4H9QB

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9qB00
4H9RB 1ULYA 1M19B 3WTPA 3UTBB 4M6BA 3AN2B 3KUYD 3KUYC 2AROB 3WTPE 1ID3D 5B33B 1HQ3B 2F8NB 3AZIB 5BO0B 5BNXB 4J8XD 4J8XC 3VH5T 1M18D 1JFIA 2BYKA 3TU4D 2HUEB 3TU4C 3W98A 2L5AA 1P3GD 3A6NB 3AZJB 3UTAD 4NE3A 4XZQD 3REKB 1M1AA 4ZBJB 4NFTA 5B1LB 5B1MD 3AV1D 2PYOB 4YM6B 5GXQB 3V9RB 3AZMA 3MGQB 1P3PD 4QLCA 5AV8D 3W98C 5BNVB 3O62D 5AV5B 3X1UD 5AV6A 3UT9A 1P3AD 4WNNB 1N1JB 1EQZA 3KXBD 4X23A 3REHA 1M1AD 1M1AC 3W97D 3X1SA 3MNNB 5AVCD 3WAAB 3REIB 4CAYA 4WU8A 3W96A 4HGAB 5B0YC 4H9PB 5B0YD 1P3KA 2RVQD 2YFVA 4QLCC 1R4VA 5GSUB 5CP6A 4NE5A 3KWQD 3KWQC 3AZGA 5B32A 3LJAD 3LJAC 3UT9C 3KSYA 3C1CB 1EQZD 1EQZC 5DNNB 2F8NH 3B6GA 1P3OA 4Z66B 4WU9A 4X23D 5E5AB 3B0CW 4X23C 4XUJD 3MGSA 3REHC 3REHD 5DNMA 1TZYD 1TZYC 5BS7A 4R8PD 3X1SC 1ZLAD 3B0DB 5AV9A 3AV2D 4WU8C 4YS3B 3W96C 2FJ7D 5CPIB 4KGCC 4KGCD 5GT0B 2HIOD 2HIOC 1P3KC 5FUGB 4H9OB 5B2JA 5CP6C 5B2ID 5B2IC 3WA9C 3WA9D 3RELD 3AZGC 5B32C 3X1TB 3AZFD 3B6GC 1P3OC 1P3LB 4WU9C 3X1VD 3X1VC 1P3MD 3MGSD 3MGSC 5AVBD 1KX3B 5DNMC 5BS7C 5AY8A 3C1BB 1P3FA 1AOID 3AZEA 3MGPB 4J8WD 1U35A 5AV9C 4CSRA 2CV5A 5B40D 1KX4B 5B2JD 5B2JC 4J8UD 3LZ0D 4J8UC 3AYWA 1S32B 2NQBB 1P34D 1F66D 1P3BB 1F66C 5B31D 4Z5TB 3LZ1A 3W99A 3VH6A 3AZHA 4EO5B 3AFAB 4LD9B 2BYMB 5AY8C 5CPKA 5JRGB 3MGRB 3AZEC 5B0ZA 5F99A 2NZDD 2CV5D 2CV5C 1P3ID 3AZNA 3MVDA 3AYWC 5GT3D 5GT3C 3LELA 3AZLD 5C3IB 1KX5A 3AZKD 5BT1D 3KUYB 3NQJA 3LZ1C 3W99C 3AZHC 4UUZB 3B6FA 5CPKC 1H3OB 1ID3B 3VH6W 5B0ZC 4H9RA 5B32G 1M19A 3UTBA 1HTAA 1WWIA 3AZNC 3AN2A 3MVDC 4J8XB 1M18B 4J8VD 4J8VC 3LELC 1KX5C 2AROA 3TU4B 1P3GB 3UTAB 3WTPD 3WTPC 4G92C 4XZQB 5B33A 3B6FC 1HQ3A 2F8NA 3AZIA 5BO0A 5BNXA 5KDMB 5B24B 5B1MB 3UTBC 3AV1B 3AN2C 2AROC 4G91B 3A6NA 3AZJA 1P3PB 1BH9B 5AV8B 5CPJB 3O62B 5G49B 3X1UB 1P3AB 3REKA 3KXBB 5B33C 3W98D 5B1LA 3R45B 4ZUXB 3W97B 2PYOA 4YM6A 5GXQA 5AVCB 3V9RA 3MGQA 3REJB 2HUEC 5B0YB 5BNVA 4WV4B 5AV5A 3A6NC 4E45A 4WNNA 1N1JA 3KWQB 3LJAB 3REKC 3AZMD 1F1EA 3AZMC 1EQZB 4Z2MH 4ZBJC 4QLCD 5B1LD 4H9NB 5B1LC 4XUJB 3MNNA 1TZYB 3WAAA 3REIA 5AV6D 5AV6C 4R8PB 3UT9D 4YM6C 1ZLAB 5GXQD 5GXQC 4H9PA 3AV2B 5GSUA 2FJ7B 4KGCB 2HIOB 3X1SD 5AV5C 3C1CA 5B2IB 3WA9B 5DNNA 3RELB 4Z66A 4WU8D 3W96D 5E5AA 1P3KD 3AZFB 5JA4B 5CP6D 3X1VB 1P3MB 5AVBB 3WAAC 3REIC 3AZGD 5B32D 4JJNB 1AOIB 1TAFB 4YS3A 3B6GD 4H9QB 5CPIA 4Z2MG 5GT0A 1P3OD 4WU9D 4J8WB 5FUGA 4H9SA 4H9OA 5GSUC 5DNMD 5B40B 2F8NG 4J8UB 3LZ0B 3C1CC 3X1TA 5DNNC 5AV9D 1P34B 1F66B 4Z66C 1P3LA 4KUDB 5B31B 5E5AC 3B0CT 1KX3A 4AWLB 3C1BA 1A7WA 3MGPA 3WKJB 2YFWB 2NZDB 4H9SC 1S32A 1KX4A 2NQBA 1P3IB 5AY8D 1P3FD 1P3FC 3AZED 1P3BA 5GT3B 3AZLB 3X1TC 1U35D 3VH5A 3AZKB 3NQUB 1U35C 4Z5TA 1P3LC 4LD9A 3AFAA 1KX3C 2BYMA 3AYWD 5JRGA 3MGRA 3MGPC 1Q9CA 4KHAB 3LZ1D 3W99D 3AZHD 4DRAA 1KX4C 1S32C 2NQBC 5CPKD 1BH8B 1P3BC 4J8VB 5B0ZD 5F99D 5F99C 3KUYA 4Z5TC 4LD9C 4EO5C 3AFAC 2JSSA 3AZND 3MVDD 4UUZA 1H3OA 3VH5W 3WTPB 3LELD 3MGRC 1KX5D 1ID3A 2IO5C 4J8XA 1M18A 1WWSA 3B6FD 5C3IC 3TU4A 1P3GA 3UTAA 1M19D 1M19C 3UTBD 3AN2D 4XZQA 1JFIB 1ID3C 2AROD 2BYKB 3VH6T 5KDMA 3W98B 5B24A 5B1MA 3AV1A 1M18C 5B33D 1P3PA 1HQ3D 1HQ3C 1BH9A 1M1AB 2F8ND 5AV8A 3AZID 3AZIC 5CPJA 1P3GC 3O62A 5G49A 3X1UA 3UTAC 1P3AA 5B31G 3KXBA 4XZQC 3R45A 4ZUXA 3AZMB 3W97A 3A6ND 3AZJD 3AZJC 4QLCB 5B24D 5B24C 5B1MC 5AVCA 5AV6B 3UT9B 3REJA 3AV1C 3REKD 5B0YA 4G91C 4X23B 3REHB 1P3PC 5CPJD 5AV8C 5CPJC 2PYOD 2PYOC 3X1SB 3O62C 3KWQA 3X1UC 4DRBA 4YM6D 3LJAA 1P3AC 3MGQD 3MGQC 3KXBC 4CAYB 4WU8B 3W96B 4H9NA 4XUJA 4ZUXD 4ZUXC 1P3KB 1TZYA 5AV5D 3W97C 4R8PA 2YFVB 5CP6B 1ZLAA 5AVCC 3AZGB 5B32B 3REJD 3REJC 2LY8A 3AV2A 4KGCA 2FJ7A 3B6GB 4WZSB 1P3OB 2HIOA 4WU9B 3MNND 3MNNC 3MGSB 2RVQC 5DNMB 3WAAD 5B2IA 3REID 3WA9A 2F8NK 3RELA 1BFMA 4HGAC 3AZFA 5AV9B 5JA4A 5GSUD 3X1VA 1P3MA 4XUJC 5AVBA 4JJNA 4R8PC 5B2JB 3C1CD 1TAFA 1AOIA 5DNND 1ZLAC 4H9QA 4Z66D 4J8WA 5E5AD 3AV2C 2FJ7C 5B40A 1B6WA 3B0DC 4J8UA 3LZ0A 5AY8B 1P3FB 1P34A 3RELC 1F66A 3AZEB 4YS3D 4YS3C 4KUDA 5B31A 5CPID 5CPIC 5GT0D 5GT0C 1U35B 3AZFC 4CSRB 2CV5B 1P3MC 3WKJA 5AVBC 4JJND 4JJNC 3AYWB 2YFWA 3X1TD 1AOIC 1P3LD 4J8WC 1KX3D 2NZDA 1P3IA 3C1BD 3C1BC 3LZ1B 2CWEA 5B40C 3AZHB 3W99B 3MGPD 5GT3A 3AZLA 3LZ0C 5CPKB 3AZKA 3NQUA 1P34C 3B0BA 4KUDD 4KUDC 5B31C 5B0ZB 5F99B 4AWLC 1KX4D 1S32D 2NQBD 1B67A 3WKJD 3WKJC 3AZNB 3MVDB 1P3BD 1KU5A 3LELB 1KX5B 4KHAA 4Z5TD 2IO5B 4LD9D 3AFAD 2NZDC 4NE6A 3NQJB 1P3IC 1BH8A 5JRGD 5JRGC 3MGRD 4G92B 4J8VA 3AZLC 3B6FB 4E44A 3AZKC 5CHLB 5BT1C
