4H9PC

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 73
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9pC00
5KDMC 4H9PC 4H9OC 4H9QC 4H9SE 4HGAA 4H9NC 4H9RC
chains in the Genus database with same CATH superfamily
1G73A 1XDOA 5HYAA 2VWAA 3QNUA 3Q2MA 2R6GF 5LGUB 4MHCA 4NXMT 1EZ3A 1D0ZA 3P8CD 1QLBA 3EDVA 2Q9QA 3OVUA 4LFBT 3VKGA 2XQ5A 4AISA 2A3DA 3ZT6A 2E8IA 4CN1A 3T1HT 2A9UA 3UUNA 4AQFA 5EK4A 4DR6T 5FVKA 2EHOD 3J7Yq 4PJNA 2LM9A 5JR9C 4JYAT 3K1SA 2E5LT 4PFPA 4JBWF 1MIYA 4UIGA 2DWKA 2E5VA 1HS7A 3D0TA 2JIWA 5JRCA 4HFVA 4U2ZA 2DNXA 2CXDA 5GONE 2IMLA 3PDYA 2YU1A 1YD8G 4TWFA 2IC9A 2WZIA 2CWYA 4AXPA 4EOZB 2X0HA 3C64A 4U7IA 5LJNA 1I6ZA 2VL8A 2UU9T 3H37A 1UX5A 4WBNE 4PNIA 4O4IE 3Q5XA 1LRZA 4I0UA 4UXNB 2E9XC 2YINA 3ONLC 3C98B 2Z6EA 3I0QA 4J2CA 5FY7A 1KK7A 4DVDA 4TNVA 3ZEFB 5FXZA 4A98A 2UXNB 2H89A 3KDSE 3UT5E 4HTEA 2LE8A 4LF6T 4GYSA 2GK9A 3NBXX 3P4QA 5AQRB 3ANWA 3F31A 4NIQA 2BDEA 2EHOB 3UU3A 4DR7T 4OX9T 2LM2A 2LOSA 3AE8A 4JI3T 5HAXA 3RQUA 2XHEB 2V6XA 2KXPB 2JRKA 1YQ3A 2LKGA 2HPJA 2NR4A 4CI1B 2XUEA 5A1LA 3B13A 4MLKA 2WS3A 2NP9A 3DTOA 1YKEB 4YHHT 3K8PC 3ZSSA 5L4HA 3EABA 5AQUB 3ZMVB 4EYUA 3AXJA 1ZV4X 4UVBB 4LMLA 2PTFA 3ESLA 3FZFB 2ZM0A 1IAPA 2RPAA 5F8PA 4ZI7E 4A5XA 4CQIA 2MYSA 4WNKA 3ZKRA 1BR1A 4Z90A 4X20E 5EK3A 3U78A 5AQSB 4MBQA 1IBMT 3QB5K 4ZI2C 3RYFE 2LEHA 5C2TA 3WAKA 4KHPT 3N9OA 3N9LA 1HNWT 4EB6E 3P4RA 2WP9A 2J4GA 2VKDA 1FMVA 3FZMB 3UQ7A 1LVFA 2XTLA 3FB2A 5AQFB 4YHJA 4ANJA 2LJLA 3MA9A 2OLTA 5HXEA 3AEGA 2BZBA 2CXFA 4YSXA 2N9DA 5FYMA 5IUXA 2X9YA 2DWGA 2KZ7B 1SA0E 3TLUA 4KMCA 5M4YA 1MMAA 3A5XA 2OA5A 2PJQA 5TAOA 4EZHA 2L9QA 2MAWA 5L3FB 3CKDA 5FP3A 3MZKB 3C4ZA 3QB5A 4TUYE 1IZNB 5IHYA 4EIWA 2BG9C 1ZOYA 3IEEA 5CGMA 3PUQA 5EK2A 2LRKA 2LT3A 2V8SV 4HWFA 2BKOA 4U2YA 5J2TE 2CLYB 3L39A 4X1IE 2KWHA 4P09A 3QK6A 5IWAT 4H9PC 3FBZA 5AQGB 1WFDA 3U3IA 4I50E 5DQWA 1UURA 3L09A 3JC6D 3KV5A 2FJBA 3AE5A 4LF4T 2YN6A 4L9IA 3GA8A 4XZCA 3TKLB 3V5SA 3HKDE 3CIRA 3WI3A 5DABA 5JDHA 3T8OA 1B7TA 2Q9QD 4IREA 5JH7E 2M6IA 3RKGA 3LFMA 4JI1T 1HX1B 4CXYA 2NTXA 2NW8A 1MIVA 4LMJA 3RX6A 4DV1T 4ILAA 3K3OA 2C5JA 2YKSA 4X1KE 3T1YT 3LK2B 1YKHB 3RH3A 5AQQB 3EUHA 1LVKA 1ZP0A 4TV8E 4OYJA 3AE4A 5AQMB 3KFWX 2E2AA 5ADXL 2VQET 3RQWA 3BQIA 2VKOA 2WY2A 2CE7A 3RIUC 2UXBT 2K5BB 1JNRA 1D1CA 3AE2A 2D0TA 3ZLIA 4JI2T 3ZCIA 5KXJA 3CX8B 3UU6A 3NKZA 2LHNA 2LSYA 3C50A 3JAEA 2V6YB 3L8RA 2XAGB 3PU3A 3ZYKA 1XNRT 3N9QA 3RHWA 2WMNA 4QH1A 3UUMA 4IGUA 5L3GB 5C3JA 2ACXA 2L3LA 3P4WA 1L0VA 5ABFA 4FI5A 1CUNA 2NTYA 5LG3A 3ZYMA 3AA7B 2JQQA 2V7MA 4TV9E 2IIUA 4IDQA 4M1PA 3EHZA 3A7MA 1Y01A 2JMKA 4LF5T 4ERRA 3KINB 4H9OC 2B1EA 2Q9QB 3KV4A 5HCJA 3LBXA 2VL0A 1XWMA 2WQYA 3ETUA 3N2KE 5J1GA 1ZKEA 3RC8A 1XDPA 2W2UA 2XAQB 1KNRA 4HFBA 3AEAA 2RP4A 3ZMSB 2K24A 3AEFA 3M3ZB 2IUBA 2A2FX 3RRCA 4E7SA 5JRCB 4DV3T 4IDZA 1IJ6A 1WYCA 4YTNA 3ONXA 2CEAA 5CFBA 1XNQT 1MMNA 5HWYA 3BQLA 2XY8B 2VURA 1N32T 4ZHQE 3ZMUB 3BQKA 2WDVA 3ONJA 4IDOA 4IE0A 4IE7A 5LHHB 3I0OA 2CHOA 2YEVC 4U7YA 3KBTA 1OEDA 5H6QB 2NW9A 1OWAA 4ZI3D 4H9NC 2CXLA 2X9WA 3SFDA 1NEKA 3PUXF 4PW8A 1T72A 3CMLA 4EAHA 3RC3A 1JNZA 4NXNT 3CK6A 3N9PA 2ODUA 4IL9A 4HKAA 2PFVA 4YJ2E 4HFIA 4AKRB 4PAGA 2MBGA 5FY1A 5ABGA 3AE3A 4O2AE 1MMDA 5BR8T 5FXWA 4JI0T 3ANWB 4X5TA 5LCYA 3PE0A 2CBJA 2XSAA 3MXZA 1US7B 3HR0A 4U3CA 2K9AA 3PU8A 2UUBT 2L8KA 2WWVA 3W15B 5AQTB 3M65A 1UCUA 2DCFA 5KX5E 3AE7A 2EHOC 2M6BA 3CWZB 1OEDE 2JQHA 3ZN0B 5AQVB 5L2LA 3JADA 3AAIA 3C4WA 2IDOB 3AXJB 3UU4A 2UXXB 1Y64B 2WCAA 5DJQC 1NENA 2UXCT 3HI2A 1BR0A 4L0RA 5AQLB 4AKIA 2XM1A 2HN2A 4LF8T 3PUGA 4BJNA 4DV2T 4H9QC 4UVCB 1E7PA 1CHUA 4QHOA 1R8IA 2FBWA 4KHZF 3AECA 4X62T 4IDPA 3KVBA 4HFCA 3J9X1 4CN4A 1HNZT 3CVRA 2ZM2A 2H7VC 3ZT5A 2FJEA 2IAKA 2HN1A 2KMFA 4BA9A 2VK9A 3CQXC 4LFAT 1XMQT 2LSIA 4TWDA 4HWIB 5L3CB 3E22E 1T7SA 2WBLA 2CPTA 3FXDB 4P0AA 3PJAJ 2NWBA 3S4UA 1UUSA 1QSDA 2WU5A 1KNZA 5LJMA 3E0ZA 4Q25A 2XAJB 2HHHT 4UF0A 5DQVA 5LBQB 2ZLYA 4HGAA 1AJ3A 2DI4A 3VR8A 2V5CA 1J5WA 4YJ3E 4KI0F 4EV6A 1YQ4A 1N36T 1D1AA 3AE1A 5JR9A 3LG7A 2W63A 4F6RC 5LMNT 1MNDA 4FJOA 3RYIE 2K48A 1I94T 4MFRA 4YSYA 1HG5A 4DR2T 4ZS2A 2CLYC 3PJAA 3P7IA 2X0LB 3HKBE 4O4JE 3WAJA 4U31A 2YDQA 2IW5B 4GKJT 4QH5A 2ZM6T 2P9BA 2MPKA 2MTQA 2WWUA 3R6NA 4EZ4A 3UUBA 1HG2A 3VRBA 3PUAA 