4H9PC

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 73
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9pC00
4H9NC 4H9RC 5KDMC 4H9OC 4H9SE 4HGAA 4H9QC 4H9PC
chains in the Genus database with same CATH superfamily
4QX7B 3T1YT 2XQ8A 1OEDB 3P4WA 5JDLA 2L9QA 4AXPA 3UUXB 3T1HT 3AE7A 4N78D 3KVAA 1YD8G 4I55E 3K3QC 2VQFT 4MHCA 4QHOA 4YY3T 4H9SE 2BKNA 2CMRA 3P50A 2ZM8A 3GA8A 1ZHCA 2NP9A 3GN5A 4KHZF 2L3LA 4FI5A 4HWCA 3ZPOA 3MK7C 2X68A 1UK5A 2LEHA 3CX8B 4GIWA 4JI5T 2VASA 1M7KA 3RIUC 4YHHT 5C8YE 5HEUA 5HEOA 1HX1B 1VRBA 2XPKA 2Q9QB 2YDSA 3SWHA 3VU7H 4F6RC 4AQYT 5FL0A 5C3JA 1FJGT 2JMKA 4IDNA 3O9XA 3HKBE 5JRCA 4P1NA 2Q9QD 5LHGB 5F5WA 5LHIB 5HXEA 4GK0E 3AA1B 4H63H 2CLYB 4DR4T 3FBZA 2YK0A 2A3DA 1M62A 2XQ6A 2CHNA 4AKLA 3R6NA 3JCFA 4A97A 2IW5B 4YHJA 2VURA 4JV5T 3N9MA 3AXJA 3AEAA 3EVYA 4NXNT 4C91A 4ZI2D 4KI0F 4ZI7E 3ZC0A 3JC6C 2DWKA 2X0HA 1R8IA 2XJ7A 3I0OA 2BS2A 3C64A 3CKDA 4HGAA 2M67A 2JIWA 3OJAA 3VKHA 4ILBA 2NTYA 2IC6A 1N34T 3E08A 2MAWA 4U7YA 4HFVA 4DBQA 3ZT7A 2XM1A 5FKYA 3PTRB 5AQSB 3NZPA 4KBMB 1N33T 1BR0A 4X62T 2LOSA 4PJNA 2CE7A 1XMQT 2BG9C 4DV6T 5LMUT 2WZHA 2XAHB 1WYCA 5TAOA 4AQFA 3LBXA 3ZT5A 4U33A 2K48A 2LOPA 4P0AA 2LKGA 2YDRA 3ETVA 4TWHA 4QXBB 1LKXA 2V5DA 4JI7T 5JVDE 1XNRT 3Q5XA 4X1KE 4DR1T 5LG4A 3ZMUB 3UU3A 2CCQA 5JDHA 5AQOB 3K8PC 5HCJA 3UQ4A 5LYJE 3PUZF 2V8SV 3CX6B 4EV6A 5CB4E 4IREA 5AQIB 4HFCA 3ANWB 2M6BA 4O2AE 4PJJA 2BBJA 1WRDA 3AE2A 4PFOA 2PJQA 2XAGB 5EK2A 3UQ7A 3C4ZA 2C5JA 4LF6T 5AFUL 2VKHA 3D0TA 3GMIA 5FL1A 2WSSV 3AE6A 3RH3A 3F57A 4IDZA 1N32T 5CA0E 5F3JA 3ZMZB 4JI8T 2IUBA 4ZI3D 4DV2T 3I0QA 2QRXA 2UXBT 5KX5E 2I0MA 4Z90A 2J1DG 2DCFA 4KX6A 1T72A 2DHRA 1ZEEA 3VRBA 3MXZA 4BAYB 3VKGA 2UXCT 3P4QA 3BK9A 2VL0A 2W63A 3TLTA 2QGSA 4MBQA 3O1HA 4GYSA 5AQVB 2Z6EA 3ZJ1A 3MACA 2HHHT 1DU2A 2Y6XA 3UU8A 2UXDT 2DNXA 5AQPB 4LF4T 1MMAA 4DUYT 3RQUA 4J2CA 4ISTA 1T8BA 3ETUA 5HXSA 2LRLA 5ETWA 2ODUA 1E7PA 2K9AA 1Y64B 2KT9A 3O1JA 3ZMTB 2BS3A 4TWFA 2YOEA 3L09A 3TLWA 1W9RA 4HFDA 3F31A 2KSRA 4CXXA 3LK2B 5GONE 4DMWA 3J9X1 5IWAT 5FMNA 4ZZBA 1NWMX 5LBMA 1HR0T 4HFEA 4PW8A 5EK4A 3AECA 3AB3B 3O4XE 3OTOT 2E9XA 2W4XA 3ZYMA 4CI2B 3AE8A 2J4GA 4QKNA 5F8PA 5L3BB 2X9YA 4O8SA 2V7IA 4IL9A 3RQWA 3ZN1B 3P4PA 3HL6A 3U3IA 3RC8A 2FJDA 5FXVA 3C4XA 4YTPA 2BVLA 4KP3C 3ZN0B 2XZEA 2BKPA 2WDRA 4EYUA 3WI3A 2X0LB 1CUNA 2J47A 3NZQA 2YEVC 4TX5A 2CM0A 2XY8B 3W15B 4LMJA 4BJMA 4QH4A 5FXXA 4PK5A 3NKZA 3LJCA 1OWAA 2YINA 3IBPA 3ZSTA 3NVOA 4X66T 5L3GB 3P7IA 3V5SA 4ASKA 2XAFB 4X1IE 2IMLA 2VKJA 2WWUA 2I6HA 3RYCE 3CX7B 2G0UA 3MJXA 5L4EA 3EHZA 5CA1E 3X1DA 5DJQC 3RRWA 3LFMA 3WAJA 1N36T 4Z91A 4YT0A 4ANJA 5L4HA 2BVMA 1D1CA 1VCSA 4LMLA 4DR6T 2QVAA 2E9XC 1FEWA 4CN6A 4HWDA 4DNDA 5HXCA 3BQLA 2JPFA 4IIJE 3N9QA 2X9HA 3UFEA 1SA0E 4EXTA 5AQKB 4PJLA 4UVAB 4ZS3A 4O2BE 3WAKA 2B1EA 1D0XA 4ERRA 1KNZA 1ZOYA 2LM2A 5HYAA 3A8YC 3C4WA 3Q5EA 4GKJT 2UXNB 3ABVA 1MNEA 4ISSA 5IYZE 2XAJB 2H89A 1HFAA 5C2TA 2LJLA 2V7LA 2XQAA 1U4QA 4U31A 3OYXA 2V7KA 2K24A 4IDQA 2XASB 3IEEA 3AAEB 5JH7E 4PK4A 2FJBA 5CGMA 2Q9QA 2ES0A 2LHNA 2HH7A 5LGTB 4HFIA 2CXFA 1YKHB 2CXLA 2YDQA 1XZYA 2XTLA 4CI3B 3AE5A 3ZMVB 2VKDA 3K3OA 1H7CA 2XSBA 4ZEYA 2RA1A 4IE4A 1UGOA 1MIYA 3UU4A 3C98B 5HEHA 3ZT6A 4YSZA 4QXHB 5ABEA 4HWFA 2W67A 3PUAA 3DP7A 2XQ3A 2N1GA 5AQGB 4IDPA 5J2UE 1OEDC 2UUAT 4LMKA 4EZ4A 4TUYE 3FXDB 3ZSSA 2A72A 5CJ5A 4OFZA 3PJAA 4AI6A 4DMVA 3RC3A 5AQNB 3KVBA 1XMOT 2HN1A 2J62A 2N9DA 4TV8E 4GK5E 4IL4A 1J1JA 2DL1A 4A98A 4L9IA 1EZ3A 5JTGA 3L39A 2ZM0A 2JQQA 4UF0B 1V9DA 3AVSA 3E0ZA 1MIVA 1LVKA 2V26A 3RF1A 2FJEA 1IBKT 4X5TA 2IIUA 5AQLB 5DABA 4G2AA 4XZCA 3V5UA 3Q9DA 5JQGE 2W2UA 4IE5A 3RKGA 3UFGA 4DBRA 2DWGA 2BS4A 2BG9B 5KDMC 4JLEA 1HF8A 4BJNA 3ZC1A 3JAEA 1IZNB 5CFBA 4B3MT 3EABA 4EEDA 3QB5K 1T7SA 2VL8A 2UUCT 2NWBA 3ANWA 4PNIA 2BZBA 4JUYA 2QA7A 4TV9E 5EZYE 3MA9A 3AEGA 1UX5A 2MOZA 2XQ9A 4HKAA 4EGWA 4H63V 4X65T 2BG9E 1SHZC 3UT5E 3PUSA 3ZEFB 4K0UA 3EDUA 4CQIA 3PUWF 4H9OC 5J2TE 3PV0F 2WZIA 3N5LA 1J5WA 5FP3A 2NW8A 2V6YB 1D1AA 4B3ST 2KXPB 1BR1A 4PFPA 4X64T 3QNUA 1G8XA 1MMGA 1BR2A 1UX4A 1S35A 3ONJA 1X9BA 5FVLA 5HWXA 5JDMA 5LB7B 2KZ7B 4YSYA 5ABGA 3LG7A 4EIWA 2MPKA 1QLBA 3H3AA 2WU5A 5AQQB 4AKRB 4NPPA 1YW0A 5FVKA 3HA4A 3FB2A 4K0KT 1HNZT 2HN2A 3CQCB 2WB5A 3PU8A 2ZM2A 4DO0A 