4H9RA

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9rA00
3AZLA 3AZIB 3AZFB 5AV8B 5B24A 4J8XA 5G49B 1M1AA 3AFAA 5AV8A 5B24B 2AROC 3REKD 2IO5B 4QLCB 1M19D 3REJB 3X1VA 1P3OC 1KU5A 5B2IB 4J8VC 3KXBB 2CV5A 5AV8C 3MGRB 5AV5A 1ZLAB 3X1TD 4WZSB 5B40C 3AZED 1JFIA 3NQJA 2NQBC 1P34C 3O62D 2NZDC 2HIOD 5BNXB 3LELA 4KUDC 3AV2C 5GT0B 5B0YB 1BH8A 4NE3A 5E5AB 4EO5B 3LELC 4KUDA 5B31A 1P3PC 3MGRD 5G49A 3R45B 3X1SA 1M18D 4J8UA 4KUDB 4CAYA 4R8PD 3X1UC 1P3KC 2PYOA 5CPKC 2RVQC 5BO0A 3B6FD 4J8WC 5BS7A 1ZLAD 5B1LD 1KX4D 4ZBJB 5BT1C 2F8NB 1KX4C 4H9RA 4JJNA 5AVBD 3AYWB 5GSUB 1H3OB 4G92B 5CPJA 2AROA 1WWIA 5DNNB 5CP6D 3A6NA 5B24C 1EQZD 4CSRB 1P3MA 3LZ1C 3C1BA 5B31G 3AFAD 4G91B 3AZMA 5B2JD 3REHA 4J8WB 4ZUXB 4ZUXA 3MGQB 3MNND 1ULYA 5GXQC 1BH8B 1BH9B 5AY8B 1P3LD 2CV5D 1KX5C 3LZ0D 2NQBB 1P3IA 1KX3B 3C1CA 4KGCA 3WKJA 3KUYC 2HUEC 4Z66C 4KHAB 5GT3B 3AV2B 3B6GD 3W99B 1M18C 1KX5A 5JRGD 5B2IC 4H9NA 3AV2A 3UTBC 4XZQB 5B1LC 1Q9CA 1BFMA 5C3IC 3MGPC 5B31D 5B33B 5B40A 3REIA 5B1MB 3AZGB 1KX3D 1F66C 1P3AD 4J8UD 2LY8A 4J8VB 2YFWA 3WTPE 3AZKB 5B0YA 5GXQA 1KX4A 5GT0A 4G92C 1TAFB 5GT3D 3MVDA 1N1JA 3AZLC 5CPKA 5CP6A 1KX3C 1F66D 5CPKB 1EQZC 4J8UC 1N1JB 5B1MC 3AZGC 3A6NC 4YS3C 3C1CB 4XUJA 5BNVB 4YM6C 5KDMB 5B2JA 5CHLB 3AZHC 1P3FC 3X1VB 3RELA 1M19C 3MNNA 4AWLC 4NE6A 2HIOC 1P3LA 5B40B 3TU4A 3W96B 1F1EA 4WNNB 1P3GB 5B24D 3REKB 5DNMD 3NQUA 2CV5C 1KX5D 2FJ7D 1M19A 2YFVB 1JFIB 1P3OA 5JA4B 4YM6A 1P3OB 1AOIB 3REJD 3W98B 3REKC 3AZEC 2CWEA 3KWQA 3MVDB 3LJAA 1KX3A 3VH6T 4DRBA 5BO0B 3X1TA 1P3AA 3MGSD 5AVCB 5CPIA 5CPIB 3LELD 5GT0D 2BYMA 5GT3C 3X1VC 5B33A 3AFAC 3X1UD 4CSRA 1P3MB 3X1SD 3W98C 1F66A 5GSUA 3W98D 1A7WA 1P3BC 1ZLAA 5B1LA 2YFVA 3KUYB 1TZYD 4E45A 2IO5C 2F8ND 3AZFD 1TZYC 5AVBA 1KX4B 2PYOB 1P34B 2AROD 4J8UB 3R45A 5B32G 3WA9C 1P3IC 4H9PB 3VH5W 5DNMA 5B2JB 5F99B 3AZMD 3REHD 4XZQC 3AZEB 3A6NB 4YM6D 4UUZB 4H9QB 4QLCC 3WAAD 3LZ0B 4Z5TC 