4GK0E 4Z8XA 4TWHA 4UV9B 1LKXA 4XAXB 5FKYA 1WR0A 5EZYE 2E9XA 1VOMA 3H3MA 3K3QC 1S94A 2J1DG 4OYKA 1J1JA 4KP3C 5HCMA 4PJJA 2X68A 3X1DA 4QX7B 1SUMB 1SHZC 5AQJB 5AQKB 2W62A 5HEOA 1S35A 4O4LE 4ILUA 2X0YA 4JI8T 4UV8B 5ETWA 3ZN1B 2BVLA 3KV9A 3DP7A 3RIFA 4ZZBA 3P4PA 5CA1E 3F57A 4IHJE 1WRDA 3O1JA 3FZHB 3KV6A 3ZT7A 3B5MA 4WBOA 4B3TT 3Q5WA 1HTJF 2CM0A 4DR4T 5L3BB 2ZMAA 5L3EB 1FEWA 4I4TE 4DUZT 3CX7B 3RLFF 4LFCT 3UQ4A 2YK0A 4TX5A 3GWHA 4CZZB 2I59A 4IIJE 3UULA 5ABFB 4JI4T 5HEGA 2CBIA 4DV7T 4LF9T 4AQYT 3OJAA 3ZSTA 5JQGE 3MK7C 3ZYLA 4ZS3A 2Y6XA 4IE6A 2I0MA 3JC6C 1YXRA 3CQGB 5F3JA 2OV9A 4ILCA 1BR4A 3N9NA 1U4QA 1HF8A 2BS2A 1N34T 3AEEA 2QVAA 3LBXB 2XQ3A 2XQ9A 1W9RA 5LG4A 1WR6A 1W09A 2VB6A 4IE5A 4PJLA 2DHRA 3IHRA 3K3NA 1MNEA 2N1GA 2FJAA 2QYWA 2XQ4A 2JMHA 2Q9QC 4XBFB 2J47A 4DR3T 3TLSA 3I9WA 2V7JA 3ZJ2A 4X64T 5FMNA 5HEUA 3LK42 3O1IA 4JI7T 2X9XA 5AQHB 3VU7H 4X65T 2NW7A 4AQFC 5AQIB 1W0BA 3OYZA 5HXRA 4JV5T 3RIAA 4JUYA 2CHNA 2QGSA 5JDLA 4DBQA 5C8YE 2IHR1 2XQ8A 4HWCA 2KLQA 2LKHA 3QOFA 3UUXB 3CPZA 4JI5T 1OEDB 2W61A 3NRYA 4COFA 4K0KT 4A97A 3NZPA 4YXDA 5HXCA 2LHRA 4G63A 2BG9A 3Q5EA 2WU2A 4MALA 3UTKA 4HWHA 4U33A 4I55E 5L3DB 2KSRA 2XQAA 5FNVE 5JVDE 3RYHE 1NAFA 4DUYT 3N2OA 4PK4A 2BS3A 3PUSA 5AFUL 5IYZE 4UELA 3OBVE 5AQPB 2VQFT 3MACA 4P1NA 2BKPA 1N33T 1IBLT 2V7LA 1HX8A 3OPCA 1X9BA 4UR9A 4C91A 3I9YA 1T8BA 3EI0A 4UEMA 2RA1A 5L4EA 3FXEB 2BBJA 1V9DA 3RKOA 3E08A 3AE6A 4AIUA 2XSBA 2VKJA 3GN5A 4B3MT 3SOLA 1IBKT 5LMUT 2UXDT 2K3WA 5AQOB 1WCRA 2WDRA 3KVAA 5JDQA 5HXHA 3A8YC 5FXVA 2BG9E 4YY3T 4DR1T 3FHNA 2XJ7A 1T98A 5CA0E 5HEHA 3H3AA 4GOUA 2KT9A 4HEAA 2VVNA 3NRXA 2KINB 1XMOT 3QC9A 5J0ZA 2WDQA 1FMWA 3UFGA 3RIUA 3CX6B 4ZI3C 4JEUB 4WYVA 5KMGP 1VCSA 2LSJA 1VCTA 4AKGA 4WZXA 4JI6T 5JDMA 1HCIA 4ILBA 3AEDA 3SRZA 2LLYA 5LYJE 1WYBA 4EEDA 4CN6A 1D1BA 3GMIA 2X67A 4X66T 2ODVA 4GK5E 2C5IT 1X79A 4C90A 4QH4A 4U72A 2E9XD 2V26A 2XASB 4OFZA 5J2UE 2KWIB 4QKNA 2XPKA 4ZOLE 3LDQB 4EEBA 3RPUA 1KF6A 3AA1B 3MKDA 3HA4A 4G2AA 1HR0T 3KBUA 1MIWA 4H9SE 4PK6A 4UF0B 1FIOA 4HFEA 3RGLA 4KBMB 3AVSA 4HWDA 3VR9A 4V1Av 3VKHA 2Y48B 4KX6A 1D0YA 1YW0A 2UUCT 1M62A 3AAAB 5JR9B 3CQCB 2WZHA 3FZLB 2CWOA 3EAMA 4LMKA 2XZEA 4EGWA 5L47A 2V7KA 4WW0A 1HFAA 2F4VT 5FVLA 2PG8A 4NPPA 2D2SA 4ADZA 3AA0B 4NUUA 4TN7B 3Q9DA 2QA7A 3UU8A 4ASKA 4JEHB 3N9MA 2XAFB 3MJXA 2YU2A 5LA6E 5F5WA 5JTGA 2X51A 2W67A 3NWIA 3FBLA 3EVYA 3HKCE 4NUVA 3IA3A 4QXBB 1IJ5A 4DR5T 2SPCA 5AQNB 2N2NA 2E9XB 3PTRB 5LHGB 3AAEB 5H6RB 1DU2A 4HFHA 2ZM8A 4OHFA 4ZI2D 4AKHA 3P4SA 2VKHA 4HFDA 2D0UA 4EXTA 3PUVF 5JDNA 1M7KA 1KNPA 1UK5A 4GKKT 5LGNB 3AVRA 4BAYB 4JLEA 1QUUA 2CCQA 3TLTA 5CJ5A 1E1HB 2JJ9A 4N78D 3EDUA 1ZEEA 4L5GA 2I6HA 1E2AA 2JQ9A 4PFOA 4B3ST 2KNDA 5JDFA 2WSSV 1ZHCA 2WAUA 1U5PA 5LNKA 4DV5T 2FJDA 3ZC0A 2ACZA 3ETVA 3HL6A 5CB4E 5LGTB 2V5DA 2XQ6A 4E7ZA 2EHOA 2FUPA 5KDMC 3I1AA 3JAFA 3VRAA 4AKLA 3OTOT 2XQYA 5HEJA 1BR2A 2IC6A 3PURA 1HNXT 2UUAT 4B6XA 2W66A 1D0XA 4F8HA 1KFYA 2WM9A 2LRLA 2H7OA 3PUWF 5E0OA 4LF7T 1VRBA 5HWXA 2J62A 5LB7B 2WMOA 4YFSA 4CXXA 1WLXA 1KEYA 3PUYF 1MMGA 3N2GE 3LSVA 4H63V 4DV0T 3ZC1A 1W0AA 2VVSA 2YDSA 2JQKA 4IE4A 2H3RA 3LK3B 3F2EA 4KUMB 3Q5DA 2ES0A 4CI3B 4BJMA 4CI2B 4AQGA 1OXZA 4O2BE 2HH7A 3RRWA 2AE9A 4AI6A 4EYYR 3SWHA 2B76A 4DMVA 3O9XA 4YSZA 3AEBA 1UX4A 4K0UA 2HPLA 2DL1A 4IDNA 5LXTE 2NOXA 3RF1A 4H63H 3QUJA 2CRBA 4YTMA 2BG9B 2BS4A 2M67A 3FZKB 4CXWA 1OEDC 3RI5A 4UVAB 4QX8B 3SS1A 4H9RC 4DMWA 4ZEYA 2CMRA 3OKQA 3AB3B 4TNWA 2XAHB 3PUZF 4GIWA 2AXDS 1J5ET 3P50A 5FL0A 2BKNA 4U74A 3ZMTB 4O8SA 2VASA 4ZXLA 2MOZA 2BVMA 5JREA 2G0UA 4QXHB 1Z8UA 4I43B 4YTPA 3R84B 2LSKA 2XM2A 4DO0A 4GYRA 2W4XA 2DLRA 4DV6T 3OYXA 4P0BA 4PJMA 2LSGA 3TLWA 4QXCB 4DNDA 4A56A 4OK0A 3UU5A 3ABVA 5FXXA 1O3XA 3DJBA 2YDRA 3IBPA 3GN5B 2Y8DA 5HXSA 1XZYA 3B57A 3NZQA 3AE9A 3VHLA 4Z91A 1G8XA 2QRXA 3RYCE 3N5LA 2W0GA 4DV4T 3C51A 4DIDB 4IL4A 3ZMZB 3ZPOA 3NVOA 4TZ4C 2X9HA 3TLVA 4IT4A 3BK9A 4HN9A 3O1HA 3ZJ1A 3SFEA 5LP6E 5FL1A 2D9DA 5FY0A 3ZCJA 2H88A 3UFEA 1FJGT 5JDGA 4O4HE 2D5UA 5ABEA 4PK5A 4ISTA 2BBHA 2CA5A 2XQ7A 3C4XA 2JPFA 5LBMA 2LOPA 2V1DB 3IF8B 2PBIA 1UGOA 4ISSA 3PV0F 1H7CA 5BMVE 4ZZCA 2W00A 4DBRA 2A72A 1Z0PA 5ABHA 4YLHA 3JCFA 2YOEA 2C5KT 3O4XE 3G06A 3HKEE 4B3RT 2WB5A 1SE7A 3LJCA 3AA6B 3L3PA 4YT0A 2V6YA 1GQEA 5LHIB 1NWMX 3V5UA 5LOVE 4QWNB 4X1YE 2V7IA 2X66A 2C0SA 4HE8A