3N9NA 4YTMA 4PK6A 1HG5A 2IAKA 2YN6A 4NXMT 3RYIE 4F8HA 2MBGA 2LE8A 3ZLIA 2HPJA 3DTOA 3B13A 3LK42 4P09A 3N9OA 2W61A 2VVSA 3RGLA 4DIDB 4V1Av 5AQMB 2PBIA 3BQKA 3IHRA 2V1DB 3ZJ2A 1OXZA 5L47A 3CMLA 3E22E 2E5LT 4ZZCA 3AEBA 4AQFC 2DI4A 3AEDA 4QWNB 2JQKA 1XDPA 2FBWA 3P4RA 3RKOA 3IA3A 3PJAJ 4OX9T 3FZKB 5BMVE 5LJMA 1D0YA 4IE6A 3FHNA 4U7IA 4ILUA 1XDOA 4EZHA 3QOFA 1O3XA 3T8OA 2YKSA 4HWIB 5JDQA 1AJ3A 4UXNB 3UUMA 4OK0A 1X79A 2WDVA 1HX8A 2BKOA 2H3RA 4Q25A 2C5KT 3UU6A 3OYZA 1YXRA 5AQFB 3Q2MA 4FJOA 3PUXF 3KV9A 2BDEA 2C0SA 2OV9A 2GK9A 1SUMB 4Z8XA 2CEAA 3TLUA 4UV8B 2ACXA 5ABFB 4HE8A 2JQ9A 4LF9T 5LP6E 4QX8B 5JR9B 3C50A 2X9WA 4ILAA 1JNZA 2PG8A 3HR0A 3NWIA 4TNWA 3HKEE 2LSIA 5JREA 2KLQA 3TLVA 2CA5A 4O4LE 3RPUA 4XAXB 4JEHB 3ZYLA 2XUEA 4U2YA 4DV5T 1CHUA 1YKEB 5IUXA 3A7MA 2RP4A 2M6IA 2EHOB 1G73A 2XQ7A 3CQXC 4JI1T 3AE3A 5H6RB 1KF6A 4DR3T 2QYWA 2NW9A 2EHOD 5EK3A 4B3TT 3VR9A 4A5XA 1Z0PA 2D0TA 3N9PA 2V7JA 2PFVA 4DUZT 3MKDA 2LSGA 3JADA 3OVUA 1HS7A 3ZCIA 1HNWT 5LOVE 4I50E 3VRAA 3QC9A 1WR0A 1D0ZA 4XBFB 3EAMA 1VCTA 4O4IE 1W0AA 2WM9A 3RIAA 2YU1A 5L3CB 5FY1A 3AA6B 4DV3T 1LRZA 4HFBA 3TKLB 4OYKA 2VK9A 3PUGA 3AEEA 2Y8DA 3PUVF 4G63A 2KMFA 2WP9A 2X66A 4M1PA 1BR4A 4ZS2A 1W0BA 4HTEA 5HCMA 2X0YA 4HEAA 4U3CA 5A1LA 3B5MA 4I4TE 5AQJB 2UU9T 2CRBA 2VVNA 3RIUA 1HCIA 2PTFA 2IHR1 2E2AA 4JI6T 2D5UA 2W0GA 3FZHB 2XQ5A 4JBWF 3M65A 4IGUA 5FY0A 5JDFA 3KFWX 2XHEB 1WCRA 1SE7A 4B6XA 5LGUB 1UUSA 2V7MA 5LJNA 3HKCE 2LSKA 5ABHA 4LF7T 2BBHA 1MMNA 3I9WA 4WYVA 1FMWA 3K1SA 4JEUB 2CWOA 5AQTB 2XQYA 3AA7B 3QB5A 4I43B 2E8IA 1B7TA 4NUVA 4KHPT 2R6GF 5AQRB 4GOUA 2D9DA 1US7B 3L8RA 2WMOA 4LFAT 3B57A 1E1HB 4UF0A 4A56A 3UTKA 3N9LA 4GKKT 3N2KE 5HEGA 2WWVA 4UR9A 2SPCA 4TWDA 4PJMA 3UULA 3AA0B 5KMGP 3FBLA 4IT4A 3KBTA 2H88A 5J0ZA 3PUYF 2V5CA 2BG9A 3KV6A 1HNXT 2W00A 3A5XA 5LBQB 4IE7A 1UCUA 1KNPA 4LF5T 3CK6A 3CQGB 4JI2T 2KWIB 1OEDE 4U72A 4CN1A 3BQIA 5L3DB 2WU2A 4ILCA 5JDNA 4EYYR 4H9PC 4YSXA 5M4YA 2WCAA 3L3PA 5HXRA 4B3RT 3NRYA 4HWHA 3KV4A 3P8CD 5L3EB 2LRKA 3JC6D 4KMCA 2ZM6T 4UIGA 1WR6A 3HI2A 4PAGA 2NW7A 4JI0T 3AEFA 4YXDA 2Q9QC 4MFRA 4AIUA 3AVRA 5ADXL 3PDYA 1ZKEA 3LK3B 3PURA 3KBUA 2V6YA 2A9UA 2WY2A 4DV1T 3AAIA 2LM9A 3GN5B 5HEJA 1HTJF 3FZLB 3RYFE 4JYAT 1WFDA 1LVFA 2CLYC 4QXCB 2JMHA 5KXJA 4U2ZA 4WBOA 4DV4T 2CBIA 3PUQA 2VKOA 4IDOA 2X51A 4ZI2C 4TN7B 5FXWA 5L2LA 3GWHA 3U78A 3FZFB 5JRCB 4WNKA 4BA9A 2W62A 3OPCA 5FNVE 3RI5A 2KINB 2JRKA 4TNVA 1L0VA 4UEMA 5FXZA 4DR5T 2CBJA 2OLTA 3RYHE 4C90A 4HN9A 3SS1A 3AXJB 4COFA 4U74A 1NAFA 1IAPA 2I59A 4TZ4C 1Z8UA 2IDOB 4QH1A 3G06A 5DQVA 4JI3T 1KEYA 4UVBB 2B76A 4L5GA 4H9NC 3SOLA 2LLYA 2ODVA 5FY7A 3ZMSB 3ZCJA 1UURA 4CI1B 3MZKB 1U5PA 3NBXX 4OYJA 4WBNE 2X9XA 4I0UA 4EOZB 1W09A 3CPZA 4NUUA 2X67A 3C51A 5HAXA 3PU3A 4IHJE 2K3WA 2FJAA 2CWYA 4AQGA 3O1IA 4UELA 3LBXB 2F4VT 5LCYA 5LXTE 3CWZB 4GYRA 4E7SA 1QUUA 3S4UA 2CHOA 3LDQB 1YQ4A 4AKIA 1WYBA 1YQ3A 1IBMT 1KK7A 4H9QC 5AQHB 3ZKRA 3N2GE 2LKHA 5ABFA 4DR7T 2ZMAA 4ZI3C 2C5IT 5JR9A 2XQ4A 5LA6E 3FXEB 3RHWA 2ZLYA 3RIFA 3H3MA 4NIQA 4KUMB 3Q5WA 2WMNA 2JQHA 5JDGA 1IBLT 1MIWA 3J7Yq 2NTXA 3R84B 2WAUA 3F2EA 3SRZA 2KWHA 3Q5DA 4YJ3E 4P0BA 2K5BB 3AAAB 2EHOA 1ZV4X 4YTNA 2NR4A 4LFCT 1FMVA 4CXYA 3QK6A 3NRXA 2VQET 3OBVE 4YFSA 1NENA 2YU2A 3VHLA 2AE9A 3EI0A 2MTQA 4DVDA 1FIOA 3TLSA 4X20E 2XAQB 2H7OA 4LFBT 3AE9A 1NEKA 2AXDS 1MNDA 3I9YA 2W66A 2MYSA 3RLFF 5LGNB 2WBLA 5E0OA 3RRCA 2IC9A 3UU5A 3OKQA 2NOXA 3I1AA 4AKGA 5H6QB 1IJ5A 4L0RA 4UV9B 2D2SA 1S94A 1D1BA 4JI4T 2XM2A 4DV0T 4O4JE 2VB6A 3M3ZB 1KNRA 5LMNT 2KNDA 4EEBA 5DQWA 2L8KA 5JR9C 4OHFA 2DLRA 3KDSE 2JJ9A 4ZOLE 3CIRA 4CN4A 1XNQT 2N2NA 1IJ6A 3JAFA 4WW0A 2CPTA 5L3FB 3PE0A 4IE0A 1XWMA 3QUJA 4HFHA 1Y01A 2E9XB 4UVCB 2LSYA 2Y48B 4MLKA 3UUBA 2EHOC 2HPLA 5HXHA 1WLXA 4QH5A 2ACZA 4H9RC 3IF8B 1I94T 4DV7T 1I6ZA 4AKHA 2E9XD 3EDVA 3RX6A 4AISA 5LG3A 2UXXB 4X1YE 4CZZB 2WS3A 5BR8T 4EB6E 1HG2A 3H37A 3DJBA 4WZXA 4CXWA 1GQEA 1MMDA 3KV5A 2FUPA 2P9BA 3VR8A 1T98A 3SFEA 3HKDE 4YJ2E 1QSDA 3EUHA 1OEDA 2OA5A 2RPAA 3ONXA 2A2FX 2UUBT 3SFDA 5LHHB 3AE4A 2CXDA 2D0UA 5LNKA 1KFYA 2LSJA 2H7VC 5HWYA 3ONLC 3K3NA 1E2AA 2LHRA 2VWAA 4E7ZA 2E5VA 2WDQA 3LSVA 5AQUB 3UUNA 3N2OA 3KINB 3FZMB 4ZHQE 4ADZA 2LT3A 2XSAA 2V6XA 3AE1A 4EAHA 4ZXLA 4YLHA 1ZP0A 1J5ET 5FYMA 1VOMA 4MALA 5J1GA 5IHYA 4LF8T 3P4SA 3ESLA 4O4HE 3ZYKA 3CVRA 4DR2T 1JNRA 2WQYA