chains in the Genus database with same CATH superfamily
3FDDA 4H9RB 1ULYA 1M19B 3WTPA 3UTBB 4M6BA 3AN2B 3KUYD 3KUYC 2AROB 3H0RC 3WTPE 1ID3D 2F2AC 5B33B 1HQ3B 2F8NB 3AZIB 5BO0B 5BNXB 4J8XD 4J8XC 3VH5T 1M18D 1JFIA 2BYKA 3TU4D 2HUEB 3TU4C 3W98A 2L5AA 1P3GD 3A6NB 3AZJB 3UTAD 4NE3A 4XZQD 3REKB 1M1AA 4ZBJB 4NFTA 5B1LB 5B1MD 2DF4C 3AV1D 2PYOB 4YM6B 5GXQB 3V9RB 3AZMA 3MGQB 1P3PD 4QLCA 5AV8D 3W98C 5BNVB 3O62D 5AV5B 3X1UD 5AV6A 3UT9A 1P3AD 4WNNB 1N1JB 1EQZA 3KXBD 4X23A 3REHA 1M1AD 1M1AC 3W97D 3X1SA 3MNNB 5AVCD 3WAAB 3REIB 4CAYA 2W8SA 4WU8A 3W96A 4HGAB 5B0YC 4H9PB 5B0YD 1P3KA 3A1IA 2RVQD 2YFVA 4QLCC 5CP6A 1R4VA 5GSUB 4NE5A 3KWQD 3KWQC 3AZGA 5B32A 3LJAD 3LJAC 3UT9C 3KFUG 3KSYA 3C1CB 1EQZD 1EQZC 5DNNB 2F8NH 3B6GA 1P3OA 4Z66B 4WU9A 4X23D 5E5AB 2Y2GA 3B0CW 4XUJD 4X23C 3MGSA 3REHC 5DNMA 1TZYD 1TZYC 5BS7A 2DQNC 4R8PD 3X1SC 1KX3B 1ZLAD 3B0DB 5AV9A 3AV2D 4WU8C 4YS3B 3W96C 2FJ7D 2Y2NA 5CPIB 4KGCC 5GT0B 2HIOD 2HIOC 1P3KC 5FUGB 4H9OB 5B2JA 5CP6C 5B2ID 5B2IC 3WA9C 3WA9D 3RELD 3AZGC 5B32C 3X1TB 2Y2KA 3AZFD 2FFFB 3B6GC 1P3OC 1P3LB 4WU9C 2JCHA 4KGCD 3X1VD 3X1VC 1P3MD 3MGSD 2Y2IA 5AVBD 3MGSC 5DNMC 5BS7C 5AY8A 3C1BB 1P3FA 1AOID 3AZEA 3MGPB 4J8WD 1U35A 5AV9C 2ZY3A 4CSRA 2CV5A 5B40D 2Y2OA 1KX4B 5B2JD 5B2JC 4J8UD 3LZ0D 4J8UC 3AYWA 1S32B 2NQBB 2Y2QA 1P34D 1F66D 1P3BB 1F66C 5B31D 4Z5TB 3LZ1A 3W99A 3VH6A 3AZHA 4EO5B 3AFAB 4LD9B 3REHD 2BYMB 5AY8C 5CPKA 5JRGB 3MGRB 3AZEC 5B0ZA 5F99A 2NZDD 2CV5D 2CV5C 1P3ID 3AZNA 3MVDA 3AYWC 5GT3D 5GT3C 3LELA 3AZLD 5C3IB 1KX5A 3AZKD 5BT1D 3KUYB 3NQJA 3LZ1C 3W99C 3AZHC 2XD1A 4UUZB 3B6FA 5CPKC 1H3OB 1ID3B 3VH6W 5B0ZC 4H9RA 5B32G 1M19A 3UTBA 1HTAA 1WWIA 3AZNC 3AN2A 3MVDC 4J8XB 1M18B 4J8VD 4J8VC 3LELC 1KX5C 2AROA 3TU4B 1P3GB 3EPHA 1Z2CB 3UTAB 3WTPD 3WTPC 4G92C 4XZQB 5B33A 3B6FC 1HQ3A 2F8NA 3AZIA 4WJ3C 5BO0A 5BNXA 5KDMB 2Y2MA 5B24B 5B1MB 3UTBC 1PZRA 3AV1B 3AN2C 2AROC 4G91B 3A6NA 3AZJA 1P3PB 1BH9B 5AV8B 5CPJB 3O62B 5G49B 3X1UB 1P3AB 3REKA 3KXBB 2J8PA 5B33C 3W98D 5B1LA 3R45B 4ZUXB 3W97B 1T3UA 2PYOA 4YM6A 5GXQA 5AVCB 3V9RA 3MGQA 3REJB 2HUEC 3H0LC 5B0YB 5BNVA 4WV4B 5AV5A 3A6NC 2ZM5A 4E45A 4WNNA 1N1JA 3KWQB 3LJAB 3REKC 3AZMD 1F1EA 3AZMC 1EQZB 4Z2MH 3F6TA 4ZBJC 4QLCD 5B1LD 4H9NB 5B1LC 4XUJB 3MNNA 1TZYB 3WAAA 3REIA 5AV6D 5AV6C 4R8PB 3UT9D 4YM6C 3P5JB 1ZLAB 5GXQD 5GXQC 4H9PA 3AV2B 5GSUA 2FJ7B 4KGCB 3EPJA 2HIOB 3X1SD 5AV5C 3C1CA 5B2IB 3WA9B 5DNNA 3RELB 2BG1A 4Z66A 4WU8D 3W96D 5E5AA 1P3KD 3AZFB 5JA4B 5CP6D 3X1VB 1P3MB 5AVBB 3WAAC 3REIC 3AZGD 5B32D 4JJNB 1AOIB 1TAFB 4YS3A 3B6GD 4H9QB 5CPIA 4Z2MG 2JE5A 5GT0A 4WU9D 4J8WB 1P3OD 5FUGA 4H9SA 4H9OA 5GSUC 5DNMD 5B40B 2F8NG 4J8UB 3LZ0B 3C1CC 3X1TA 5DNNC 5AV9D 1P34B 1F66B 4Z66C 1P3LA 4KUDB 5B31B 5E5AC 3B0CT 1KX3A 4AWLB 2ZY4A 3H0MC 3C1BA 1A7WA 3MGPA 3WKJB 2YFWB 2NZDB 4H9SC 1S32A 1KX4A 2NQBA 1P3IB 5AY8D 1P3FD 1P3FC 3AZED 1P3BA 5GT3B 4DQYB 3AZLB 3X1TC 1U35D 3VH5A 3AZKB 3NQUB 1U35C 4Z5TA 1P3LC 4LD9A 3AFAA 1KX3C 2BYMA 3AYWD 5JRGA 3MGRA 3AL0C 3MGPC 1Q9CA 4KHAB 3LZ1D 3W99D 3AZHD 4DRAA 1KX4C 1S32C 2NQBC 5CPKD 1BH8B 1P3BC 4J8VB 5B0ZD 5F99D 5F99C 3KUYA 4Z5TC 4LD9C 4EO5C 3AFAC 2JSSA 3AZND 4UPKA 3MVDD 4UUZA 1H3OA 3VH5W 3WTPB 3LELD 3MGRC 1KX5D 1ID3A 2Y2LA 2IO5C 4J8XA 1M18A 1WWSA 3B6FD 5C3IC 3TU4A 2UWXA 1P3GA 2G5HC 3UTAA 1M19C 1M19D 3UTBD 2Y2PA 3AN2D 4XZQA 3EPLA 1JFIB 1ID3C 2AROD 2BYKB 3VH6T 5KDMA 3W98B 5B24A 5B1MA 3AV1A 1M18C 5B33D 1P3PA 1HQ3D 1HQ3C 1BH9A 1M1AB 2F8ND 5AV8A 3AZID 3AZIC 5CPJA 3A1KA 1P3GC 3O62A 5G49A 3X1UA 3UTAC 1P3AA 5B31G 2RIQA 2Y2JA 3KXBA 4XZQC 3R45A 4ZUXA 3AZMB 3W97A 3A6ND 3AZJD 3AZJC 4QLCB 5B24D 5B24C 5B1MC 5AVCA 5AV6B 3UT9B 3REJA 3AV1C 3REKD 2ZY5A 5B0YA 4G91C 4X23B 3REHB 1P3PC 5CPJD 5AV8C 5CPJC 2PYOD 2PYOC 3X1SB 3O62C 3KWQA 3X1UC 4DRBA 4YM6D 3LJAA 1P3AC 3MGQD 3MGQC 3KXBC 4CAYB 4WU8B 3W96B 4H9NA 4XUJA 4ZUXD 4ZUXC 1P3KB 1TZYA 5AV5D 3W97C 4R8PA 2YFVB 1W2EA 5CP6B 1ZLAA 5AVCC 3AZGB 5B32B 3REJD 3REJC 3IP4C 2LY8A 3AV2A 4KGCA 2FJ7A 3B6GB 2ZY2A 4WZSB 1P3OB 2HIOA 4WU9B 3MNND 3MNNC 3MGSB 2RVQC 2G5IC 5DNMB 3WAAD 5B2IA 3REID 3WA9A 2F8NK 3RELA 1BFMA 4HGAC 3AZFA 5AV9B 5JA4A 5GSUD 3EG5B 3X1VA 1P3MA 4XUJC 5AVBA 2VQRA 4JJNA 4R8PC 5B2JB 3C1CD 1TAFA 1AOIA 5DNND 1ZLAC 4H9QA 4Z66D 4J8WA 5E5AD 3AV2C 2FJ7C 5B40A 1B6WA 3B0DC 4J8UA 3LZ0A 5AY8B 1P3FB 1P34A 3RELC 1F66A 2Y2HA 4YS3D 4YS3C 3AZEB 5B31A 4KUDA 5CPID 5CPIC 5GT0D 5GT0C 1U35B 3AZFC 4CSRB 2CV5B 1P3MC 3WKJA 5AVBC 4JJND 4JJNC 3AYWB 2YFWA 3X1TD 1AOIC 1P3LD 4J8WC 1KX3D 2NZDA 2XD5A 1P3IA 3C1BD 3C1BC 3LZ1B 2CWEA 5B40C 3AZHB 3W99B 3MGPD 5GT3A 3AZLA 3LZ0C 5CPKB 3AZKA 3NQUA 1P34C 3B0BA 4KUDD 4KUDC 5B31C 5B0ZB 5F99B 4AWLC 1KX4D 1S32D 2NQBD 1B67A 3WKJD 3WKJC 3AZNB 3MVDB 1P3BD 1KU5A 3LELB 1KX5B 4KHAA 4Z5TD 3EPKA 2IO5B 4LD9D 3AFAD 2NZDC 4NE6A 3NQJB 1P3IC 1BH8A 5JRGD 5JRGC 3MGRD 4G92B 4J8VA 3AZLC 3B6FB 4E44A 3AZKC 5CHLB 5BT1C