chains in the Genus database with same CATH topology
1G73A 5ADXL 4EZ4A 1HG2A 3PUAA 4GK0E 2CWOA 4Z8XA 3BQIA 2VWAA 2VKOA 4UV9B 3Q2MA 5HYAA 1LKXA 4XAXB 2V7KA 5EZYE 2E9XA 1VOMA 1HFAA 4WW0A 3K3QC 2CE7A 1S94A 2J1DG 4OYKA 5LGUB 4MHCA 2PG8A 4KP3C 4PJJA 1EZ3A 2D2SA 2K5BB 2X68A 1D0ZA 4ADZA 1D1CA 3AA0B 3P8CD 4NUUA 4TN7B 2D0TA 3Q9DA 3ZLIA 2QA7A 4QX7B 4ASKA 4JEHB 3EDVA 3ZCIA 3N9MA 2XAFB 3CX8B 2LHNA 1SHZC 3MJXA 2LSYA 2YU2A 3C50A 2W62A 5LA6E 2Q9QA 2X51A 2XAGB 1S35A 3PU3A 4O4LE 3ZYKA 4ILUA 3N9QA 3VKGA 2WMNA 3UUMA 4IGUA 4UV8B 5ETWA 2A3DA 3EVYA 3FBLA 2E8IA 5L3GB 3ZN1B 2ACXA 2BVLA 2L3LA 3KV9A 3HKCE 3DP7A 4NUVA 3UUNA 4FI5A 4AQFA 4QXBB 1IJ5A 5EK4A 2SPCA 5CA1E 1CUNA 2NTYA 3F57A 4IHJE 1WRDA 3O1JA 2N2NA 2E9XB 3ZYMA 2EHOD 3PTRB 5LHGB 3J7Yq 3AA7B 2JQQA 3KV6A 3AAEB 2LM9A 2V7MA 4PJNA 5H6RB 4TV9E 2ZM8A 5JR9C 4M1PA 4WBOA 4OHFA 4ZI2D 4AKHA 3Q5WA 1HTJF 4PFPA 2VKHA 1MIYA 2CM0A 2JMKA 4UIGA 2DWKA 1HS7A 4ERRA 5L3BB 2D0UA 2ZMAA 3D0TA 4EXTA 1FEWA 3KINB 5L3EB 5JRCA 4HFVA 4I4TE 4H9OC 5JDNA 2B1EA 2Q9QB 3KV4A 3CX7B 2DNXA 5LGNB 3AVRA 2CXDA 5GONE 3LBXA 4BAYB 3PDYA 4JLEA 2YU1A 1YD8G 2YK0A 3ETUA 3N2KE 5J1GA 1QUUA 2CCQA 4TX5A 2IC9A 3GWHA 4CZZB 2I59A 4IIJE 3UULA 1ZKEA 2CWYA 4AXPA 1E1HB 3RC8A 2JJ9A 4N78D 3EDUA 1ZEEA 4L5GA 4EOZB 2XAQB 3C64A 3OJAA 5LJNA 4PFOA 5JQGE 2KNDA 3MK7C 3ZYLA 4ZS3A 2VL8A 2Y6XA 5JDFA 2WSSV 4IE6A 1ZHCA 2WAUA 3H37A 1UX5A 4WBNE 2RP4A 4PNIA 3ZMSB 3JC6C 2K24A 1U5PA 4O4IE 3Q5XA 1LRZA 3CQGB 5LNKA 5F3JA 2A2FX 1BR4A 3N9NA 3ZC0A 1U4QA 3ETVA 3RRCA 1HF8A 4E7SA 5JRCB 3HL6A 5CB4E 4UXNB 5LGTB 2E9XC 4IDZA 1IJ6A 3LBXB 2YINA 4E7ZA 1WYCA 2EHOA 5KDMC 3C98B 5LG4A 1WR6A 3I1AA 3ONXA 2CEAA 2Z6EA 3I0QA 1MMNA 5HWYA 4J2CA 3BQLA 4ZHQE 3ZMUB 2VB6A 4IE5A 3BQKA 4PJLA 4IE0A 2DHRA 5FY7A 4AKLA 3IHRA 3K3NA 1KK7A 4IE7A 5LHHB 2XQYA 3I0OA 1BR2A 1MNEA 2YEVC 4DVDA 2IC6A 3KBTA 3PURA 2N1GA 2JMHA 2Q9QC 3ZEFB 5FXZA 4XBFB 4B6XA 5H6QB 1D0XA 2NW9A 1OWAA 2UXNB 3I9WA 2V7JA 3KDSE 3ZJ2A 5FMNA 3UT5E 4ZI3D 3LK42 4HTEA 3O1IA 2LE8A 4GYSA 4H9NC 2GK9A 2CXLA 2X9XA 3NBXX 2X9WA 3VU7H 3ANWA 2WM9A 2NW7A 4AQFC 2H7OA 3F31A 5E0OA 3OYZA 5HXRA 1VRBA 5HWXA 4PW8A 2BDEA 2WMOA 2EHOB 4YFSA 4CXXA 1WLXA 3CMLA 4JUYA 4EAHA 3RC3A 2QGSA 2LOSA 4DBQA 5JDLA 5HAXA 3N9PA 2ODUA 5C8YE 1MMGA 4HKAA 2PFVA 3N2GE 2KLQA 4H63V 2XHEB 4YJ2E 4AKRB 3UUXB 2KXPB 3CPZA 4PAGA 2JRKA 2MBGA 2HPJA 2W61A 5FY1A 3ZC1A 3NRYA 4CI1B 2XUEA 5A1LA 3B13A 4IE4A 2H3RA 3LK3B 3F2EA 4KUMB 4O2AE 3NZPA 1MMDA 2ES0A 4CI3B 4MLKA 5HXCA 5FXWA 4BJMA 2LHRA 4G63A 2NP9A 3DTOA 3ANWB 5LCYA 4CI2B 1YKEB 3PE0A 3K8PC 4AQGA 1OXZA 4MALA 3ZMVB 4EYUA 3MXZA 1US7B 4O2BE 2HH7A 3HR0A 3RRWA 1ZV4X 3UTKA 4UVBB 4AI6A 4I55E 4EYYR 5L3DB 3SWHA 5FNVE 4DMVA 5JVDE 3RYHE 3O9XA 2K9AA 1NAFA 1UX4A 3PU8A 4K0UA 3ESLA 3N2OA 4PK4A 2L8KA 3PUSA 3W15B 2ZM0A 1IAPA 5AFUL 5IYZE 5F8PA 3M65A 4UELA 4CQIA 4ZI7E 3OBVE 1UCUA 2DCFA 2HPLA 5KX5E 2MYSA 3MACA 4WNKA 2EHOC 5LXTE 1BR1A 3CWZB 4X20E 5EK3A 3U78A 2NOXA 3ZN0B 4MBQA 5L2LA 4H63H 4ZI2C 3QUJA 3RYFE 2LEHA 3WAKA 2M67A 3N9OA 2V7LA 4CXWA 3N9LA 4EB6E 4UVAB 3AAIA 3C4WA 4QX8B 3SS1A 1HX8A 4H9RC 4DMWA 2VKDA 1FMVA 2CMRA 2UXXB 1Y64B 1LVFA 3OKQA 2XTLA 3AB3B 3FB2A 5DJQC 4YHJA 4ANJA 2XAHB 4C91A 4GIWA 3I9YA 3HI2A 1BR0A 4L0RA 2LJLA 3MA9A 4UEMA 5HXEA 2RA1A 4AKIA 2BZBA 3FXEB 4U74A 4O8SA 3ZMTB 2VASA 2CXFA 1V9DA 3RKOA 3PUGA 3E08A 2MOZA 4BJNA 2N9DA 2BVMA 5FYMA 5JREA 2VKJA 2G0UA 2X9YA 3GN5A 4H9QC 4UVCB 2DWGA 4QXHB 2KZ7B 3SOLA 1SA0E 4I43B 4QHOA 4KMCA 3R84B 5M4YA 1MMAA 3A5XA 2OA5A 2LSKA 3KVAA 5JDQA 2PJQA 5TAOA 4EZHA 5HXHA 4DO0A 5FXVA 2L9QA 3KVBA 4GYRA 5L3FB 3J9X1 3CKDA 5FP3A 2DLRA 3CVRA 3MZKB 3C4ZA 3OYXA 4P0BA 4PJMA 2LSGA 4TUYE 1IZNB 2ZM2A 4QXCB 2H7VC 4DNDA 5IHYA 4A56A 4OK0A 2IAKA 4EIWA 3FHNA 2KMFA 5FXXA 1O3XA 3IEEA 1T98A 4BA9A 5CA0E 2VK9A 3CQXC 3H3AA 3DJBA 3PUQA 4GOUA 2KT9A 4HEAA 5EK2A 3IBPA 3NRXA 2LSIA 3GN5B 2LT3A 2Y8DA 5HXSA 2KINB 3QC9A 1FMWA 3B57A 5J2TE 3NZQA 5L3CB 3E22E 2CLYB 2WBLA 3VHLA 3CX6B 4ZI3C 4X1IE 1G8XA 2KWHA 3FXDB 4P0AA 2NWBA 4JEUB 4P09A 5KMGP 3QK6A 3N5LA 3RYCE 2LSJA 2W0GA 3C51A 4H9PC 3S4UA 4AKGA 3FBZA 3ZMZB 3ZPOA 5JDMA 1QSDA 4TZ4C 1KNZA 3U3IA 1HCIA 2X9HA 5LJMA 4I50E 3E0ZA 3SRZA 3BK9A 5DQWA 3L09A 3O1HA 4HN9A 1WYBA 5LYJE 3ZJ1A 