4H9PC

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 73
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9pC00
4H9PC 5KDMC 4H9RC 4H9NC 4H9OC 4H9QC 4HGAA 4H9SE
chains in the Genus database with same CATH superfamily
1QUUA 2Q9QD 2LE8A 4U74A 2WWUA 3EI0A 2VQET 2VL8A 4G63A 2AXDS 2HPLA 4DIDB 2BG9E 4AKIA 2UXBT 3KV6A 4OK0A 3CX7B 3TLVA 4LF4T 4IL4A 1IJ6A 1MMAA 5L3CB 4GYSA 4ZI3D 2ZMAA 5AQPB 2CPTA 4DV7T 4ZZBA 3RIUA 3VKHA 4AQYT 4E7ZA 1V9DA 1LVKA 1MMDA 4DO0A 1HG5A 2NOXA 3KINB 4I4TE 3HKDE 2XTLA 4LFCT 2BVMA 3CQCB 2V7LA 3NKZA 4UV8B 3MKDA 3HI2A 3FZKB 4X62T 1WFDA 2KWHA 4OYJA 3O1IA 2H7OA 3E22E 3VKGA 3AE9A 2QRXA 5FY1A 2VK9A 3AA6B 3AXJA 5JR9B 3GN5A 2DWKA 2CBJA 4EEDA 4OFZA 2VB6A 4U72A 3P4RA 5AQHB 3ESLA 4DR3T 4LF9T 1BR1A 4JI3T 4H9NC 4AKHA 3TLTA 3WAKA 3CMLA 4U3CA 4JI5T 2C5IT 5HEUA 1IZNB 4MALA 4WW0A 2LOPA 4HFVA 5HEJA 2H3RA 3AEDA 5KX5E 2WP9A 5J2UE 4YSXA 5F5WA 2XQYA 3MA9A 1S94A 1VCTA 5L3GB 3ZMTB 3QUJA 2RP4A 1KNZA 5JDHA 3IEEA 3NBXX 2YDQA 3TLWA 1YW0A 2D9DA 4X1KE 1UCUA 4CI2B 1D1CA 1SHZC 2XJ7A 1T72A 3KVAA 3NZPA 4L9IA 5DJQC 3LSVA 2HPJA 5AQJB 3GA8A 4ILAA 3PTRB 5AFUL 4DR1T 1XDPA 4DR4T 5JR9A 5M4YA 5HEGA 3LFMA 5AQVB 2L8KA 2LEHA 3RYHE 3RPUA 4X20E 3RX6A 5LG3A 2WSSV 4TNWA 5FNVE 2E9XB 1U4QA 2K48A 3LG7A 4XBFB 5JRCB 4YXDA 2X0HA 2WQYA 2UU9T 1O3XA 2WAUA 3EDUA 2DNXA 4N78D 4LF8T 3CQXC 1R8IA 3OTOT 2ES0A 4IE0A 2LM9A 1IJ5A 5JDQA 2QVAA 2WZIA 4HFHA 3F57A 5AQMB 2CCQA 5FYMA 4B3MT 5DQWA 5HEOA 1CUNA 1OEDC 4ZHQE 2P9BA 2WB5A 2J4GA 3JC6D 3K3OA 4GKJT 4ILCA 4MLKA 1HCIA 1SA0E 5CFBA 1U5PA 4PJMA 1UX5A 3KV5A 4DUYT 2ZM8A 4DV6T 4AKGA 4O4LE 4TV8E 4AQFC 4KMCA 4TX5A 1LVFA 2JQ9A 4LFBT 2E9XA 1ZHCA 3SFDA 2E5LT 3CWZB 3L09A 5JRCA 2DI4A 1UK5A 2ACXA 2KWIB 2K9AA 2NTXA 4X1IE 4EGWA 1W0AA 2V5DA 2VKDA 2W0GA 1N32T 4K0UA 4BJMA 5LOVE 4PW8A 1SE7A 4DR6T 4WBOA 3KV9A 5CGMA 3ONXA 1NEKA 2KXPB 3ANWB 2J47A 2CXDA 5EK3A 1HX8A 2X66A 3ZYLA 2X9WA 3FZLB 4HFIA 1XMQT 4TZ4C 5AQLB 2A2FX 2E9XD 3RYCE 3BQIA 1W9RA 2FUPA 3RC8A 3UU4A 1FMWA 2IDOB 1VRBA 4TV9E 4F8HA 5A1LA 2LSGA 3C64A 1HNWT 3DJBA 4NUUA 4JI2T 4B3TT 2XM1A 4PJNA 5HXCA 3QK6A 1HS7A 4U31A 4JI0T 3AB3B 5C2TA 1J5ET 1WYCA 3ETUA 2DL1A 3MZKB 3PV0F 2YKSA 3PUSA 5AQNB 2XQAA 5LMUT 2CWOA 5J2TE 4O4IE 4B3RT 3PUAA 4IIJE 5HCJA 3UU5A 1US7B 2ZM6T 2JPFA 4NXMT 4HGAA 2ZM2A 3JC6C 4YTMA 2LRLA 2W63A 3ANWA 1UURA 1G8XA 5DABA 2OV9A 2LHRA 2Q9QB 5L47A 2X51A 4Z8XA 1YKHB 4IE4A 2LSIA 4YJ2E 3Q5EA 1HR0T 1MIVA 3KBTA 3UU6A 3U78A 1W0BA 4IDZA 4H63H 3WAJA 3N9PA 2ZM0A 4LF5T 2YN6A 2IAKA 3MJXA 2I6HA 2CRBA 3O1JA 4PJJA 3ZN0B 3UUBA 3BK9A 4EYUA 4EV6A 4GK5E 5JH7E 2A72A 4KP3C 1FIOA 5EZYE 4P0BA 4CXYA 3ZN1B 5ABFA 5HXRA 4HWIB 2CHOA 4JEUB 4IE6A 3ZCJA 4X64T 2W00A 4I43B 3CVRA 1D1BA 3ZSSA 2X67A 2GK9A 2Y48B 4IHJE 5BR8T 2M67A 3LDQB 1OEDB 2YU2A 5IHYA 5JTGA 2H88A 3ZJ2A 5LHIB 3RLFF 3VR8A 2DLRA 2X9XA 4K0KT 3CX8B 2XQ8A 3Q9DA 3CX6B 2CWYA 1WRDA 2KMFA 3J7Yq 1OWAA 2X68A 1FJGT 3C51A 1YQ3A 4V1Av 3ZMVB 5LBQB 2A9UA 2XSBA 3GWHA 2HH7A 3RRWA 3M65A 1I94T 3UT5E 3N9QA 2D0TA 1FMVA 2LSYA 5AQSB 2JQQA 3A7MA 3OBVE 5IWAT 3P4QA 4IDOA 3IA3A 1XWMA 2YINA 3I0QA 3RYFE 4L0RA 5AQOB 4OYKA 4HN9A 4HFEA 2XAFB 1MNDA 3UQ7A 3EHZA 2PTFA 2XSAA 5F8PA 5LJNA 4QH5A 2FJDA 4DMVA 2N1GA 2NTYA 2LRKA 3FZFB 3QNUA 1OEDA 3NRYA 4UIGA 2NP9A 3V5UA 4LMKA 4H9OC 3ZJ1A 2UUAT 2WMOA 2CE7A 3ZT7A 3HKEE 1Y01A 4QXBB 3ZEFB 2NW7A 2WZHA 5JQGE 4Z91A 4Z90A 4O8SA 4AQFA 4XAXB 2IC9A 2XASB 2D2SA 4PAGA 3FBZA 2PBIA 5L4EA 2HHHT 3IF8B 2D5UA 4TWHA 1WCRA 3R84B 5LP6E 3I1AA 4UVCB 1D0XA 3AEFA 3SWHA 3P50A 3FB2A 4X66T 3DP7A 4DV5T 2V6XA 5ABEA 1W09A 2G0UA 3H3AA 1ZV4X 4TUYE 4CI3B 2XAJB 4P0AA 2MTQA 4LF6T 3TLSA 4JEHB 4JI8T 2QYWA 3R6NA 3P8CD 3I9YA 3HL6A 4E7SA 3C98B 2LSKA 3JADA 3UFGA 1H7CA 3RGLA 3PUQA 1E7PA 3RQWA 2FJEA 5LJMA 2WS3A 2XQ4A 4LMLA 5HAXA 3P4SA 4EZ4A 2WU5A 4UXNB 1J1JA 4PFPA 4AQGA 1E2AA 4PK4A 3F31A 4UF0B 2ODUA 3FZMB 3LK3B 4B3ST 5FY0A 5HXSA 4ZS3A 3CKDA 3LJCA 3ZSTA 3QOFA 2D0UA 4CXWA 2WU2A 1KNPA 3I9WA 5KDMC 3L39A 1KK7A 3C50A 3OYZA 2VASA 5LHGB 4UV9B 3BQKA 3UULA 3U3IA 1Z0PA 2C5JA 4O4JE 4CN4A 2N2NA 2PG8A 3TKLB 4QWNB 3RI5A 4DV1T 3VU7H 2BKPA 3AE1A 3OPCA 5CJ5A 4YT0A 2XQ9A 3K3QC 4JUYA 3IHRA 3OJAA 1HTJF 3Q2MA 1IAPA 2BKNA 3T1HT 1KNRA 2XUEA 4IDQA 3MXZA 3AECA 2W2UA 5LYJE 4CN1A 4U33A 1T8BA 4NPPA 3B13A 2M6IA 4QXHB 2V7IA 4L5GA 