0A 4H9PC 2W63A 4ZI3C 5LGUB 3ZMSB 3T1HT 3N2KE 3P8CD 4U2ZA 5EK3A 1XNQT 1WR6A 3B5MA 2XM1A 2XAGB 4UVCB 2BDEA 1N36T 3E0ZA 4QXBB 4JI3T 2LOPA 2IDOB 3TLTA 1N34T 2MBGA 4DV6T 4B6XA 4KI0F 3UU6A 2XAQB 3UUMA 3C4WA 4PNIA 3CMLA 2G0UA 4JEHB 2E5VA 3KBTA 2J1DG 5CB4E 3EDVA 5IHYA 1LVFA 3PV0F 2XZEA 1CUNA 3PUAA 1J5WA 3LK42 5AQIB 3QNUA 3NBXX 4BA9A 4H63H 2LSGA 4HFVA 1H7CA 2W66A 4TN7B 1NWMX 4WZXA 3AE7A 5JDFA 3OPCA 5FYMA 4EEBA 2VQFT 4OYKA 4GKKT 3U3IA 3N9LA 5FL1A 4K0UA 1UGOA 3FBLA 5LOVE 2NWBA 4PK6A 1UURA 5ABGA 3RKOA 5CFBA 4ILUA 5JDHA 4WBNE 2EHOA 2UXXB 4DV0T 3L09A 3TLSA 2LE8A 3NRYA 1S35A 3RIFA 4WYVA 5ETWA 3CVRA 2EHOD 1ZHCA 2ZLYA 4UF0B 3FBZA 3UUBA 1N33T 3UFGA 5AQRB 1SA0E 3FZFB 4QH5A 2V5CA 4JI0T 2NP9A 3OYZA 2B1EA 4ANJA 4P1NA 4UEMA 4PJJA 3RC8A 2B76A 4TZ4C 3K8PC 2MTQA 4UVBB 2LM2A 3RPUA 2XQYA 2XAFB 3GA8A 4U7YA 4E7SA 4HFIA 3M3ZB 4JEUB 3ZT6A 4JI2T 4AKGA 4U31A 1XNRT 4BJNA 3UU5A 2LSKA 4HN9A 3I0QA 4QWNB 3ZMTB 3LFMA 3HKEE 5LMNT 3C98B 2WDVA 5LG3A 4X66T 4IT4A 1UK5A 4TNWA 4UIGA 1MIWA 1HF8A 2WWUA 1T7SA 3N5LA 5H6RB 2VWAA 2Q9QA 3NKZA 3HKCE
chains in the Genus database with same CATH topology
5JDGA 2E8IA 4UVAB 1T98A 2NTXA 2C5KT 3B57A 3FB2A 2KLQA 1BR1A 3I9YA 3N9OA 4X20E 5LHIB 3AA1B 5JRCB 4AQFC 2IC6A 3SRZA 2D5UA 3PUGA 2K9AA 3ZCJA 1UX4A 5LJMA 2XAJB 4EIWA 4EZ4A 1ZEEA 2XASB 3CQCB 2Q9QD 1HFAA 2V7IA 4OFZA 4KUMB 2CA5A 1SHZC 3ZN0B 5FXWA 1ZV4X 2N1GA 2EHOB 5A1LA 5HXCA 3AAEB 3I0OA 4MHCA 1HCIA 4DBRA 4M1PA 4X1IE 3QK6A 5JREA 3NRXA 3J9X1 4O8SA 1US7B 4ADZA 4DO0A 5LHGB 3KVAA 1FMWA 2JMKA 2ZMAA 4G63A 4L5GA 4CXXA 1D1AA 4IGUA 4PJMA 4ZS2A 4EXTA 2PG8A 3RYHE 4O2AE 3ZMZB 4CI1B 2JJ9A 4G2AA 4WW0A 2XTLA 4ISSA 2XUEA 3UFEA 5JR9A 3JC6D 3LBXA 4QHOA 2V1DB 3CWZB 2DWGA 2JQQA 3IEEA 5L2LA 3F2EA 4O4HE 5CA1E 4XBFB 2ODVA 2KNDA 3Q2MA 3KV9A 3RYCE 2WSSV 5LYJE 5DABA 1AJ3A 2P9BA 1LVKA 4ZOLE 4UV9B 4KMCA 4UF0A 1ZKEA 2LOSA 1EZ3A 2CWYA 3K3QC 3U78A 5LXTE 3F31A 4J2CA 4DVDA 3OJAA 3D0TA 4YFSA 2ZM0A 1IZNB 3RYIE 2BVLA 2E9XA 4OK0A 4TUYE 3FXEB 2DWKA 1D1CA 4ZI2C 1FIOA 4EYYR 3PTRB 2RP4A 2A2FX 2X9YA 5LGTB 2KMFA 4CI3B 2C5IT 5L3GB 4YHJA 3W15B 2KT9A 2CWOA 3IF8B 3FHNA 3K3OA 4UV8B 1B7TA 3AA6B 5LBQB 4GK0E 4Z8XA 2PFVA 2V7MA 3MACA 5LCYA 3R6NA 4ZI7E 2C0SA 4CXWA 4PJLA 5M4YA 3UUXB 3DTOA 4QKNA 1X79A 2LSYA 2BZBA 2JMHA 2E9XD 2RA1A 3CQXC 5FXXA 3SOLA 4QXHB 3GN5A 2D2SA 3C51A 4HGAA 4GYRA 4BJMA 3ZMVB 4GOUA 3SWHA 3VKGA 1YW0A 4HE8A 4ISTA 4L9IA 4C91A 2VKDA 5LA6E 2YU1A 4O2BE 5FY0A 5JDLA 3O4XE 4H9SE 3LK2B 4ZI3D 5ADXL 5L3FB 2C5JA 4NUVA 2Y48B 1WYCA 5DQWA 4IE7A 3L3PA 3CX6B 5L3EB 4DMVA 2ES0A 4DNDA 5HXHA 4AI6A 3ANWB 1LRZA 2DLRA 3PU3A 3N9NA 3ETUA 2X67A 3H3AA 2PBIA 3RYFE 4BAYB 4E7ZA 3C50A 4ZI2D 4AKHA 4MALA 4JUYA 1OXZA 2X51A 5CA0E 1BR0A 2WAUA 5KX5E 4YLHA 4IE4A 2VK9A 5FXZA 1U4QA 3O1HA 3VKHA 5HWYA 4XAXB 4XZCA 3BQLA 4IHJE 4NUUA 2VASA 4IIJE 5AFUL 3MA9A 4I55E 3JC6C 1HS7A 4ASKA 2QA7A 3TKLB 1Y64B 3KBUA 5HYAA 5LP6E 3MZKB 1E1HB 2BVMA 2SPCA 3LK3B 4QXCB 4UELA 2IAKA 2CMRA 1LKXA 2WMNA 2L8KA 4H9OC 3VHLA 4L0RA 2D0UA 3DP7A 3CX8B 4I4TE 3C64A 1UCUA 4O4LE 4P0AA 2HH7A 5DJQC 5JRCA 2W61A 3PUQA 2Y8DA 5JR9C 3V5UA 4IE6A 3VU7H 3ZJ2A 4P09A 3E22E 3HA4A 3PDYA 1D0XA 3ZCIA 2LHNA 3IBPA 5HXSA 4IE5A 4KP3C 3ETVA 1YD8G 2ZM8A 2LSJA 3N9PA 3DJBA 1KK7A 3BK9A 4CQIA 2NTYA 4AKIA 3F57A 3Q5WA 4AKRB 1QSDA 2WM9A 4GK5E 4U74A 2HPJA 5KMGP 4GIWA 2E9XC 