chains in the Genus database with same CATH topology
3FDDA 4H9RB 1ULYA 1M19B 3WTPA 3UTBB 4M6BA 3AN2B 3KUYD 3KUYC 2AROB 3H0RC 3WTPE 1ID3D 2F2AC 5B33B 1HQ3B 2F8NB 3AZIB 5BO0B 5BNXB 4J8XD 4J8XC 3VH5T 1M18D 1JFIA 2BYKA 3TU4D 2HUEB 3TU4C 3W98A 2L5AA 1P3GD 3A6NB 3AZJB 3UTAD 4NE3A 4XZQD 3REKB 1M1AA 4ZBJB 4NFTA 5B1LB 5B1MD 2DF4C 3AV1D 2PYOB 4YM6B 5GXQB 3V9RB 3AZMA 3MGQB 1P3PD 4QLCA 5AV8D 3W98C 5BNVB 3O62D 5AV5B 3X1UD 5AV6A 3UT9A 1P3AD 4WNNB 1N1JB 1EQZA 3KXBD 4X23A 3REHA 1M1AD 1M1AC 3W97D 3X1SA 3MNNB 5AVCD 3WAAB 3REIB 4CAYA 2W8SA 4WU8A 3W96A 4HGAB 5B0YC 4H9PB 5B0YD 1P3KA 3A1IA 2RVQD 2YFVA 4QLCC 5CP6A 1R4VA 5GSUB 4NE5A 3KWQD 3KWQC 3AZGA 5B32A 3LJAD 3LJAC 3UT9C 3KFUG 3KSYA 3C1CB 1EQZD 1EQZC 5DNNB 2F8NH 3B6GA 1P3OA 4Z66B 4WU9A 4X23D 5E5AB 2Y2GA 3B0CW 4XUJD 4X23C 3MGSA 3REHC 5DNMA 1TZYD 1TZYC 5BS7A 2DQNC 4R8PD 3X1SC 1KX3B 1ZLAD 3B0DB 5AV9A 3AV2D 4WU8C 4YS3B 3W96C 2FJ7D 2Y2NA 5CPIB 4KGCC 5GT0B 2HIOD 2HIOC 1P3KC 5FUGB 4H9OB 5B2JA 5CP6C 5B2ID 5B2IC 3WA9C 3WA9D 3RELD 3AZGC 5B32C 3X1TB 2Y2KA 3AZFD 2FFFB 3B6GC 1P3OC 1P3LB 4WU9C 2JCHA 4KGCD 3X1VD 3X1VC 1P3MD 3MGSD 2Y2IA 5AVBD 3MGSC 5DNMC 5BS7C 5AY8A 3C1BB 1P3FA 1AOID 3AZEA 3MGPB 4J8WD 1U35A 5AV9C 2ZY3A 4CSRA 2CV5A 5B40D 2Y2OA 1KX4B 5B2JD 5B2JC 4J8UD 3LZ0D 4J8UC 3AYWA 1S32B 2NQBB 2Y2QA 1P34D 1F66D 1P3BB 1F66C 5B31D 4Z5TB 3LZ1A 3W99A 3VH6A 3AZHA 4EO5B 3AFAB 4LD9B 3REHD 2BYMB 5AY8C 5CPKA 5JRGB 3MGRB 3AZEC 5B0ZA 5F99A 2NZDD 2CV5D 2CV5C 1P3ID 3AZNA 3MVDA 3AYWC 5GT3D 5GT3C 3LELA 3AZLD 5C3IB 1KX5A 3AZKD 5BT1D 3KUYB 3NQJA 3LZ1C 3W99C 3AZHC 2XD1A 4UUZB 3B6FA 5CPKC 1H3OB 1ID3B 3VH6W 5B0ZC 4H9RA 5B32G 1M19A 3UTBA 1HTAA 1WWIA 3AZNC 3AN2A 3MVDC 4J8XB 1M18B 4J8VD 4J8VC 3LELC 1KX5C 2AROA 3TU4B 1P3GB 3EPHA 1Z2CB 3UTAB 3WTPD 3WTPC 4G92C 4XZQB 5B33A 3B6FC 1HQ3A 2F8NA 3AZIA 4WJ3C 5BO0A 5BNXA 5KDMB 2Y2MA 5B24B 5B1MB 3UTBC 1PZRA 3AV1B 3AN2C 2AROC 4G91B 3A6NA 3AZJA 1P3PB 1BH9B 5AV8B 5CPJB 3O62B 5G49B 3X1UB 1P3AB 3REKA 3KXBB 2J8PA 5B33C 3W98D 5B1LA 3R45B 4ZUXB 3W97B 1T3UA 2PYOA 4YM6A 5GXQA 5AVCB 3V9RA 3MGQA 3REJB 2HUEC 3H0LC 5B0YB 5BNVA 4WV4B 5AV5A 3A6NC 2ZM5A 4E45A 4WNNA 1N1JA 3KWQB 3LJAB 3REKC 3AZMD 1F1EA 3AZMC 1EQZB 4Z2MH 3F6TA 4ZBJC 4QLCD 5B1LD 4H9NB 5B1LC 4XUJB 3MNNA 1TZYB 3WAAA 3REIA 5AV6D 5AV6C 4R8PB 3UT9D 4YM6C 3P5JB 1ZLAB 5GXQD 5GXQC 4H9PA 3AV2B 5GSUA 2FJ7B 4KGCB 3EPJA 2HIOB 3X1SD 5AV5C 3C1CA 5B2IB 3WA9B 5DNNA 3RELB 2BG1A 4Z66A 4WU8D 3W96D 5E5AA 1P3KD 3AZFB 5JA4B 5CP6D 3X1VB 1P3MB 5AVBB 3WAAC 3REIC 3AZGD 5B32D 4JJNB 1AOIB 1TAFB 4YS3A 3B6GD 4H9QB 5CPIA 4Z2MG 2JE5A 5GT0A 4WU9D 4J8WB 1P3OD 5FUGA 4H9SA 4H9OA 5GSUC 5DNMD 5B40B 2F8NG 4J8UB 3LZ0B 3C1CC 3X1TA 5DNNC 5AV9D 1P34B 1F66B 4Z66C 1P3LA 4KUDB 5B31B 5E5AC 3B0CT 1KX3A 4AWLB 2ZY4A 3H0MC 3C1BA 1A7WA 3MGPA 3WKJB 2YFWB 2NZDB 4H9SC 1S32A 1KX4A 2NQBA 1P3IB 5AY8D 1P3FD 1P3FC 3AZED 1P3BA 5GT3B 4DQYB 3AZLB 3X1TC 1U35D 3VH5A 3AZKB 3NQUB 1U35C 4Z5TA 1P3LC 4LD9A 3AFAA 1KX3C 2BYMA 3AYWD 5JRGA 3MGRA 3AL0C 3MGPC 1Q9CA 4KHAB 3LZ1D 3W99D 3AZHD 4DRAA 1KX4C 1S32C 2NQBC 5CPKD 1BH8B 1P3BC 4J8VB 5B0ZD 5F99D 5F99C 3KUYA 4Z5TC 4LD9C 4EO5C 3AFAC 2JSSA 3AZND 4UPKA 3MVDD 4UUZA 1H3OA 3VH5W 3WTPB 3LELD 3MGRC 1KX5D 1ID3A 2Y2LA 2IO5C 4J8XA 1M18A 1WWSA 3B6FD 5C3IC 3TU4A 2UWXA 1P3GA 2G5HC 3UTAA 1M19C 1M19D 3UTBD 2Y2PA 3AN2D 4XZQA 3EPLA 1JFIB 1ID3C 2AROD 2BYKB 3VH6T 5KDMA 3W98B 5B24A 5B1MA 3AV1A 1M18C 5B33D 1P3PA 1HQ3D 1HQ3C 1BH9A 1M1AB 2F8ND 5AV8A 3AZID 3AZIC 5CPJA 3A1KA 1P3GC 3O62A 5G49A 3X1UA 3UTAC 1P3AA 5B31G 2RIQA 2Y2JA 3KXBA 4XZQC 3R45A 4ZUXA 3AZMB 3W97A 3A6ND 3AZJD 3AZJC 4QLCB 5B24D 5B24C 5B1MC 5AVCA 5AV6B 3UT9B 3REJA 3AV1C 3REKD 2ZY5A 5B0YA 4G91C 4X23B 3REHB 1P3PC 5CPJD 5AV8C 5CPJC 2PYOD 2PYOC 3X1SB 3O62C 3KWQA 3X1UC 4DRBA 4YM6D 3LJAA 1P3AC 3MGQD 3MGQC 3KXBC 4CAYB 4WU8B 3W96B 4H9NA 4XUJA 4ZUXD 4ZUXC 1P3KB 1TZYA 5AV5D 3W97C 4R8PA 2YFVB 1W2EA 5CP6B 1ZLAA 5AVCC 3AZGB 5B32B 3REJD 3REJC 3IP4C 2LY8A 