chains in the Genus database with same CATH topology
2X0LB 3PUQA 2VKOA 1CUNA 4QX7B 2X51A 4ZI2C 1OXZA 3NZQA 2YEVC 4TN7B 5FXWA 5L2LA 3GWHA 3CMLA 4TX5A 3E22E 2L9QA 4AXPA 2CM0A 5JDLA 3UUXB 3U78A 4AQFC 2DI4A 3W15B 4QWNB 5JRCB 4BJMA 4WNKA 4N78D 3KVAA 5FXXA 1YD8G 4I55E 4PK5A 4BA9A 3K3QC 3LJCA 1OWAA 2W62A 2YINA 3RKOA 4MHCA 5FNVE 3IBPA 4QHOA 2KINB 4H9SE 2JRKA 5L3GB 3P7IA 5BMVE 5LJMA 1D0YA 2CMRA 4IE6A 3FHNA 4UEMA 3V5SA 4ASKA 5FXZA 4ILUA 2XAFB 4X1IE 2ZM8A 3GA8A 1ZHCA 4EZHA 1O3XA 2VKJA 3T8OA 2WWUA 3RYHE 5JDQA 4C90A 2NP9A 1AJ3A 3GN5A 4UXNB 3CX7B 2G0UA 3RYCE 3MJXA 2L3LA 3UUMA 4OK0A 4HN9A 3SS1A 1X79A 1HX8A 4FI5A 5CA1E 2H3RA 4U74A 5DJQC 1NAFA 1IAPA 3RRWA 3ZPOA 2C5KT 3LFMA 3WAJA 3MK7C 2I59A 3OYZA 2X68A 4TZ4C 2LEHA 3Q2MA 3CX8B 4GIWA 2VASA 4FJOA 4ANJA 3KV9A 5DQVA 2BVMA 2BDEA 2C0SA 1D1CA 5C8YE 1VRBA 2Q9QB 4UVBB 3SWHA 3VU7H 4F6RC 2GK9A 2E9XC 1FEWA 4L5GA 4H9NC 3SOLA 4DNDA 5HXCA 2JMKA 2ODVA 5FY7A 3BQLA 3ZMSB 3ZCJA 2JPFA 4IIJE 3N9QA 2X9HA 3UFEA 1SA0E 4Z8XA 4EXTA 2CEAA 4CI1B 3O9XA 4UV8B 3MZKB 4PJLA 3HKBE 2ACXA 5JRCA 1U5PA 2Q9QD 4HE8A 4UVAB 5LHGB 4ZS3A 3NBXX 5LP6E 4QX8B 4OYJA 4O2BE 3WAKA 4WBNE 2X9XA 5LHIB 5JR9B 3C50A 2X9WA 4EOZB 5HXEA 3CPZA 4NUUA 4GK0E 2B1EA 2X67A 3AA1B 4H63H 3C51A 2CLYB 1D0XA 5HAXA 2PG8A 3HR0A 4ERRA 3FBZA 1KNZA 5HYAA 2YK0A 3HKEE 3C4WA 3PU3A 2A3DA 2LSIA 4IHJE 2UXNB 4ISSA 1MNEA 5IYZE 5JREA 2XAJB 2KLQA 4AKLA 1HFAA 2CWYA 3R6NA 2CA5A 4O4LE 2LJLA 2V7LA 4AQGA 3O1IA 2IW5B 4UELA 1U4QA 3RPUA 4YHJA 3LBXB 3N9MA 4XAXB 4JEHB 3ZYLA 5LCYA 5LXTE 2XUEA 3CWZB 3EVYA 3OYXA 2V7KA 2K24A 4C91A 1YKEB 2XASB 4ZI2D 2RP4A 3IEEA 4GYRA 4E7SA 1QUUA 2EHOB 3AAEB 4ZI7E 5JH7E 3ZC0A 4PK4A 1G73A 3CQXC 3JC6C 3S4UA 3IHRA 2DWKA 5H6RB 2Q9QA 2ES0A 4AKIA 2NW9A 2LHNA 3I0OA 2EHOD 1WYBA 5EK3A 2HH7A 5LGTB 3C64A 1KK7A 3CKDA 2CXFA 4HGAA 2M67A 4H9QC 3OJAA 1Z0PA 2D0TA 3N2GE 3N9PA 3VKHA 1YKHB 2V7JA 2NTYA 2ZMAA 2IC6A 2PFVA 4ZI3C 2C5IT 3E08A 2CXLA 3MKDA 2LSGA 2XTLA 5JR9A 4HFVA 5LA6E 3FXEB 4CI3B 4DBQA 2ZLYA 3PTRB 1HS7A 3NZPA 4KBMB 1BR0A 2LOSA 3ZCIA 4PJNA 3ZMVB 4KUMB 2VKDA 3K3OA 5LOVE 2CE7A 1H7CA 4I50E 3QC9A 1D0ZA 3Q5WA 2WMNA 2RA1A 4IE4A 2XAHB 5JDGA 1WYCA 1MIYA 5TAOA 4AQFA 4XBFB 1MIWA 4O4IE 2WM9A 3C98B 3LBXA 3J7Yq 2NTXA 2YU1A 3R84B 5L3CB 5FY1A 4QXHB 2WAUA 3AA6B 3F2EA 3SRZA 2KWHA 2K48A 4YJ3E 4P0BA 2LOPA 2K5BB 3AAAB 4P0AA 2EHOA 1ZV4X 3ETVA 1LRZA 4QXBB 3TKLB 1FMVA 4OYKA 3QK6A 1LKXA 4CXYA 3PUAA 3DP7A 2N1GA 2VK9A 3NRXA 3PUGA 5J2UE 5JVDE 3OBVE 2Y8DA 4YFSA 4EZ4A 4TUYE 3FXDB 3Q5XA 4X1KE 4G63A 5LG4A 2KMFA 2YU2A 3ZMUB 2A72A 4OFZA 3VHLA 2CCQA 2X66A 4AI6A 4DMVA 3RC3A 5JDHA 4M1PA 1BR4A 4ZS2A 3KVBA 2MTQA 4HTEA 3K8PC 2N9DA 4DVDA 1FIOA 4GK5E 4TV8E 4HEAA 4X20E 5A1LA 2XAQB 5LYJE 4I4TE 2H7OA 4L9IA 1EZ3A 3CX6B 1MNDA 3I9YA 2ZM0A 5CB4E 2JQQA 2MYSA 1HCIA 4UF0B 1V9DA 5LGNB 3ANWB 2WBLA 3AVSA 4O2AE 4PJJA 1WRDA 3E0ZA 5E0OA 1MIVA 2IC9A 3RRCA 1LVKA 2V26A 2D5UA 2W0GA 4PFOA 2PJQA 2XAGB 3OKQA 5EK2A 2NOXA 2C5JA 3C4ZA 3M65A 5AFUL 4IGUA 5FY0A 5JDFA 3KFWX 2XHEB 3I1AA 5DABA 5H6QB 2VKHA 3D0TA 3GMIA 1IJ5A 2WSSV 4G2AA 4AKGA 4XZCA 4L0RA 3V5UA 4B6XA 3RH3A 3Q9DA 5LGUB 5JQGE 3F57A 4IE5A 4IDZA 4UV9B 2V7MA 5LJNA 3HKCE 2D2SA 2LSKA 1S94A 1D1BA 5CA0E 5F3JA 3ZMZB 4DBRA 1MMNA 2DWGA 3I9WA 4O4JE 4ZI3D 3I0QA 2VB6A 1FMWA 5KX5E 4JEUB 2J1DG 2KNDA 2CWOA 5KDMC 2DCFA 5DQWA 2XQYA 3AA7B 4JLEA 1HF8A 2DHRA 2L8KA 3ZC1A 4BJNA 1ZEEA 5JR9C 4OHFA 1IZNB 4I43B 2E8IA 1B7TA 2DLRA 3KDSE 3MXZA 4BAYB 2JJ9A 4ZOLE 4NUVA 3VKGA 4GOUA 1US7B 2N2NA 1IJ6A 2VL8A 2WMOA 3BK9A 3B57A 4WW0A 5L3FB 3PE0A 1E1HB 4IE0A 4UF0A 2NWBA 2W63A 3ANWA 3QUJA 4A56A 3UTKA 4PNIA 2BZBA 2QGSA 2QA7A 4JUYA 3O1HA 4MBQA 4TV9E 2E9XB 3N9LA 4GYSA 2LSYA 4UVCB 5EZYE 3MA9A 3N2KE 2Y48B 2Z6EA 3ZJ1A 3MACA 1UX5A 2MOZA 4MLKA 4HKAA 2EHOC 2HPLA 2Y6XA 4H63V 1WLXA 5HXHA 1SHZC 2SPCA 2DNXA 3PUSA 3UT5E 4H9RC 3IF8B 4AKHA 2E9XD 3ZEFB 4PJMA 4K0UA 3EDUA 1MMAA 3UULA 3AA0B 4CQIA 5KMGP 4J2CA 3EDVA 4H9OC 3RX6A 5J2TE 3FBLA 4ISTA 3KBTA 2UXXB 4X1YE 3N5LA 5FP3A 3ETUA 4CZZB 5HXSA 2NW8A 5ETWA 2ODUA 3KV6A 4EB6E 2W00A 3A5XA 2K9AA 5LBQB 4IE7A 1HG2A 1UCUA 3H37A 1Y64B 2KT9A 3O1JA 1D1AA 3ZMTB 3DJBA 3CQGB 2KWIB 2KXPB 3L09A 1BR1A 4CXWA 4U72A 4PFPA 1MMDA 3KV5A 3BQIA 3F31A 5L3DB 2P9BA 