3O62C 3C1BC 3LZ0A 4JJNB 3AYWA 3B6GC 4H9QA 2JSSA 3LJAD 1ID3D 1M19B 3C1CD 3WKJD 2CV5B 3VH5T 3AN2A 2F8NG 1U35C 5GXQB 1BH9A 5B32B 3AV2D 4YS3B 3B6GB 1HQ3B 4J8WA 4H9OB 5B0ZC 5B31B 5B33D 3MGSC 3AZND 3AZLB 2HUEB 3X1UA 2PYOC 1ZLAC 5B40D 5FUGB 1P3AB 3X1SC 3O62B 1ID3C 3LJAB 3AV1C 5GSUD 2FJ7B 3W98A 4H9NB 5B0YD 4E44A 5GXQD 3WTPB 5AV6A 4M6BA 3B0DC 5AV6B 2F8NA 4WU8D 5GT3A 3AZFC 4ZBJC 4R8PB 3KXBA 4YS3D 3W96A 5CPKD 3AZKC 3AZKA 1P3LB 3MGQA 3LJAC 4XUJD 4J8VA 2BYKA 5E5AA 4EO5C 3UT9C 2L5AA 3UT9A 4WU8C 1U35D 1HQ3C 1M1AC 4J8XC 4LD9A 3MGQC 1ID3A 3TU4D 3WAAC 2FJ7A 1P3OD 4H9PA 3REJA 3W97A 3AZNA 2FJ7C 4R8PC 4Z66D 3KWQD 3AZJD 3B6FB 5B1MA 3AZGA 3AZHB 1P3FB 3B0CT 4Z5TA 3MGSA 5CPID 5BNXA 5B1LB 1S32B 4WU8A 1R4VA 5AV9A 1P3GC 5DNND 5CP6B 5AV9B 3AZIC 3B0BA 1S32A 5B0YC 3KXBD 3UTAC 3AN2C 3W99C 4Z66B 3WKJB 3AZJC 3AZKD 3B0CW 1P3KD 1S32C 5F99A 5AY8C 5FUGA 3VH6A 3REIC 2NZDB 4QLCA 1TZYA 3AFAB 3AZHD 1P3FD 5AVCA 3AZFA 3UT9D 4DRAA 3AZNB 5DNMC 4LD9D 3W99D 3KUYA 3V9RA 1P3KB 2AROB 4WU9B 3NQJB 5B0ZD 3REJC 4H9SA 4WU8B 1P3PB 3MGPD 1WWSA 3MGSB 3WTPC 4H9SC 2NZDD 3WAAA 3AZMC 5AY8A 3AYWD 4CAYB 4X23A 3AZJA 4H9OA 3AV1B 5B1MD 3AZGD 4J8XB 3AN2D 4WV4B 3AZIA 3RELB 4Z5TD 5CPJC 1AOID 5AV9C 1P3BB 3UTBD 5BNVA 4WU9D 4JJNC 4XZQA 4J8WD 5DNNA 1H3OA 5BS7C 5F99C 4H9RB 1P3AC 3AZLD 4UUZA 3MGRC 3V9RB 1P3KA 1F66B 3UTAA 3KWQC 4J8XD 3AZNC 5AV8D 3REKA 1TAFA 4Z5TB 4WNNA 1P3GA 3X1VD 5AV6D 4QLCD 5JRGB 3AZHA 3X1UB 1P3FA 3UTBB 4HGAB 5B2ID 3X1SB 5BT1D 3REHB 3AZJB 3AV1A 4YS3A 3W96D 4X23B 1P34A 3X1TB 3WAAB 5KDMA 5CP6C 3KUYD 3MGQD 4XUJB 5B0ZA 1P3LC 4LD9C 2HIOA 4J8VD 5AV5C 5CPJB 5E5AD 4NFTA 5B33C 1U35B 1U35A 5E5AC 5B2JC 3VH6W 4KUDD 4G91C 4XUJC 3MGRA 5CPIC 3NQUB 4Z2MG 3WA9B 4X23D 3TU4B 1M18B 3LZ0C 5DNNC 3B6FA 3AZID 2YFWB 1HQ3A 3MVDC 3UTBA 5B32A 4JJND 4WU9C 3B0DB 5AV6C 1EQZB 5AVBB 3W97D 5CPJD 1AOIC 3KWQB 4NE5A 4Z66A 4X23C 3WA9D 1P3MD 4KGCC 3W96C 3KXBC 3WTPA 3UTAD 