3AV2A 4KGCA 2FJ7A 3B6GB 2ZY2A 4WZSB 1P3OB 2HIOA 4WU9B 3MNND 3MNNC 3MGSB 2RVQC 2G5IC 5DNMB 3WAAD 5B2IA 3REID 3WA9A 2F8NK 3RELA 1BFMA 4HGAC 3AZFA 5AV9B 5JA4A 5GSUD 3EG5B 3X1VA 1P3MA 4XUJC 5AVBA 2VQRA 4JJNA 4R8PC 5B2JB 3C1CD 1TAFA 1AOIA 5DNND 1ZLAC 4H9QA 4Z66D 4J8WA 5E5AD 3AV2C 2FJ7C 5B40A 1B6WA 3B0DC 4J8UA 3LZ0A 5AY8B 1P3FB 1P34A 3RELC 1F66A 2Y2HA 4YS3D 4YS3C 3AZEB 5B31A 4KUDA 5CPID 5CPIC 5GT0D 5GT0C 1U35B 3AZFC 4CSRB 2CV5B 1P3MC 3WKJA 5AVBC 4JJND 4JJNC 3AYWB 2YFWA 3X1TD 1AOIC 1P3LD 4J8WC 1KX3D 2NZDA 2XD5A 1P3IA 3C1BD 3C1BC 3LZ1B 2CWEA 5B40C 3AZHB 3W99B 3MGPD 5GT3A 3AZLA 3LZ0C 5CPKB 3AZKA 3NQUA 1P34C 3B0BA 4KUDD 4KUDC 5B31C 5B0ZB 5F99B 4AWLC 1KX4D 1S32D 2NQBD 1B67A 3WKJD 3WKJC 3AZNB 3MVDB 1P3BD 1KU5A 3LELB 1KX5B 4KHAA 4Z5TD 3EPKA 2IO5B 4LD9D 3AFAD 2NZDC 4NE6A 3NQJB 1P3IC 1BH8A 5JRGD 5JRGC 3MGRD 4G92B 4J8VA 3AZLC 3B6FB 4E44A 3AZKC 5CHLB 5BT1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R B;  1ULY A;  1M19 B;  3WTP A;  3UTB B;  4M6B A;  3AN2 B;  3KUY D;  3KUY C;  2ARO B;  3WTP E;  1ID3 D;  5B33 B;  1HQ3 B;  2F8N B;  3AZI B;  5BO0 B;  5BNX B;  4J8X D;  4J8X C;  3VH5 T;  1M18 D;  1JFI A;  2BYK A;  3TU4 D;  2HUE B;  3TU4 C;  3W98 A;  2L5A A;  1P3G D;  3A6N B;  3AZJ B;  3UTA D;  4NE3 A;  4XZQ D;  3REK B;  1M1A A;  4ZBJ B;  4NFT A;  5B1L B;  5B1M D;  3AV1 D;  2PYO B;  4YM6 B;  5GXQ B;  3V9R B;  3AZM A;  3MGQ B;  1P3P D;  4QLC A;  5AV8 D;  3W98 C;  5BNV B;  3O62 D;  5AV5 B;  3X1U D;  5AV6 A;  3UT9 A;  1P3A D;  4WNN B;  1N1J B;  1EQZ A;  3KXB D;  4X23 A;  3REH A;  1M1A D;  1M1A C;  3W97 D;  3X1S A;  3MNN B;  5AVC D;  3WAA B;  3REI B;  4CAY A;  4WU8 A;  3W96 A;  4HGA B;  5B0Y C;  4H9P B;  5B0Y D;  1P3K A;  2RVQ D;  2YFV A;  4QLC C;  1R4V A;  5GSU B;  5CP6 A;  4NE5 A;  3KWQ D;  3KWQ C;  3AZG A;  5B32 A;  3LJA D;  3LJA C;  3UT9 C;  3KSY A;  3C1C B;  1EQZ D;  1EQZ C;  5DNN B;  2F8N H;  3B6G A;  1P3O A;  4Z66 B;  4WU9 A;  4X23 D;  5E5A B;  3B0C W;  4X23 C;  4XUJ D;  3MGS A;  3REH C;  3REH D;  5DNM A;  1TZY D;  1TZY C;  5BS7 A;  4R8P D;  3X1S C;  1ZLA D;  3B0D B;  5AV9 A;  3AV2 D;  4WU8 C;  4YS3 B;  3W96 C;  2FJ7 D;  5CPI B;  4KGC C;  4KGC D;  5GT0 B;  2HIO D;  2HIO C;  1P3K C;  5FUG B;  4H9O B;  5B2J A;  5CP6 C;  5B2I D;  5B2I C;  3WA9 C;  3WA9 D;  3REL D;  3AZG C;  5B32 C;  3X1T B;  3AZF D;  3B6G C;  1P3O C;  1P3L B;  4WU9 C;  3X1V D;  3X1V C;  1P3M D;  3MGS D;  3MGS C;  5AVB D;  1KX3 B;  5DNM C;  5BS7 C;  5AY8 A;  3C1B B;  1P3F A;  1AOI D;  3AZE A;  3MGP B;  4J8W D;  1U35 A;  5AV9 C;  4CSR A;  2CV5 A;  5B40 D;  1KX4 B;  5B2J D;  5B2J C;  4J8U D;  3LZ0 D;  4J8U C;  3AYW A;  1S32 B;  2NQB B;  1P34 D;  1F66 D;  1P3B B;  1F66 C;  5B31 D;  4Z5T B;  3LZ1 A;  3W99 A;  3VH6 A;  3AZH A;  4EO5 B;  3AFA B;  4LD9 B;  2BYM B;  5AY8 C;  5CPK A;  5JRG B;  3MGR B;  3AZE C;  5B0Z A;  5F99 A;  2NZD D;  2CV5 D;  2CV5 C;  1P3I D;  3AZN A;  3MVD A;  3AYW C;  5GT3 D;  5GT3 C;  3LEL A;  3AZL D;  5C3I B;  1KX5 A;  3AZK D;  5BT1 D;  3KUY B;  3NQJ A;  3LZ1 C;  3W99 C;  3AZH C;  4UUZ B;  3B6F A;  5CPK C;  1H3O B;  1ID3 B;  3VH6 W;  5B0Z C;  4H9R A;  5B32 G;  1M19 A;  3UTB A;  1HTA A;  1WWI A;  3AZN C;  3AN2 A;  3MVD C;  4J8X B;  1M18 B;  4J8V D;  4J8V C;  3LEL C;  1KX5 C;  2ARO A;  3TU4 B;  1P3G B;  3UTA B;  3WTP D;  3WTP C;  4G92 C;  4XZQ B;  5B33 A;  3B6F C;  1HQ3 A;  2F8N A;  3AZI A;  5BO0 A;  5BNX A;  5KDM B;  5B24 B;  5B1M B;  3UTB C;  3AV1 B;  3AN2 C;  2ARO C;  4G91 B;  3A6N A;  3AZJ A;  1P3P B;  1BH9 B;  5AV8 B;  5CPJ B;  3O62 B;  5G49 B;  3X1U B;  1P3A B;  3REK A;  3KXB B;  5B33 C;  3W98 D;  5B1L A;  3R45 B;  4ZUX B;  3W97 B;  2PYO A;  4YM6 A;  5GXQ A;  5AVC B;  3V9R A;  3MGQ A;  3REJ B;  2HUE C;  5B0Y B;  5BNV A;  4WV4 B;  5AV5 A;  3A6N C;  4E45 A;  4WNN A;  1N1J A;  3KWQ B;  3LJA B;  3REK C;  3AZM D;  1F1E A;  3AZM C;  1EQZ B;  4Z2M H;  4ZBJ C;  4QLC D;  5B1L D;  4H9N B;  5B1L C;  4XUJ B;  3MNN A;  1TZY B;  3WAA A;  3REI A;  5AV6 D;  5AV6 C;  4R8P B;  3UT9 D;  4YM6 C;  1ZLA B;  5GXQ D;  5GXQ C;  4H9P A;  3AV2 B;  5GSU A;  2FJ7 B;  4KGC B;  2HIO B;  3X1S D;  5AV5 C;  3C1C A;  5B2I B;  3WA9 B;  5DNN A;  3REL B;  4Z66 A;  4WU8 D;  3W96 D;  5E5A A;  1P3K D;  3AZF B;  5JA4 B;  5CP6 D;  3X1V B;  1P3M B;  5AVB B;  3WAA C;  3REI C;  3AZG D;  5B32 D;  4JJN B;  1AOI B;  1TAF B;  4YS3 A;  3B6G D;  4H9Q B;  5CPI A;  4Z2M