4CXXA 3LK2B 5JDNA 5GONE 4DMWA 3J9X1 1G8XA 1T98A 4H9PC 5FMNA 4EYYR 5M4YA 3HKDE 1MMGA 1BR2A 1NWMX 5LBMA 4YJ2E 1QSDA 3EUHA 1UX4A 1S35A 2OA5A 3L3PA 3ONXA 4PW8A 5HXRA 5EK4A 2A2FX 5HWXA 5JDMA 3NRYA 5LHHB 3O4XE 3AB3B 2KZ7B 2E9XA 2CXDA 2D0UA 5LNKA 3LG7A 3ZYMA 4CI2B 3KV4A 4EIWA 2LSJA 3H3AA 3P8CD 4AKRB 5L3EB 3JC6D 4QKNA 4KMCA 1YW0A 4UIGA 2H7VC 5HWYA 1WR6A 3HA4A 3FB2A 3K3NA 5F8PA 2LHRA 2VWAA 3HI2A 5L3BB 2X9YA 4O8SA 4E7ZA 3CQCB 4PAGA 2NW7A 2V7IA 3UUNA 3N2OA 3KINB 3PU8A 2Q9QC 3ZN1B 4MFRA 4ZHQE 2ZM2A 4ADZA 4DO0A 2LT3A 3N9NA 3AVRA 3HL6A 5ADXL 3PDYA 1ZKEA 4PK6A 1HG5A 3LK3B 3PURA 3U3IA 3RC8A 2IAKA 3KBUA 5FXVA 3RYIE 3C4XA 4EAHA 3AAIA 2LM9A 3GN5B 4YLHA 2MBGA 2BVLA 1HTJF 4KP3C 4WBOA 2LE8A 5FYMA 3ZLIA 3ZN0B 2HPJA 1VOMA 4MALA 3DTOA 5J1GA 3RYFE 3B13A 5IHYA 3LK42 3ESLA 4P09A 1LVFA 2CLYC 3N9OA 2W61A 4O4HE 4QXCB 4EYUA 3ZYKA 2JMHA 3CVRA 3WI3A 4V1Av 2PBIA 3BQKA 2V1DB 3ZJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N C;  4H9R C;  5KDM C;  4H9O C;  4H9S E;  4HGA A;  4H9Q C;  4H9P C; 
#chains in the Genus database with same CATH topology
 4QX7 B;  3T1Y T;  2XQ8 A;  1OED B;  3P4W A;  5JDL A;  2L9Q A;  4AXP A;  3UUX B;  3T1H T;  3AE7 A;  4N78 D;  3KVA A;  1YD8 G;  4I55 E;  3K3Q C;  2VQF T;  4MHC A;  4QHO A;  4YY3 T;  4H9S E;  2BKN A;  2CMR A;  3P50 A;  2ZM8 A;  3GA8 A;  1ZHC A;  2NP9 A;  3GN5 A;  4KHZ F;  2L3L A;  4FI5 A;  4HWC A;  3ZPO A;  3MK7 C;  2X68 A;  1UK5 A;  2LEH A;  3CX8 B;  4GIW A;  4JI5 T;  2VAS A;  1M7K A;  3RIU C;  4YHH T;  5C8Y E;  5HEU A;  5HEO A;  1HX1 B;  1VRB A;  2XPK A;  2Q9Q B;  2YDS A;  3SWH A;  3VU7 H;  4F6R C;  4AQY T;  5FL0 A;  5C3J A;  1FJG T;  2JMK A;  4IDN A;  3O9X A;  3HKB E;  5JRC A;  4P1N A;  2Q9Q D;  5LHG B;  5F5W A;  5LHI B;  5HXE A;  4GK0 E;  3AA1 B;  4H63 H;  2CLY B;  4DR4 T;  3FBZ A;  2YK0 A;  2A3D A;  1M62 A;  2XQ6 A;  2CHN A;  4AKL A;  3R6N A;  3JCF A;  4A97 A;  2IW5 B;  4YHJ A;  2VUR A;  4JV5 T;  3N9M A;  3AXJ A;  3AEA A;  3EVY A;  4NXN T;  4C91 A;  4ZI2 D;  4KI0 F;  4ZI7 E;  3ZC0 A;  3JC6 C;  2DWK A;  2X0H A;  1R8I A;  2XJ7 A;  3I0O A;  2BS2 A;  3C64 A;  3CKD A;  4HGA A;  2M67 A;  2JIW A;  3OJA A;  3VKH A;  4ILB A;  2NTY A;  2IC6 A;  1N34 T;  3E08 A;  2MAW A;  4U7Y A;  4HFV A;  4DBQ A;  3ZT7 A;  2XM1 A;  5FKY A;  3PTR B;  5AQS B;  3NZP A;  4KBM B;  1N33 T;  1BR0 A;  4X62 T;  2LOS A;  4PJN A;  2CE7 A;  1XMQ T;  2BG9 C;  4DV6 T;  5LMU T;  2WZH A;  2XAH B;  1WYC A;  5TAO A;  4AQF A;  3LBX A;  3ZT5 A;  4U33 A;  2K48 A;  2LOP A;  4P0A A;  2LKG A;  2YDR A;  3ETV A;  4TWH A;  4QXB B;  1LKX A;  2V5D A;  4JI7 T;  5JVD E;  1XNR T;  3Q5X A;  4X1K E;  4DR1 T;  5LG4 A;  3ZMU B;  3UU3 A;  2CCQ A;  5JDH A;  5AQO B;  3K8P C;  5HCJ A;  3UQ4 A;  5LYJ E;  3PUZ F;  2V8S V;  3CX6 B;  4EV6 A;  5CB4 E;  4IRE A;  5AQI B;  4HFC A;  3ANW B;  2M6B A;  4O2A E;  4PJJ A;  2BBJ A;  1WRD A;  3AE2 A;  4PFO A;  2PJQ A;  2XAG B;  5EK2 A;  3UQ7 A;  3C4Z A;  2C5J A;  4LF6 T;  5AFU L;  2VKH A;  3D0T A;  3GMI A;  5FL1 A;  2WSS V;  3AE6 A;  3RH3 A;  3F57 A;  4IDZ A;  1N32 T;  5CA0 E;  5F3J A;  3ZMZ B;  4JI8 T;  2IUB A;  4ZI3 D;  4DV2 T;  3I0Q A;  2QRX A;  2UXB T;  5KX5 E;  2I0M A;  4Z90 A;  2J1D G;  2DCF A;  4KX6 A;  1T72 A;  2DHR A;  1ZEE A;  3VRB A;  3MXZ A;  4BAY B;  3VKG A;  2UXC T;  3P4Q A;  3BK9 A;  2VL0 A;  2W63 A;  3TLT A;  2QGS A;  4MBQ A;  3O1H A;  4GYS A;  5AQV B;  2Z6E A;  3ZJ1 A;  3MAC A;  2HHH T;  1DU2 A;  2Y6X A;  3UU8 A;  2UXD T;  2DNX A;  5AQP B;  4LF4 T;  1MMA A;  4DUY T;  3RQU A;  4J2C A;  4IST A;  1T8B A;  3ETU A;  5HXS A;  2LRL A;  5ETW A;  2ODU A;  1E7P A;  2K9A A;  1Y64 B;  2KT9 A;  3O1J A;  3ZMT B;  2BS3 A;  4TWF A;  2YOE A;  3L09 A;  3TLW A;  1W9R A;  4HFD A;  3F31 A;  2KSR A;  4CXX A;  3LK2 B;  5GON E;  4DMW A;  3J9X 1;  5IWA T;  5FMN A;  4ZZB A;  1NWM X;  5LBM A;  1HR0 T;  4HFE A;  4PW8 A;  5EK4 A;  3AEC A;  3AB3 B;  3O4X E;  3OTO T;  2E9X A;  2W4X A;  3ZYM A;  4CI2 B;  3AE8 A;  2J4G A;  4QKN A;  5F8P A;  5L3B B;  2X9Y A;  4O8S A;  2V7I A;  4IL9 A;  3RQW A;  3ZN1 B;  3P4P A;  3HL6 A;  3U3I A;  3RC8 A;  2FJD A;  5FXV A;  3C4X A;  4YTP A;  2BVL A;  4KP3 C;  3ZN0 B;  2XZE A;  2BKP A;  2WDR A;  4EYU A;  3WI3 A;  2X0L B;  1CUN A;  2J47 