3JC6D 2XAJB 4UF0A 3KV5A 5LP6E 5DQVA 5LBQB 1D1BA 2ZLYA 4HGAA 3GMIA 2X67A 2ODVA 5FY0A 4GK5E 1AJ3A 2C5IT 1X79A 2DI4A 3ZCJA 4L9IA 3GA8A 4C90A 3UFEA 4YJ3E 4XZCA 4U72A 2E9XD 2V26A 2XASB 4OFZA 5J2UE 5JDGA 4O4HE 2D5UA 3TKLB 2KWIB 4QKNA 4ZOLE 4PK5A 3V5SA 4ISTA 3HKDE 1D1AA 2CA5A 5JR9A 3C4XA 2JPFA 5LBMA 3LG7A 3WI3A 2W63A 4F6RC 5DABA 3RPUA 1MNDA 2LOPA 2V1DB 4FJOA 3RYIE 5JDHA 3AA1B 3T8OA 3MKDA 1B7TA 2Q9QD 3IF8B 2PBIA 2K48A 4ISSA 5JH7E 3HA4A 4G2AA 3KBUA 1H7CA 1MIWA 4MFRA 1HG5A 4H9SE 4PK6A 4UF0B 1FIOA 4ZS2A 5BMVE 2CLYC 3LFMA 2W00A 4KBMB 4DBRA 3P7IA 2A72A 2X0LB 1Z0PA 3HKBE 4O4JE 3WAJA 4CXYA 2NTXA 4YLHA 2NW8A 1MIVA 3RX6A 2C5KT 3O4XE 3AVSA 3HKEE 3K3OA 2C5JA 3LJCA 4V1Av 3AA6B 2IW5B 3L3PA 4X1KE 3LK2B 3VKHA 1YKHB 5LHIB 2Y48B 1NWMX 1D0YA 3RH3A 3EUHA 3V5UA 1LVKA 5LOVE 1YW0A 2P9BA 2MTQA 4QWNB 4X1YE 2WWUA 3R6NA 4TV8E 3AAAB 5JR9B 2V7IA 4OYJA 2X66A 3CQCB 2C0SA 3KFWX 4HE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM C;  4H9P C;  4H9O C;  4H9Q C;  4H9S E;  4HGA A;  4H9N C;  4H9R C; 
#chains in the Genus database with same CATH topology
 1G73 A;  1XDO A;  5HYA A;  2VWA A;  3QNU A;  3Q2M A;  2R6G F;  5LGU B;  4MHC A;  4NXM T;  1EZ3 A;  1D0Z A;  3P8C D;  1QLB A;  3EDV A;  2Q9Q A;  3OVU A;  4LFB T;  3VKG A;  2XQ5 A;  4AIS A;  2A3D A;  3ZT6 A;  2E8I A;  4CN1 A;  3T1H T;  2A9U A;  3UUN A;  4AQF A;  5EK4 A;  4DR6 T;  5FVK A;  2EHO D;  3J7Y q;  4PJN A;  2LM9 A;  5JR9 C;  4JYA T;  3K1S A;  2E5L T;  4PFP A;  4JBW F;  1MIY A;  4UIG A;  2DWK A;  2E5V A;  1HS7 A;  3D0T A;  2JIW A;  5JRC A;  4HFV A;  4U2Z A;  2DNX A;  2CXD A;  5GON E;  2IML A;  3PDY A;  2YU1 A;  1YD8 G;  4TWF A;  2IC9 A;  2WZI A;  2CWY A;  4AXP A;  4EOZ B;  2X0H A;  3C64 A;  4U7I A;  5LJN A;  1I6Z A;  2VL8 A;  2UU9 T;  3H37 A;  1UX5 A;  4WBN E;  4PNI A;  4O4I E;  3Q5X A;  1LRZ A;  4I0U A;  4UXN B;  2E9X C;  2YIN A;  3ONL C;  3C98 B;  2Z6E A;  3I0Q A;  4J2C A;  5FY7 A;  1KK7 A;  4DVD A;  4TNV A;  3ZEF B;  5FXZ A;  4A98 A;  2UXN B;  2H89 A;  3KDS E;  3UT5 E;  4HTE A;  2LE8 A;  4LF6 T;  4GYS A;  2GK9 A;  3NBX X;  3P4Q A;  5AQR B;  3ANW A;  3F31 A;  4NIQ A;  2BDE A;  2EHO B;  3UU3 A;  4DR7 T;  4OX9 T;  2LM2 A;  2LOS A;  3AE8 A;  4JI3 T;  5HAX A;  3RQU A;  2XHE B;  2V6X A;  2KXP B;  2JRK A;  1YQ3 A;  2LKG A;  2HPJ A;  2NR4 A;  4CI1 B;  2XUE A;  5A1L A;  3B13 A;  4MLK A;  2WS3 A;  2NP9 A;  3DTO A;  1YKE B;  4YHH T;  3K8P C;  3ZSS A;  5L4H A;  3EAB A;  5AQU B;  3ZMV B;  4EYU A;  3AXJ A;  1ZV4 X;  4UVB B;  4LML A;  2PTF A;  3ESL A;  3FZF B;  2ZM0 A;  1IAP A;  2RPA A;  5F8P A;  4ZI7 E;  4A5X A;  4CQI A;  2MYS A;  4WNK A;  3ZKR A;  1BR1 A;  4Z90 A;  4X20 E;  5EK3 A;  3U78 A;  5AQS B;  4MBQ A;  1IBM T;  3QB5 K;  4ZI2 C;  3RYF E;  2LEH A;  5C2T A;  3WAK A;  4KHP T;  3N9O A;  3N9L A;  1HNW T;  4EB6 E;  3P4R A;  2WP9 A;  2J4G A;  2VKD A;  1FMV A;  3FZM B;  3UQ7 A;  1LVF A;  2XTL A;  3FB2 A;  5AQF B;  4YHJ A;  4ANJ A;  2LJL A;  3MA9 A;  2OLT A;  5HXE A;  3AEG A;  2BZB A;  2CXF A;  4YSX A;  2N9D A;  5FYM A;  5IUX A;  2X9Y A;  2DWG A;  2KZ7 B;  1SA0 E;  3TLU A;  4KMC A;  5M4Y A;  1MMA A;  3A5X A;  2OA5 A;  2PJQ A;  5TAO A;  4EZH A;  2L9Q A;  2MAW A;  5L3F B;  3CKD A;  5FP3 A;  3MZK B;  3C4Z A;  3QB5 A;  4TUY E;  1IZN B;  5IHY A;  4EIW A;  2BG9 C;  1ZOY A;  3IEE A;  5CGM A;  3PUQ A;  5EK2 A;  2LRK A;  2LT3 A;  2V8S V;  4HWF A;  2BKO A;  4U2Y A;  5J2T E;  2CLY B;  3L39 A;  4X1I E;  2KWH A;  4P09 A;  3QK6 A;  5IWA T;  4H9P C;  3FBZ A;  5AQG B;  1WFD A;  3U3I A;  4I50 E;  5DQW A;  1UUR A;  3L09 A;  3JC6 D;  3KV5 A;  2FJB A;  3AE5 A;  4LF4 T;  2YN6 A;  4L9I A;  3GA8 A;  4XZC A;  3TKL B;  3V5S A;  3HKD E;  3CIR A;  3WI3 A;  5DAB A;  5JDH A;  3T8O A;  1B7T A;  2Q9Q D;  4IRE A;  5JH7 E;  2M6I A;  3RKG A;  3LFM A;  4JI1 T;  1HX1 B;  4CXY A;  2NTX A;  2NW8 A;  1MIV A;  4LMJ A;  3RX6 A;  4DV1 T;  4ILA A;  3K3O A;  2C5J A;  2YKS A;  4X1K E;  3T1Y T;  3LK2 B;  1YKH B;  3RH3 A;  5AQQ B;  3EUH A;  1LVK A;  1ZP0 A;  4TV8 E;  4OYJ A;  3AE4 A;  5AQM B;  3KFW X;  2E2A A;  5ADX L;  2VQE T;  3RQW A;  3BQI A;  2VKO A;  2WY2 A;  2CE7 A;  3RIU C;  2UXB T;  2K5B B;  1JNR A;  1D1C A;  3AE2 A;  2D0T A;  3ZLI A;  4JI2 T;  3ZCI A;  5KXJ A;  3CX8 