4UF0A 4HWCA 1WYBA 3AE5A 4MBQA 4EZHA 2KZ7B 2CMRA 3EDVA 3PE0A 2BG9C 3BQLA 3QB5A 2UXDT 3AE4A 1UGOA 4O4HE 3SOLA 2WY2A 2VWAA 5DQVA 4YTPA 4YSZA 3KFWX 4IL9A 5HWYA 4U2ZA 2NW9A 2BBHA 4UVBB 4MFRA 5C8YE 4EYYR 3RF1A 4JI6T 1D1AA 2YOEA 3NZQA 3K3NA 3F2EA 3K8PC 4KI0F 4TWDA 3RQUA 3RH3A 4A98A 2VKOA 2OLTA 2LT3A 4UR9A 2W67A 4DR5T 4IGUA 3HKCE 3MK7C 1T98A 3UU8A 2XY8B 5E0OA 4IDPA 4JI7T 2WM9A 3Q5DA 4LF7T 1JNRA 5L4HA 2EHOC 3UQ4A 4I50E 3C4ZA 1ZKEA 2FJBA 5AQTB 2XQ5A 4IE5A 1YD8G 3KBUA 3ZPOA 3ONJA 3GMIA 3UUNA 1WR0A 5LG4A 3N2GE 4ADZA 4IREA 2X0YA 2JMHA 2V1DB 4EAHA 3S4UA 2J1DG 1CHUA 5AQKB 4H63V 2KINB 5ABFB 4KX6A 2PFVA 1FEWA 2Y6XA 1IBMT 3P7IA 1ZP0A 4P1NA 5ABGA 4U2YA 2X9HA 4HFBA 5HCMA 1SUMB 2YU1A 4CZZB 2YDRA 2V7KA 3Q5WA 3A8YC 1XZYA 3E08A 3AE2A 2X0LB 4DR7T 5LGNB 2L3LA 3JCFA 3O4XE 2W4XA 3PDYA 1D0YA 4H9QC 2BS2A 3SFEA 3RYIE 4X65T 2IW5B 4CXXA 4X1YE 1S35A 3VHLA 3PU3A 4HFCA 3EAMA 4ZI2C 4ZEYA 4H9RC 3KVBA 5HWXA 2V26A 2VKHA 5F3JA 4ISSA 3L3PA 5FXZA 2KNDA 2E2AA 3AA1B 3L8RA 2PJQA 3JAEA 3PJAA 2BBJA 2QGSA 4YTNA 3RRCA 2XM2A 2XQ7A 5H6QB 2KSRA 3AVRA 2WDVA 2HN1A 4MHCA 3OYXA 5LA6E 4GYRA 4WNKA 1G73A 3FXDB 4AISA 3PUZF 4HEAA 2K5BB 1XDOA 2WBLA 5LGTB 3Q5XA 2BG9B 2JQHA 5BMVE 3N9LA 1E1HB 3O1HA 4A56A 5JDFA 2W66A 2HN2A 4AXPA 4QH1A 4ZI7E 1OEDE 3QC9A 1YXRA 5FY7A 4H9SE 1D0ZA 5KMGP 1X9BA 1IBKT 2JJ9A 5IYZE 1NAFA 3KDSE 4AIUA 2XAHB 2H7VC 3PURA 5LB7B 3N5LA 4ZXLA 2MOZA 3AA0B 1HG2A 4G2AA 3LK42 1MIYA 2DCFA 5LHHB 1HF8A 4WZXA 2XHEB 2YDSA 4PJLA 1LRZA 3CK6A 2WDRA 4EOZB 1HNXT 1XNRT 5JVDE 1XMOT 5LCYA 2W62A 1HFAA 2CEAA 1J5WA 1MMNA 4JBWF 3UFEA 3UTKA 5GONE 2XAQB 3PUGA 2MBGA 2EHOB 5FVKA 5AQGB 3ZMUB 3VR9A 4C90A 3N2KE 2NW8A 2XPKA 2IIUA 5LMNT 2LJLA 3CIRA 2LM2A 1MMGA 4JI4T 3UUMA 3AE7A 2BG9A 1M62A 4KBMB 3ONLC 4DV4T 3NRXA 1Y64B 5JDMA 3ZLIA 1N33T 2CHNA 4AKLA 5FVLA 5AQFB 2IMLA 5L2LA 5L3EB 2VKJA 4NXNT 5JREA 1QLBA 3SRZA 2Z6EA 2CXLA 5LBMA 3VRBA 3AEAA 2DWGA 2Y8DA 4M1PA 2CXFA 4NIQA 2YK0A 2BKOA 2FJAA 3SS1A 3C4WA 2VL0A 3NWIA 3PUXF 3LBXB 2MYSA 2WCAA 4WYVA 2VVSA 5FXVA 3ZMZB 4QX8B 5L3FB 2E5VA 5AQIB 4A5XA 4P09A 3DTOA 5JDLA 5FMNA 3EVYA 1KF6A 5H6RB 4XZCA 5LNKA 4LMJA 3AAEB 4OHFA 1XNQT 4ILBA 2JMKA 3UU3A 1WR6A 3FBLA 4EEBA 2EHOA 2QA7A 4DV3T 3AEEA 4YY3T 3HA4A 5HYAA 1T7SA 1YKEB 4IDNA 2YEVC 2XQ6A 1QSDA 2KT9A 3AEBA 4KHZF 4QKNA 2UXNB 4ASKA 3VRAA 2I0MA 3T8OA 3WI3A 4ZOLE 3N9OA 2B76A 1BR0A 1M7KA 3ZT6A 3E0ZA 1WLXA 2V5CA 4CQIA 4DMWA 3AA7B 2Q9QC 3ZMSB 2KLQA 4HTEA 5ADXL 4YLHA 3OKQA 5FL0A 3AAAB 3AE6A 4GKKT 2EHOD 3P4WA 4HWHA 3M3ZB 2WDQA 3LBXA 3FZHB 2CLYC 2ACZA 4ZI3C 2BDEA 2NR4A 1L0VA 2X9YA 5TAOA 2VVNA 3I0OA 3PUYF 2N9DA 3ZYMA 2XZEA 4ERRA 4PK5A 4UELA 4HE8A 5JDNA 4TN7B 4DV0T 5FXXA 4C91A 3AEGA 5J0ZA 4WBNE 4PK6A 4U7YA 3RHWA 2UUCT 4QHOA 4NUVA 3A5XA 4CI1B 4YJ3E 3RIUC 4CN6A 3ZKRA 5CA0E 5CA1E 1IBLT 4ZS2A 1UUSA 4IT4A 3RIAA 2LLYA 2LOSA 4PNIA 4HWFA 4ANJA 4FJOA 3ZC1A 1ZOYA 2LKGA 2B1EA 3RKOA 3AE8A 1HX1B 2MAWA 4EIWA 3P4PA 4YHJA 3N2OA 3N9NA 5HXHA 3PUWF 4ISTA 1I6ZA 4ZI2D 4J2CA 4B6XA 5HXEA 3H3MA 5HEHA 4BA9A 2IC6A 4Q25A 3CPZA 4GOUA 3NVOA 4ZZCA 1ZEEA 3B57A 4YHHT 2M6BA 3N9MA 5ETWA 3MACA 3ZT5A 3V5SA 5ABHA 4BAYB 2IHR1 1N34T 3W15B 3AE3A 2IUBA 4H9PC 4KHPT 3H37A 2LKHA 1AJ3A 4UVAB 3OVUA 4IE7A 1HNZT 3ZYKA 4COFA 2ZLYA 2WWVA 4UEMA 4U7IA 4HWDA 4JI1T 2WMNA 2F4VT 3FHNA 4EB6E 4JV5T 2LSJA 4TWFA 3RC3A 3AVSA 5L3BB 3D0TA 3ZC0A 1KEYA 4O2AE 2V8SV 2CM0A 5J1GA 4ILUA 4DV2T 4A97A 2MPKA 2K3WA 5FL1A 5EK4A 2JIWA 2L9QA 4QH4A 5JR9C 4JYAT 2JRKA 3EUHA 1DU2A 2DHRA 4DR2T 5AQUB 3EABA 3C4XA 1KFYA 2H89A 2RA1A 3T1YT 5IUXA 2VURA 2BS3A 3PJAJ 4KUMB 4FI5A 1MIWA 2V6YB 3TLUA 2RPAA 2UUBT 2XQ3A 4AKRB 1Z8UA 3RKGA 2R6GF 3QB5K 2SPCA 4YSYA 2I59A 4OX9T 2V7JA 2CLYB 3HKBE 5LGUB 4PFOA 3CQGB 3PU8A 3JAFA 4LFAT 2UXCT 4X5TA 2E8IA 4I0UA 4QXCB 3IBPA 2K24A 1GQEA 2CA5A 4GK0E 1VCSA 4F6RC 1N36T 3HR0A 4YFSA 1UX4A 3AAIA 1OXZA 5FP3A 1NENA 2BZBA 1B7TA 2A3DA 3G06A 2AE9A 4JLEA 3ZCIA 5C3JA 4HFDA 1X79A 3O9XA 2J62A 2UXXB 4QX7B 3UUXB 2LHNA 5EK2A 4BJNA 4TNVA 1EZ3A 2XAGB 2JQKA 1LKXA 2ODVA 3X1DA 3K1SA 4HKAA 2E9XC 2V7MA 5CB4E 4O2BE 5KXJA 3PUVF 3B5MA 2C0SA 5L3DB 5FXWA 1BR4A 2W61A 4AI6A 4DNDA 2BS4A 4DUZT 2Q9QA 2V6YA 2FBWA 4DBQA 4EXTA 1YQ4A 5AQRB 2CBIA 3ETVA 5JDGA 3ABVA 4DBRA 5AQQB 5FKYA 1VOMA 1NWMX 2OA5A 2VQFT 1MNEA 3RIFA 2NWBA 5LXTE 4DVDA 4I55E 3LK2B 3FXEB 1JNZA 2BVLA 3J9X1 1BR2A 2C5KT 3AXJB 3KV4A 4GIWA 3GN5B