G;  5GT0 A;  1P3O D;  4WU9 D;  4J8W B;  5FUG A;  4H9S A;  4H9O A;  5GSU C;  5DNM D;  5B40 B;  2F8N G;  4J8U B;  3LZ0 B;  3C1C C;  3X1T A;  5DNN C;  5AV9 D;  1P34 B;  1F66 B;  4Z66 C;  1P3L A;  4KUD B;  5B31 B;  5E5A C;  3B0C T;  1KX3 A;  4AWL B;  3C1B A;  1A7W A;  3MGP A;  3WKJ B;  2YFW B;  2NZD B;  4H9S C;  1S32 A;  1KX4 A;  2NQB A;  1P3I B;  5AY8 D;  1P3F D;  1P3F C;  3AZE D;  1P3B A;  5GT3 B;  3AZL B;  3X1T C;  1U35 D;  3VH5 A;  3AZK B;  3NQU B;  1U35 C;  4Z5T A;  1P3L C;  4LD9 A;  3AFA A;  1KX3 C;  2BYM A;  3AYW D;  5JRG A;  3MGR A;  3MGP C;  1Q9C A;  4KHA B;  3LZ1 D;  3W99 D;  3AZH D;  4DRA A;  1KX4 C;  1S32 C;  2NQB C;  5CPK D;  1BH8 B;  1P3B C;  4J8V B;  5B0Z D;  5F99 D;  5F99 C;  3KUY A;  4Z5T C;  4LD9 C;  4EO5 C;  3AFA C;  2JSS A;  3AZN D;  3MVD D;  4UUZ A;  1H3O A;  3VH5 W;  3WTP B;  3LEL D;  3MGR C;  1KX5 D;  1ID3 A;  2IO5 C;  4J8X A;  1M18 A;  1WWS A;  3B6F D;  5C3I C;  3TU4 A;  1P3G A;  3UTA A;  1M19 D;  1M19 C;  3UTB D;  3AN2 D;  4XZQ A;  1JFI B;  1ID3 C;  2ARO D;  2BYK B;  3VH6 T;  5KDM A;  3W98 B;  5B24 A;  5B1M A;  3AV1 A;  1M18 C;  5B33 D;  1P3P A;  1HQ3 D;  1HQ3 C;  1BH9 A;  1M1A B;  2F8N D;  5AV8 A;  3AZI D;  3AZI C;  5CPJ A;  1P3G C;  3O62 A;  5G49 A;  3X1U A;  3UTA C;  1P3A A;  5B31 G;  3KXB A;  4XZQ C;  3R45 A;  4ZUX A;  3AZM B;  3W97 A;  3A6N D;  3AZJ D;  3AZJ C;  4QLC B;  5B24 D;  5B24 C;  5B1M C;  5AVC A;  5AV6 B;  3UT9 B;  3REJ A;  3AV1 C;  3REK D;  5B0Y A;  4G91 C;  4X23 B;  3REH B;  1P3P C;  5CPJ D;  5AV8 C;  5CPJ C;  2PYO D;  2PYO C;  3X1S B;  3O62 C;  3KWQ A;  3X1U C;  4DRB A;  4YM6 D;  3LJA A;  1P3A C;  3MGQ D;  3MGQ C;  3KXB C;  4CAY B;  4WU8 B;  3W96 B;  4H9N A;  4XUJ A;  4ZUX D;  4ZUX C;  1P3K B;  1TZY A;  5AV5 D;  3W97 C;  4R8P A;  2YFV B;  5CP6 B;  1ZLA A;  5AVC C;  3AZG B;  5B32 B;  3REJ D;  3REJ C;  2LY8 A;  3AV2 A;  4KGC A;  2FJ7 A;  3B6G B;  4WZS B;  1P3O B;  2HIO A;  4WU9 B;  3MNN D;  3MNN C;  3MGS B;  2RVQ C;  5DNM B;  3WAA D;  5B2I A;  3REI D;  3WA9 A;  2F8N K;  3REL A;  1BFM A;  4HGA C;  3AZF A;  5AV9 B;  5JA4 A;  5GSU D;  3X1V A;  1P3M A;  4XUJ C;  5AVB A;  4JJN A;  4R8P C;  5B2J B;  3C1C D;  1TAF A;  1AOI A;  5DNN D;  1ZLA C;  4H9Q A;  4Z66 D;  4J8W A;  5E5A D;  3AV2 C;  2FJ7 C;  5B40 A;  1B6W A;  3B0D C;  4J8U A;  3LZ0 A;  5AY8 B;  1P3F B;  1P34 A;  3REL C;  1F66 A;  3AZE B;  4YS3 D;  4YS3 C;  4KUD A;  5B31 A;  5CPI D;  5CPI C;  5GT0 D;  5GT0 C;  1U35 B;  3AZF C;  4CSR B;  2CV5 B;  1P3M C;  3WKJ A;  5AVB C;  4JJN D;  4JJN C;  3AYW B;  2YFW A;  3X1T D;  1AOI C;  1P3L D;  4J8W C;  1KX3 D;  2NZD A;  1P3I A;  3C1B D;  3C1B C;  3LZ1 B;  2CWE A;  5B40 C;  3AZH B;  3W99 B;  3MGP D;  5GT3 A;  3AZL A;  3LZ0 C;  5CPK B;  3AZK A;  3NQU A;  1P34 C;  3B0B A;  4KUD D;  4KUD C;  5B31 C;  5B0Z B;  5F99 B;  4AWL C;  1KX4 D;  1S32 D;  2NQB D;  1B67 A;  3WKJ D;  3WKJ C;  3AZN B;  3MVD B;  1P3B D;  1KU5 A;  3LEL B;  1KX5 B;  4KHA A;  4Z5T D;  2IO5 B;  4LD9 D;  3AFA D;  2NZD C;  4NE6 A;  3NQJ B;  1P3I C;  1BH8 A;  5JRG D;  5JRG C;  3MGR D;  4G92 B;  4J8V A;  3AZL C;  3B6F B;  4E44 A;  3AZK C;  5CHL B;  5BT1 C; 
#chains in the Genus database with same CATH topology
 3FDD A;  4H9R B;  1ULY A;  1M19 B;  3WTP A;  3UTB B;  4M6B A;  3AN2 B;  3KUY D;  3KUY C;  2ARO B;  3H0R C;  3WTP E;  1ID3 D;  2F2A C;  5B33 B;  1HQ3 B;  2F8N B;  3AZI B;  5BO0 B;  5BNX B;  4J8X D;  4J8X C;  3VH5 T;  1M18 D;  1JFI A;  2BYK A;  3TU4 D;  2HUE B;  3TU4 C;  3W98 A;  2L5A A;  1P3G D;  3A6N B;  3AZJ B;  3UTA D;  4NE3 A;  4XZQ D;  3REK B;  1M1A A;  4ZBJ B;  4NFT A;  5B1L B;  5B1M D;  2DF4 C;  3AV1 D;  2PYO B;  4YM6 B;  5GXQ B;  3V9R B;  3AZM A;  3MGQ B;  1P3P D;  4QLC A;  5AV8 D;  3W98 C;  5BNV B;  3O62 D;  5AV5 B;  3X1U D;  5AV6 A;  3UT9 A;  1P3A D;  4WNN B;  1N1J B;  1EQZ A;  3KXB D;  4X23 A;  3REH A;  1M1A D;  1M1A C;  3W97 D;  3X1S A;  3MNN B;  5AVC D;  3WAA B;  3REI B;  4CAY A;  2W8S A;  4WU8 A;  3W96 A;  4HGA B;  5B0Y C;  4H9P B;  5B0Y D;  1P3K A;  3A1I A;  2RVQ D;  2YFV A;  4QLC C;  5CP6 A;  1R4V A;  5GSU B;  4NE5 A;  3KWQ D;  3KWQ C;  3AZG A;  5B32 A;  3LJA D;  3LJA C;  3UT9 C;  3KFU G;  3KSY A;  3C1C B;  1EQZ D;  1EQZ C;  5DNN B;  2F8N H;  3B6G A;  1P3O A;  4Z66 B;  4WU9 A;  4X23 D;  5E5A B;  2Y2G A;  3B0C W;  4XUJ D;  4X23 C;  3MGS A;  3REH C;  5DNM A;  1TZY D;  1TZY C;  5BS7 A;  