B;  3UU6 A;  3NKZ A;  2LHN A;  2LSY A;  3C50 A;  3JAE A;  2V6Y B;  3L8R A;  2XAG B;  3PU3 A;  3ZYK A;  1XNR T;  3N9Q A;  3RHW A;  2WMN A;  4QH1 A;  3UUM A;  4IGU A;  5L3G B;  5C3J A;  2ACX A;  2L3L A;  3P4W A;  1L0V A;  5ABF A;  4FI5 A;  1CUN A;  2NTY A;  5LG3 A;  3ZYM A;  3AA7 B;  2JQQ A;  2V7M A;  4TV9 E;  2IIU A;  4IDQ A;  4M1P A;  3EHZ A;  3A7M A;  1Y01 A;  2JMK A;  4LF5 T;  4ERR A;  3KIN B;  4H9O C;  2B1E A;  2Q9Q B;  3KV4 A;  5HCJ A;  3LBX A;  2VL0 A;  1XWM A;  2WQY A;  3ETU A;  3N2K E;  5J1G A;  1ZKE A;  3RC8 A;  1XDP A;  2W2U A;  2XAQ B;  1KNR A;  4HFB A;  3AEA A;  2RP4 A;  3ZMS B;  2K24 A;  3AEF A;  3M3Z B;  2IUB A;  2A2F X;  3RRC A;  4E7S A;  5JRC B;  4DV3 T;  4IDZ A;  1IJ6 A;  1WYC A;  4YTN A;  3ONX A;  2CEA A;  5CFB A;  1XNQ T;  1MMN A;  5HWY A;  3BQL A;  2XY8 B;  2VUR A;  1N32 T;  4ZHQ E;  3ZMU B;  3BQK A;  2WDV A;  3ONJ A;  4IDO A;  4IE0 A;  4IE7 A;  5LHH B;  3I0O A;  2CHO A;  2YEV C;  4U7Y A;  3KBT A;  1OED A;  5H6Q B;  2NW9 A;  1OWA A;  4ZI3 D;  4H9N C;  2CXL A;  2X9W A;  3SFD A;  1NEK A;  3PUX F;  4PW8 A;  1T72 A;  3CML A;  4EAH A;  3RC3 A;  1JNZ A;  4NXN T;  3CK6 A;  3N9P A;  2ODU A;  4IL9 A;  4HKA A;  2PFV A;  4YJ2 E;  4HFI A;  4AKR B;  4PAG A;  2MBG A;  5FY1 A;  5ABG A;  3AE3 A;  4O2A E;  1MMD A;  5BR8 T;  5FXW A;  4JI0 T;  3ANW B;  4X5T A;  5LCY A;  3PE0 A;  2CBJ A;  2XSA A;  3MXZ A;  1US7 B;  3HR0 A;  4U3C A;  2K9A A;  3PU8 A;  2UUB T;  2L8K A;  2WWV A;  3W15 B;  5AQT B;  3M65 A;  1UCU A;  2DCF A;  5KX5 E;  3AE7 A;  2EHO C;  2M6B A;  3CWZ B;  1OED E;  2JQH A;  3ZN0 B;  5AQV B;  5L2L A;  3JAD A;  3AAI A;  3C4W A;  2IDO B;  3AXJ B;  3UU4 A;  2UXX B;  1Y64 B;  2WCA A;  5DJQ C;  1NEN A;  2UXC T;  3HI2 A;  1BR0 A;  4L0R A;  5AQL B;  4AKI A;  2XM1 A;  2HN2 A;  4LF8 T;  3PUG A;  4BJN A;  4DV2 T;  4H9Q C;  4UVC B;  1E7P A;  1CHU A;  4QHO A;  1R8I A;  2FBW A;  4KHZ F;  3AEC A;  4X62 T;  4IDP A;  3KVB A;  4HFC A;  3J9X 1;  4CN4 A;  1HNZ T;  3CVR A;  2ZM2 A;  2H7V C;  3ZT5 A;  2FJE A;  2IAK A;  2HN1 A;  2KMF A;  4BA9 A;  2VK9 A;  3CQX C;  4LFA T;  1XMQ T;  2LSI A;  4TWD A;  4HWI B;  5L3C B;  3E22 E;  1T7S A;  2WBL A;  2CPT A;  3FXD B;  4P0A A;  3PJA J;  2NWB A;  3S4U A;  1UUS A;  1QSD A;  2WU5 A;  1KNZ A;  5LJM A;  3E0Z A;  4Q25 A;  2XAJ B;  2HHH T;  4UF0 A;  5DQV A;  5LBQ B;  2ZLY A;  4HGA A;  1AJ3 A;  2DI4 A;  3VR8 A;  2V5C A;  1J5W A;  4YJ3 E;  4KI0 F;  4EV6 A;  1YQ4 A;  1N36 T;  1D1A A;  3AE1 A;  5JR9 A;  3LG7 A;  2W63 A;  4F6R C;  5LMN T;  1MND A;  4FJO A;  3RYI E;  2K48 A;  1I94 T;  4MFR A;  4YSY A;  1HG5 A;  4DR2 T;  4ZS2 A;  2CLY C;  3PJA A;  3P7I A;  2X0L B;  3HKB E;  4O4J E;  3WAJ A;  4U31 A;  2YDQ A;  2IW5 B;  4GKJ T;  4QH5 A;  2ZM6 T;  2P9B A;  2MPK A;  2MTQ A;  2WWU A;  3R6N A;  4EZ4 A;  3UUB A;  1HG2 A;  3VRB A;  3PUA A;  4GK0 E;  4Z8X A;  4TWH A;  4UV9 B;  1LKX A;  4XAX B;  5FKY A;  1WR0 A;  5EZY E;  2E9X A;  1VOM A;  3H3M A;  3K3Q C;  1S94 A;  2J1D G;  4OYK A;  1J1J A;  4KP3 C;  5HCM A;  4PJJ A;  2X68 A;  3X1D A;  4QX7 B;  1SUM B;  1SHZ C;  5AQJ B;  5AQK B;  2W62 A;  5HEO A;  1S35 A;  4O4L E;  4ILU A;  2X0Y A;  4JI8 T;  4UV8 B;  5ETW A;  3ZN1 B;  2BVL A;  3KV9 A;  3DP7 A;  3RIF A;  4ZZB A;  3P4P A;  5CA1 E;  3F57 A;  4IHJ E;  1WRD A;  3O1J A;  3FZH B;  3KV6 A;  3ZT7 A;  3B5M A;  4WBO A;  4B3T T;  3Q5W A;  1HTJ F;  2CM0 A;  4DR4 T;  5L3B B;  2ZMA A;  5L3E B;  1FEW A;  4I4T E;  4DUZ T;  3CX7 B;  3RLF F;  4LFC T;  3UQ4 A;  2YK0 A;  4TX5 A;  3GWH A;  4CZZ B;  2I59 A;  4IIJ E;  3UUL A;  5ABF B;  4JI4 T;  5HEG A;  2CBI A;  4DV7 T;  4LF9 T;  4AQY T;  3OJA A;  3ZST A;  5JQG E;  3MK7 C;  3ZYL A;  4ZS3 A;  2Y6X A;  4IE6 A;  2I0M A;  3JC6 C;  1YXR A;  3CQG B;  5F3J A;  2OV9 A;  4ILC A;  1BR4 A;  3N9N A;  1U4Q A;  1HF8 A;  2BS2 A;  1N34 T;  3AEE A;  2QVA A;  3LBX B;  2XQ3 A;  2XQ9 A;  1W9R A;  5LG4 A;  1WR6 A;  1W09 A;  2VB6 A;  4IE5 A;  4PJL A;  2DHR A;  3IHR A;  3K3N A;  1MNE A;  2N1G A;  2FJA A;  2QYW A;  2XQ4 A;  2JMH A;  2Q9Q C;  4XBF B;  2J47 A;  4DR3 T;  3TLS A;  3I9W A;  2V7J A;  3ZJ2 A;  4X64 T;  5FMN A;  5HEU A;  3LK4 2;  3O1I A;  4JI7 T;  2X9X A;  5AQH B;  3VU7 H;  4X65 T;  2NW7 A;  4AQF C;  5AQI B;  1W0B