5LGNB 1WRDA 4TV9E 3ZN1B 3BQIA 3P7IA 3OBVE 4IDZA 5FMNA 2CM0A 4ZHQE 3PUSA 4H9PC 2W63A 4PAGA 4ZI3C 1HTJF 2ZM2A 5LGUB 3H37A 3ZC1A 5E0OA 3ZMSB 5FXVA 2QGSA 3N2KE 4HTEA 5IYZE 2JRKA 3P8CD 5EK3A 3A5XA 4GYSA 2VKOA 2CCQA 3PU8A 2CE7A 1WR6A 3N2GE 2NW8A 1S94A 2XAGB 4UVCB 4FJOA 3Q5XA 2BDEA 3MKDA 3WI3A 3AVSA 3N2OA 3E0ZA 4O4IE 4QXBB 2LOPA 3AAAB 3HKBE 2V7JA 2Z6EA 1YKHB 3EUHA 2W00A 1MMNA 2I59A 4MBQA 3PE0A 2MBGA 3IHRA 4ZS3A 4B6XA 4OYJA 5JH7E 3Q9DA 1MIYA 2XAQB 4ERRA 4HKAA 3UUMA 3C4WA 4PK5A 4PNIA 3CMLA 5L3CB 5LJNA 2G0UA 4JLEA 2K24A 4AKLA 3AB3B 2D0TA 4JEHB 1G73A 3LJCA 2V7KA 5HXRA 3HI2A 3KBTA 3SS1A 1MMGA 3ESLA 2ODUA 2J1DG 3FXDB 2KWIB 3AVRA 3GN5B 5CB4E 4V1Av 3OKQA 5TAOA 4MLKA 3UTKA 3EDVA 3RRCA 2IW5B 5IHYA 5EK2A 5FP3A 1HG2A 1OWAA 3O1IA 2YINA 4H9NC 5KDMC 1D0ZA 1LVFA 4KBMB 4A56A 2ACXA 3C4ZA 1V9DA 1CUNA 1IAPA 5HWXA 3N9QA 2PJQA 2MYSA 2VKHA 3MK7C 3PUAA 4UXNB 4C90A 4DMWA 2Y6XA 3J7Yq 4N78D 1MMDA 1D0YA 2CLYB 3LK42 1VOMA 2A3DA 2N2NA 3UUNA 4H9QC 2W0GA 3CQGB 3HKDE 2Q9QB 1O3XA 1QUUA 2XAHB 3NBXX 5HAXA 4BA9A 4I50E 1U5PA 1HX8A 1NAFA 4H63H 2LSGA 4WBOA 2X68A 4EYUA 4HFVA 2X9HA 3T8OA 1H7CA 2YK0A 4TN7B 1NWMX 4O4JE 3ZYMA 1MNEA 3PURA 5JDFA 2VB6A 2K48A 3MXZA 3OYXA 2EHOC 5FYMA 3KV5A 2H7VC 4YJ3E 2A72A 4U72A 4OYKA 5JQGE 3RH3A 3AAIA 3U3IA 4HEAA 3N9LA 2CXLA 2W62A 3E08A 4K0UA 3FBLA 1HG5A 2L3LA 4X1KE 5LOVE 3QUJA 3RX6A 4CI2B 1UX5A 5FY1A 3CKDA 3KVBA 5L3DB 5EK4A 4PFPA 2NWBA 5C8YE 2LHRA 1MMAA 2LT3A 3KFWX 4PK6A 5JDMA 3I9WA 4PK4A 4EZHA 3RKOA 2M67A 2IC9A 3N9MA 2LJLA 4ILUA 2JPFA 4AXPA 5JDHA 3BQKA 4WBNE 1Z0PA 4DBQA 2EHOA 4FI5A 2KXPB 3ZYKA 5JVDE 3M65A 4OHFA 2XHEB 2UXXB 5FY7A 3L09A 1WYBA 2LE8A 3NRYA 5LHHB 5FNVE 1KNZA 2X9XA 1S35A 5LBMA 3GMIA 3ZMUB 2YEVC 2K5BB 5H6QB 5JR9B 3LBXB 5F8PA 3ZLIA 1MIVA 2MOZA 3I1AA 3CPZA 4IE0A 3ZPOA 5ETWA 4AQFA 2KINB 2CXDA 3CVRA 3LG7A 3R84B 2EHOD 1ZHCA 3V5SA 2ZLYA 5JDNA 3HR0A 4UF0B 5BMVE 2X0LB 2X9WA 3FBZA 2DI4A 2KWHA 2UXNB 2LM9A 1SA0E 2V7LA 4F6RC 4P0BA 2E9XB 3ZC0A 2GK9A 4AQGA 4YJ2E 3QC9A 5J1GA 2LEHA 2NP9A 4QX8B 3O9XA 2DHRA 2YU2A 3OYZA 2B1EA 3S4UA 5DQVA 4ANJA 4CXYA 3KDSE 4QX7B 4MFRA 4PJNA 5LNKA 3RRWA 2VL8A 4EOZB 3AA0B 5F3JA 3UT5E 4UEMA 4WNKA 2N9DA 2NOXA 3KV6A 4PJJA 2CEAA 3RC8A 4TV8E 1IJ5A 4EAHA 1BR2A 4TZ4C 1YKEB 3K8PC 3NZPA 3NZQA 2MTQA 3EDUA 4UVBB 3ZYLA 2HPLA 4I43B 3RPUA 2XQYA 3ZEFB 2OA5A 1D1BA 4CZZB 2LSIA 3GWHA 1IJ6A 1MNDA 2XAFB 3GA8A 3CX7B 4E7SA 2H3RA 2DNXA 3WAJA 4JEUB 2CLYC 5HXEA 4PFOA 2L9QA 4AKGA 3HL6A 3AA7B 1VRBA 5GONE 4BJNA 2H7OA 2LSKA 2CXFA 4HN9A 2Q9QC 4H63V 1BR4A 5L3BB 3I0QA 2KZ7B 4QWNB 3ZMTB 1WLXA 3LFMA 4TX5A 4PW8A 3HKEE 2VKJA 2X66A 3O1JA 3C98B 3C4XA 3KINB 3RC3A 3EVYA 3KV4A 2WMOA 5J2TE 3MJXA 3ANWA 3ONXA 4H9RC 2WBLA 4UIGA 1MIWA 1FEWA 3B13A 3ZJ1A 3WAKA 1G8XA 5J2UE 1HF8A 3K3NA 1FMVA 2WWUA 2DCFA 3N5LA 3UULA 5H6RB 4EB6E 2VWAA 4X1YE 2NW7A 2Q9QA 5EZYE 5LG4A 5JDQA 2NW9A 3HKCE 2V26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R C;  4H9Q C;  4H9N C;  4H9P C;  4H9O C;  4HGA A;  5KDM C;  4H9S E; 
#chains in the Genus database with same CATH topology