2DQN C;  4R8P D;  3X1S C;  1KX3 B;  1ZLA D;  3B0D B;  5AV9 A;  3AV2 D;  4WU8 C;  4YS3 B;  3W96 C;  2FJ7 D;  2Y2N A;  5CPI B;  4KGC C;  5GT0 B;  2HIO D;  2HIO C;  1P3K C;  5FUG B;  4H9O B;  5B2J A;  5CP6 C;  5B2I D;  5B2I C;  3WA9 C;  3WA9 D;  3REL D;  3AZG C;  5B32 C;  3X1T B;  2Y2K A;  3AZF D;  2FFF B;  3B6G C;  1P3O C;  1P3L B;  4WU9 C;  2JCH A;  4KGC D;  3X1V D;  3X1V C;  1P3M D;  3MGS D;  2Y2I A;  5AVB D;  3MGS C;  5DNM C;  5BS7 C;  5AY8 A;  3C1B B;  1P3F A;  1AOI D;  3AZE A;  3MGP B;  4J8W D;  1U35 A;  5AV9 C;  2ZY3 A;  4CSR A;  2CV5 A;  5B40 D;  2Y2O A;  1KX4 B;  5B2J D;  5B2J C;  4J8U D;  3LZ0 D;  4J8U C;  3AYW A;  1S32 B;  2NQB B;  2Y2Q A;  1P34 D;  1F66 D;  1P3B B;  1F66 C;  5B31 D;  4Z5T B;  3LZ1 A;  3W99 A;  3VH6 A;  3AZH A;  4EO5 B;  3AFA B;  4LD9 B;  3REH D;  2BYM B;  5AY8 C;  5CPK A;  5JRG B;  3MGR B;  3AZE C;  5B0Z A;  5F99 A;  2NZD D;  2CV5 D;  2CV5 C;  1P3I D;  3AZN A;  3MVD A;  3AYW C;  5GT3 D;  5GT3 C;  3LEL A;  3AZL D;  5C3I B;  1KX5 A;  3AZK D;  5BT1 D;  3KUY B;  3NQJ A;  3LZ1 C;  3W99 C;  3AZH C;  2XD1 A;  4UUZ B;  3B6F A;  5CPK C;  1H3O B;  1ID3 B;  3VH6 W;  5B0Z C;  4H9R A;  5B32 G;  1M19 A;  3UTB A;  1HTA A;  1WWI A;  3AZN C;  3AN2 A;  3MVD C;  4J8X B;  1M18 B;  4J8V D;  4J8V C;  3LEL C;  1KX5 C;  2ARO A;  3TU4 B;  1P3G B;  3EPH A;  1Z2C B;  3UTA B;  3WTP D;  3WTP C;  4G92 C;  4XZQ B;  5B33 A;  3B6F C;  1HQ3 A;  2F8N A;  3AZI A;  4WJ3 C;  5BO0 A;  5BNX A;  5KDM B;  2Y2M A;  5B24 B;  5B1M B;  3UTB C;  1PZR A;  3AV1 B;  3AN2 C;  2ARO C;  4G91 B;  3A6N A;  3AZJ A;  1P3P B;  1BH9 B;  5AV8 B;  5CPJ B;  3O62 B;  5G49 B;  3X1U B;  1P3A B;  3REK A;  3KXB B;  2J8P A;  5B33 C;  3W98 D;  5B1L A;  3R45 B;  4ZUX B;  3W97 B;  1T3U A;  2PYO A;  4YM6 A;  5GXQ A;  5AVC B;  3V9R A;  3MGQ A;  3REJ B;  2HUE C;  3H0L C;  5B0Y B;  5BNV A;  4WV4 B;  5AV5 A;  3A6N C;  2ZM5 A;  4E45 A;  4WNN A;  1N1J A;  3KWQ B;  3LJA B;  3REK C;  3AZM D;  1F1E A;  3AZM C;  1EQZ B;  4Z2M H;  3F6T A;  4ZBJ C;  4QLC D;  5B1L D;  4H9N B;  5B1L C;  4XUJ B;  3MNN A;  1TZY B;  3WAA A;  3REI A;  5AV6 D;  5AV6 C;  4R8P B;  3UT9 D;  4YM6 C;  3P5J B;  1ZLA B;  5GXQ D;  5GXQ C;  4H9P A;  3AV2 B;  5GSU A;  2FJ7 B;  4KGC B;  3EPJ A;  2HIO B;  3X1S D;  5AV5 C;  3C1C A;  5B2I B;  3WA9 B;  5DNN A;  3REL B;  2BG1 A;  4Z66 A;  4WU8 D;  3W96 D;  5E5A A;  1P3K D;  3AZF B;  5JA4 B;  5CP6 D;  3X1V B;  1P3M B;  5AVB B;  3WAA C;  3REI C;  3AZG D;  5B32 D;  4JJN B;  1AOI B;  1TAF B;  4YS3 A;  3B6G D;  4H9Q B;  5CPI A;  4Z2M G;  2JE5 A;  5GT0 A;  4WU9 D;  4J8W B;  1P3O D;  5FUG A;  4H9S A;  4H9O A;  5GSU C;  5DNM D;  5B40 B;  2F8N G;  4J8U B;  3LZ0 B;  3C1C C;  3X1T A;  5DNN C;  5AV9 D;  1P34 B;  1F66 B;  4Z66 C;  1P3L A;  4KUD B;  5B31 B;  5E5A C;  3B0C T;  1KX3 A;  4AWL B;  2ZY4 A;  3H0M C;  3C1B A;  1A7W A;  3MGP A;  3WKJ B;  2YFW B;  2NZD B;  4H9S C;  1S32 A;  1KX4 A;  2NQB A;  1P3I B;  5AY8 D;  1P3F D;  1P3F C;  3AZE D;  1P3B A;  5GT3 B;  4DQY B;  3AZL B;  3X1T C;  1U35 D;  3VH5 A;  3AZK B;  3NQU B;  1U35 C;  4Z5T A;  1P3L C;  4LD9 A;  3AFA A;  1KX3 C;  2BYM A;  3AYW D;  5JRG A;  3MGR A;  3AL0 C;  3MGP C;  1Q9C A;  4KHA B;  3LZ1 D;  3W99 D;  3AZH D;  4DRA A;  1KX4 C;  1S32 C;  2NQB C;  5CPK D;  1BH8 B;  1P3B C;  4J8V B;  5B0Z D;  5F99 D;  5F99 C;  3KUY A;  4Z5T C;  4LD9 C;  4EO5 C;  3AFA C;  2JSS A;  3AZN D;  4UPK A;  3MVD D;  4UUZ A;  1H3O A;  3VH5 W;  3WTP B;  3LEL D;  3MGR C;  1KX5 D;  1ID3 A;  2Y2L A;  2IO5 C;  4J8X A;  1M18 A;  1WWS A;  3B6F D;  5C3I C;  3TU4 A;  2UWX A;  1P3G A;  2G5H C;  3UTA A;  1M19 C;  1M19 D;  3UTB D;  2Y2P A;  3AN2 D;  4XZQ A;  3EPL A;  1JFI B;  1ID3 C;  2ARO D;  2BYK B;  3VH6 T;  5KDM A;  3W98 B;  5B24 A;  5B1M A;  3AV1 A;  1M18 C;  5B33 D;  1P3P A;  1HQ3 D;  1HQ3 C;  1BH9 A;  1M1A B;  2F8N D;  5AV8 A;  3AZI D;  3AZI C;  5CPJ A;  3A1K A;  1P3G C;  3O62 A;  5G49 A;  3X1U A;  3UTA C;  1P3A A;  5B31 G;  2RIQ A;  2Y2J A;  3KXB A;  4XZQ C;  3R45 A;  4ZUX A;  3AZM B;  3W97 A;  3A6N D;  3AZJ D;  3AZJ C;  4QLC B;  5B24 D;  5B24 C;  5B1M C;  5AVC A;  5AV6 B;  3UT9 B;  3REJ A;  3AV1 C;  3REK D;  2ZY5 A;  5B0Y A;  4G91 C;  4X23 B;  3REH B;  1P3P C;  5CPJ D;  5AV8 C;  5CPJ C;  2PYO D;  2PYO C;  3X1S B;  3O62 C;  3KWQ A;  3X1U C;  4DRB A;  4YM6 D;  3LJA A;  1P3A C;  3MGQ D;  3MGQ C;  3KXB C;  4CAY B;  4WU8 