A;  3OYZ A;  5HXR A;  4JV5 T;  3RIA A;  4JUY A;  2CHN A;  2QGS A;  5JDL A;  4DBQ A;  5C8Y E;  2IHR 1;  2XQ8 A;  4HWC A;  2KLQ A;  2LKH A;  3QOF A;  3UUX B;  3CPZ A;  4JI5 T;  1OED B;  2W61 A;  3NRY A;  4COF A;  4K0K T;  4A97 A;  3NZP A;  4YXD A;  5HXC A;  2LHR A;  4G63 A;  2BG9 A;  3Q5E A;  2WU2 A;  4MAL A;  3UTK A;  4HWH A;  4U33 A;  4I55 E;  5L3D B;  2KSR A;  2XQA A;  5FNV E;  5JVD E;  3RYH E;  1NAF A;  4DUY T;  3N2O A;  4PK4 A;  2BS3 A;  3PUS A;  5AFU L;  5IYZ E;  4UEL A;  3OBV E;  5AQP B;  2VQF T;  3MAC A;  4P1N A;  2BKP A;  1N33 T;  1IBL T;  2V7L A;  1HX8 A;  3OPC A;  1X9B A;  4UR9 A;  4C91 A;  3I9Y A;  1T8B A;  3EI0 A;  4UEM A;  2RA1 A;  5L4E A;  3FXE B;  2BBJ A;  1V9D A;  3RKO A;  3E08 A;  3AE6 A;  4AIU A;  2XSB A;  2VKJ A;  3GN5 A;  4B3M T;  3SOL A;  1IBK T;  5LMU T;  2UXD T;  2K3W A;  5AQO B;  1WCR A;  2WDR A;  3KVA A;  5JDQ A;  5HXH A;  3A8Y C;  5FXV A;  2BG9 E;  4YY3 T;  4DR1 T;  3FHN A;  2XJ7 A;  1T98 A;  5CA0 E;  5HEH A;  3H3A A;  4GOU A;  2KT9 A;  4HEA A;  2VVN A;  3NRX A;  2KIN B;  1XMO T;  3QC9 A;  5J0Z A;  2WDQ A;  1FMW A;  3UFG A;  3RIU A;  3CX6 B;  4ZI3 C;  4JEU B;  4WYV A;  5KMG P;  1VCS A;  2LSJ A;  1VCT A;  4AKG A;  4WZX A;  4JI6 T;  5JDM A;  1HCI A;  4ILB A;  3AED A;  3SRZ A;  2LLY A;  5LYJ E;  1WYB A;  4EED A;  4CN6 A;  1D1B A;  3GMI A;  2X67 A;  4X66 T;  2ODV A;  4GK5 E;  2C5I T;  1X79 A;  4C90 A;  4QH4 A;  4U72 A;  2E9X D;  2V26 A;  2XAS B;  4OFZ A;  5J2U E;  2KWI B;  4QKN A;  2XPK A;  4ZOL E;  3LDQ B;  4EEB A;  3RPU A;  1KF6 A;  3AA1 B;  3MKD A;  3HA4 A;  4G2A A;  1HR0 T;  3KBU A;  1MIW A;  4H9S E;  4PK6 A;  4UF0 B;  1FIO A;  4HFE A;  3RGL A;  4KBM B;  3AVS A;  4HWD A;  3VR9 A;  4V1A v;  3VKH A;  2Y48 B;  4KX6 A;  1D0Y A;  1YW0 A;  2UUC T;  1M62 A;  3AAA B;  5JR9 B;  3CQC B;  2WZH A;  3FZL B;  2CWO A;  3EAM A;  4LMK A;  2XZE A;  4EGW A;  5L47 A;  2V7K A;  4WW0 A;  1HFA A;  2F4V T;  5FVL A;  2PG8 A;  4NPP A;  2D2S A;  4ADZ A;  3AA0 B;  4NUU A;  4TN7 B;  3Q9D A;  2QA7 A;  3UU8 A;  4ASK A;  4JEH B;  3N9M A;  2XAF B;  3MJX A;  2YU2 A;  5LA6 E;  5F5W A;  5JTG A;  2X51 A;  2W67 A;  3NWI A;  3FBL A;  3EVY A;  3HKC E;  4NUV A;  3IA3 A;  4QXB B;  1IJ5 A;  4DR5 T;  2SPC A;  5AQN B;  2N2N A;  2E9X B;  3PTR B;  5LHG B;  3AAE B;  5H6R B;  1DU2 A;  4HFH A;  2ZM8 A;  4OHF A;  4ZI2 D;  4AKH A;  3P4S A;  2VKH A;  4HFD A;  2D0U A;  4EXT A;  3PUV F;  5JDN A;  1M7K A;  1KNP A;  1UK5 A;  4GKK T;  5LGN B;  3AVR A;  4BAY B;  4JLE A;  1QUU A;  2CCQ A;  3TLT A;  5CJ5 A;  1E1H B;  2JJ9 A;  4N78 D;  3EDU A;  1ZEE A;  4L5G A;  2I6H A;  1E2A A;  2JQ9 A;  4PFO A;  4B3S T;  2KND A;  5JDF A;  2WSS V;  1ZHC A;  2WAU A;  1U5P A;  5LNK A;  4DV5 T;  2FJD A;  3ZC0 A;  2ACZ A;  3ETV A;  3HL6 A;  5CB4 E;  5LGT B;  2V5D A;  2XQ6 A;  4E7Z A;  2EHO A;  2FUP A;  5KDM C;  3I1A A;  3JAF A;  3VRA A;  4AKL A;  3OTO T;  2XQY A;  5HEJ A;  1BR2 A;  2IC6 A;  3PUR A;  1HNX T;  2UUA T;  4B6X A;  2W66 A;  1D0X A;  4F8H A;  1KFY A;  2WM9 A;  2LRL A;  2H7O A;  3PUW F;  5E0O A;  4LF7 T;  1VRB A;  5HWX A;  2J62 A;  5LB7 B;  2WMO A;  4YFS A;  4CXX A;  1WLX A;  1KEY A;  3PUY F;  1MMG A;  3N2G E;  3LSV A;  4H63 V;  4DV0 T;  3ZC1 A;  1W0A A;  2VVS A;  2YDS A;  2JQK A;  4IE4 A;  2H3R A;  3LK3 B;  3F2E A;  4KUM B;  3Q5D A;  2ES0 A;  4CI3 B;  4BJM A;  4CI2 B;  4AQG A;  1OXZ A;  4O2B E;  2HH7 A;  3RRW A;  2AE9 A;  4AI6 A;  4EYY R;  3SWH A;  2B76 A;  4DMV A;  3O9X A;  4YSZ A;  3AEB A;  1UX4 A;  4K0U A;  2HPL A;  2DL1 A;  4IDN A;  5LXT E;  2NOX A;  3RF1 A;  4H63 H;  3QUJ A;  2CRB A;  4YTM A;  2BG9 B;  2BS4 A;  2M67 A;  3FZK B;  4CXW A;  1OED C;  3RI5 A;  4UVA B;  4QX8 B;  3SS1 A;  4H9R C;  4DMW A;  4ZEY A;  2CMR A;  3OKQ A;  3AB3 B;  4TNW A;  2XAH B;  3PUZ F;  4GIW A;  2AXD S;  1J5E T;  3P50 A;  5FL0 A;  2BKN A;  4U74 A;  3ZMT B;  4O8S A;  2VAS A;  4ZXL A;  2MOZ A;  2BVM A;  5JRE A;  2G0U A;  4QXH B;  1Z8U A;  4I43 B;  4YTP A;  3R84 B;  2LSK A;  2XM2 A;  4DO0 A;  4GYR A;  2W4X A;  2DLR A;  4DV6 T;  3OYX A;  4P0B A;  4PJM A;  2LSG A;  3TLW A;  4QXC B;  4DND A;  4A56 A;  4OK0 A;  3UU5 A;  3ABV A;  5FXX A;  1O3X A;  3DJB A;  2YDR A;  3IBP A;  3GN5 B;  2Y8D A;  5HXS A;  1XZY