 5JDG A;  2E8I A;  4UVA B;  3B57 A;  2KLQ A;  3I9Y A;  3N9O A;  2JIW A;  3AA1 B;  2V6Y A;  2BS3 A;  2XAJ B;  2Q9Q D;  1HFA A;  5FXW A;  5F5W A;  5A1L A;  5HXC A;  2HN1 A;  4DBR A;  3NRX A;  3J9X 1;  2IUB A;  5LHG B;  2JQK A;  3KVA A;  5C2T A;  1XDO A;  4PJM A;  4IDO A;  4EXT A;  2PG8 A;  4LML A;  2JJ9 A;  4WW0 A;  3JCF A;  2XTL A;  5JR9 A;  3JC6 D;  2V1D B;  3CWZ B;  2WY2 A;  2IML A;  1L0V A;  3ZST A;  4EED A;  5AQV B;  4XBF B;  2ODV A;  4X65 T;  3PJA A;  3KV9 A;  2WSS V;  4ZOL E;  4KMC A;  4LFB T;  2LOS A;  1EZ3 A;  4DVD A;  3OJA A;  4YFS A;  2ZM0 A;  5AQQ B;  1IZN B;  1IBK T;  4ZI2 C;  3AE3 A;  4NPP A;  2A2F X;  2KMF A;  4CI3 B;  5L3G B;  4YHJ A;  3W15 B;  2KT9 A;  3IF8 B;  3AA6 B;  4GK0 E;  4Z8X A;  2V7M A;  4ZEY A;  5M4Y A;  4QKN A;  3QOF A;  5HEH A;  2RA1 A;  3GN5 A;  4GYR A;  5L4H A;  1WR0 A;  4L9I A;  2VKD A;  5LA6 E;  4O2B E;  5JDL A;  3O4X E;  4NUV A;  2I0M A;  3NWI A;  1WYC A;  5DQW A;  3RIU A;  2LRK A;  3L39 A;  5CGM A;  2DLR A;  3PU3 A;  3AEC A;  3ETU A;  3RYF E;  4BAY B;  2PBI A;  4E7Z A;  4AKH A;  4JI5 T;  5HWY A;  3BQL A;  2QYW A;  2VAS A;  5HEJ A;  5AFU L;  3MA9 A;  3JC6 C;  3TKL B;  3KBU A;  3MZK B;  1E1H B;  2WDQ A;  1LKX A;  1XZY A;  4L0R A;  2D0U A;  3DP7 A;  2XQ9 A;  4HFE A;  3AE5 A;  3OTO T;  4P0A A;  2BG9 A;  4KHP T;  2CRB A;  5JR9 C;  1YQ3 A;  1W0B A;  3ZCI A;  4IE5 A;  2H89 A;  2LSJ A;  3RIA A;  4CQI A;  2BKP A;  2XSA A;  2WM9 A;  5KMG P;  1WRD A;  3ZN1 B;  1R8I A;  3BQI A;  3JAF A;  4LFA T;  1HTJ F;  5E0O A;  3A5X A;  2VKO A;  2CCQ A;  3PU8 A;  2CE7 A;  5BR8 T;  4KHZ F;  2XPK A;  3Q5X A;  3MKD A;  3WI3 A;  4DR4 T;  3AVS A;  3RGL A;  3HKB E;  1YKH B;  2W00 A;  4IRE A;  4B3T T;  1MIY A;  4PK5 A;  2K24 A;  3LJC A;  2V7K A;  2V6X A;  1XMO T;  3ESL A;  3FXD B;  4ILB A;  2IW5 B;  1CHU A;  5EK2 A;  3ZT7 A;  4DV7 T;  4QH1 A;  3O1I A;  3PUX F;  4KBM B;  2ACX A;  1IAP A;  5HWX A;  2LRL A;  3MK7 C;  4DMW A;  4UXN B;  2UXB T;  5AQN B;  2W4X A;  2CLY B;  1VOM A;  4HWI B;  3UUN A;  4H9Q C;  5AQU B;  4JBW F;  2W0G A;  5HAX A;  1HX8 A;  4WBO A;  3T8O A;  2YK0 A;  2BBJ A;  4O4J E;  3ZYM A;  1MNE A;  3PUR A;  2K48 A;  3OYX A;  4U72 A;  5JQG E;  2OLT A;  2VVN A;  1OED B;  3E08 A;  2L3L A;  5HEG A;  2XQ6 A;  1UX5 A;  5FY1 A;  3CKD A;  2LT3 A;  2WZI A;  4CN4 A;  4DID B;  5AQT B;  3N9M A;  4YHH T;  4AXP A;  2V8S V;  5AQF B;  4FI5 A;  3ZYK A;  2JQH A;  2XHE B;  1DU2 A;  4A97 A;  5LBM A;  4ILC A;  2J4G A;  4AQF A;  2NR4 A;  4U3C A;  4TWF A;  5BMV E;  1KF6 A;  2VUR A;  4HFD A;  1VCT A;  2RPA A;  2X9W A;  2UXN B;  4F6R C;  2E9X B;  4YJ2 E;  5J1G A;  3Q5D A;  2LEH A;  2LLY A;  3PJA J;  3KDS E;  4B3R T;  5LNK A;  3RRW A;  2VL8 A;  2A9U A;  5CJ5 A;  2BS2 A;  4EGW A;  4K0K T;  2VL0 A;  4TV8 E;  1BR2 A;  3EI0 A;  3NZQ A;  3EDU A;  3ZYL A;  1UUS A;  1D1B A;  2LSI A;  3GWH A;  1IJ6 A;  1MND A;  3CX7 B;  4X5T A;  2CLY C;  5HXE A;  1VRB A;  5GON E;  4JI6 T;  4IL4 A;  2CXF A;  3RLF F;  3O1J A;  3VRA A;  3C4X A;  4DUY T;  5J0Z A;  3MJX A;  3ONX A;  4H9R C;  4KX6 A;  3B13 A;  4ZZB A;  3ZJ1 A;  5AQM B;  3K3N A;  3UUL A;  4EB6 E;  2NW7 A;  2WU5 A;  4X20 E;  2WZH A;  2BKO A;  4AQF C;  2IC6 A;  3SRZ A;  3PUG A;  2K9A A;  3A8Y C;  5ABE A;  5LJM A;  4EIW A;  1ZEE A;  2V7I A;  2HHH T;  1SHZ C;  1GQE A;  2EHO B;  4MHC A;  4X64 T;  1HCI A;  4M1P A;  3QK6 A;  3EHZ A;  4HWH A;  3OVU A;  2YDQ A;  3RI5 A;  1FMW A;  2ZMA A;  4CXX A;  1D1A A;  4ZS2 A;  3ZMZ B;  2UUB T;  4AQY T;  5FL0 A;  4ISS A;  2WU2 A;  3LDQ B;  3UFE A;  4HFC A;  2JQQ A;  3IEE A;  