chains in the Genus database with same CATH topology
1QUUA 2LSIA 2Q9QD 2LE8A 3KFWX 1QSDA 2WWUA 4U74A 4YJ2E 2KT9A 2VL8A 5HWYA 1MIVA 4G63A 4QKNA 3KBTA 2NW9A 2UXNB 4ASKA 2HPLA 3T8OA 4AKIA 4UVBB 4MFRA 3WI3A 3KV6A 4OK0A 4ZOLE 3N9OA 3U78A 3CX7B 1BR0A 5C8YE 4EYYR 3E0ZA 1WLXA 4IDZA 4H63H 3WAJA 1IJ6A 4CQIA 1D1AA 1MMAA 3N9PA 2ZM0A 4DMWA 3NZQA 5L3CB 4GYSA 4ZI3D 3K3NA 3AA7B 2Q9QC 3F2EA 2ZMAA 3K8PC 2IAKA 3ZMSB 2KLQA 3MJXA 4HTEA 3RH3A 5ADXL 4YLHA 2VKOA 3OKQA 3VKHA 4E7ZA 3AAAB 1V9DA 1LVKA 2LT3A 3O1JA 2EHOD 4PJJA 3ZN0B 3LBXA 1MMDA 4IGUA 4DO0A 1HG5A 2CLYC 3HKCE 2NOXA 3MK7C 3KINB 3BK9A 4EYUA 1T98A 4ZI3C 2BDEA 4GK5E 4I4TE 3HKDE 4GIWA 5JH7E 2A72A 2XTLA 2X9YA 5E0OA 4KP3C 5TAOA 2WM9A 1FIOA 5EZYE 2BVMA 3CQCB 4P0BA 3I0OA 2V7LA 4CXYA 2EHOC 3ZN1B 2N9DA 4UV8B 5HXRA 3MKDA 3ZYMA 4JEUB 4I50E 4IE6A 3C4ZA 3HI2A 1ZKEA 4ERRA 3ZCJA 4PK5A 4UELA 4HE8A 5JDNA 4IE5A 2W00A 1YD8G 2KWHA 4OYJA 4I43B 3CVRA 4TN7B 1D1BA 3KBUA 3O1IA 2X67A 2H7OA 2GK9A 5FXXA 4C91A 3ZPOA 3E22E 3VKGA 3GMIA 2Y48B 3UUNA 4IHJE 4WBNE 2M67A 5LG4A 4PK6A 3N2GE 2YU2A 5IHYA 4ADZA 5FY1A 2VK9A 3AA6B 5JR9B 3GN5A 2DWKA 2JMHA 2V1DB 4EAHA 3S4UA 3ZJ2A 5LHIB 4OFZA 4QHOA 2J1DG 2DLRA 2VB6A 4U72A 2X9XA 4NUVA 3ESLA 3A5XA 3CX8B 4CI1B 1BR1A 4H63V 3Q9DA 4H9NC 3CX6B 2CWYA 4YJ3E 4AKHA 1WRDA 3WAKA 2KINB 3CMLA 2KMFA 5CA0E 3J7Yq 1OWAA 2PFVA 2X68A 3C51A 2C5IT 1FEWA 5CA1E 2Y6XA 3P7IA 4ZS2A 1IZNB 4MALA 4WW0A 2LOPA 4V1Av 3ZMVB 5LBQB 4HFVA 2X9HA 2H3RA 2YU1A 4CZZB 2LOSA 3GWHA 2HH7A 3RRWA 4PNIA 3M65A 4ANJA 5KX5E 5J2UE 4FJOA 2V7KA 3UT5E 3ZC1A 3Q5WA 2XQYA 3MA9A 3N9QA 2D0TA 1FMVA 2B1EA 2LSYA 3RKOA 3E08A 2JQQA 4EIWA 2X0LB 1S94A 5L3GB 3ZMTB 3QUJA 2RP4A 1KNZA 3OBVE 4YHJA 5LGNB 2L3LA 5JDHA 3N2OA 3N9NA 3O4XE 3I0QA 2YINA 3IEEA 3NBXX 3RYFE 5HXHA 4L0RA 1YW0A 4X1KE 1UCUA 4OYKA 4HN9A 4ISTA 4CI2B 4ZI2D 1D1CA 3PDYA 1SHZC 2XAFB 1MNDA 4J2CA 4B6XA 5HXEA 1D0YA 3KVAA 3NZPA 4L9IA 4H9QC 4BA9A 5DJQC 3RYIE 2IC6A 5F8PA 3CPZA 4GOUA 5LJNA 2HPJA 2IW5B 4CXXA 4X1YE 1S35A 4DMVA 2N1GA 3PU3A 2NTYA 3VHLA 3GA8A 3PTRB 1ZEEA 5AFUL 3B57A 3NRYA 4UIGA 2NP9A 3N9MA 5ETWA 4ZI2C 3MACA 3V5UA 5JR9A 3V5SA 4H9RC 5M4YA 4H9OC 3ZJ1A 3LFMA 2WMOA 2CE7A 4BAYB 3KVBA 3HKEE 2L8KA 2LEHA 4QXBB 3RYHE 3ZEFB 5HWXA 3W15B 3RPUA 2V26A 4X20E 2NW7A 2VKHA 3RX6A 5F3JA 4ISSA 2WSSV 3L3PA 4H9PC 5FXZA 5JQGE 3H37A 5FNVE 2E9XB 2KNDA 1U4QA 1AJ3A 4O8SA 4UVAB 4IE7A 4AQFA 3AA1B 2PJQA 3ZYKA 2K48A 3LG7A 4XAXB 4XBFB 5JRCB 2ZLYA 2IC9A 2XASB 4UEMA 2D2SA 4PAGA 2QGSA 3FBZA 2PBIA 3IF8B 1O3XA 2D5UA 2WMNA 2WAUA 3FHNA 3EDUA 2DNXA 3RRCA 4EB6E 4N78D 5H6QB 3R84B 5LP6E 3I1AA 3AVRA 2LSJA 4UVCB 1D0XA 3SWHA 3CQXC 4MHCA 3OYXA 3RC3A 3FB2A 5LA6E 3AVSA 4GYRA 3DP7A 5L3BB 2ES0A 4WNKA 4IE0A 3D0TA 2LM9A 3ZC0A 1IJ5A 1G73A 4O2AE 5JDQA 3FXDB 2CM0A 3F57A 4HEAA 2CCQA 5J1GA 2K5BB 5FYMA 4ILUA 2G0UA 2WBLA 5DQWA 5LGTB 3Q5XA 3H3AA 1CUNA 4ZHQE 1ZV4X 4TUYE 5EK4A 2P9BA 2L9QA 4CI3B 3N9LA 5BMVE 3JC6D 5JR9C 2XAJB 4P0AA 1E1HB 2MTQA 3K3OA 4MLKA 1HCIA 1SA0E 2JRKA 3O1HA 1U5PA 4PJMA 4JEHB 4A56A 5JDFA 3EUHA 1UX5A 3KV5A 2ZM8A 4AKGA 4AXPA 2DHRA 4ZI7E 3R6NA 3QC9A 3P8CD 5FY7A 4O4LE 3I9YA 4H9SE 3HL6A 1D0ZA 5KMGP 4TV8E 4AQFC 3C4XA 4E7SA 3C98B 2JJ9A 5IYZE 2LSKA 4KMCA 1NAFA 2RA1A 4TX5A 3KDSE 1H7CA 3PUQA 2XAHB 1LVFA 2H7VC 3PURA 3N5LA 4KUMB 4FI5A 1MIWA 2MOZA 3AA0B 1HG2A 4G2AA 5LJMA 2E9XA 3LK42 5HAXA 1MIYA 1ZHCA 2DCFA 4EZ4A 4AKRB 5LHHB 1HF8A 3CWZB 3L09A 4UXNB 5JRCA 2DI4A 2XHEB 4PJLA 1LRZA 2ACXA 2KWIB 2SPCA 4PFPA 4AQGA 4EOZB 2I59A 2K9AA 2NTXA 4X1IE 5JVDE 5LCYA 2V7JA 2CLYB 3HKBE 2VKDA 2W0GA 2W62A 4PFOA 4PK4A 3CQGB 3PU8A 4K0UA 5LGUB 1HFAA 3F31A 4BJMA 2CEAA 5LOVE 4PW8A 4UF0B 2E8IA 2ODUA 3LK3B 4QXCB 1MMNA 3IBPA 2K24A 4WBOA 2CA5A 4GK0E 5FY0A 4F6RC 5HXSA 3KV9A 3UFEA 3UTKA 5GONE 2XAQB 4ZS3A 3ONXA 3CKDA 3LJCA 3PUGA 2MBGA 3HR0A 2EHOB 4YFSA 1UX4A 3AAIA 2KXPB 3ANWB 3ZMUB 4C90A 2CXDA 3N2KE 2D0UA 2NW8A 1HX8A 5EK3A 4CXWA 2X66A 1OXZA 3I9WA 5KDMC 3ZYLA 5FP3A 2X9WA 2BZBA 1B7TA 1KK7A 2LJLA 3C50A 3OYZA 4TZ4C 2A2FX 2A3DA 1MMGA 3UUMA 2VASA 4JLEA 5LHGB 2E9XD 4UV9B 3RYCE 3ZCIA 4KBMB 3BQIA 1X79A 3BQKA 3NRXA 3U3IA 1Y64B 3UULA 5JDMA 3O9XA 2UXXB 4QX7B 3ZLIA 1Z0PA 3UUXB 2LHNA 2C5JA 5EK2A 4O4JE 3RC8A 2N2NA 4BJNA 1EZ3A 1FMWA 2XAGB 2PG8A 