B;  3W96 B;  4H9N A;  4XUJ A;  4ZUX D;  4ZUX C;  1P3K B;  1TZY A;  5AV5 D;  3W97 C;  4R8P A;  2YFV B;  1W2E A;  5CP6 B;  1ZLA A;  5AVC C;  3AZG B;  5B32 B;  3REJ D;  3REJ C;  3IP4 C;  2LY8 A;  3AV2 A;  4KGC A;  2FJ7 A;  3B6G B;  2ZY2 A;  4WZS B;  1P3O B;  2HIO A;  4WU9 B;  3MNN D;  3MNN C;  3MGS B;  2RVQ C;  2G5I C;  5DNM B;  3WAA D;  5B2I A;  3REI D;  3WA9 A;  2F8N K;  3REL A;  1BFM A;  4HGA C;  3AZF A;  5AV9 B;  5JA4 A;  5GSU D;  3EG5 B;  3X1V A;  1P3M A;  4XUJ C;  5AVB A;  2VQR A;  4JJN A;  4R8P C;  5B2J B;  3C1C D;  1TAF A;  1AOI A;  5DNN D;  1ZLA C;  4H9Q A;  4Z66 D;  4J8W A;  5E5A D;  3AV2 C;  2FJ7 C;  5B40 A;  1B6W A;  3B0D C;  4J8U A;  3LZ0 A;  5AY8 B;  1P3F B;  1P34 A;  3REL C;  1F66 A;  2Y2H A;  4YS3 D;  4YS3 C;  3AZE B;  5B31 A;  4KUD A;  5CPI D;  5CPI C;  5GT0 D;  5GT0 C;  1U35 B;  3AZF C;  4CSR B;  2CV5 B;  1P3M C;  3WKJ A;  5AVB C;  4JJN D;  4JJN C;  3AYW B;  2YFW A;  3X1T D;  1AOI C;  1P3L D;  4J8W C;  1KX3 D;  2NZD A;  2XD5 A;  1P3I A;  3C1B D;  3C1B C;  3LZ1 B;  2CWE A;  5B40 C;  3AZH B;  3W99 B;  3MGP D;  5GT3 A;  3AZL A;  3LZ0 C;  5CPK B;  3AZK A;  3NQU A;  1P34 C;  3B0B A;  4KUD D;  4KUD C;  5B31 C;  5B0Z B;  5F99 B;  4AWL C;  1KX4 D;  1S32 D;  2NQB D;  1B67 A;  3WKJ D;  3WKJ C;  3AZN B;  3MVD B;  1P3B D;  1KU5 A;  3LEL B;  1KX5 B;  4KHA A;  4Z5T D;  3EPK A;  2IO5 B;  4LD9 D;  3AFA D;  2NZD C;  4NE6 A;  3NQJ B;  1P3I C;  1BH8 A;  5JRG D;  5JRG C;  3MGR D;  4G92 B;  4J8V A;  3AZL C;  3B6F B;  4E44 A;  3AZK C;  5CHL B;  5BT1 C; 
#chains in the Genus database with same CATH homology
 3FDD A;  4H9R B;  1ULY A;  1M19 B;  3WTP A;  3UTB B;  4M6B A;  3AN2 B;  3KUY D;  3KUY C;  2ARO B;  3H0R C;  3WTP E;  1ID3 D;  2F2A C;  5B33 B;  1HQ3 B;  2F8N B;  3AZI B;  5BO0 B;  5BNX B;  4J8X D;  4J8X C;  3VH5 T;  1M18 D;  1JFI A;  2BYK A;  3TU4 D;  2HUE B;  3TU4 C;  3W98 A;  2L5A A;  1P3G D;  3A6N B;  3AZJ B;  3UTA D;  4NE3 A;  4XZQ D;  3REK B;  1M1A A;  4ZBJ B;  4NFT A;  5B1L B;  5B1M D;  2DF4 C;  3AV1 D;  2PYO B;  4YM6 B;  5GXQ B;  3V9R B;  3AZM A;  3MGQ B;  1P3P D;  4QLC A;  5AV8 D;  3W98 C;  5BNV B;  3O62 D;  5AV5 B;  3X1U D;  5AV6 A;  3UT9 A;  1P3A D;  4WNN B;  1N1J B;  1EQZ A;  3KXB D;  4X23 A;  3REH A;  1M1A D;  1M1A C;  3W97 D;  3X1S A;  3MNN B;  5AVC D;  3WAA B;  3REI B;  4CAY A;  2W8S A;  4WU8 A;  3W96 A;  4HGA B;  5B0Y C;  4H9P B;  5B0Y D;  1P3K A;  3A1I A;  2RVQ D;  2YFV A;  4QLC C;  5CP6 A;  1R4V A;  5GSU B;  4NE5 A;  3KWQ D;  3KWQ C;  3AZG A;  5B32 A;  3LJA D;  3LJA C;  3UT9 C;  3KFU G;  3KSY A;  3C1C B;  1EQZ D;  1EQZ C;  5DNN B;  2F8N H;  3B6G A;  1P3O A;  4Z66 B;  4WU9 A;  4X23 D;  5E5A B;  2Y2G A;  3B0C W;  4XUJ D;  4X23 C;  3MGS A;  3REH C;  5DNM A;  1TZY D;  1TZY C;  5BS7 A;  2DQN C;  4R8P D;  3X1S C;  1KX3 B;  1ZLA D;  3B0D B;  5AV9 A;  3AV2 D;  4WU8 C;  4YS3 B;  3W96 C;  2FJ7 D;  2Y2N A;  5CPI B;  4KGC C;  5GT0 B;  2HIO D;  2HIO C;  1P3K C;  5FUG B;  4H9O B;  5B2J A;  5CP6 C;  5B2I D;  5B2I C;  3WA9 C;  3WA9 D;  3REL D;  3AZG C;  5B32 C;  3X1T B;  2Y2K A;  3AZF D;  2FFF B;  3B6G C;  1P3O C;  1P3L B;  4WU9 C;  2JCH A;  4KGC D;  3X1V D;  3X1V C;  1P3M D;  3MGS D;  2Y2I A;  5AVB D;  3MGS C;  5DNM C;  5BS7 C;  5AY8 A;  3C1B B;  1P3F A;  1AOI D;  3AZE A;  3MGP B;  4J8W D;  1U35 A;  5AV9 C;  2ZY3 A;  4CSR A;  2CV5 A;  5B40 D;  2Y2O A;  1KX4 B;  5B2J D;  5B2J C;  4J8U D;  3LZ0 D;  4J8U C;  3AYW A;  1S32 B;  2NQB B;  2Y2Q A;  1P34 D;  1F66 D;  1P3B B;  1F66 C;  5B31 D;  4Z5T B;  3LZ1 A;  3W99 A;  3VH6 A;  3AZH A;  4EO5 B;  3AFA B;  4LD9 B;  3REH D;  2BYM B;  5AY8 C;  5CPK A;  5JRG B;  3MGR B;  3AZE C;  5B0Z A;  5F99 A;  2NZD D;  2CV5 D;  2CV5 C;  1P3I D;  3AZN A;  3MVD A;  3AYW C;  5GT3 D;  5GT3 C;  3LEL A;  3AZL D;  5C3I B;  1KX5 A;  3AZK D;  5BT1 D;  3KUY B;  3NQJ A;  3LZ1 C;  3W99 C;  3AZH C;  2XD1 A;  4UUZ B;  3B6F A;  5CPK C;  1H3O B;  1ID3 B;  3VH6 W;  5B0Z C;  4H9R A;  5B32 G;  1M19 A;  3UTB A;  1HTA A;  1WWI A;  3AZN C;  3AN2 A;  3MVD C;  4J8X B;  1M18 B;  4J8V D;  4J8V C;  3LEL C;  1KX5 C;  2ARO A;  3TU4 B;  1P3G B;  3EPH A;  1Z2C B;  3UTA B;  3WTP D;  3WTP C;  4G92 C;  4XZQ B;  5B33 A;  3B6F C;  1HQ3 A;  2F8N A;  3AZI A;  4WJ3 C;  5BO0 A;  5BNX A;  5KDM B;  2Y2M A;  5B24 B;  5B1M B;  3UTB C;  1PZR A;  3AV1 B;  3AN2 C;  2ARO C;  4G91 B;  3A6N A;  3AZJ A;  1P3P B;  