5L2L A;  3F2E A;  4O4H E;  4IDP A;  3RYC E;  3TLU A;  4IDN A;  4UF0 A;  2CWY A;  3K3Q C;  3U78 A;  3F31 A;  2UXD T;  3ZSS A;  1HNZ T;  4OK0 A;  1D1C A;  4A5X A;  2QRX A;  2X9Y A;  3AEG A;  1HNW T;  3QB5 K;  3TLW A;  2CBI A;  4UV8 B;  3RF1 A;  4ZI7 E;  5LCY A;  4CXW A;  4PJL A;  2M6I A;  3DTO A;  3UUX B;  1X79 A;  2JMH A;  5FXX A;  2MPK A;  3Q5E A;  4QH4 A;  4BJM A;  3ZMV B;  4GOU A;  3SWH A;  3VKG A;  3FZH B;  4HE8 A;  4YXD A;  4C91 A;  2X0H A;  3SFE A;  5FY0 A;  5ADX L;  2C5J A;  4IE7 A;  2FJE A;  3L3P A;  4IDQ A;  4DMV A;  1KEY A;  2ES0 A;  4YTN A;  5HXH A;  4COF A;  2X67 A;  4ZI2 D;  1KFY A;  3AE4 A;  3C50 A;  4JUY A;  2IIU A;  2WAU A;  5KX5 E;  4YLH A;  4DR2 T;  3VKH A;  1U4Q A;  3O1H A;  4IHJ E;  3AXJ B;  1Y64 B;  2DL1 A;  2SPC A;  5HEO A;  4ZZC A;  3FZM B;  4QXC B;  4UEL A;  2CMR A;  3P4S A;  3VHL A;  2PTF A;  1E7P A;  5L47 A;  4LFC T;  2HH7 A;  3PUQ A;  2H88 A;  3V5U A;  4DR6 T;  3AE6 A;  4P09 A;  3E22 E;  3PDY A;  3X1D A;  5HXS A;  2ZM8 A;  2VVS A;  1KK7 A;  4A98 A;  3ONL C;  3P4R A;  5LB7 B;  2UU9 T;  3PUS A;  4PAG A;  2ZM2 A;  3ZC1 A;  2AE9 A;  2QGS A;  3UU4 A;  4GYS A;  3N2G E;  4YSX A;  2XQ7 A;  4JV5 T;  3TLV A;  3AAA B;  2V7J A;  2X0Y A;  2Z6E A;  4MBQ A;  3IHR A;  4ZS3 A;  5JH7 E;  4OYJ A;  2CHO A;  4ERR A;  4HKA A;  4TNV A;  3AE1 A;  5LJN A;  4JLE A;  4AKL A;  3AB3 B;  2D0T A;  1G73 A;  2YN6 A;  5HXR A;  3HI2 A;  2ODU A;  2XM2 A;  3GN5 B;  2XQ4 A;  4V1A v;  3OKQ A;  5TAO A;  3UTK A;  3RRC A;  1ZP0 A;  1HG2 A;  2YIN A;  1M7K A;  4F8H A;  3LSV A;  1V9D A;  2VKH A;  2Y6X A;  1ZOY A;  4DV1 T;  1MMD A;  4TWH A;  3FZL B;  1QUU A;  1U5P A;  3QB5 A;  2X9H A;  1M62 A;  4DV3 T;  1FJG T;  5ABF B;  2VB6 A;  3MXZ A;  2J47 A;  3KV5 A;  2H7V C;  4YJ3 E;  2UUA T;  3AAI A;  4JI8 T;  2W62 A;  4LF4 T;  1I6Z A;  4X1K E;  4DUZ T;  3QUJ A;  3RX6 A;  5JDM A;  3KFW X;  4JYA T;  4YT0 A;  2IC9 A;  2LJL A;  2JPF A;  1Z0P A;  2WWV A;  4JI1 T;  3ZKR A;  5FY7 A;  4OX9 T;  2FBW A;  2ACZ A;  4ZXL A;  3ZMU B;  2K5B B;  5H6Q B;  3LBX B;  5F8P A;  3ZLI A;  1WFD A;  2MOZ A;  3I1A A;  2KIN B;  2CXD A;  3HR0 A;  4DR7 T;  2KWH A;  2CHN A;  3ZC0 A;  2GK9 A;  4AQG A;  3S4U A;  4CXY A;  4QX7 B;  4MFR A;  4PJN A;  4EOZ B;  3UT5 E;  2K3W A;  4WNK A;  2N9D A;  3KV6 A;  1OED E;  1Z8U A;  2KSR A;  4LF7 T;  3ZEF B;  2D9D A;  1X9B A;  2H3R A;  2DNX A;  3WAJ A;  4PFO A;  2L9Q A;  4LF5 T;  5AQP B;  4DR5 T;  3PUW F;  4JI4 T;  1WLX A;  4TX5 A;  4PW8 A;  3VRB A;  4YTP A;  3KIN B;  3RC3 A;  3EVY A;  3KV4 A;  4NXN T;  5J2T E;  3ANW A;  2WBL A;  1KNP A;  1FEW A;  1G8X A;  2DCF A;  3PUY F;  4X1Y E;  5EZY E;  5LG4 A;  5JDQ A;  2WCA A;  2NW9 A;  5L3B B;  2FJD A;  4I0U A;  5AQH B;  3L8R A;  3RHW A;  5LHI B;  3T1Y T;  4Q25 A;  2XQ5 A;  5JRC B;  2D5U A;  2IHR 1;  5HCM A;  3ZCJ A;  4EZ4 A;  3SFD A;  2XAS B;  4OFZ A;  1N32 T;  1XDP A;  2CA5 A;  1W0A A;  3ZN0 B;  3UQ7 A;  3AAE B;  1KNR A;  4TWD A;  4JI7 T;  5JRE A;  4O8S A;  4G63 A;  4AIU A;  4IGU A;  3RYH E;  4CI1 B;  4G2A A;  2XUE A;  2DWG A;  4Z91 A;  2KND A;  5LYJ E;  1AJ3 A;  2P9B A;  4U2Y A;  1LVK A;  4UV9 B;  3AE9 A;  5LXT E;  1JNZ A;  3RYI E;  2E9X A;  2DWK A;  1YXR A;  4YSY A;  2W67 A;  5LGT B;  2C5I T;  3AEA A;  1B7T A;  5AQO B;  5LBQ B;  2PFV A;  3MAC A;  