1LKXA 1VRBA 2ODVA 3TKLB 4TV9E 4AKLA 4QWNB 5L2LA 5L3EB 2VKJA 5A1LA 4HKAA 5JREA 3SRZA 3VU7H 2Z6EA 2CXLA 2E9XC 2V7MA 5CB4E 5LBMA 4O2BE 2LSGA 2DWGA 3C64A 2Y8DA 4M1PA 2CXFA 3DJBA 2C0SA 4NUUA 5L3DB 2YK0A 5FXWA 1BR4A 3SS1A 2W61A 4AI6A 3C4WA 4DNDA 3K3QC 4JUYA 3LBXB 2MYSA 4PJNA 3IHRA 5HXCA 2Q9QA 3QK6A 3OJAA 1HS7A 1HTJF 3Q2MA 4DBQA 1IAPA 3AB3B 2XUEA 5FXVA 4EXTA 1WYCA 3MXZA 3ETUA 3ZMZB 3MZKB 3PUSA 3ETVA 5JDGA 5LYJE 4QX8B 5L3FB 4DBRA 3B13A 4P09A 5DQVA 1VOMA 4QXHB 2V7IA 2CWOA 3DTOA 5J2TE 4L5GA 5JDLA 4O4IE 5FMNA 1NWMX 2OA5A 3PUAA 4IIJE 3EVYA 4UF0A 1MNEA 5H6RB 4XZCA 5LNKA 2NWBA 1WYBA 3AAEB 4MBQA 1US7B 4OHFA 4EZHA 2KZ7B 2CMRA 2JMKA 3EDVA 3PE0A 5LXTE 4DVDA 1WR6A 2JPFA 3FBLA 4HGAA 2ZM2A 2EHOA 3JC6C 4I55E 2W63A 3BQLA 3LK2B 3ANWA 2QA7A 3FXEB 1G8XA 5DABA 2BVLA 3HA4A 4O4HE 5HYAA 2LHRA 2Q9QB 3J9X1 3SOLA 1BR2A 2C5KT 2X51A 1YKEB 2VWAA 4Z8XA 3KV4A 1YKHB 4IE4A 2YEVC 3GN5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P C;  5KDM C;  4H9R C;  4H9N C;  4H9O C;  4H9Q C;  4HGA A;  4H9S E; 
#chains in the Genus database with same CATH topology
 1QUU A;  2Q9Q D;  2LE8 A;  4U74 A;  2WWU A;  3EI0 A;  2VQE T;  2VL8 A;  4G63 A;  2AXD S;  2HPL A;  4DID B;  2BG9 E;  4AKI A;  2UXB T;  3KV6 A;  4OK0 A;  3CX7 B;  3TLV A;  4LF4 T;  4IL4 A;  1IJ6 A;  1MMA A;  5L3C B;  4GYS A;  4ZI3 D;  2ZMA A;  5AQP B;  2CPT A;  4DV7 T;  4ZZB A;  3RIU A;  3VKH A;  4AQY T;  4E7Z A;  1V9D A;  1LVK A;  1MMD A;  4DO0 A;  1HG5 A;  2NOX A;  3KIN B;  4I4T E;  3HKD E;  2XTL A;  4LFC T;  2BVM A;  3CQC B;  2V7L A;  3NKZ A;  4UV8 B;  3MKD A;  3HI2 A;  3FZK B;  4X62 T;  1WFD A;  2KWH A;  4OYJ A;  3O1I A;  2H7O A;  3E22 E;  3VKG A;  3AE9 A;  2QRX A;  5FY1 A;  2VK9 A;  3AA6 B;  3AXJ A;  5JR9 B;  3GN5 A;  2DWK A;  2CBJ A;  4EED A;  4OFZ A;  2VB6 A;  4U72 A;  3P4R A;  5AQH B;  3ESL A;  4DR3 T;  4LF9 T;  1BR1 A;  4JI3 T;  4H9N C;  4AKH A;  3TLT A;  3WAK A;  3CML A;  4U3C A;  4JI5 T;  2C5I T;  5HEU A;  1IZN B;  4MAL A;  4WW0 A;  2LOP A;  4HFV A;  5HEJ A;  2H3R A;  3AED A;  5KX5 E;  2WP9 A;  5J2U E;  4YSX A;  5F5W A;  2XQY A;  3MA9 A;  1S94 A;  1VCT A;  5L3G B;  3ZMT B;  3QUJ A;  2RP4 A;  1KNZ A;  5JDH A;  3IEE A;  3NBX X;  2YDQ A;  3TLW A;  1YW0 A;  2D9D A;  4X1K E;  1UCU A;  4CI2 B;  1D1C A;  1SHZ C;  2XJ7 A;  1T72 A;  3KVA A;  3NZP A;  4L9I A;  5DJQ C;  3LSV A;  2HPJ A;  5AQJ B;  3GA8 A;  4ILA A;  3PTR B;  5AFU L;  4DR1 T;  1XDP A;  4DR4 T;  5JR9 A;  5M4Y A;  5HEG A;  3LFM A;  5AQV B;  2L8K A;  2LEH A;  3RYH E;  3RPU A;  4X20 E;  3RX6 A;  5LG3 A;  2WSS V;  4TNW A;  5FNV E;  2E9X B;  1U4Q A;  2K48 A;  3LG7 A;  4XBF B;  5JRC B;  4YXD A;  2X0H A;  2WQY A;  2UU9 T;  1O3X A;  2WAU A;  3EDU A;  2DNX A;  4N78 D;  4LF8 T;  3CQX C;  1R8I A;  3OTO T;  2ES0 A;  4IE0 A;  2LM9 A;  1IJ5 A;  5JDQ A;  2QVA A;  2WZI A;  4HFH A;  3F57 A;  5AQM B;  2CCQ A;  5FYM A;  4B3M T;  5DQW A;  5HEO A;  1CUN A;  1OED C;  4ZHQ E;  2P9B A;  2WB5 A;  2J4G A;  3JC6 D;  3K3O A;  4GKJ T;  4ILC A;  4MLK A;  1HCI A;  1SA0 E;  5CFB A;  1U5P A;  4PJM A;  1UX5 A;  3KV5 A;  4DUY T;  2ZM8 A;  4DV6 T;  4AKG A;  4O4L E;  4TV8 E;  4AQF C;  4KMC A;  4TX5 A;  1LVF A;  2JQ9 A;  4LFB T;  2E9X A;  1ZHC A;  3SFD A;  2E5L T;  3CWZ B;  3L09 A;  5JRC A;  2DI4 A;  1UK5 A;  2ACX A;  2KWI B;  2K9A A;  2NTX A;  4X1I E;  4EGW A;  1W0A A;  2V5D A;  2VKD A;  2W0G A;  1N32 T;  4K0U A;  4BJM A;  5LOV E;  4PW8 A;  1SE7 A;  4DR6 T;  4WBO A;  3KV9 A;  5CGM A;  3ONX A;  1NEK A;  2KXP B;  3ANW B;  2J47 A;  2CXD A;  5EK3 A;  1HX8 A;  2X66 A;  3ZYL A;  2X9W A;  3FZL B;  4HFI A;  1XMQ T;  4TZ4 C;  5AQL B;  2A2F X;  2E9X D;  3RYC E;  3BQI A;  1W9R A;  2FUP A;  3RC8 A;  3UU4 A;  1FMW A;  2IDO B;  1VRB A;  4TV9 E;  4F8H A;  5A1L A;  2LSG A;  3C64 A;  1HNW T;  3DJB A;  4NUU A;  4JI2 T;  4B3T T;  2XM1 A;  4PJN A;  5HXC A;  3QK6 A;  1HS7 A;  4U31 A;  4JI0 T;  3AB3 B;  5C2T A;  1J5E T;  1WYC A;  3ETU A;  2DL1 A;  3MZK B;  3PV0 F;  2YKS A;  3PUS A;  5AQN B;  2XQA A;  5LMU T;  2CWO A;  5J2T E;  4O4I E;  4B3R T;  3PUA A;  4IIJ E;  5HCJ A;  3UU5 A;  1US7 B;  2ZM6 T;  2JPF A;  4NXM T;  4HGA A;  2ZM2 A;  3JC6 C;  4YTM A;  2LRL A;  2W63 A;  3ANW A;  1UUR A;  1G8X A;  5DAB A;  2OV9 A;  2LHR