1P3PD 3KSYA 1P3GD 5AV5B 2HIOB 2F8NK 4ZUXD 5AV9D 5B2IA 1P3BA 2BYMB 1S32D 1P3ID 3AV1D 2NQBD 2BYKB 1P34D 3LZ1A 1P3MC 3C1CC 4KGCD 3W97B 3B6GA 5F99D 3AZMB 1M1AD 5JRGA 5AVCC 4ZUXC 5AVCD 3UTAB 3REHC 5GT0C 4YM6B 5AV5D 1ID3B 3REID 1KX5B 2RVQD 5JRGC 4KHAA 3W99A 4KGCB 4LD9B 3AZEA 5B0ZB 3AYWC 4AWLB 4Z2MH 3O62A 1P3IB 2F8NH 5AVBC 1HQ3D 3MGPA 3MVDD 5B32D 1M1AB 3LZ1B 1TZYB 3MNNB 5C3IB 3MGPB 2NZDA 3TU4C 3REIB 5AY8D 5GSUC 1M18A 3C1BB 3WA9A 4R8PA 2PYOD 3LELB 3AN2B 3WKJC 1B6WA 3W97C 3WTPD 5B31C 3MNNC 1HTAA 1P3PA 3RELC 1AOIA 5JA4A 4HGAC 3RELD 4WU9A 5B32C 1B67A 4XZQD 1P3BD 3A6ND 3VH5A 2NQBA 1EQZA 3UT9B 5DNMB 3B6FC 3X1TC 3LZ1D 3C1BD
chains in the Genus database with same CATH superfamily
3AZLA 3AZIB 3AZFB 5AV8B 5B24A 4J8XA 5G49B 1M1AA 3AFAA 5AV8A 2Y2PA 2AROC 5B24B 2IO5B 4QLCB 3REKD 1M19D 3REJB 3X1VA 1P3OC 1KU5A 5B2IB 4J8VC 3KXBB 2CV5A 5AV8C 3MGRB 5AV5A 1ZLAB 3X1TD 4WZSB 5B40C 2UWXA 3AZED 3NQJA 1JFIA 2NQBC 1P34C 3O62D 2NZDC 2HIOD 5BNXB 3LELA 4KUDC 3AV2C 5GT0B 5B0YB 1BH8A 4NE3A 5E5AB 4EO5B 3LELC 4KUDA 5B31A 1P3PC 3MGRD 5G49A 3R45B 3X1SA 1M18D 4J8UA 4KUDB 4CAYA 4R8PD 3X1UC 1P3KC 2PYOA 5CPKC 2RVQC 5BO0A 2Y2JA 4J8WC 3B6FD 3A1IA 5BS7A 5B1LD 1ZLAD 3FDDA 1KX4D 4ZBJB 5BT1C 2F8NB 1KX4C 4H9RA 4JJNA 5AVBD 3AYWB 5GSUB 1H3OB 4G92B 5CPJA 2AROA 1WWIA 5DNNB 5CP6D 3A6NA 5B24C 1EQZD 4CSRB 1P3MA 3LZ1C 3C1BA 5B31G 3AFAD 4G91B 3AZMA 5B2JD 3REHA 4J8WB 4ZUXB 4ZUXA 3MGQB 3MNND 1ULYA 5GXQC 1BH8B 1BH9B 5AY8B 1P3LD 2XD5A 2CV5D 3LZ0D 1KX5C 2NQBB 1P3IA 1KX3B 2VQRA 2Y2IA 3C1CA 4KGCA 3WKJA 3KUYC 2HUEC 4KHAB 4Z66C 5GT3B 3AV2B 3B6GD 3W99B 1M18C 1KX5A 5JRGD 5B2IC 4H9NA 3AV2A 3UTBC 4XZQB 5B1LC 1Q9CA 1BFMA 5C3IC 3MGPC 5B31D 5B33B 5B40A 3REIA 1W2EA 5B1MB 3AZGB 1KX3D 1F66C 1P3AD 4J8UD 2LY8A 4J8VB 2YFWA 3WTPE 2ZM5A 3AZKB 2BG1A 5B0YA 5GXQA 1KX4A 5GT0A 4G92C 1TAFB 5GT3D 3MVDA 2F2AC 1N1JA 3AZLC 5CPKA 5CP6A 1KX3C 1F66D 5CPKB 2XD1A 1EQZC 4J8UC 