3R6N A;  2XQ3 A;  5KXJ A;  2C0S A;  2E9X D;  5LMU T;  3CQX C;  4QXH B;  2XSB A;  3C51 A;  1NEK A;  1YW0 A;  4CN6 A;  2FUP A;  4H9S E;  5L3F B;  2V5D A;  2Y48 B;  4DND A;  1LRZ A;  3N9N A;  5AQG B;  1XWM A;  3H3A A;  1OED C;  4IE4 A;  1T8B A;  4NUU A;  3UU8 A;  1HS7 A;  1QLB A;  4HFB A;  5HYA A;  4CN1 A;  2BVM A;  3LK3 B;  4LMJ A;  2WMN A;  4H9O C;  2XQ8 A;  2WP9 A;  3VR9 A;  4I4T E;  3C64 A;  4O4L E;  1T72 A;  2CPT A;  2Y8D A;  3G06 A;  3P4W A;  4IE6 A;  2I6H A;  2MAW A;  1D0X A;  4DR1 T;  1NEN A;  3IBP A;  2FJA A;  2YDR A;  4KP3 C;  2ZM6 T;  3ETV A;  4LF6 T;  3BK9 A;  4DR3 T;  4AKR B;  4GK5 E;  4LF9 T;  4LMK A;  4GIW A;  2E9X C;  4TV9 E;  3RQU A;  3P7I A;  3OBV E;  4IDZ A;  4ZHQ E;  5L4E A;  3H37 A;  2YKS A;  5FXV A;  1WCR A;  4HTE A;  5IYZ E;  2JRK A;  2NW8 A;  1S94 A;  2M6B A;  4FJO A;  4HWD A;  3N2O A;  4O4I E;  1IBM T;  5IUX A;  3EUH A;  1MMN A;  2I59 A;  1XMQ T;  3PE0 A;  4IL9 A;  3VR8 A;  5FVL A;  3Q9D A;  4B3M T;  5L3C B;  2YDS A;  4U7I A;  2OV9 A;  3AE2 A;  4DV4 T;  3SS1 A;  1MMG A;  2KWI B;  3AVR A;  4MLK A;  2BS4 A;  5FP3 A;  3A7M A;  1OWA A;  4H9N C;  2W2U A;  5KDM C;  1D0Z A;  5FKY A;  3C4Z A;  3N9Q A;  4C90 A;  2PJQ A;  2MYS A;  3J7Y q;  5HEU A;  4N78 D;  1D0Y A;  2A3D A;  2N2N A;  4YY3 T;  3JAD A;  3CQG B;  3HKD E;  3H3M A;  2Q9Q B;  1O3X A;  1I94 T;  2XAH B;  4I50 E;  1NAF A;  3AED A;  5AQS B;  1SE7 A;  2X68 A;  4EYU A;  4X62 T;  2V6Y B;  2EHO C;  2WDR A;  2A72 A;  3RH3 A;  3AXJ A;  4HEA A;  2CXL A;  1HG5 A;  2QVA A;  2E5L T;  4CI2 B;  3KVB A;  5L3D B;  5EK4 A;  4PFP A;  5C8Y E;  2LHR A;  1MMA A;  3I9W A;  1VCS A;  4PK4 A;  4EZH A;  2M67 A;  3BQK A;  4DBQ A;  2AXD S;  2KXP B;  5JVD E;  3M65 A;  4OHF A;  2HN2 A;  2F4V T;  1WYB A;  5LHH B;  3EAM A;  5FNV E;  3UU3 A;  1KNZ A;  2X9X A;  3GMI A;  2YEV C;  5JR9 B;  1MIV A;  3ZPO A;  3CPZ A;  4IE0 A;  1HR0 T;  3LG7 A;  3R84 B;  3V5S A;  5JDN A;  2WQY A;  2X0L B;  4GKJ T;  2DI4 A;  3AEB A;  2CBJ A;  3AEF A;  5C3J A;  2LM9 A;  2V7L A;  4P0B A;  3QC9 A;  4QX8 B;  3O9X A;  2DHR A;  2YU2 A;  5DQV A;  2R6G F;  4NIQ A;  3AA0 B;  5F3J A;  2NOX A;  2CEA A;  4B3S T;  2BG9 E;  4YSZ A;  1IJ5 A;  4EAH A;  1YKE B;  3PUV F;  3NZP A;  2HPL A;  4I43 B;  2OA5 A;  4CZZ B;  3HL6 A;  3AA7 B;  3P4Q A;  2H7O A;  2Q9Q C;  4H63 V;  2LKG A;  5JTG A;  1BR4 A;  2KZ7 B;  4UR9 A;  2VKJ A;  2X66 A;  3NVO A;  2WMO A;  4Z90 A;  3WAK A;  5J2U E;  1FMV A;  3RQW A;  1J5E T;  4ASK A;  1J1J A;  4A56 A;  2V26 A;  1T98 A;  2NTX A;  2C5K T;  3FB2 A;  2BG9 B;  1BR1 A;  5ABF A;  3AE8 A;  3EAB A;  3ABV A;  3CK6 A;  1UX4 A;  2VQE T;  2WS3 A;  3CQC B;  2BKN A;  4KUM B;  5AQL B;  1ZV4 X;  2N1G A;  4YTM A;  3PUZ F;  3I0O A;  1YQ4 A;  4X1I E;  1US7 B;  4ADZ A;  4DO0 A;  2JQ9 A;  2JMK A;  4L5G A;  4O2A E;  1W9R A;  4AIS A;  2BBH A;  4DV5 T;  4HWC A;  3LBX A;  4QHO A;  1IBL T;  5CA1 E;  3Q2M A;  5DAB A;  1E2A A;  2J62 A;  3JAE A;  1ZKE A;  3P50 A;  4J2C A;  3D0T A;  3IA3 A;  2FJB A;  2BVL A;  4TUY E;  3FXE B;  5FVK A;  1FIO A;  4EYY R;  3PTR B;  2RP4 A;  4EV6 A;  3FZK B;  2CWO A;  3FHN A;  3K3O A;  3P4P A;  3RIU C;  1HNX T;  2YOE A;  4HWF A;  2LSY A;  2BZB A;  3SOL A;  1W09 A;  2D2S A;  4HGA A;  4IST A;  2XJ7 A;  2UXC T;  2YU1 A;  4U33 A;  3LK2 B;  4ZI3 D;  