A;  2Q9Q B;  5L47 A;  2X51 A;  4Z8X A;  1YKH B;  4IE4 A;  2LSI A;  4YJ2 E;  3Q5E A;  1HR0 T;  1MIV A;  3KBT A;  3UU6 A;  3U78 A;  1W0B A;  4IDZ A;  4H63 H;  3WAJ A;  3N9P A;  2ZM0 A;  4LF5 T;  2YN6 A;  2IAK A;  3MJX A;  2I6H A;  2CRB A;  3O1J A;  4PJJ A;  3ZN0 B;  3UUB A;  3BK9 A;  4EYU A;  4EV6 A;  4GK5 E;  5JH7 E;  2A72 A;  4KP3 C;  1FIO A;  5EZY E;  4P0B A;  4CXY A;  3ZN1 B;  5ABF A;  5HXR A;  4HWI B;  2CHO A;  4JEU B;  4IE6 A;  3ZCJ A;  4X64 T;  2W00 A;  4I43 B;  3CVR A;  1D1B A;  3ZSS A;  2X67 A;  2GK9 A;  2Y48 B;  4IHJ E;  5BR8 T;  2M67 A;  3LDQ B;  1OED B;  2YU2 A;  5IHY A;  5JTG A;  2H88 A;  3ZJ2 A;  5LHI B;  3RLF F;  3VR8 A;  2DLR A;  2X9X A;  4K0K T;  3CX8 B;  2XQ8 A;  3Q9D A;  3CX6 B;  2CWY A;  1WRD A;  2KMF A;  3J7Y q;  1OWA A;  2X68 A;  1FJG T;  3C51 A;  1YQ3 A;  4V1A v;  3ZMV B;  5LBQ B;  2A9U A;  2XSB A;  3GWH A;  2HH7 A;  3RRW A;  3M65 A;  1I94 T;  3UT5 E;  3N9Q A;  2D0T A;  1FMV A;  2LSY A;  5AQS B;  2JQQ A;  3A7M A;  3OBV E;  5IWA T;  3P4Q A;  4IDO A;  3IA3 A;  1XWM A;  2YIN A;  3I0Q A;  3RYF E;  4L0R A;  5AQO B;  4OYK A;  4HN9 A;  4HFE A;  2XAF B;  1MND A;  3UQ7 A;  3EHZ A;  2PTF A;  2XSA A;  5F8P A;  5LJN A;  4QH5 A;  2FJD A;  4DMV A;  2N1G A;  2NTY A;  2LRK A;  3FZF B;  3QNU A;  1OED A;  3NRY A;  4UIG A;  2NP9 A;  3V5U A;  4LMK A;  4H9O C;  3ZJ1 A;  2UUA T;  2WMO A;  2CE7 A;  3ZT7 A;  3HKE E;  1Y01 A;  4QXB B;  3ZEF B;  2NW7 A;  2WZH A;  5JQG E;  4Z91 A;  4Z90 A;  4O8S A;  4AQF A;  4XAX B;  2IC9 A;  2XAS B;  2D2S A;  4PAG A;  3FBZ A;  2PBI A;  5L4E A;  2HHH T;  3IF8 B;  2D5U A;  4TWH A;  1WCR A;  3R84 B;  5LP6 E;  3I1A A;  4UVC B;  1D0X A;  3AEF A;  3SWH A;  3P50 A;  3FB2 A;  4X66 T;  3DP7 A;  4DV5 T;  2V6X A;  5ABE A;  1W09 A;  2G0U A;  3H3A A;  1ZV4 X;  4TUY E;  4CI3 B;  2XAJ B;  4P0A A;  2MTQ A;  4LF6 T;  3TLS A;  4JEH B;  4JI8 T;  2QYW A;  3R6N A;  3P8C D;  3I9Y A;  3HL6 A;  4E7S A;  3C98 B;  2LSK A;  3JAD A;  3UFG A;  1H7C A;  3RGL A;  3PUQ A;  1E7P A;  3RQW A;  2FJE A;  5LJM A;  2WS3 A;  2XQ4 A;  4LML A;  5HAX A;  3P4S A;  4EZ4 A;  2WU5 A;  4UXN B;  1J1J A;  4PFP A;  4AQG A;  1E2A A;  4PK4 A;  3F31 A;  4UF0 B;  2ODU A;  3FZM B;  3LK3 B;  4B3S T;  5FY0 A;  5HXS A;  4ZS3 A;  3CKD A;  3LJC A;  3ZST A;  3QOF A;  2D0U A;  4CXW A;  2WU2 A;  1KNP A;  3I9W A;  5KDM C;  3L39 A;  1KK7 A;  3C50 A;  3OYZ A;  2VAS A;  5LHG B;  4UV9 B;  3BQK A;  3UUL A;  3U3I A;  1Z0P A;  2C5J A;  4O4J E;  4CN4 A;  2N2N A;  2PG8 A;  3TKL B;  4QWN B;  3RI5 A;  4DV1 T;  3VU7 H;  2BKP A;  3AE1 A;  3OPC A;  5CJ5 A;  4YT0 A;  2XQ9 A;  3K3Q C;  4JUY A;  3IHR A;  3OJA A;  1HTJ F;  3Q2M A;  1IAP A;  2BKN A;  3T1H T;  1KNR A;  2XUE A;  4IDQ A;  3MXZ A;  3AEC A;  2W2U A;  5LYJ E;  4CN1 A;  4U33 A;  1T8B A;  4NPP A;  3B13 A;  2M6I A;  4QXH B;  2V7I A;  4L5G A;  4UF0 A;  4HWC A;  1WYB A;  3AE5 A;  4MBQ A;  4EZH A;  2KZ7 B;  2CMR A;  3EDV A;  3PE0 A;  2BG9 C;  3BQL A;  3QB5 A;  2UXD T;  3AE4 A;  1UGO A;  4O4H E;  3SOL A;  2WY2 A;  2VWA A;  5DQV A;  4YTP A;  4YSZ A;  3KFW X;  4IL9 A;  5HWY A;  4U2Z A;  2NW9 A;  2BBH A;  4UVB B;  4MFR A;  5C8Y E;  4EYY R;  3RF1 A;  4JI6 T;  1D1A A;  2YOE A;  3NZQ A;  3K3N A;  3F2E A;  3K8P C;  4KI0 F;  4TWD A;  3RQU A;  3RH3 A;  4A98 A;  2VKO A;  2OLT A;  2LT3 A;  4UR9 A;  2W67 A;  4DR5 T;  4IGU A;  3HKC E;  3MK7 C;  1T98 A;  3UU8 A;  2XY8 B;  5E0O A;  4IDP A;  4JI7 T;  2WM9 A;  3Q5D A;  4LF7 T;  1JNR A;  5L4H A;  2EHO C;  3UQ4 A;  4I50 E;  3C4Z A;  1ZKE A;  2FJB A;  5AQT B;  2XQ5 A;  4IE5 A;  1YD8 G;  3KBU A;  3ZPO A;  3ONJ A;  3GMI A;  3UUN A;  1WR0 A;  5LG4 A;  3N2G E;  4ADZ A;  4IRE A;  2X0Y A;  2JMH A;  2V1D B;  4EAH A;  3S4U A;  2J1D G;  1CHU A;  5AQK B;  4H63 V;  2KIN B;  5ABF B;  4KX6 A;  2PFV A;  1FEW A;  2Y6X A;  1IBM T;  3P7I A;  1ZP0 A;  4P1N A;  5ABG A;  4U2Y A;  2X9H A;  4HFB A;  5HCM A;  1SUM B;  2YU1 A;  4CZZ B;  2YDR A;  2V7K A;  3Q5W A;  3A8Y C;  1XZY A;  3E08 A;  3AE2 A;  2X0L B;  4DR7 T;  5LGN B;  2L3L A;  3JCF A;  3O4X E;  2W4X A;  3PDY A;  1D0Y A;  4H9Q C;  2BS2 A;  3SFE A;  3RYI E;  4X65 T;  2IW5 B;  4CXX A;  4X1Y E;  1S35 A;  3VHL A;  3PU3 A;  4HFC A;  3EAM A;  4ZI2 C;  4ZEY A;  4H9R C;  3KVB