A;  3NZQ A;  2YEV C;  4TX5 A;  2CM0 A;  2XY8 B;  3W15 B;  4LMJ A;  4BJM A;  4QH4 A;  5FXX A;  4PK5 A;  3NKZ A;  3LJC A;  1OWA A;  2YIN A;  3IBP A;  3ZST A;  3NVO A;  4X66 T;  5L3G B;  3P7I A;  3V5S A;  4ASK A;  2XAF B;  4X1I E;  2IML A;  2VKJ A;  2WWU A;  2I6H A;  3RYC E;  3CX7 B;  2G0U A;  3MJX A;  5L4E A;  3EHZ A;  5CA1 E;  3X1D A;  5DJQ C;  3RRW A;  3LFM A;  3WAJ A;  1N36 T;  4Z91 A;  4YT0 A;  4ANJ A;  5L4H A;  2BVM A;  1D1C A;  1VCS A;  4LML A;  4DR6 T;  2QVA A;  2E9X C;  1FEW A;  4CN6 A;  4HWD A;  4DND A;  5HXC A;  3BQL A;  2JPF A;  4IIJ E;  3N9Q A;  2X9H A;  3UFE A;  1SA0 E;  4EXT A;  5AQK B;  4PJL A;  4UVA B;  4ZS3 A;  4O2B E;  3WAK A;  2B1E A;  1D0X A;  4ERR A;  1KNZ A;  1ZOY A;  2LM2 A;  5HYA A;  3A8Y C;  3C4W A;  3Q5E A;  4GKJ T;  2UXN B;  3ABV A;  1MNE A;  4ISS A;  5IYZ E;  2XAJ B;  2H89 A;  1HFA A;  5C2T A;  2LJL A;  2V7L A;  2XQA A;  1U4Q A;  4U31 A;  3OYX A;  2V7K A;  2K24 A;  4IDQ A;  2XAS B;  3IEE A;  3AAE B;  5JH7 E;  4PK4 A;  2FJB A;  5CGM A;  2Q9Q A;  2ES0 A;  2LHN A;  2HH7 A;  5LGT B;  4HFI A;  2CXF A;  1YKH B;  2CXL A;  2YDQ A;  1XZY A;  2XTL A;  4CI3 B;  3AE5 A;  3ZMV B;  2VKD A;  3K3O A;  1H7C A;  2XSB A;  4ZEY A;  2RA1 A;  4IE4 A;  1UGO A;  1MIY A;  3UU4 A;  3C98 B;  5HEH A;  3ZT6 A;  4YSZ A;  4QXH B;  5ABE A;  4HWF A;  2W67 A;  3PUA A;  3DP7 A;  2XQ3 A;  2N1G A;  5AQG B;  4IDP A;  5J2U E;  1OED C;  2UUA T;  4LMK A;  4EZ4 A;  4TUY E;  3FXD B;  3ZSS A;  2A72 A;  5CJ5 A;  4OFZ A;  3PJA A;  4AI6 A;  4DMV A;  3RC3 A;  5AQN B;  3KVB A;  1XMO T;  2HN1 A;  2J62 A;  2N9D A;  4TV8 E;  4GK5 E;  4IL4 A;  1J1J A;  2DL1 A;  4A98 A;  4L9I A;  1EZ3 A;  5JTG A;  3L39 A;  2ZM0 A;  2JQQ A;  4UF0 B;  1V9D A;  3AVS A;  3E0Z A;  1MIV A;  1LVK A;  2V26 A;  3RF1 A;  2FJE A;  1IBK T;  4X5T A;  2IIU A;  5AQL B;  5DAB A;  4G2A A;  4XZC A;  3V5U A;  3Q9D A;  5JQG E;  2W2U A;  4IE5 A;  3RKG A;  3UFG A;  4DBR A;  2DWG A;  2BS4 A;  2BG9 B;  5KDM C;  4JLE A;  1HF8 A;  4BJN A;  3ZC1 A;  3JAE A;  1IZN B;  5CFB A;  4B3M T;  3EAB A;  4EED A;  3QB5 K;  1T7S A;  2VL8 A;  2UUC T;  2NWB A;  3ANW A;  4PNI A;  2BZB A;  4JUY A;  2QA7 A;  4TV9 E;  5EZY E;  3MA9 A;  3AEG A;  1UX5 A;  2MOZ A;  2XQ9 A;  4HKA A;  4EGW A;  4H63 V;  4X65 T;  2BG9 E;  1SHZ C;  3UT5 E;  3PUS A;  3ZEF B;  4K0U A;  3EDU A;  4CQI A;  3PUW F;  4H9O C;  5J2T E;  3PV0 F;  2WZI A;  3N5L A;  1J5W A;  5FP3 A;  2NW8 A;  2V6Y B;  1D1A A;  4B3S T;  2KXP B;  1BR1 A;  4PFP A;  4X64 T;  3QNU A;  1G8X A;  1MMG A;  1BR2 A;  1UX4 A;  1S35 A;  3ONJ A;  1X9B A;  5FVL A;  5HWX A;  5JDM A;  5LB7 B;  2KZ7 B;  4YSY A;  5ABG A;  3LG7 A;  4EIW A;  2MPK A;  1QLB A;  3H3A A;  2WU5 A;  5AQQ B;  4AKR B;  4NPP A;  1YW0 A;  5FVK A;  3HA4 A;  3FB2 A;  4K0K T;  1HNZ T;  2HN2 A;  3CQC B;  2WB5 A;  3PU8 A;  2ZM2 A;  4DO0 A;  3N9N A;  4YTM A;  4PK6 A;  1HG5 A;  2IAK A;  2YN6 A;  4NXM T;  3RYI E;  4F8H A;  2MBG A;  2LE8 A;  3ZLI A;  2HPJ A;  3DTO A;  3B13 A;  3LK4 2;  4P09 A;  3N9O A;  2W61 A;  2VVS A;  3RGL A;  4DID B;  4V1A v;  5AQM B;  2PBI A;  3BQK A;  3IHR A;  2V1D B;  3ZJ2 A;  1OXZ A;  5L47 A;  3CML A;  3E22 E;  2E5L T;  4ZZC A;  3AEB A;  4AQF C;  2DI4 A;  3AED A;  4QWN B;  2JQK A;  1XDP A;  2FBW A;  3P4R A;  3RKO A;  3IA3 A;  3PJA J;  4OX9 T;  3FZK B;  5BMV E;  5LJM A;  1D0Y A;  4IE6 A;  3FHN A;  4U7I A;  4ILU A;  1XDO A;  4EZH A;  3QOF A;  1O3X A;  3T8O A;  2YKS A;  4HWI B;  5JDQ A;  1AJ3 A;  4UXN B;  3UUM A;  4OK0 A;  1X79 A;  2WDV A;  1HX8 A;  2BKO A;  2H3R A;  4Q25 A;  2C5K T;  3UU6 A;  3OYZ A;  1YXR A;  5AQF B;  3Q2M A;  4FJO A;  3PUX F;  3KV9 A;  2BDE A;  2C0S A;  2OV9 A;  2GK9 A;  1SUM B;  4Z8X A;  2CEA A;  3TLU A;  4UV8 B;  2ACX A;  5ABF B;  4HE8 A;  2JQ9 A;  4LF9 T;  5LP6 E;  4QX8 B;  5JR9 B;  3C50 A;  2X9W A;  4ILA A;  1JNZ A;  2PG8 A;  3HR0 A;  3NWI A;  4TNW A;  3HKE E;  2LSI A;  5JRE A;  2KLQ A;  3TLV A;  2CA5 A;  4O4L E;  3RPU A;  4XAX B;  4JEH B;  3ZYL A;  2XUE A;  4U2Y A;  4DV5 T;  1CHU A;  1YKE B;  5IUX A;  3A7M A;  2RP4 A;  2M6I A;  2EHO B;  1G73 A;  2XQ7 A;  3CQX C;  4JI1 T;  3AE3 A;  5H6R B;  1KF6 A;  4DR3 T;  2QYW A;  2NW9 A;  2EHO D;  5EK3 A;  4B3T T;  3VR9 A;  4A5X A;  1Z0P A;  2D0T