1N1JB 3EPKA 5B1MC 3AZGC 3A6NC 4YS3C 3C1CB 4XUJA 5BNVB 4YM6C 5KDMB 5B2JA 5CHLB 3AZHC 1P3FC 3X1VB 3RELA 1M19C 3MNNA 4AWLC 4NE6A 2HIOC 1P3LA 5B40B 3TU4A 3W96B 1F1EA 4WNNB 1P3GB 5B24D 3REKB 5DNMD 3NQUA 2CV5C 1KX5D 2FJ7D 1M19A 2YFVB 1JFIB 1P3OA 5JA4B 4YM6A 1P3OB 1AOIB 3REJD 3W98B 3REKC 3AZEC 2CWEA 3KWQA 3MVDB 3LJAA 1KX3A 3VH6T 4DRBA 5BO0B 3X1TA 1P3AA 2ZY2A 1PZRA 3MGSD 5AVCB 5CPIA 5CPIB 3LELD 5GT0D 2BYMA 5GT3C 3X1VC 5B33A 3AFAC 3X1UD 4CSRA 1P3MB 3X1SD 3W98C 1F66A 5GSUA 3W98D 1A7WA 1P3BC 1ZLAA 5B1LA 2YFVA 3KUYB 1TZYD 4E45A 2IO5C 2F8ND 3AZFD 1TZYC 5AVBA 1KX4B 2DQNC 2PYOB 1P34B 2AROD 4J8UB 3R45A 5B32G 3WA9C 1P3IC 4H9PB 3VH5W 3H0RC 5DNMA 5B2JB 5F99B 3AZMD 2JCHA 3REHD 4XZQC 3AZEB 3A6NB 4YM6D 4UUZB 4H9QB 4QLCC 3WAAD 3LZ0B 2G5IC 4Z5TC 3O62C 3C1BC 3LZ0A 4JJNB 3AYWA 3B6GC 2JSSA 4H9QA 3LJAD 1ID3D 1M19B 3C1CD 3WKJD 2CV5B 3VH5T 3AN2A 2F8NG 1U35C 5GXQB 1BH9A 5B32B 3AV2D 4YS3B 3B6GB 3EPLA 1HQ3B 4J8WA 4H9OB 5B0ZC 5B31B 5B33D 3MGSC 3AZND 3AZLB 2HUEB 3X1UA 2PYOC 1ZLAC 5B40D 5FUGB 1P3AB 2G5HC 3O62B 3X1SC 3LJAB 1ID3C 3AV1C 5GSUD 2FJ7B 3W98A 4H9NB 5B0YD 4E44A 5GXQD 3WTPB 5AV6A 4M6BA 3B0DC 5AV6B 2F8NA 4WU8D 5GT3A 3AZFC 2W8SA 4ZBJC 4R8PB 3KXBA 4YS3D 3W96A 5CPKD 2Y2OA 3AZKC 3AZKA 1P3LB 3MGQA 3LJAC 4XUJD 4J8VA 2BYKA 5E5AA 2FFFB 4EO5C 3UT9C 2L5AA 3UT9A 4WU8C 1U35D 1HQ3C 1M1AC 4J8XC 4LD9A 2Y2QA 3MGQC 1ID3A 3TU4D 3WAAC 2FJ7A 1P3OD 4H9PA 3H0LC 3REJA 3W97A 3AZNA 2FJ7C 4R8PC 4Z66D 3KWQD 3AZJD 2Y2LA 3B6FB 5B1MA 3AZGA 3AZHB 1P3FB 3B0CT 3P5JB 1Z2CB 4Z5TA 3MGSA 5CPID 5BNXA 3AL0C 5B1LB 1S32B 4WU8A 1R4VA 5AV9A 1P3GC 5DNND 5CP6B 5AV9B 3AZIC 3B0BA 1S32A 5B0YC 3KXBD 3UTAC 3AN2C 3W99C 4Z66B 3WKJB 3AZJC 3AZKD 3B0CW 1P3KD 1S32C 5F99A 5AY8C 5FUGA 3VH6A 3REIC 2NZDB 4QLCA 1TZYA 3AFAB 3AZHD 1P3FD 5AVCA 3AZFA 3UT9D 4DRAA 3AZNB 5DNMC 4LD9D 4WJ3C 3W99D 3KUYA 3V9RA 1P3KB 2AROB 4WU9B 3NQJB 5B0ZD 3REJC 4H9SA 4WU8B 1P3PB 3MGPD 1WWSA 3MGSB 