5HCJ A;  3CX6 B;  5L3E B;  1SUM B;  4AI6 A;  3ANW B;  4LF8 T;  2E2A A;  4ILA A;  4MAL A;  5AQJ B;  1OXZ A;  2X51 A;  5CA0 E;  1BR0 A;  2BG9 C;  5FXZ A;  2VK9 A;  3RKG A;  2XY8 B;  4XAX B;  4XZC A;  2UUC T;  4IIJ E;  5AQK B;  4I55 E;  3ZT5 A;  2QA7 A;  5LP6 E;  4HFH A;  3K1S A;  1JNR A;  2IAK A;  2L8K A;  3CX8 B;  1OED A;  1HX1 B;  1UCU A;  2LKH A;  5DJQ C;  4NXM T;  5JRC A;  2W61 A;  2XQA A;  3VU7 H;  3AEE A;  3ZJ2 A;  3HA4 A;  3CIR A;  2LHN A;  4DV2 T;  1YD8 G;  3UQ4 A;  1Y01 A;  3ONJ A;  3N9P A;  3DJB A;  2NTY A;  4AKI A;  3F57 A;  3Q5W A;  5ABH A;  1QSD A;  4U74 A;  2HPJ A;  2WB5 A;  5IWA T;  5LGN B;  5FMN A;  2CM0 A;  4H9P C;  2W63 A;  4ZI3 C;  5LGU B;  3ZMS B;  3T1H T;  3N2K E;  3P8C D;  4U2Z A;  5EK3 A;  1XNQ T;  1WR6 A;  3B5M A;  2XM1 A;  2XAG B;  4UVC B;  2BDE A;  1N36 T;  3E0Z A;  4QXB B;  4JI3 T;  2LOP A;  2IDO B;  3TLT A;  1N34 T;  2MBG A;  4DV6 T;  4B6X A;  4KI0 F;  3UU6 A;  2XAQ B;  3UUM A;  3C4W A;  4PNI A;  3CML A;  2G0U A;  4JEH B;  2E5V A;  3KBT A;  2J1D G;  5CB4 E;  3EDV A;  5IHY A;  1LVF A;  3PV0 F;  2XZE A;  1CUN A;  3PUA A;  1J5W A;  3LK4 2;  5AQI B;  3QNU A;  3NBX X;  4BA9 A;  4H63 H;  2LSG A;  4HFV A;  1H7C A;  2W66 A;  4TN7 B;  1NWM X;  4WZX A;  3AE7 A;  5JDF A;  3OPC A;  5FYM A;  4EEB A;  2VQF T;  4OYK A;  4GKK T;  3U3I A;  3N9L A;  5FL1 A;  4K0U A;  1UGO A;  3FBL A;  5LOV E;  2NWB A;  4PK6 A;  1UUR A;  5ABG A;  3RKO A;  5CFB A;  4ILU A;  5JDH A;  4WBN E;  2EHO A;  2UXX B;  4DV0 T;  3L09 A;  3TLS A;  2LE8 A;  3NRY A;  1S35 A;  3RIF A;  4WYV A;  5ETW A;  3CVR A;  2EHO D;  1ZHC A;  2ZLY A;  4UF0 B;  3FBZ A;  3UUB A;  1N33 T;  3UFG A;  5AQR B;  1SA0 E;  3FZF B;  4QH5 A;  2V5C A;  4JI0 T;  2NP9 A;  3OYZ A;  2B1E A;  4ANJ A;  4P1N A;  4UEM A;  4PJJ A;  3RC8 A;  2B76 A;  4TZ4 C;  3K8P C;  2MTQ A;  4UVB B;  2LM2 A;  3RPU A;  2XQY A;  2XAF B;  3GA8 A;  4U7Y A;  4E7S A;  4HFI A;  3M3Z B;  4JEU B;  3ZT6 A;  4JI2 T;  4AKG A;  4U31 A;  1XNR T;  4BJN A;  3UU5 A;  2LSK A;  4HN9 A;  3I0Q A;  4QWN B;  3ZMT B;  3LFM A;  3HKE E;  5LMN T;  3C98 B;  2WDV A;  5LG3 A;  4X66 T;  4IT4 A;  1UK5 A;  4TNW A;  4UIG A;  1MIW A;  1HF8 A;  2WWU A;  1T7S A;  3N5L A;  5H6R B;  2VWA A;  2Q9Q A;  3NKZ A;  3HKC E; 
#chains in the Genus database with same CATH homology
 5JDG A;  2E8I A;  4UVA B;  1T98 A;  2NTX A;  2C5K T;  3B57 A;  3FB2 A;  2KLQ A;  1BR1 A;  3I9Y A;  3N9O A;  4X20 E;  5LHI B;  3AA1 B;  5JRC B;  4AQF C;  2IC6 A;  3SRZ A;  2D5U A;  3PUG A;  2K9A A;  3ZCJ A;  1UX4 A;  5LJM A;  2XAJ B;  4EIW A;  4EZ4 A;  1ZEE A;  2XAS B;  3CQC B;  2Q9Q D;  1HFA A;  2V7I A;  4OFZ A;  4KUM B;  2CA5 A;  1SHZ C;  3ZN0 B;  5FXW A;  1ZV4 X;  2N1G A;  2EHO B;  5A1L A;  5HXC A;  3AAE B;  3I0O A;  4MHC A;  1HCI A;  4DBR A;  4M1P A;  4X1I E;  3QK6 A;  5JRE A;  3NRX A;  3J9X 1;  4O8S A;  1US7 B;  4ADZ A;  4DO0 A;  5LHG B;  3KVA A;  1FMW A;  2JMK A;  2ZMA A;  4G63 A;  4L5G A;  4CXX A;  1D1A A;  4IGU A;  4PJM A;  4ZS2 A;  4EXT A;  2PG8 A;  3RYH E;  4O2A E;  3ZMZ B;  4CI1 B;  2JJ9 A;  4G2A A;  4WW0 A;  2XTL A;  4ISS A;  2XUE A;  3UFE A;  5JR9 A;  3JC6 D;  3LBX A;  4QHO A;  2V1D B;  3CWZ B;  2DWG A;  2JQQ A;  3IEE A;  5L2L A;  3F2E A;  4O4H E;  5CA1 E;  4XBF B;  2ODV A;  2KND A;  3Q2M A;  3KV9 