1BH9 B;  5AV8 B;  5CPJ B;  3O62 B;  5G49 B;  3X1U B;  1P3A B;  3REK A;  3KXB B;  2J8P A;  5B33 C;  3W98 D;  5B1L A;  3R45 B;  4ZUX B;  3W97 B;  1T3U A;  2PYO A;  4YM6 A;  5GXQ A;  5AVC B;  3V9R A;  3MGQ A;  3REJ B;  2HUE C;  3H0L C;  5B0Y B;  5BNV A;  4WV4 B;  5AV5 A;  3A6N C;  2ZM5 A;  4E45 A;  4WNN A;  1N1J A;  3KWQ B;  3LJA B;  3REK C;  3AZM D;  1F1E A;  3AZM C;  1EQZ B;  4Z2M H;  3F6T A;  4ZBJ C;  4QLC D;  5B1L D;  4H9N B;  5B1L C;  4XUJ B;  3MNN A;  1TZY B;  3WAA A;  3REI A;  5AV6 D;  5AV6 C;  4R8P B;  3UT9 D;  4YM6 C;  3P5J B;  1ZLA B;  5GXQ D;  5GXQ C;  4H9P A;  3AV2 B;  5GSU A;  2FJ7 B;  4KGC B;  3EPJ A;  2HIO B;  3X1S D;  5AV5 C;  3C1C A;  5B2I B;  3WA9 B;  5DNN A;  3REL B;  2BG1 A;  4Z66 A;  4WU8 D;  3W96 D;  5E5A A;  1P3K D;  3AZF B;  5JA4 B;  5CP6 D;  3X1V B;  1P3M B;  5AVB B;  3WAA C;  3REI C;  3AZG D;  5B32 D;  4JJN B;  1AOI B;  1TAF B;  4YS3 A;  3B6G D;  4H9Q B;  5CPI A;  4Z2M G;  2JE5 A;  5GT0 A;  4WU9 D;  4J8W B;  1P3O D;  5FUG A;  4H9S A;  4H9O A;  5GSU C;  5DNM D;  5B40 B;  2F8N G;  4J8U B;  3LZ0 B;  3C1C C;  3X1T A;  5DNN C;  5AV9 D;  1P34 B;  1F66 B;  4Z66 C;  1P3L A;  4KUD B;  5B31 B;  5E5A C;  3B0C T;  1KX3 A;  4AWL B;  2ZY4 A;  3H0M C;  3C1B A;  1A7W A;  3MGP A;  3WKJ B;  2YFW B;  2NZD B;  4H9S C;  1S32 A;  1KX4 A;  2NQB A;  1P3I B;  5AY8 D;  1P3F D;  1P3F C;  3AZE D;  1P3B A;  5GT3 B;  4DQY B;  3AZL B;  3X1T C;  1U35 D;  3VH5 A;  3AZK B;  3NQU B;  1U35 C;  4Z5T A;  1P3L C;  4LD9 A;  3AFA A;  1KX3 C;  2BYM A;  3AYW D;  5JRG A;  3MGR A;  3AL0 C;  3MGP C;  1Q9C A;  4KHA B;  3LZ1 D;  3W99 D;  3AZH D;  4DRA A;  1KX4 C;  1S32 C;  2NQB C;  5CPK D;  1BH8 B;  1P3B C;  4J8V B;  5B0Z D;  5F99 D;  5F99 C;  3KUY A;  4Z5T C;  4LD9 C;  4EO5 C;  3AFA C;  2JSS A;  3AZN D;  4UPK A;  3MVD D;  4UUZ A;  1H3O A;  3VH5 W;  3WTP B;  3LEL D;  3MGR C;  1KX5 D;  1ID3 A;  2Y2L A;  2IO5 C;  4J8X A;  1M18 A;  1WWS A;  3B6F D;  5C3I C;  3TU4 A;  2UWX A;  1P3G A;  2G5H C;  3UTA A;  1M19 C;  1M19 D;  3UTB D;  2Y2P A;  3AN2 D;  4XZQ A;  3EPL A;  1JFI B;  1ID3 C;  2ARO D;  2BYK B;  3VH6 T;  5KDM A;  3W98 B;  5B24 A;  5B1M A;  3AV1 A;  1M18 C;  5B33 D;  1P3P A;  1HQ3 D;  1HQ3 C;  1BH9 A;  1M1A B;  2F8N D;  5AV8 A;  3AZI D;  3AZI C;  5CPJ A;  3A1K A;  1P3G C;  3O62 A;  5G49 A;  3X1U A;  3UTA C;  1P3A A;  5B31 G;  2RIQ A;  2Y2J A;  3KXB A;  4XZQ C;  3R45 A;  4ZUX A;  3AZM B;  3W97 A;  3A6N D;  3AZJ D;  3AZJ C;  4QLC B;  5B24 D;  5B24 C;  5B1M C;  5AVC A;  5AV6 B;  3UT9 B;  3REJ A;  3AV1 C;  3REK D;  2ZY5 A;  5B0Y A;  4G91 C;  4X23 B;  3REH B;  1P3P C;  5CPJ D;  5AV8 C;  5CPJ C;  2PYO D;  2PYO C;  3X1S B;  3O62 C;  3KWQ A;  3X1U C;  4DRB A;  4YM6 D;  3LJA A;  1P3A C;  3MGQ D;  3MGQ C;  3KXB C;  4CAY B;  4WU8 B;  3W96 B;  4H9N A;  4XUJ A;  4ZUX D;  4ZUX C;  1P3K B;  1TZY A;  5AV5 D;  3W97 C;  4R8P A;  2YFV B;  1W2E A;  5CP6 B;  1ZLA A;  5AVC C;  3AZG B;  5B32 B;  3REJ D;  3REJ C;  3IP4 C;  2LY8 A;  3AV2 A;  4KGC A;  2FJ7 A;  3B6G B;  2ZY2 A;  4WZS B;  1P3O B;  2HIO A;  4WU9 B;  3MNN D;  3MNN C;  3MGS B;  2RVQ C;  2G5I C;  5DNM B;  3WAA D;  5B2I A;  3REI D;  3WA9 A;  2F8N K;  3REL A;  1BFM A;  4HGA C;  3AZF A;  5AV9 B;  5JA4 A;  5GSU D;  3EG5 B;  3X1V A;  1P3M A;  4XUJ C;  5AVB A;  2VQR A;  4JJN A;  4R8P C;  5B2J B;  3C1C D;  1TAF A;  1AOI A;  5DNN D;  1ZLA C;  4H9Q A;  4Z66 D;  4J8W A;  5E5A D;  3AV2 C;  2FJ7 C;  5B40 A;  1B6W A;  3B0D C;  4J8U A;  3LZ0 A;  5AY8 B;  1P3F B;  1P34 A;  3REL C;  1F66 A;  2Y2H A;  4YS3 D;  4YS3 C;  3AZE B;  5B31 A;  4KUD A;  5CPI D;  5CPI C;  5GT0 D;  5GT0 C;  1U35 B;  3AZF C;  4CSR B;  2CV5 B;  1P3M C;  3WKJ A;  5AVB C;  4JJN D;  4JJN C;  3AYW B;  2YFW A;  3X1T D;  1AOI C;  1P3L D;  4J8W C;  1KX3 D;  2NZD A;  2XD5 A;  1P3I A;  3C1B D;  3C1B C;  3LZ1 B;  2CWE A;  5B40 C;  3AZH B;  3W99 B;  3MGP D;  5GT3 A;  3AZL A;  3LZ0 C;  5CPK B;  3AZK A;  3NQU A;  1P34 C;  3B0B A;  4KUD D;  4KUD C;  5B31 C;  5B0Z B;  5F99 B;  4AWL C;  1KX4 D;  1S32 D;  2NQB D;  1B67 A;  3WKJ D;  3WKJ C;  3AZN B;  3MVD B;  1P3B D;  1KU5 A;  3LEL B;  1KX5 B;  4KHA A;  4Z5T D;  3EPK A;  2IO5 B;  4LD9 D;  3AFA D;  2NZD C;  4NE6 A;  3NQJ B;  1P3I C;  1BH8 A;  5JRG D;  5JRG C;  3MGR D;  4G92 B;  4J8V A;  3AZL C;  3B6F B;  4E44 A;  3AZK C;  5CHL B;  5BT1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...