A;  5HWX A;  2V26 A;  2VKH A;  5F3J A;  4ISS A;  3L3P A;  5FXZ A;  2KND A;  2E2A A;  3AA1 B;  3L8R A;  2PJQ A;  3JAE A;  3PJA A;  2BBJ A;  2QGS A;  4YTN A;  3RRC A;  2XM2 A;  2XQ7 A;  5H6Q B;  2KSR A;  3AVR A;  2WDV A;  2HN1 A;  4MHC A;  3OYX A;  5LA6 E;  4GYR A;  4WNK A;  1G73 A;  3FXD B;  4AIS A;  3PUZ F;  4HEA A;  2K5B B;  1XDO A;  2WBL A;  5LGT B;  3Q5X A;  2BG9 B;  2JQH A;  5BMV E;  3N9L A;  1E1H B;  3O1H A;  4A56 A;  5JDF A;  2W66 A;  2HN2 A;  4AXP A;  4QH1 A;  4ZI7 E;  1OED E;  3QC9 A;  1YXR A;  5FY7 A;  4H9S E;  1D0Z A;  5KMG P;  1X9B A;  1IBK T;  2JJ9 A;  5IYZ E;  1NAF A;  3KDS E;  4AIU A;  2XAH B;  2H7V C;  3PUR A;  5LB7 B;  3N5L A;  4ZXL A;  2MOZ A;  3AA0 B;  1HG2 A;  4G2A A;  3LK4 2;  1MIY A;  2DCF A;  5LHH B;  1HF8 A;  4WZX A;  2XHE B;  2YDS A;  4PJL A;  1LRZ A;  3CK6 A;  2WDR A;  4EOZ B;  1HNX T;  1XNR T;  5JVD E;  1XMO T;  5LCY A;  2W62 A;  1HFA A;  2CEA A;  1J5W A;  1MMN A;  4JBW F;  3UFE A;  3UTK A;  5GON E;  2XAQ B;  3PUG A;  2MBG A;  2EHO B;  5FVK A;  5AQG B;  3ZMU B;  3VR9 A;  4C90 A;  3N2K E;  2NW8 A;  2XPK A;  2IIU A;  5LMN T;  2LJL A;  3CIR A;  2LM2 A;  1MMG A;  4JI4 T;  3UUM A;  3AE7 A;  2BG9 A;  1M62 A;  4KBM B;  3ONL C;  4DV4 T;  3NRX A;  1Y64 B;  5JDM A;  3ZLI A;  1N33 T;  2CHN A;  4AKL A;  5FVL A;  5AQF B;  2IML A;  5L2L A;  5L3E B;  2VKJ A;  4NXN T;  5JRE A;  1QLB A;  3SRZ A;  2Z6E A;  2CXL A;  5LBM A;  3VRB A;  3AEA A;  2DWG A;  2Y8D A;  4M1P A;  2CXF A;  4NIQ A;  2YK0 A;  2BKO A;  2FJA A;  3SS1 A;  3C4W A;  2VL0 A;  3NWI A;  3PUX F;  3LBX B;  2MYS A;  2WCA A;  4WYV A;  2VVS A;  5FXV A;  3ZMZ B;  4QX8 B;  5L3F B;  2E5V A;  5AQI B;  4A5X A;  4P09 A;  3DTO A;  5JDL A;  5FMN A;  3EVY A;  1KF6 A;  5H6R B;  4XZC A;  5LNK A;  4LMJ A;  3AAE B;  4OHF A;  1XNQ T;  4ILB A;  2JMK A;  3UU3 A;  1WR6 A;  3FBL A;  4EEB A;  2EHO A;  2QA7 A;  4DV3 T;  3AEE A;  4YY3 T;  3HA4 A;  5HYA A;  1T7S A;  1YKE B;  4IDN A;  2YEV C;  2XQ6 A;  1QSD A;  2KT9 A;  3AEB A;  4KHZ F;  4QKN A;  2UXN B;  4ASK A;  3VRA A;  2I0M A;  3T8O A;  3WI3 A;  4ZOL E;  3N9O A;  2B76 A;  1BR0 A;  1M7K A;  3ZT6 A;  3E0Z A;  1WLX A;  2V5C A;  4CQI A;  4DMW A;  3AA7 B;  2Q9Q C;  3ZMS B;  2KLQ A;  4HTE A;  5ADX L;  4YLH A;  3OKQ A;  5FL0 A;  3AAA B;  3AE6 A;  4GKK T;  2EHO D;  3P4W A;  4HWH A;  3M3Z B;  2WDQ A;  3LBX A;  3FZH B;  2CLY C;  2ACZ A;  4ZI3 C;  2BDE A;  2NR4 A;  1L0V A;  2X9Y A;  5TAO A;  2VVN A;  3I0O A;  3PUY F;  2N9D A;  3ZYM A;  2XZE A;  4ERR A;  4PK5 A;  4UEL A;  4HE8 A;  5JDN A;  4TN7 B;  4DV0 T;  5FXX A;  4C91 A;  3AEG A;  5J0Z A;  4WBN E;  4PK6 A;  4U7Y A;  3RHW A;  2UUC T;  4QHO A;  4NUV A;  3A5X A;  4CI1 B;  4YJ3 E;  3RIU C;  4CN6 A;  3ZKR A;  5CA0 E;  5CA1 E;  1IBL T;  4ZS2 A;  1UUS A;  4IT4 A;  3RIA A;  2LLY A;  2LOS A;  4PNI A;  4HWF A;  4ANJ A;  4FJO A;  3ZC1 A;  1ZOY A;  2LKG A;  2B1E A;  3RKO A;  3AE8 A;  1HX1 B;  2MAW A;  4EIW A;  3P4P A;  4YHJ A;  3N2O A;  3N9N A;  5HXH A;  3PUW F;  4IST A;  1I6Z A;  4ZI2 D;  4J2C A;  4B6X A;  5HXE A;  3H3M A;  5HEH A;  4BA9 A;  2IC6 A;  4Q25 A;  3CPZ A;  4GOU A;  3NVO A;  4ZZC A;  1ZEE A;  3B57 A;  4YHH T;  2M6B A;  3N9M A;  5ETW A;  3MAC A;  3ZT5 A;  3V5S A;  5ABH A;  4BAY B;  2IHR 1;  1N34 T;  3W15 B;  3AE3 A;  2IUB A;  4H9P C;  4KHP T;  3H37 A;  2LKH A;  1AJ3 A;  4UVA B;  3OVU A;  4IE7 A;  1HNZ T;  3ZYK A;  4COF A;  2ZLY A;  2WWV A;  4UEM A;  4U7I A;  4HWD A;  4JI1 T;  2WMN A;  2F4V T;  3FHN A;  4EB6 E;  4JV5 T;  2LSJ A;  4TWF A;  3RC3 A;  3AVS A;  5L3B B;  3D0T A;  3ZC0 A;  1KEY A;  4O2A E;  2V8S V;  2CM0 A;  5J1G A;  4ILU A;  4DV2 T;  4A97 A;  2MPK A;  2K3W A;  5FL1 A;  5EK4 A;  2JIW A;  2L9Q A;  4QH4 A;  5JR9 C;  4JYA T;  2JRK A;  3EUH A;  1DU2 A;  2DHR A;  4DR2 T;  5AQU B;  3EAB A;  3C4X A;  1KFY A;  2H89 A;  2RA1 A;  3T1Y T;  5IUX A;  2VUR A;  2BS3 A;  3PJA J;  4KUM B;  4FI5 A;  1MIW A;  2V6Y B;  3TLU A;  2RPA A;  2UUB T;  2XQ3 A;  4AKR B;  1Z8U A;  3RKG A;  2R6G F;  3QB5 K;  2SPC A;  4YSY A;  2I59 A;  4OX9 T;  2V7J A;  2CLY B;  3HKB E;  5LGU B;  4PFO A;  3CQG B;  3PU8 A;  3JAF A;  4LFA T;  2UXC T;  4X5T A;  2E8I A;  4I0U A;  4QXC B;  3IBP A;  2K24 A;  1GQE A;  2CA5 A;  4GK0 E;  1VCS