3WTPC 4H9SC 2NZDD 3WAAA 3AZMC 5AY8A 3AYWD 4CAYB 4X23A 3AZJA 4H9OA 3AV1B 5B1MD 3AZGD 4J8XB 2Y2MA 4WV4B 3AN2D 3AZIA 3RELB 4Z5TD 5CPJC 1AOID 5AV9C 1P3BB 3UTBD 5BNVA 4WU9D 4JJNC 4XZQA 4J8WD 3F6TA 5DNNA 1H3OA 5BS7C 5F99C 4H9RB 1P3AC 3AZLD 4UUZA 3MGRC 3V9RB 1P3KA 1F66B 3UTAA 3KWQC 4J8XD 3AZNC 5AV8D 3REKA 1TAFA 4Z5TB 4WNNA 1P3GA 3X1VD 5AV6D 4QLCD 5JRGB 3AZHA 3X1UB 1P3FA 3UTBB 3H0MC 4HGAB 5B2ID 3X1SB 5BT1D 3REHB 3AZJB 3AV1A 4YS3A 3W96D 4X23B 1P34A 2Y2NA 3X1TB 2JE5A 3WAAB 5KDMA 5CP6C 3KUYD 3MGQD 2J8PA 4XUJB 5B0ZA 2RIQA 1P3LC 4LD9C 2HIOA 2ZY3A 4J8VD 5AV5C 5CPJB 5E5AD 4NFTA 5B33C 1T3UA 1U35B 4UPKA 1U35A 5E5AC 5B2JC 3VH6W 4KUDD 4G91C 4XUJC 3MGRA 5CPIC 3NQUB 2Y2GA 4Z2MG 3WA9B 4X23D 3TU4B 1M18B 3LZ0C 5DNNC 3B6FA 3AZID 2YFWB 1HQ3A 3MVDC 3EG5B 5B32A 3UTBA 4JJND 4WU9C 3B0DB 5AV6C 1EQZB 5AVBB 3W97D 5CPJD 1AOIC 3KWQB 4NE5A 4Z66A 4X23C 3WA9D 1P3MD 4KGCC 3W96C 3KXBC 3WTPA 3UTAD 1P3PD 3KSYA 1P3GD 5AV5B 2HIOB 2F8NK 4ZUXD 5AV9D 5B2IA 1P3BA 2BYMB 4DQYB 1S32D 2ZY5A 3AV1D 1P3ID 2NQBD 2BYKB 1P34D 3LZ1A 1P3MC 3C1CC 4KGCD 3A1KA 3W97B 3B6GA 5F99D 3AZMB 1M1AD 5JRGA 5AVCC 2ZY4A 4ZUXC 5AVCD 3UTAB 3REHC 5GT0C 4YM6B 5AV5D 2Y2KA 1ID3B 3REID 2DF4C 1KX5B 2RVQD 5JRGC 4KHAA 3W99A 3EPHA 3EPJA 4KGCB 4LD9B 3AZEA 5B0ZB 3AYWC 4AWLB 4Z2MH 3O62A 1P3IB 2F8NH 5AVBC 3KFUG 1HQ3D 3MGPA 3MVDD 5B32D 1M1AB 3LZ1B 1TZYB 2Y2HA 3MNNB 5C3IB 3MGPB 2NZDA 3TU4C 3REIB 5AY8D 5GSUC 1M18A 3C1BB 3WA9A 4R8PA 2PYOD 3LELB 3AN2B 3WKJC 1B6WA 3W97C 3WTPD 5B31C 3MNNC 1HTAA 3IP4C 3RELC 1P3PA 1AOIA 5JA4A 4HGAC 3RELD 4WU9A 5B32C 1B67A 4XZQD 1P3BD 3A6ND 3VH5A 2NQBA 1EQZA 3UT9B 5DNMB 3B6FC 3X1TC 3LZ1D 3C1BD
chains in the Genus database with same CATH topology