A;  3RYC E;  2WSS V;  5LYJ E;  5DAB A;  1AJ3 A;  2P9B A;  1LVK A;  4ZOL E;  4UV9 B;  4KMC A;  4UF0 A;  1ZKE A;  2LOS A;  1EZ3 A;  2CWY A;  3K3Q C;  3U78 A;  5LXT E;  3F31 A;  4J2C A;  4DVD A;  3OJA A;  3D0T A;  4YFS A;  2ZM0 A;  1IZN B;  3RYI E;  2BVL A;  2E9X A;  4OK0 A;  4TUY E;  3FXE B;  2DWK A;  1D1C A;  4ZI2 C;  1FIO A;  4EYY R;  3PTR B;  2RP4 A;  2A2F X;  2X9Y A;  5LGT B;  2KMF A;  4CI3 B;  2C5I T;  5L3G B;  4YHJ A;  3W15 B;  2KT9 A;  2CWO A;  3IF8 B;  3FHN A;  3K3O A;  4UV8 B;  1B7T A;  3AA6 B;  5LBQ B;  4GK0 E;  4Z8X A;  2PFV A;  2V7M A;  3MAC A;  5LCY A;  3R6N A;  4ZI7 E;  2C0S A;  4CXW A;  4PJL A;  5M4Y A;  3UUX B;  3DTO A;  4QKN A;  1X79 A;  2LSY A;  2BZB A;  2JMH A;  2E9X D;  2RA1 A;  3CQX C;  5FXX A;  3SOL A;  4QXH B;  3GN5 A;  2D2S A;  3C51 A;  4HGA A;  4GYR A;  4BJM A;  3ZMV B;  4GOU A;  3SWH A;  3VKG A;  1YW0 A;  4HE8 A;  4IST A;  4L9I A;  4C91 A;  2VKD A;  5LA6 E;  2YU1 A;  4O2B E;  5FY0 A;  5JDL A;  3O4X E;  4H9S E;  3LK2 B;  4ZI3 D;  5ADX L;  5L3F B;  2C5J A;  4NUV A;  2Y48 B;  1WYC A;  5DQW A;  4IE7 A;  3L3P A;  3CX6 B;  5L3E B;  4DMV A;  2ES0 A;  4DND A;  5HXH A;  4AI6 A;  3ANW B;  1LRZ A;  2DLR A;  3PU3 A;  3N9N A;  3ETU A;  2X67 A;  3H3A A;  2PBI A;  3RYF E;  4BAY B;  4E7Z A;  3C50 A;  4ZI2 D;  4AKH A;  4MAL A;  4JUY A;  1OXZ A;  2X51 A;  5CA0 E;  1BR0 A;  2WAU A;  5KX5 E;  4YLH A;  4IE4 A;  2VK9 A;  5FXZ A;  1U4Q A;  3O1H A;  3VKH A;  5HWY A;  4XAX B;  4XZC A;  3BQL A;  4IHJ E;  4NUU A;  2VAS A;  4IIJ E;  5AFU L;  3MA9 A;  4I55 E;  3JC6 C;  1HS7 A;  4ASK A;  2QA7 A;  3TKL B;  1Y64 B;  3KBU A;  5HYA A;  5LP6 E;  3MZK B;  1E1H B;  2BVM A;  2SPC A;  3LK3 B;  4QXC B;  4UEL A;  2IAK A;  2CMR A;  1LKX A;  2WMN A;  2L8K A;  4H9O C;  3VHL A;  4L0R A;  2D0U A;  3DP7 A;  3CX8 B;  4I4T E;  3C64 A;  1UCU A;  4O4L E;  4P0A A;  2HH7 A;  5DJQ C;  5JRC A;  2W61 A;  3PUQ A;  2Y8D A;  5JR9 C;  3V5U A;  4IE6 A;  3VU7 H;  3ZJ2 A;  4P09 A;  3E22 E;  3HA4 A;  3PDY A;  1D0X A;  3ZCI A;  2LHN A;  3IBP A;  5HXS A;  4IE5 A;  4KP3 C;  3ETV A;  1YD8 G;  2ZM8 A;  2LSJ A;  3N9P A;  3DJB A;  1KK7 A;  3BK9 A;  4CQI A;  2NTY A;  4AKI A;  3F57 A;  3Q5W A;  4AKR B;  1QSD A;  2WM9 A;  4GK5 E;  4U74 A;  2HPJ A;  5KMG P;  4GIW A;  2E9X C;  5LGN B;  1WRD A;  4TV9 E;  3ZN1 B;  3BQI A;  3P7I A;  3OBV E;  4IDZ A;  5FMN A;  2CM0 A;  4ZHQ E;  3PUS A;  4H9P C;  2W63 A;  4PAG A;  4ZI3 C;  1HTJ F;  2ZM2 A;  5LGU B;  3H37 A;  3ZC1 A;  5E0O A;  3ZMS B;  5FXV A;  2QGS A;  3N2K E;  4HTE A;  5IYZ E;  2JRK A;  3P8C D;  5EK3 A;  3A5X A;  4GYS A;  2VKO A;  2CCQ A;  3PU8 A;  2CE7 A;  1WR6 A;  3N2G E;  2NW8 A;  1S94 A;  2XAG B;  4UVC B;  4FJO A;  3Q5X A;  2BDE A;  3MKD A;  3WI3 A;  3AVS A;  3N2O A;  3E0Z A;  4O4I E;  4QXB B;  2LOP A;  3AAA B;  3HKB E;  2V7J A;  2Z6E A;  1YKH B;  3EUH A;  2W00 A;  1MMN A;  2I59 A;  4MBQ A;  3PE0 A;  2MBG A;  3IHR A;  4ZS3 A;  4B6X A;  4OYJ A;  5JH7 E;  3Q9D A;  1MIY A;  2XAQ B;  4ERR A;  4HKA A;  3UUM A;  3C4W A;  4PK5 A;  4PNI A;  3CML A;  5L3C B;  5LJN A;  2G0U A;  4JLE A;  2K24 A;  4AKL A;  3AB3 B;  2D0T A;  4JEH B;  1G73 A;  3LJC A;  2V7K A;  5HXR A;  3HI2 A;  3KBT A;  3SS1 A;  1MMG A;  3ESL A;  2ODU A;  2J1D G;  3FXD B;  2KWI B;  3AVR A;  3GN5 B;  5CB4 E;  4V1A v;  3OKQ A;  5TAO A;  4MLK A;  3UTK A;  3EDV A;  3RRC A;  2IW5 B;  5IHY A;  5EK2 A;  5FP3 A;  1HG2 A;  1OWA A;  3O1I A;  2YIN A;  4H9N C;  5KDM C;  1D0Z A;  1LVF A;  4KBM B;  4A56 A;  2ACX A;  3C4Z A;  1V9D A;  1CUN A;  1IAP A;  5HWX A;  3N9Q A;  2PJQ A;  2MYS A;  2VKH A;  3MK7 C;  3PUA A;  4UXN B;  4C90 A;  4DMW A;  2Y6X A;  3J7Y q;  4N78 D;  1MMD A;  1D0Y A;  2CLY B;  3LK4 2;  1VOM A;  2A3D A;  2N2N A;  3UUN A;  4H9Q C;  2W0G A;  3CQG B;  3HKD E;  2Q9Q B;  1O3X A;  1QUU A;  2XAH B;  3NBX X;  5HAX A;  4BA9 A;  4I50 E;  1U5P A;  1HX8 A;  1NAF A;  4H63 H;  2LSG A;  4WBO A;  2X68 A;  4EYU A;  4HFV A;  2X9H A;  3T8O A;  1H7C A;  2YK0 A;  4TN7 B;  1NWM X;  4O4J E;  3ZYM A;  1MNE A;  3PUR A;  5JDF A;  2VB6 A;  2K48 A;  3MXZ A;  3OYX A;  2EHO C;  5FYM A;  3KV5 A;  2H7V C;  4YJ3 E;  2A72 A;  4U72 A;  4OYK A;  5JQG E;  3RH3 A;  3AAI A;  3U3I A;  4HEA A;  3N9L A;  2CXL A;  2W62 A;  3E08 A;  4K0U A;  3FBL A;  1HG5 A;  2L3L A;  4X1K E;  5LOV E;  3QUJ A;  3RX6 A;  4CI2 B;  1UX5 A;  5FY1 A;  3CKD A;  3KVB A;  5L3D B;  5EK4 A;  4PFP A;  2NWB A;  5C8Y E;  2LHR A;  1MMA A;  2LT3 A;  3KFW X;  4PK6 A;  5JDM A;  3I9W A;  4PK4 A;  4EZH A;  3RKO A;  2M67 A;  2IC9 A;  3N9M A;  2LJL A;  4ILU A;  2JPF A;  4AXP A;  5JDH A;  3BQK A;  4WBN E;  1Z0P A;  4DBQ A;  2EHO A;  4FI5 A;  2KXP B;  3ZYK A;  5JVD E;  3M65 A;  4OHF A;  2XHE B;  2UXX B;  5FY7 A;  3L09 A;  1WYB A;  2LE8 A;  3NRY A;  5LHH B;  5FNV E;  1KNZ A;  2X9X A;  1S35 A;  5LBM A;  3GMI A;  3ZMU B;  2YEV C;  2K5B B;  5H6Q B;  5JR9 B;  3LBX B;  5F8P A;  3ZLI A;  1MIV A;  2MOZ A;  3I1A A;  3CPZ A;  4IE0 A;  3ZPO A;  5ETW A;  4AQF A;  2KIN B;  2CXD A;  3CVR A;  3LG7 A;  3R84 B;  2EHO D;  1ZHC A;  3V5S A;  2ZLY A;  5JDN A;  3HR0 A;  4UF0 B;  5BMV E;  2X0L B;  2X9W A;  3FBZ A;  2DI4 A;  2KWH A;  2UXN B;  2LM9 A;  1SA0 E;  2V7L A;  4F6R C;  4P0B A;  2E9X B;  3ZC0 A;  2GK9 A;  4AQG A;  4YJ2 E;  3QC9 A;  5J1G A;  2LEH A;  2NP9 A;  4QX8 B;  3O9X A;  2DHR A;  2YU2 A;  3OYZ A;  2B1E A;  3S4U A;  5DQV A;  4ANJ A;  4CXY A;  3KDS E;  4QX7 B;  4MFR A;  4PJN A;  5LNK A;  3RRW A;  2VL8 A;  4EOZ B;  3AA0 B;  5F3J A;  3UT5 E;  4UEM A;  4WNK A;  2N9D A;  2NOX A;  3KV6 A;  4PJJ A;  2CEA A;  3RC8 A;  4TV8 E;  1IJ5 A;  4EAH A;  1BR2 A;  4TZ4 C;  1YKE B;  3K8P C;  3NZP A;  3NZQ A;  2MTQ A;  3EDU A;  4UVB B;  3ZYL A;  2HPL A;  4I43 B;  3RPU A;  2XQY A;  3ZEF B;  2OA5 A;  1D1B A;  4CZZ B;  2LSI A;  3GWH A;  1IJ6 A;  1MND A;  2XAF B;  3GA8 A;  3CX7 B;  4E7S A;  2H3R A;  2DNX A;  3WAJ A;  4JEU B;  2CLY C;  5HXE A;  4PFO A;  2L9Q A;  4AKG A;  3HL6 A;  3AA7 B;  1VRB A;  5GON E;  4BJN A;  2H7O A;  2LSK A;  2CXF A;  4HN9 A;  2Q9Q C;  4H63 V;  1BR4 A;  5L3B B;  3I0Q A;  2KZ7 B;  4QWN B;  3ZMT B;  1WLX A;  3LFM A;  4TX5 A;  4PW8 A;  3HKE E;  2VKJ A;  2X66 A;  3O1J A;  3C98 B;  3C4X A;  3KIN B;  3RC3 A;  3EVY A;  3KV4 A;  2WMO A;  5J2T E;  3MJX A;  3ANW A;  3ONX A;  4H9R C;  2WBL A;  4UIG A;  1MIW A;  1FEW A;  3B13 A;  3ZJ1 A;  3WAK A;  1G8X A;  5J2U E;  1HF8 A;  3K3N A;  1FMV A;  2WWU A;  2DCF A;  3N5L A;  3UUL A;  5H6R B;  4EB6 E;  2VWA A;  4X1Y E;  2NW7 A;  2Q9Q A;  5EZY E;  5LG4 A;  5JDQ A;  2NW9 A;  3HKC E;  2V26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...