A;  4F6R C;  1N36 T;  3HR0 A;  4YFS A;  1UX4 A;  3AAI A;  1OXZ A;  5FP3 A;  1NEN A;  2BZB A;  1B7T A;  2A3D A;  3G06 A;  2AE9 A;  4JLE A;  3ZCI A;  5C3J A;  4HFD A;  1X79 A;  3O9X A;  2J62 A;  2UXX B;  4QX7 B;  3UUX B;  2LHN A;  5EK2 A;  4BJN A;  4TNV A;  1EZ3 A;  2XAG B;  2JQK A;  1LKX A;  2ODV A;  3X1D A;  3K1S A;  4HKA A;  2E9X C;  2V7M A;  5CB4 E;  4O2B E;  5KXJ A;  3PUV F;  3B5M A;  2C0S A;  5L3D B;  5FXW A;  1BR4 A;  2W61 A;  4AI6 A;  4DND A;  2BS4 A;  4DUZ T;  2Q9Q A;  2V6Y A;  2FBW A;  4DBQ A;  4EXT A;  1YQ4 A;  5AQR B;  2CBI A;  3ETV A;  5JDG A;  3ABV A;  4DBR A;  5AQQ B;  5FKY A;  1VOM A;  1NWM X;  2OA5 A;  2VQF T;  1MNE A;  3RIF A;  2NWB A;  5LXT E;  4DVD A;  4I55 E;  3LK2 B;  3FXE B;  1JNZ A;  2BVL A;  3J9X 1;  1BR2 A;  2C5K T;  3AXJ B;  3KV4 A;  4GIW A;  3GN5 B; 
#chains in the Genus database with same CATH homology
 1QUU A;  2LSI A;  2Q9Q D;  2LE8 A;  3KFW X;  1QSD A;  2WWU A;  4U74 A;  4YJ2 E;  2KT9 A;  2VL8 A;  5HWY A;  1MIV A;  4G63 A;  4QKN A;  3KBT A;  2NW9 A;  2UXN B;  4ASK A;  2HPL A;  3T8O A;  4AKI A;  4UVB B;  4MFR A;  3WI3 A;  3KV6 A;  4OK0 A;  4ZOL E;  3N9O A;  3U78 A;  3CX7 B;  1BR0 A;  5C8Y E;  4EYY R;  3E0Z A;  1WLX A;  4IDZ A;  4H63 H;  3WAJ A;  1IJ6 A;  4CQI A;  1D1A A;  1MMA A;  3N9P A;  2ZM0 A;  4DMW A;  3NZQ A;  5L3C B;  4GYS A;  4ZI3 D;  3K3N A;  3AA7 B;  2Q9Q C;  3F2E A;  2ZMA A;  3K8P C;  2IAK A;  3ZMS B;  2KLQ A;  3MJX A;  4HTE A;  3RH3 A;  5ADX L;  4YLH A;  2VKO A;  3OKQ A;  3VKH A;  4E7Z A;  3AAA B;  1V9D A;  1LVK A;  2LT3 A;  3O1J A;  2EHO D;  4PJJ A;  3ZN0 B;  3LBX A;  1MMD A;  4IGU A;  4DO0 A;  1HG5 A;  2CLY C;  3HKC E;  2NOX A;  3MK7 C;  3KIN B;  3BK9 A;  4EYU A;  1T98 A;  4ZI3 C;  2BDE A;  4GK5 E;  4I4T E;  3HKD E;  4GIW A;  5JH7 E;  2A72 A;  2XTL A;  2X9Y A;  5E0O A;  4KP3 C;  5TAO A;  2WM9 A;  1FIO A;  5EZY E;  2BVM A;  3CQC B;  4P0B A;  3I0O A;  2V7L A;  4CXY A;  2EHO C;  3ZN1 B;  2N9D A;  4UV8 B;  5HXR A;  3MKD A;  3ZYM A;  4JEU B;  4I50 E;  4IE6 A;  3C4Z A;  3HI2 A;  1ZKE A;  4ERR A;  3ZCJ A;  4PK5 A;  4UEL A;  4HE8 A;  5JDN A;  4IE5 A;  2W00 A;  1YD8 G;  2KWH A;  4OYJ A;  4I43 B;  3CVR A;  4TN7 B;  1D1B A;  3KBU A;  3O1I A;  2X67 A;  2H7O A;  2GK9 A;  5FXX A;  4C91 A;  3ZPO A;  3E22 E;  3VKG A;  3GMI A;  2Y48 B;  3UUN A;  4IHJ E;  4WBN E;  2M67 A;  5LG4 A;  4PK6 A;  3N2G E;  2YU2 A;  5IHY A;  4ADZ A;  5FY1 A;  2VK9 A;  3AA6 B;  5JR9 B;  3GN5 A;  2DWK A;  2JMH A;  2V1D B;  4EAH A;  3S4U A;  3ZJ2 A;  5LHI B;  4OFZ A;  4QHO A;  2J1D G;  2DLR A;  2VB6 A;  4U72 A;  2X9X A;  4NUV A;  3ESL A;  3A5X A;  3CX8 B;  4CI1 B;  1BR1 A;  4H63 V;  3Q9D A;  4H9N C;  3CX6 B;  2CWY A;  4YJ3 E;  4AKH A;  1WRD A;  3WAK A;  2KIN B;  3CML A;  2KMF A;  5CA0 E;  3J7Y q;  1OWA A;  2PFV A;  2X68 A;  3C51 A;  2C5I T;  1FEW A;  5CA1 E;  2Y6X A;  3P7I A;  4ZS2 A;  1IZN B;  4MAL A;  4WW0 A;  2LOP A;  4V1A v;  3ZMV B;  5LBQ B;  4HFV A;  2X9H A;  2H3R A;  2YU1 A;  4CZZ B;  2LOS A;  3GWH A;  2HH7 A;  3RRW A;  4PNI A;  3M65 A;  4ANJ A;  5KX5 E;  5J2U E;  4FJO A;  2V7K A;  3UT5 E;  3ZC1 A;  3Q5W A;  2XQY A;  3MA9 A;  3N9Q A;  2D0T A;  1FMV A;  2B1E A;  2LSY A;  3RKO A;  3E08 A;  2JQQ A;  4EIW A;  2X0L B;  1S94 A;  5L3G B;  3ZMT B;  3QUJ A;  2RP4 A;  1KNZ A;  3OBV E;  4YHJ A;  5LGN B;  2L3L A;  5JDH A;  3N2O A;  3N9N A;  3O4X E;  3I0Q A;  2YIN A;  3IEE A;  3NBX X;  3RYF E;  5HXH A;  4L0R A;  1YW0 A;  4X1K E;  1UCU A;  4OYK A;  4HN9 A;  4IST A;  4CI2 B;  4ZI2 D;  1D1C A;  3PDY A;  1SHZ C;  2XAF B;  1MND A;  4J2C A;  4B6X A;  5HXE A;  1D0Y A;  3KVA A;  3NZP A;  4L9I A;  4H9Q C;  4BA9 A;  5DJQ C;  3RYI E;  2IC6 A;  5F8P A;  3CPZ A;  4GOU A;  5LJN A;  2HPJ A;  2IW5 B;  4CXX A;  4X1Y E;  1S35 A;  4DMV A;  2N1G A;  3PU3 A;  2NTY A;  3VHL A;  3GA8 A;  3PTR B;  1ZEE A;  5AFU L;  3B57 A;  3NRY A;  4UIG A;  2NP9 A;  3N9M A;  5ETW A;  4ZI2 C;  3MAC A;  3V5U A;  5JR9 A;  3V5S A;  4H9R C;  5M4Y A;  4H9O C;  3ZJ1 A;  3LFM A;  2WMO A;  2CE7 A;  4BAY B;  3KVB A;  3HKE E;  2L8K A;  2LEH A;  4QXB B;  3RYH E;  3ZEF B;  5HWX A;  3W15 B;  3RPU A;  2V26 A;  4X20 E;  2NW7 A;  2VKH A;  3RX6 A;  5F3J A;  4ISS A;  2WSS V;  3L3P A;  4H9P C;  5FXZ A;  5JQG E;  3H37 A;  5FNV E;  2E9X B;  2KND A;  1U4Q A;  1AJ3 A;  4O8S A;  4UVA B;  4IE7 A;  4AQF A;  3AA1 B;  2PJQ A;  3ZYK A;  2K48 A;  3LG7 A;  4XAX B;  4XBF B;  5JRC B;  2ZLY A;  2IC9 A;  2XAS B;  4UEM A;  2D2S A;  4PAG A;  2QGS A;  3FBZ A;  2PBI A;  3IF8 B;  1O3X A;  2D5U A;  2WMN A;  2WAU A;  3FHN A;  3EDU A;  2DNX A;  3RRC A;  4EB6 E;  4N78 D;  5H6Q B;  3R84 B;  5LP6 E;  3I1A A;  3AVR A;  2LSJ A;  4UVC B;  1D0X A;  3SWH A;  3CQX C;  4MHC A;  3OYX A;  3RC3 A;  3FB2 A;  5LA6 E;  3AVS A;  4GYR A;  3DP7 A;  5L3B B;  2ES0 A;  4WNK A;  4IE0 A;  3D0T A;  2LM9 A;  3ZC0 A;  1IJ5 A;  1G73 A;  4O2A E;  5JDQ A;  3FXD B;  2CM0 A;  3F57 A;  4HEA A;  2CCQ A;  5J1G A;  2K5B B;  5FYM A;  4ILU A;  2G0U A;  2WBL A;  5DQW A;  5LGT B;  3Q5X A;  3H3A A;  1CUN A;  4ZHQ E;  1ZV4 X;  4TUY E;  5EK4 A;  2P9B A;  2L9Q A;  4CI3 B;  3N9L A;  5BMV E;  3JC6 D;  5JR9 C;  2XAJ B;  4P0A A;  1E1H B;  2MTQ A;  3K3O A;  4MLK A;  1HCI A;  1SA0 E;  2JRK A;  3O1H A;  1U5P A;  4PJM A;  4JEH B;  4A56 A;  5JDF A;  3EUH A;  1UX5 A;  3KV5 A;  2ZM8 A;  4AKG A;  4AXP A;  2DHR A;  4ZI7 E;  3R6N A;  3QC9 A;  3P8C D;  5FY7 A;  4O4L E;  3I9Y A;  4H9S E;  3HL6 A;  1D0Z A;  5KMG P;  4TV8 E;  4AQF C;  3C4X A;  4E7S A;  3C98 B;  2JJ9 A;  5IYZ E;  2LSK A;  4KMC A;  1NAF A;  2RA1 A;  4TX5 A;  3KDS E;  1H7C A;  3PUQ A;  2XAH B;  1LVF A;  2H7V C;  3PUR A;  3N5L A;  4KUM B;  4FI5 A;  1MIW A;  2MOZ A;  3AA0 B;  1HG2 A;  4G2A A;  5LJM A;  2E9X A;  3LK4 2;  5HAX A;  1MIY A;  1ZHC A;  2DCF A;  4EZ4 A;  4AKR B;  5LHH B;  1HF8 A;  3CWZ B;  3L09 A;  4UXN B;  5JRC A;  2DI4 A;  2XHE B;  4PJL A;  1LRZ A;  2ACX A;  2KWI B;  2SPC A;  4PFP A;  4AQG A;  4EOZ B;  2I59 A;  2K9A A;  2NTX A;  4X1I E;  5JVD E;  5LCY A;  2V7J A;  2CLY B;  3HKB E;  2VKD A;  2W0G A;  2W62 A;  4PFO A;  4PK4 A;  3CQG B;  3PU8 A;  4K0U A;  5LGU B;  1HFA A;  3F31 A;  4BJM A;  2CEA A;  5LOV E;  4PW8 A;  4UF0 B;  2E8I A;  2ODU A;  3LK3 B;  4QXC B;  1MMN A;  3IBP A;  2K24 A;  4WBO A;  2CA5 A;  4GK0 E;  5FY0 A;  4F6R C;  5HXS A;  3KV9 A;  3UFE A;  3UTK A;  5GON E;  2XAQ B;  4ZS3 A;  3ONX A;  3CKD A;  3LJC A;  3PUG A;  2MBG A;  3HR0 A;  2EHO B;  4YFS A;  1UX4 A;  3AAI A;  2KXP B;  3ANW B;  3ZMU B;  4C90 A;  2CXD A;  3N2K E;  2D0U A;  2NW8 A;  1HX8 A;  5EK3 A;  4CXW A;  2X66 A;  1OXZ A;  3I9W A;  5KDM C;  3ZYL A;  5FP3 A;  2X9W A;  2BZB A;  1B7T A;  1KK7 A;  2LJL A;  3C50 A;  3OYZ A;  4TZ4 C;  2A2F X;  2A3D A;  1MMG A;  3UUM A;  2VAS A;  4JLE A;  5LHG B;  2E9X D;  4UV9 B;  3RYC E;  3ZCI A;  4KBM B;  3BQI A;  1X79 A;  3BQK A;  3NRX A;  3U3I A;  1Y64 B;  3UUL A;  5JDM A;  3O9X A;  2UXX B;  4QX7 B;  3ZLI A;  1Z0P A;  3UUX B;  2LHN A;  2C5J A;  5EK2 A;  4O4J E;  3RC8 A;  2N2N A;  4BJN A;  1EZ3 A;  1FMW A;  2XAG B;  2PG8 A;  1LKX A;  1VRB A;  2ODV A;  3TKL B;  4TV9 E;  4AKL A;  4QWN B;  5L2L A;  5L3E B;  2VKJ A;  5A1L A;  4HKA A;  5JRE A;  3SRZ A;  3VU7 H;  2Z6E A;  2CXL A;  2E9X C;  2V7M A;  5CB4 E;  5LBM A;  4O2B E;  2LSG A;  2DWG A;  3C64 A;  2Y8D A;  4M1P A;  2CXF A;  3DJB A;  2C0S A;  4NUU A;  5L3D B;  2YK0 A;  5FXW A;  1BR4 A;  3SS1 A;  2W61 A;  4AI6 A;  3C4W A;  4DND A;  3K3Q C;  4JUY A;  3LBX B;  2MYS A;  4PJN A;  3IHR A;  5HXC A;  2Q9Q A;  3QK6 A;  3OJA A;  1HS7 A;  1HTJ F;  3Q2M A;  4DBQ A;  1IAP A;  3AB3 B;  2XUE A;  5FXV A;  4EXT A;  1WYC A;  3MXZ A;  3ETU A;  3ZMZ B;  3MZK B;  3PUS A;  3ETV A;  5JDG A;  5LYJ E;  4QX8 B;  5L3F B;  4DBR A;  3B13 A;  4P09 A;  5DQV A;  1VOM A;  4QXH B;  2V7I A;  2CWO A;  3DTO A;  5J2T E;  4L5G A;  5JDL A;  4O4I E;  5FMN A;  1NWM X;  2OA5 A;  3PUA A;  4IIJ E;  3EVY A;  4UF0 A;  1MNE A;  5H6R B;  4XZC A;  5LNK A;  2NWB A;  1WYB A;  3AAE B;  4MBQ A;  1US7 B;  4OHF A;  4EZH A;  2KZ7 B;  2CMR A;  2JMK A;  3EDV A;  3PE0 A;  5LXT E;  4DVD A;  1WR6 A;  2JPF A;  3FBL A;  4HGA A;  2ZM2 A;  2EHO A;  3JC6 C;  4I55 E;  2W63 A;  3BQL A;  3LK2 B;  3ANW A;  2QA7 A;  3FXE B;  1G8X A;  5DAB A;  2BVL A;  3HA4 A;  4O4H E;  5HYA A;  2LHR A;  2Q9Q B;  3J9X 1;  3SOL A;  1BR2 A;  2C5K T;  2X51 A;  1YKE B;  2VWA A;  4Z8X A;  3KV4 A;  1YKH B;  4IE4 A;  2YEV C;  3GN5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...