A;  3B57 A;  3NZQ A;  3AE9 A;  3VHL A;  4Z91 A;  1G8X A;  2QRX A;  3RYC E;  3N5L A;  2W0G A;  4DV4 T;  3C51 A;  4DID B;  4IL4 A;  3ZMZ B;  3ZPO A;  3NVO A;  4TZ4 C;  2X9H A;  3TLV A;  4IT4 A;  3BK9 A;  4HN9 A;  3O1H A;  3ZJ1 A;  3SFE A;  5LP6 E;  5FL1 A;  2D9D A;  5FY0 A;  3ZCJ A;  2H88 A;  3UFE A;  1FJG T;  5JDG A;  4O4H E;  2D5U A;  5ABE A;  4PK5 A;  4IST A;  2BBH A;  2CA5 A;  2XQ7 A;  3C4X A;  2JPF A;  5LBM A;  2LOP A;  2V1D B;  3IF8 B;  2PBI A;  1UGO A;  4ISS A;  3PV0 F;  1H7C A;  5BMV E;  4ZZC A;  2W00 A;  4DBR A;  2A72 A;  1Z0P A;  5ABH A;  4YLH A;  3JCF A;  2YOE A;  2C5K T;  3O4X E;  3G06 A;  3HKE E;  4B3R T;  2WB5 A;  1SE7 A;  3LJC A;  3AA6 B;  3L3P A;  4YT0 A;  2V6Y A;  1GQE A;  5LHI B;  1NWM X;  3V5U A;  5LOV E;  4QWN B;  4X1Y E;  2V7I A;  2X66 A;  2C0S A;  4HE8 A; 
#chains in the Genus database with same CATH homology
 1G73 A;  5ADX L;  4EZ4 A;  1HG2 A;  3PUA A;  4GK0 E;  2CWO A;  4Z8X A;  3BQI A;  2VWA A;  2VKO A;  4UV9 B;  3Q2M A;  5HYA A;  1LKX A;  4XAX B;  2V7K A;  5EZY E;  2E9X A;  1VOM A;  1HFA A;  4WW0 A;  3K3Q C;  2CE7 A;  1S94 A;  2J1D G;  4OYK A;  5LGU B;  4MHC A;  2PG8 A;  4KP3 C;  4PJJ A;  1EZ3 A;  2D2S A;  2K5B B;  2X68 A;  1D0Z A;  4ADZ A;  1D1C A;  3AA0 B;  3P8C D;  4NUU A;  4TN7 B;  2D0T A;  3Q9D A;  3ZLI A;  2QA7 A;  4QX7 B;  4ASK A;  4JEH B;  3EDV A;  3ZCI A;  3N9M A;  2XAF B;  3CX8 B;  2LHN A;  1SHZ C;  3MJX A;  2LSY A;  2YU2 A;  3C50 A;  2W62 A;  5LA6 E;  2Q9Q A;  2X51 A;  2XAG B;  1S35 A;  3PU3 A;  4O4L E;  3ZYK A;  4ILU A;  3N9Q A;  3VKG A;  2WMN A;  3UUM A;  4IGU A;  4UV8 B;  5ETW A;  2A3D A;  3EVY A;  3FBL A;  2E8I A;  5L3G B;  3ZN1 B;  2ACX A;  2BVL A;  2L3L A;  3KV9 A;  3HKC E;  3DP7 A;  4NUV A;  3UUN A;  4FI5 A;  4AQF A;  4QXB B;  1IJ5 A;  5EK4 A;  2SPC A;  5CA1 E;  1CUN A;  2NTY A;  3F57 A;  4IHJ E;  1WRD A;  3O1J A;  2N2N A;  2E9X B;  3ZYM A;  2EHO D;  3PTR B;  5LHG B;  3J7Y q;  3AA7 B;  2JQQ A;  3KV6 A;  3AAE B;  2LM9 A;  2V7M A;  4PJN A;  5H6R B;  4TV9 E;  2ZM8 A;  5JR9 C;  4M1P A;  4WBO A;  4OHF A;  4ZI2 D;  4AKH A;  3Q5W A;  1HTJ F;  4PFP A;  2VKH A;  1MIY A;  2CM0 A;  2JMK A;  4UIG A;  2DWK A;  1HS7 A;  4ERR A;  5L3B B;  2D0U A;  2ZMA A;  3D0T A;  4EXT A;  1FEW A;  3KIN B;  5L3E B;  5JRC A;  4HFV A;  4I4T E;  4H9O C;  5JDN A;  2B1E A;  2Q9Q B;  3KV4 A;  3CX7 B;  2DNX A;  5LGN B;  3AVR A;  2CXD A;  5GON E;  3LBX A;  4BAY B;  3PDY A;  4JLE A;  2YU1 A;  1YD8 G;  2YK0 A;  3ETU A;  3N2K E;  5J1G A;  1QUU A;  2CCQ A;  4TX5 A;  2IC9 A;  3GWH A;  4CZZ B;  2I59 A;  4IIJ E;  3UUL A;  1ZKE A;  2CWY A;  4AXP A;  1E1H B;  3RC8 A;  2JJ9 A;  4N78 D;  3EDU A;  1ZEE A;  4L5G A;  4EOZ B;  2XAQ B;  3C64 A;  3OJA A;  5LJN A;  4PFO A;  5JQG E;  2KND A;  3MK7 C;  3ZYL A;  4ZS3 A;  2VL8 A;  2Y6X A;  5JDF A;  2WSS V;  4IE6 A;  1ZHC A;  2WAU A;  3H37 A;  1UX5 A;  4WBN E;  2RP4 A;  4PNI A;  3ZMS B;  3JC6 C;  2K24 A;  1U5P A;  4O4I E;  3Q5X A;  1LRZ A;  3CQG B;  5LNK A;  5F3J A;  2A2F X;  1BR4 A;  3N9N A;  3ZC0 A;  1U4Q A;  3ETV A;  3RRC A;  1HF8 A;  4E7S A;  5JRC B;  3HL6 A;  5CB4 E;  4UXN B;  5LGT B;  2E9X C;  4IDZ A;  1IJ6 A;  3LBX B;  2YIN A;  4E7Z A;  1WYC A;  2EHO A;  5KDM C;  3C98 B;  5LG4 A;  1WR6 A;  3I1A A;  3ONX A;  2CEA A;  2Z6E A;  3I0Q A;  1MMN A;  5HWY A;  4J2C A;  3BQL A;  4ZHQ E;  3ZMU B;  2VB6 A;  4IE5 A;  3BQK A;  4PJL A;  4IE0 A;  2DHR A;  5FY7 A;  4AKL A;  3IHR A;  3K3N A;  1KK7 A;  4IE7 A;  5LHH B;  2XQY A;  3I0O A;  1BR2 A;  1MNE A;  2YEV C;  4DVD A;  2IC6 A;  3KBT A;  3PUR A;  2N1G A;  2JMH A;  2Q9Q C;  3ZEF B;  5FXZ A;  4XBF B;  4B6X A;  5H6Q B;  1D0X A;  2NW9 A;  1OWA A;  2UXN B;  3I9W A;  2V7J A;  3KDS E;  3ZJ2 A;  5FMN A;  3UT5 E;  4ZI3 D;  3LK4 2;  4HTE A;  3O1I A;  2LE8 A;  4GYS A;  4H9N C;  2GK9 A;  2CXL A;  2X9X A;  3NBX X;  2X9W A;  3VU7 H;  3ANW A;  2WM9 A;  2NW7 A;  4AQF C;  2H7O A;  3F31 A;  5E0O A;  3OYZ A;  5HXR A;  1VRB A;  5HWX A;  4PW8 A;  2BDE A;  2WMO A;  2EHO B;  4YFS A;  4CXX A;  1WLX A;  3CML A;  4JUY A;  4EAH A;  3RC3 A;  2QGS A;  2LOS A;  4DBQ A;  5JDL A;  5HAX A;  3N9P A;  2ODU A;  5C8Y E;  1MMG A;  4HKA A;  2PFV A;  3N2G E;  2KLQ A;  4H63 V;  2XHE B;  4YJ2 E;  4AKR