3AZLA 3AZIB 3AZFB 5AV8B 5B24A 4J8XA 5G49B 1M1AA 3AFAA 5AV8A 2Y2PA 2AROC 5B24B 2IO5B 4QLCB 3REKD 1M19D 3REJB 3X1VA 1P3OC 1KU5A 5B2IB 4J8VC 3KXBB 2CV5A 5AV8C 3MGRB 5AV5A 1ZLAB 3X1TD 4WZSB 5B40C 2UWXA 3AZED 3NQJA 1JFIA 2NQBC 1P34C 3O62D 2NZDC 2HIOD 5BNXB 3LELA 4KUDC 3AV2C 5GT0B 5B0YB 1BH8A 4NE3A 5E5AB 4EO5B 3LELC 4KUDA 5B31A 1P3PC 3MGRD 5G49A 3R45B 3X1SA 1M18D 4J8UA 4KUDB 4CAYA 4R8PD 3X1UC 1P3KC 2PYOA 5CPKC 2RVQC 5BO0A 2Y2JA 4J8WC 3B6FD 3A1IA 5BS7A 5B1LD 1ZLAD 3FDDA 1KX4D 4ZBJB 5BT1C 2F8NB 1KX4C 4H9RA 4JJNA 5AVBD 3AYWB 5GSUB 1H3OB 4G92B 5CPJA 2AROA 1WWIA 5DNNB 5CP6D 3A6NA 5B24C 1EQZD 4CSRB 1P3MA 3LZ1C 3C1BA 5B31G 3AFAD 4G91B 3AZMA 5B2JD 3REHA 4J8WB 4ZUXB 4ZUXA 3MGQB 3MNND 1ULYA 5GXQC 1BH8B 1BH9B 5AY8B 1P3LD 2XD5A 2CV5D 3LZ0D 1KX5C 2NQBB 1P3IA 1KX3B 2VQRA 2Y2IA 3C1CA 4KGCA 3WKJA 3KUYC 2HUEC 4KHAB 4Z66C 5GT3B 3AV2B 3B6GD 3W99B 1M18C 1KX5A 5JRGD 5B2IC 4H9NA 3AV2A 3UTBC 4XZQB 5B1LC 1Q9CA 1BFMA 5C3IC 3MGPC 5B31D 5B33B 5B40A 3REIA 1W2EA 5B1MB 3AZGB 1KX3D 1F66C 1P3AD 4J8UD 2LY8A 4J8VB 2YFWA 3WTPE 2ZM5A 3AZKB 2BG1A 5B0YA 5GXQA 1KX4A 5GT0A 4G92C 1TAFB 5GT3D 3MVDA 2F2AC 1N1JA 3AZLC 5CPKA 5CP6A 1KX3C 1F66D 5CPKB 2XD1A 1EQZC 4J8UC 1N1JB 3EPKA 5B1MC 3AZGC 3A6NC 4YS3C 3C1CB 4XUJA 5BNVB 4YM6C 5KDMB 5B2JA 5CHLB 3AZHC 1P3FC 3X1VB 3RELA 1M19C 3MNNA 4AWLC 4NE6A 2HIOC 1P3LA 5B40B 3TU4A 3W96B 1F1EA 4WNNB 1P3GB 5B24D 3REKB 5DNMD 3NQUA 2CV5C 1KX5D 2FJ7D 1M19A 2YFVB 1JFIB 1P3OA 5JA4B 4YM6A 1P3OB 1AOIB 3REJD 3W98B 3REKC 3AZEC 2CWEA 3KWQA 3MVDB 3LJAA 1KX3A 3VH6T 4DRBA 5BO0B 3X1TA 1P3AA 2ZY2A 1PZRA 3MGSD 5AVCB 5CPIA 5CPIB 3LELD 5GT0D 2BYMA 5GT3C 3X1VC 5B33A 3AFAC 3X1UD 4CSRA 1P3MB 3X1SD 3W98C 1F66A 5GSUA 3W98D 1A7WA 1P3BC 1ZLAA 5B1LA 2YFVA 3KUYB 1TZYD 4E45A 2IO5C 2F8ND 3AZFD 1TZYC 5AVBA 1KX4B 2DQNC 2PYOB 1P34B 2AROD 4J8UB 3R45A 5B32G 3WA9C 1P3IC 4H9PB 3VH5W 3H0RC 5DNMA 5B2JB 5F99B 3AZMD 2JCHA 3REHD 4XZQC 3AZEB 3A6NB 4YM6D 4UUZB 4H9QB 4QLCC 3WAAD 3LZ0B 2G5IC 4Z5TC 3O62C 3C1BC 3LZ0A 4JJNB 3AYWA 3B6GC 2JSSA 4H9QA 3LJAD 1ID3D 1M19B 3C1CD 3WKJD 2CV5B 3VH5T 3AN2A 2F8NG 1U35C 5GXQB 1BH9A 5B32B 3AV2D 4YS3B 3B6GB 