A;  3N9P A;  2V7J A;  2PFV A;  4DUZ T;  3MKD A;  2LSG A;  3JAD A;  3OVU A;  1HS7 A;  3ZCI A;  1HNW T;  5LOV E;  4I50 E;  3VRA A;  3QC9 A;  1WR0 A;  1D0Z A;  4XBF B;  3EAM A;  1VCT A;  4O4I E;  1W0A A;  2WM9 A;  3RIA A;  2YU1 A;  5L3C B;  5FY1 A;  3AA6 B;  4DV3 T;  1LRZ A;  4HFB A;  3TKL B;  4OYK A;  2VK9 A;  3PUG A;  3AEE A;  2Y8D A;  3PUV F;  4G63 A;  2KMF A;  2WP9 A;  2X66 A;  4M1P A;  1BR4 A;  4ZS2 A;  1W0B A;  4HTE A;  5HCM A;  2X0Y A;  4HEA A;  4U3C A;  5A1L A;  3B5M A;  4I4T E;  5AQJ B;  2UU9 T;  2CRB A;  2VVN A;  3RIU A;  1HCI A;  2PTF A;  2IHR 1;  2E2A A;  4JI6 T;  2D5U A;  2W0G A;  3FZH B;  2XQ5 A;  4JBW F;  3M65 A;  4IGU A;  5FY0 A;  5JDF A;  3KFW X;  2XHE B;  1WCR A;  1SE7 A;  4B6X A;  5LGU B;  1UUS A;  2V7M A;  5LJN A;  3HKC E;  2LSK A;  5ABH A;  4LF7 T;  2BBH A;  1MMN A;  3I9W A;  4WYV A;  1FMW A;  3K1S A;  4JEU B;  2CWO A;  5AQT B;  2XQY A;  3AA7 B;  3QB5 A;  4I43 B;  2E8I A;  1B7T A;  4NUV A;  4KHP T;  2R6G F;  5AQR B;  4GOU A;  2D9D A;  1US7 B;  3L8R A;  2WMO A;  4LFA T;  3B57 A;  1E1H B;  4UF0 A;  4A56 A;  3UTK A;  3N9L A;  4GKK T;  3N2K E;  5HEG A;  2WWV A;  4UR9 A;  2SPC A;  4TWD A;  4PJM A;  3UUL A;  3AA0 B;  5KMG P;  3FBL A;  4IT4 A;  3KBT A;  2H88 A;  5J0Z A;  3PUY F;  2V5C A;  2BG9 A;  3KV6 A;  1HNX T;  2W00 A;  3A5X A;  5LBQ B;  4IE7 A;  1UCU A;  1KNP A;  4LF5 T;  3CK6 A;  3CQG B;  4JI2 T;  2KWI B;  1OED E;  4U72 A;  4CN1 A;  3BQI A;  5L3D B;  2WU2 A;  4ILC A;  5JDN A;  4EYY R;  4H9P C;  4YSX A;  5M4Y A;  2WCA A;  3L3P A;  5HXR A;  4B3R T;  3NRY A;  4HWH A;  3KV4 A;  3P8C D;  5L3E B;  2LRK A;  3JC6 D;  4KMC A;  2ZM6 T;  4UIG A;  1WR6 A;  3HI2 A;  4PAG A;  2NW7 A;  4JI0 T;  3AEF A;  4YXD A;  2Q9Q C;  4MFR A;  4AIU A;  3AVR A;  5ADX L;  3PDY A;  1ZKE A;  3LK3 B;  3PUR A;  3KBU A;  2V6Y A;  2A9U A;  2WY2 A;  4DV1 T;  3AAI A;  2LM9 A;  3GN5 B;  5HEJ A;  1HTJ F;  3FZL B;  3RYF E;  4JYA T;  1WFD A;  1LVF A;  2CLY C;  4QXC B;  2JMH A;  5KXJ A;  4U2Z A;  4WBO A;  4DV4 T;  2CBI A;  3PUQ A;  2VKO A;  4IDO A;  2X51 A;  4ZI2 C;  4TN7 B;  5FXW A;  5L2L A;  3GWH A;  3U78 A;  3FZF B;  5JRC B;  4WNK A;  4BA9 A;  2W62 A;  3OPC A;  5FNV E;  3RI5 A;  2KIN B;  2JRK A;  4TNV A;  1L0V A;  4UEM A;  5FXZ A;  4DR5 T;  2CBJ A;  2OLT A;  3RYH E;  4C90 A;  4HN9 A;  3SS1 A;  3AXJ B;  4COF A;  4U74 A;  1NAF A;  1IAP A;  2I59 A;  4TZ4 C;  1Z8U A;  2IDO B;  4QH1 A;  3G06 A;  5DQV A;  4JI3 T;  1KEY A;  4UVB B;  2B76 A;  4L5G A;  4H9N C;  3SOL A;  2LLY A;  2ODV A;  5FY7 A;  3ZMS B;  3ZCJ A;  1UUR A;  4CI1 B;  3MZK B;  1U5P A;  3NBX X;  4OYJ A;  4WBN E;  2X9X A;  4I0U A;  4EOZ B;  1W09 A;  3CPZ A;  4NUU A;  2X67 A;  3C51 A;  5HAX A;  3PU3 A;  4IHJ E;  2K3W A;  2FJA A;  2CWY A;  4AQG A;  3O1I A;  4UEL A;  3LBX B;  2F4V T;  5LCY A;  5LXT E;  3CWZ B;  4GYR A;  4E7S A;  1QUU A;  3S4U A;  2CHO A;  3LDQ B;  1YQ4 A;  4AKI A;  1WYB A;  1YQ3 A;  1IBM T;  1KK7 A;  4H9Q C;  5AQH B;  3ZKR A;  3N2G E;  2LKH A;  5ABF A;  4DR7 T;  2ZMA A;  4ZI3 C;  2C5I T;  5JR9 A;  2XQ4 A;  5LA6 E;  3FXE B;  3RHW A;  2ZLY A;  3RIF A;  3H3M A;  4NIQ A;  4KUM B;  3Q5W A;  2WMN A;  2JQH A;  5JDG A;  1IBL T;  1MIW A;  3J7Y q;  2NTX A;  3R84 B;  2WAU A;  3F2E A;  3SRZ A;  2KWH A;  3Q5D A;  4YJ3 E;  4P0B A;  2K5B B;  3AAA B;  2EHO A;  1ZV4 X;  4YTN A;  2NR4 A;  4LFC T;  1FMV A;  4CXY A;  3QK6 A;  3NRX A;  2VQE T;  3OBV E;  4YFS A;  1NEN A;  2YU2 A;  3VHL A;  2AE9 A;  3EI0 A;  2MTQ A;  4DVD A;  1FIO A;  3TLS A;  4X20 E;  2XAQ B;  2H7O A;  4LFB T;  3AE9 A;  1NEK A;  2AXD S;  1MND A;  3I9Y A;  2W66 A;  2MYS A;  3RLF F;  5LGN B;  2WBL A;  5E0O A;  3RRC A;  2IC9 A;  3UU5 A;  3OKQ A;  2NOX A;  3I1A A;  4AKG A;  5H6Q B;  1IJ5 A;  4L0R A;  4UV9 B;  2D2S A;  1S94 A;  1D1B A;  4JI4 T;  2XM2 A;  4DV0 T;  4O4J E;  2VB6 A;  3M3Z B;  1KNR A;  5LMN T;  2KND A;  4EEB A;  5DQW A;  2L8K A;  5JR9 C;  4OHF A;  2DLR A;  3KDS E;  2JJ9 A;  4ZOL E;  3CIR A;  4CN4 A;  1XNQ T;  2N2N A;  1IJ6 A;  3JAF A;  4WW0 A;  2CPT A;  5L3F B;  3PE0 A;  4IE0 A;  1XWM A;  3QUJ A;  4HFH A;  1Y01 A;  2E9X B;  4UVC B;  2LSY A;  2Y48 B;  4MLK A;  3UUB A;  2EHO C;  2HPL A;  5HXH A;  1WLX A;  4QH5 A;  2ACZ A;  4H9R C;  3IF8 