B;  3UUX B;  2KXP B;  3CPZ A;  4PAG A;  2JRK A;  2MBG A;  2HPJ A;  2W61 A;  5FY1 A;  3ZC1 A;  3NRY A;  4CI1 B;  2XUE A;  5A1L A;  3B13 A;  4IE4 A;  2H3R A;  3LK3 B;  3F2E A;  4KUM B;  4O2A E;  3NZP A;  1MMD A;  2ES0 A;  4CI3 B;  4MLK A;  5HXC A;  5FXW A;  4BJM A;  2LHR A;  4G63 A;  2NP9 A;  3DTO A;  3ANW B;  5LCY A;  4CI2 B;  1YKE B;  3PE0 A;  3K8P C;  4AQG A;  1OXZ A;  4MAL A;  3ZMV B;  4EYU A;  3MXZ A;  1US7 B;  4O2B E;  2HH7 A;  3HR0 A;  3RRW A;  1ZV4 X;  3UTK A;  4UVB B;  4AI6 A;  4I55 E;  4EYY R;  5L3D B;  3SWH A;  5FNV E;  4DMV A;  5JVD E;  3RYH E;  3O9X A;  2K9A A;  1NAF A;  1UX4 A;  3PU8 A;  4K0U A;  3ESL A;  3N2O A;  4PK4 A;  2L8K A;  3PUS A;  3W15 B;  2ZM0 A;  1IAP A;  5AFU L;  5IYZ E;  5F8P A;  3M65 A;  4UEL A;  4CQI A;  4ZI7 E;  3OBV E;  1UCU A;  2DCF A;  2HPL A;  5KX5 E;  2MYS A;  3MAC A;  4WNK A;  2EHO C;  5LXT E;  1BR1 A;  3CWZ B;  4X20 E;  5EK3 A;  3U78 A;  2NOX A;  3ZN0 B;  4MBQ A;  5L2L A;  4H63 H;  4ZI2 C;  3QUJ A;  3RYF E;  2LEH A;  3WAK A;  2M67 A;  3N9O A;  2V7L A;  4CXW A;  3N9L A;  4EB6 E;  4UVA B;  3AAI A;  3C4W A;  4QX8 B;  3SS1 A;  1HX8 A;  4H9R C;  4DMW A;  2VKD A;  1FMV A;  2CMR A;  2UXX B;  1Y64 B;  1LVF A;  3OKQ A;  2XTL A;  3AB3 B;  3FB2 A;  5DJQ C;  4YHJ A;  4ANJ A;  2XAH B;  4C91 A;  4GIW A;  3I9Y A;  3HI2 A;  1BR0 A;  4L0R A;  2LJL A;  3MA9 A;  4UEM A;  5HXE A;  2RA1 A;  4AKI A;  2BZB A;  3FXE B;  4U74 A;  4O8S A;  3ZMT B;  2VAS A;  2CXF A;  1V9D A;  3RKO A;  3PUG A;  3E08 A;  2MOZ A;  4BJN A;  2N9D A;  2BVM A;  5FYM A;  5JRE A;  2VKJ A;  2G0U A;  2X9Y A;  3GN5 A;  4H9Q C;  4UVC B;  2DWG A;  4QXH B;  2KZ7 B;  3SOL A;  1SA0 E;  4I43 B;  4QHO A;  4KMC A;  3R84 B;  5M4Y A;  1MMA A;  3A5X A;  2OA5 A;  2LSK A;  3KVA A;  5JDQ A;  2PJQ A;  5TAO A;  4EZH A;  5HXH A;  4DO0 A;  5FXV A;  2L9Q A;  3KVB A;  4GYR A;  5L3F B;  3J9X 1;  3CKD A;  5FP3 A;  2DLR A;  3CVR A;  3MZK B;  3C4Z A;  3OYX A;  4P0B A;  4PJM A;  2LSG A;  4TUY E;  1IZN B;  2ZM2 A;  4QXC B;  2H7V C;  4DND A;  5IHY A;  4A56 A;  4OK0 A;  2IAK A;  4EIW A;  3FHN A;  2KMF A;  5FXX A;  1O3X A;  3IEE A;  1T98 A;  4BA9 A;  5CA0 E;  2VK9 A;  3CQX C;  3H3A A;  3DJB A;  3PUQ A;  4GOU A;  2KT9 A;  4HEA A;  5EK2 A;  3IBP A;  3NRX A;  2LSI A;  3GN5 B;  2LT3 A;  2Y8D A;  5HXS A;  2KIN B;  3QC9 A;  1FMW A;  3B57 A;  5J2T E;  3NZQ A;  5L3C B;  3E22 E;  2CLY B;  2WBL A;  3VHL A;  3CX6 B;  4ZI3 C;  4X1I E;  1G8X A;  2KWH A;  3FXD B;  4P0A A;  2NWB A;  4JEU B;  4P09 A;  5KMG P;  3QK6 A;  3N5L A;  3RYC E;  2LSJ A;  2W0G A;  3C51 A;  4H9P C;  3S4U A;  4AKG A;  3FBZ A;  3ZMZ B;  3ZPO A;  5JDM A;  1QSD A;  4TZ4 C;  1KNZ A;  3U3I A;  1HCI A;  2X9H A;  5LJM A;  4I50 E;  3E0Z A;  3SRZ A;  3BK9 A;  5DQW A;  3L09 A;  3O1H A;  4HN9 A;  1WYB A;  5LYJ E;  3ZJ1 A;  3JC6 D;  2XAJ B;  4UF0 A;  3KV5 A;  5LP6 E;  5DQV A;  5LBQ B;  1D1B A;  2ZLY A;  4HGA A;  3GMI A;  2X67 A;  2ODV A;  5FY0 A;  4GK5 E;  1AJ3 A;  2C5I T;  1X79 A;  2DI4 A;  3ZCJ A;  4L9I A;  3GA8 A;  4C90 A;  3UFE A;  4YJ3 E;  4XZC A;  4U72 A;  2E9X D;  2V26 A;  2XAS B;  4OFZ A;  5J2U E;  5JDG A;  4O4H E;  2D5U A;  3TKL B;  2KWI B;  4QKN A;  4ZOL E;  4PK5 A;  3V5S A;  4IST A;  3HKD E;  1D1A A;  2CA5 A;  5JR9 A;  3C4X A;  2JPF A;  5LBM A;  3LG7 A;  3WI3 A;  2W63 A;  4F6R C;  5DAB A;  3RPU A;  1MND A;  2LOP A;  2V1D B;  4FJO A;  3RYI E;  5JDH A;  3AA1 B;  3T8O A;  3MKD A;  1B7T A;  2Q9Q D;  3IF8 B;  2PBI A;  2K48 A;  4ISS A;  5JH7 E;  3HA4 A;  4G2A A;  3KBU A;  1H7C A;  1MIW A;  4MFR A;  1HG5 A;  4H9S E;  4PK6 A;  4UF0 B;  1FIO A;  4ZS2 A;  5BMV E;  2CLY C;  3LFM A;  2W00 A;  4KBM B;  4DBR A;  3P7I A;  2A72 A;  2X0L B;  1Z0P A;  3HKB E;  4O4J E;  3WAJ A;  4CXY A;  2NTX A;  4YLH A;  2NW8 A;  1MIV A;  3RX6 A;  2C5K T;  3O4X E;  3AVS A;  3HKE E;  3K3O A;  2C5J A;  3LJC A;  4V1A v;  3AA6 B;  2IW5 B;  3L3P A;  4X1K E;  3LK2 B;  3VKH A;  1YKH B;  5LHI B;  2Y48 B;  1NWM X;  1D0Y A;  3RH3 A;  3EUH A;  3V5U A;  1LVK A;  5LOV E;  1YW0 A;  2P9B A;  2MTQ A;  4QWN B;  4X1Y E;  2WWU A;  3R6N A;  4TV8 E;  3AAA B;  5JR9 B;  2V7I A;  4OYJ A;  2X66 A;  3CQC B;  2C0S A;  3KFW X;  4HE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...