3EPLA 1HQ3B 4J8WA 4H9OB 5B0ZC 5B31B 5B33D 3MGSC 3AZND 3AZLB 2HUEB 3X1UA 2PYOC 1ZLAC 5B40D 5FUGB 1P3AB 2G5HC 3O62B 3X1SC 3LJAB 1ID3C 3AV1C 5GSUD 2FJ7B 3W98A 4H9NB 5B0YD 4E44A 5GXQD 3WTPB 5AV6A 4M6BA 3B0DC 5AV6B 2F8NA 4WU8D 5GT3A 3AZFC 2W8SA 4ZBJC 4R8PB 3KXBA 4YS3D 3W96A 5CPKD 2Y2OA 3AZKC 3AZKA 1P3LB 3MGQA 3LJAC 4XUJD 4J8VA 2BYKA 5E5AA 2FFFB 4EO5C 3UT9C 2L5AA 3UT9A 4WU8C 1U35D 1HQ3C 1M1AC 4J8XC 4LD9A 2Y2QA 3MGQC 1ID3A 3TU4D 3WAAC 2FJ7A 1P3OD 4H9PA 3H0LC 3REJA 3W97A 3AZNA 2FJ7C 4R8PC 4Z66D 3KWQD 3AZJD 2Y2LA 3B6FB 5B1MA 3AZGA 3AZHB 1P3FB 3B0CT 3P5JB 1Z2CB 4Z5TA 3MGSA 5CPID 5BNXA 3AL0C 5B1LB 1S32B 4WU8A 1R4VA 5AV9A 1P3GC 5DNND 5CP6B 5AV9B 3AZIC 3B0BA 1S32A 5B0YC 3KXBD 3UTAC 3AN2C 3W99C 4Z66B 3WKJB 3AZJC 3AZKD 3B0CW 1P3KD 1S32C 5F99A 5AY8C 5FUGA 3VH6A 3REIC 2NZDB 4QLCA 1TZYA 3AFAB 3AZHD 1P3FD 5AVCA 3AZFA 3UT9D 4DRAA 3AZNB 5DNMC 4LD9D 4WJ3C 3W99D 3KUYA 3V9RA 1P3KB 2AROB 4WU9B 3NQJB 5B0ZD 3REJC 4H9SA 4WU8B 1P3PB 3MGPD 1WWSA 3MGSB 3WTPC 4H9SC 2NZDD 3WAAA 3AZMC 5AY8A 3AYWD 4CAYB 4X23A 3AZJA 4H9OA 3AV1B 5B1MD 3AZGD 4J8XB 2Y2MA 4WV4B 3AN2D 3AZIA 3RELB 4Z5TD 5CPJC 1AOID 5AV9C 1P3BB 3UTBD 5BNVA 4WU9D 4JJNC 4XZQA 4J8WD 3F6TA 5DNNA 1H3OA 5BS7C 5F99C 4H9RB 1P3AC 3AZLD 4UUZA 3MGRC 3V9RB 1P3KA 1F66B 3UTAA 3KWQC 4J8XD 3AZNC 5AV8D 3REKA 1TAFA 4Z5TB 4WNNA 1P3GA 3X1VD 5AV6D 4QLCD 5JRGB 3AZHA 3X1UB 1P3FA 3UTBB 3H0MC 4HGAB 5B2ID 3X1SB 5BT1D 3REHB 3AZJB 3AV1A 4YS3A 3W96D 4X23B 1P34A 2Y2NA 3X1TB 2JE5A 3WAAB 5KDMA 5CP6C 3KUYD 3MGQD 2J8PA 4XUJB 5B0ZA 2RIQA 1P3LC 4LD9C 2HIOA 2ZY3A 4J8VD 5AV5C 5CPJB 5E5AD 4NFTA 5B33C 1T3UA 1U35B 4UPKA 1U35A 5E5AC 5B2JC 3VH6W 4KUDD 4G91C 4XUJC 3MGRA 5CPIC 3NQUB 2Y2GA 4Z2MG 3WA9B 4X23D 3TU4B 1M18B 3LZ0C 5DNNC 3B6FA 3AZID 2YFWB 1HQ3A 3MVDC 3EG5B 5B32A 3UTBA 4JJND 4WU9C 3B0DB 5AV6C 1EQZB 5AVBB 3W97D 5CPJD 1AOIC 3KWQB 4NE5A 4Z66A 4X23C 3WA9D 1P3MD 4KGCC 3W96C 3KXBC 3WTPA 3UTAD 1P3PD 