B;  1I94 T;  4DV7 T;  1I6Z A;  4AKH A;  2E9X D;  3EDV A;  3RX6 A;  4AIS A;  5LG3 A;  2UXX B;  4X1Y E;  4CZZ B;  2WS3 A;  5BR8 T;  4EB6 E;  1HG2 A;  3H37 A;  3DJB A;  4WZX A;  4CXW A;  1GQE A;  1MMD A;  3KV5 A;  2FUP A;  2P9B A;  3VR8 A;  1T98 A;  3SFE A;  3HKD E;  4YJ2 E;  1QSD A;  3EUH A;  1OED A;  2OA5 A;  2RPA A;  3ONX A;  2A2F X;  2UUB T;  3SFD A;  5LHH B;  3AE4 A;  2CXD A;  2D0U A;  5LNK A;  1KFY A;  2LSJ A;  2H7V C;  5HWY A;  3ONL C;  3K3N A;  1E2A A;  2LHR A;  2VWA A;  4E7Z A;  2E5V A;  2WDQ A;  3LSV A;  5AQU B;  3UUN A;  3N2O A;  3KIN B;  3FZM B;  4ZHQ E;  4ADZ A;  2LT3 A;  2XSA A;  2V6X A;  3AE1 A;  4EAH A;  4ZXL A;  4YLH A;  1ZP0 A;  1J5E T;  5FYM A;  1VOM A;  4MAL A;  5J1G A;  5IHY A;  4LF8 T;  3P4S A;  3ESL A;  4O4H E;  3ZYK A;  3CVR A;  4DR2 T;  1JNR A;  2WQY A; 
#chains in the Genus database with same CATH homology
 2X0L B;  3PUQ A;  2VKO A;  1CUN A;  4QX7 B;  2X51 A;  4ZI2 C;  1OXZ A;  3NZQ A;  2YEV C;  4TN7 B;  5FXW A;  5L2L A;  3GWH A;  3CML A;  4TX5 A;  3E22 E;  2L9Q A;  4AXP A;  2CM0 A;  5JDL A;  3UUX B;  3U78 A;  4AQF C;  2DI4 A;  3W15 B;  4QWN B;  5JRC B;  4BJM A;  4WNK A;  4N78 D;  3KVA A;  5FXX A;  1YD8 G;  4I55 E;  4PK5 A;  4BA9 A;  3K3Q C;  3LJC A;  1OWA A;  2W62 A;  2YIN A;  3RKO A;  4MHC A;  5FNV E;  3IBP A;  4QHO A;  2KIN B;  4H9S E;  2JRK A;  5L3G B;  3P7I A;  5BMV E;  5LJM A;  1D0Y A;  2CMR A;  4IE6 A;  3FHN A;  4UEM A;  3V5S A;  4ASK A;  5FXZ A;  4ILU A;  2XAF B;  4X1I E;  2ZM8 A;  3GA8 A;  1ZHC A;  4EZH A;  1O3X A;  2VKJ A;  3T8O A;  2WWU A;  3RYH E;  5JDQ A;  4C90 A;  2NP9 A;  1AJ3 A;  3GN5 A;  4UXN B;  3CX7 B;  2G0U A;  3RYC E;  3MJX A;  2L3L A;  3UUM A;  4OK0 A;  4HN9 A;  3SS1 A;  1X79 A;  1HX8 A;  4FI5 A;  5CA1 E;  2H3R A;  4U74 A;  5DJQ C;  1NAF A;  1IAP A;  3RRW A;  3ZPO A;  2C5K T;  3LFM A;  3WAJ A;  3MK7 C;  2I59 A;  3OYZ A;  2X68 A;  4TZ4 C;  2LEH A;  3Q2M A;  3CX8 B;  4GIW A;  2VAS A;  4FJO A;  4ANJ A;  3KV9 A;  5DQV A;  2BVM A;  2BDE A;  2C0S A;  1D1C A;  5C8Y E;  1VRB A;  2Q9Q B;  4UVB B;  3SWH A;  3VU7 H;  4F6R C;  2GK9 A;  2E9X C;  1FEW A;  4L5G A;  4H9N C;  3SOL A;  4DND A;  5HXC A;  2JMK A;  2ODV A;  5FY7 A;  3BQL A;  3ZMS B;  3ZCJ A;  2JPF A;  4IIJ E;  3N9Q A;  2X9H A;  3UFE A;  1SA0 E;  4Z8X A;  4EXT A;  2CEA A;  4CI1 B;  3O9X A;  4UV8 B;  3MZK B;  4PJL A;  3HKB E;  2ACX A;  5JRC A;  1U5P A;  2Q9Q D;  4HE8 A;  4UVA B;  5LHG B;  4ZS3 A;  3NBX X;  5LP6 E;  4QX8 B;  4OYJ A;  4O2B E;  3WAK A;  4WBN E;  2X9X A;  5LHI B;  5JR9 B;  3C50 A;  2X9W A;  4EOZ B;  5HXE A;  3CPZ A;  4NUU A;  4GK0 E;  2B1E A;  2X67 A;  3AA1 B;  4H63 H;  3C51 A;  2CLY B;  1D0X A;  5HAX A;  2PG8 A;  3HR0 A;  4ERR A;  3FBZ A;  1KNZ A;  5HYA A;  2YK0 A;  3HKE E;  3C4W A;  3PU3 A;  2A3D A;  2LSI A;  4IHJ E;  2UXN B;  4ISS A;  1MNE A;  5IYZ E;  5JRE A;  2XAJ B;  2KLQ A;  4AKL A;  1HFA A;  2CWY A;  3R6N A;  2CA5 A;  4O4L E;  2LJL A;  2V7L A;  4AQG A;  3O1I A;  2IW5 B;  4UEL A;  1U4Q A;  3RPU A;  4YHJ A;  3LBX B;  3N9M A;  4XAX B;  4JEH B;  3ZYL A;  5LCY A;  5LXT E;  2XUE A;  3CWZ B;  3EVY A;  3OYX A;  2V7K A;  2K24 A;  4C91 A;  1YKE B;  2XAS B;  4ZI2 D;  2RP4 A;  3IEE A;  4GYR A;  4E7S A;  1QUU A;  2EHO B;  3AAE B;  4ZI7 E;  5JH7 E;  3ZC0 A;  4PK4 A;  1G73 A;  3CQX C;  3JC6 C;  3S4U A;  3IHR A;  2DWK A;  5H6R B;  2Q9Q A;  2ES0 A;  4AKI A;  2NW9 A;  2LHN A;  3I0O A;  2EHO D;  1WYB A;  5EK3 A;  2HH7 A;  5LGT B;  3C64 A;  1KK7 A;  3CKD A;  2CXF A;  4HGA A;  2M67 A;  4H9Q C;  3OJA A;  1Z0P A;  2D0T A;  3N2G E;  3N9P A;  3VKH A;  1YKH B;  2V7J A;  2NTY A;  2ZMA A;  2IC6 A;  2PFV A;  4ZI3 C;  2C5I T;  3E08 A;  2CXL A;  3MKD A;  2LSG A;  2XTL A;  5JR9 A;  4HFV A;  5LA6 E;  3FXE B;  4CI3 B;  4DBQ A;  2ZLY A;  3PTR B;  1HS7 A;  3NZP A;  4KBM B;  1BR0 A;  2LOS A;  3ZCI A;  4PJN A;  3ZMV B;  4KUM B;  2VKD A;  3K3O A;  5LOV E;  2CE7 A;  1H7C A;  4I50 E;  3QC9 A;  1D0Z A;  3Q5W A;  2WMN A;  2RA1 A;  4IE4 A;  2XAH B;  5JDG A;  1WYC A;  1MIY A;  5TAO A;  4AQF A;  4XBF B;  1MIW A;  4O4I E;  2WM9 A;  3C98 B;  3LBX A;  3J7Y q;  2NTX A;  2YU1 A;  3R84 B;  5L3C B;  5FY1 A;  4QXH B;  2WAU A;  3AA6 B;  3F2E A;  3SRZ A;  2KWH A;  2K48 A;  4YJ3 E;  4P0B A;  2LOP A;  2K5B B;  3AAA B;  4P0A A;  2EHO A;  1ZV4 X;  3ETV A;  1LRZ A;  4QXB B;  3TKL B;  1FMV A;  4OYK A;  3QK6 A;  1LKX A;  4CXY A;  3PUA A;  3DP7 A;  2N1G A;  2VK9 A;  3NRX A;  3PUG A;  5J2U E;  5JVD E;  3OBV E;  2Y8D A;  4YFS A;  4EZ4 A;  4TUY E;  3FXD B;  3Q5X A;  4X1K E;  4G63 A;  5LG4 A;  2KMF A;  2YU2 A;  3ZMU B;  2A72 A;  4OFZ A;  3VHL A;  2CCQ A;  2X66 A;  4AI6 A;  4DMV A;  3RC3 A;  5JDH A;  4M1P A;  1BR4 A;  4ZS2 A;  3KVB A;  2MTQ A;  4HTE A;  3K8P C;  2N9D A;  4DVD A;  1FIO A;  4GK5 E;  4TV8 E;  4HEA A;  4X20 E;  5A1L A;  2XAQ B;  5LYJ E;  4I4T E;  2H7O A;  4L9I A;  1EZ3 A;  3CX6 B;  1MND A;  3I9Y A;  2ZM0 A;  5CB4 E;  2JQQ A;  2MYS A;  1HCI A;  4UF0 B;  1V9D A;  5LGN B;  3ANW B;  2WBL A;  3AVS A;  4O2A E;  4PJJ A;  1WRD A;  3E0Z A;  5E0O A;  1MIV A;  2IC9 A;  3RRC A;  1LVK A;  2V26 A;  2D5U A;  2W0G A;  4PFO A;  2PJQ A;  2XAG B;  3OKQ A;  5EK2 A;  2NOX A;  2C5J A;  3C4Z A;  3M65 A;  5AFU L;  4IGU A;  5FY0 A;  5JDF A;  3KFW X;  2XHE B;  3I1A A;  5DAB A;  5H6Q B;  2VKH A;  3D0T A;  3GMI A;  1IJ5 A;  2WSS V;  4G2A A;  4AKG A;  4XZC A;  4L0R A;  3V5U A;  4B6X A;  3RH3 A;  3Q9D A;  5LGU B;  5JQG E;  3F57 A;  4IE5 A;  4IDZ A;  4UV9 B;  2V7M A;  5LJN A;  3HKC E;  2D2S A;  2LSK A;  1S94 A;  1D1B A;  5CA0 E;  5F3J A;  3ZMZ B;  4DBR A;  1MMN A;  2DWG A;  3I9W A;  4O4J E;  4ZI3 D;  3I0Q A;  2VB6 A;  1FMW A;  5KX5 E;  4JEU B;  2J1D G;  2KND A;  2CWO A;  5KDM C;  2DCF A;  5DQW A;  2XQY A;  3AA7 B;  4JLE A;  1HF8 A;  2DHR A;  2L8K A;  3ZC1 A;  4BJN A;  1ZEE A;  5JR9 C;  4OHF A;  1IZN B;  4I43 B;  2E8I A;  1B7T A;  2DLR A;  3KDS E;  3MXZ A;  4BAY B;  2JJ9 A;  4ZOL E;  4NUV A;  3VKG A;  4GOU A;  1US7 B;  2N2N A;  1IJ6 A;  2VL8 A;  2WMO A;  3BK9 A;  3B57 A;  4WW0 A;  5L3F B;  3PE0 A;  1E1H B;  4IE0 A;  4UF0 A;  2NWB A;  2W63 A;  3ANW A;  3QUJ A;  4A56 A;  3UTK A;  4PNI A;  2BZB A;  2QGS A;  2QA7 A;  4JUY A;  3O1H A;  4MBQ A;  4TV9 E;  2E9X B;  3N9L A;  4GYS A;  2LSY A;  4UVC B;  5EZY E;  3MA9 A;  3N2K E;  2Y48 B;  2Z6E A;  3ZJ1 A;  3MAC A;  1UX5 A;  2MOZ A;  4MLK A;  4HKA A;  2EHO C;  2HPL A;  2Y6X A;  4H63 V;  1WLX A;  5HXH A;  1SHZ C;  2SPC A;  2DNX A;  3PUS A;  3UT5 E;  4H9R C;  3IF8 B;  4AKH A;  2E9X D;  3ZEF B;  4PJM A;  4K0U A;  3EDU A;  1MMA A;  3UUL A;  3AA0 B;  4CQI A;  5KMG P;  4J2C A;  3EDV A;  4H9O C;  3RX6 A;  5J2T E;  3FBL A;  4IST A;  3KBT A;  2UXX B;  4X1Y E;  3N5L A;  5FP3 A;  3ETU A;  4CZZ B;  5HXS A;  2NW8 A;  5ETW A;  2ODU A;  3KV6 A;  4EB6 E;  2W00 A;  3A5X A;  2K9A A;  5LBQ B;  4IE7 A;  1HG2 A;  1UCU A;  3H37 A;  1Y64 B;  2KT9 A;  3O1J A;  1D1A A;  3ZMT B;  3DJB A;  3CQG B;  2KWI B;  2KXP B;  3L09 A;  1BR1 A;  4CXW A;  4U72 A;  4PFP A;  1MMD A;  3KV5 A;  3BQI A;  3F31 A;  5L3D B;  2P9B A;  4CXX A;  3LK2 B;  5JDN A;  5GON E;  4DMW A;  3J9X 1;  1G8X A;  1T98 A;  4H9P C;  5FMN A;  4EYY R;  5M4Y A;  3HKD E;  1MMG A;  1BR2 A;  1NWM X;  5LBM A;  4YJ2 E;  1QSD A;  3EUH A;  1UX4 A;  1S35 A;  2OA5 A;  3L3P A;  3ONX A;  4PW8 A;  5HXR A;  5EK4 A;  2A2F X;  5HWX A;  5JDM A;  3NRY A;  5LHH B;  3O4X E;  3AB3 B;  2KZ7 B;  2E9X A;  2CXD A;  2D0U A;  5LNK A;  3LG7 A;  3ZYM A;  4CI2 B;  3KV4 A;  4EIW A;  2LSJ A;  3H3A A;  3P8C D;  4AKR B;  5L3E B;  3JC6 D;  4QKN A;  4KMC A;  1YW0 A;  4UIG A;  2H7V C;  5HWY A;  1WR6 A;  3HA4 A;  3FB2 A;  3K3N A;  5F8P A;  2LHR A;  2VWA A;  3HI2 A;  5L3B B;  2X9Y A;  4O8S A;  4E7Z A;  3CQC B;  4PAG A;  2NW7 A;  2V7I A;  3UUN A;  3N2O A;  3KIN B;  3PU8 A;  2Q9Q C;  3ZN1 B;  4MFR A;  4ZHQ E;  2ZM2 A;  4ADZ A;  4DO0 A;  2LT3 A;  3N9N A;  3AVR A;  3HL6 A;  5ADX L;  3PDY A;  1ZKE A;  4PK6 A;  1HG5 A;  3LK3 B;  3PUR A;  3U3I A;  3RC8 A;  2IAK A;  3KBU A;  5FXV A;  3RYI E;  3C4X A;  4EAH A;  3AAI A;  2LM9 A;  3GN5 B;  4YLH A;  2MBG A;  2BVL A;  1HTJ F;  4KP3 C;  4WBO A;  2LE8 A;  5FYM A;  3ZLI A;  3ZN0 B;  2HPJ A;  1VOM A;  4MAL A;  3DTO A;  5J1G A;  3RYF E;  3B13 A;  5IHY A;  3LK4 2;  3ESL A;  4P09 A;  1LVF A;  2CLY C;  3N9O A;  2W61 A;  4O4H E;  4QXC B;  4EYU A;  3ZYK A;  2JMH A;  3CVR A;  3WI3 A;  4V1A v;  2PBI A;  3BQK A;  2V1D B;  3ZJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...