3KSYA 1P3GD 5AV5B 2HIOB 2F8NK 4ZUXD 5AV9D 5B2IA 1P3BA 2BYMB 4DQYB 1S32D 2ZY5A 3AV1D 1P3ID 2NQBD 2BYKB 1P34D 3LZ1A 1P3MC 3C1CC 4KGCD 3A1KA 3W97B 3B6GA 5F99D 3AZMB 1M1AD 5JRGA 5AVCC 2ZY4A 4ZUXC 5AVCD 3UTAB 3REHC 5GT0C 4YM6B 5AV5D 2Y2KA 1ID3B 3REID 2DF4C 1KX5B 2RVQD 5JRGC 4KHAA 3W99A 3EPHA 3EPJA 4KGCB 4LD9B 3AZEA 5B0ZB 3AYWC 4AWLB 4Z2MH 3O62A 1P3IB 2F8NH 5AVBC 3KFUG 1HQ3D 3MGPA 3MVDD 5B32D 1M1AB 3LZ1B 1TZYB 2Y2HA 3MNNB 5C3IB 3MGPB 2NZDA 3TU4C 3REIB 5AY8D 5GSUC 1M18A 3C1BB 3WA9A 4R8PA 2PYOD 3LELB 3AN2B 3WKJC 1B6WA 3W97C 3WTPD 5B31C 3MNNC 1HTAA 3IP4C 3RELC 1P3PA 1AOIA 5JA4A 4HGAC 3RELD 4WU9A 5B32C 1B67A 4XZQD 1P3BD 3A6ND 3VH5A 2NQBA 1EQZA 3UT9B 5DNMB 3B6FC 3X1TC 3LZ1D 3C1BD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  3AZI B;  3AZF B;  5AV8 B;  5B24 A;  4J8X A;  5G49 B;  1M1A A;  3AFA A;  5AV8 A;  5B24 B;  2ARO C;  3REK D;  2IO5 B;  4QLC B;  1M19 D;  3REJ B;  3X1V A;  1P3O C;  1KU5 A;  5B2I B;  4J8V C;  3KXB B;  2CV5 A;  5AV8 C;  3MGR B;  5AV5 A;  1ZLA B;  3X1T D;  4WZS B;  5B40 C;  3AZE D;  1JFI A;  3NQJ A;  2NQB C;  1P34 C;  3O62 D;  2NZD C;  2HIO D;  5BNX B;  3LEL A;  4KUD C;  3AV2 C;  5GT0 B;  5B0Y B;  1BH8 A;  4NE3 A;  5E5A B;  4EO5 B;  3LEL C;  4KUD A;  5B31 A;  1P3P C;  3MGR D;  5G49 A;  3R45 B;  3X1S A;  1M18 D;  4J8U A;  4KUD B;  4CAY A;  4R8P D;  3X1U C;  1P3K C;  2PYO A;  5CPK C;  2RVQ C;  5BO0 A;  3B6F D;  4J8W C;  5BS7 A;  1ZLA D;  5B1L D;  1KX4 D;  4ZBJ B;  5BT1 C;  2F8N B;  1KX4 C;  4H9R A;  4JJN A;  5AVB D;  3AYW B;  5GSU B;  1H3O B;  4G92 B;  5CPJ A;  2ARO A;  1WWI A;  5DNN B;  5CP6 D;  3A6N A;  5B24 C;  1EQZ D;  4CSR B;  1P3M A;  3LZ1 C;  3C1B A;  5B31 G;  3AFA D;  4G91 B;  3AZM A;  5B2J D;  3REH A;  4J8W B;  4ZUX B;  4ZUX A;  3MGQ B;  3MNN D;  1ULY A;  5GXQ C;  1BH8 B;  1BH9 B;  5AY8 B;  1P3L D;  2CV5 D;  1KX5 C;  3LZ0 D;  2NQB B;  1P3I A;  1KX3 B;  3C1C A;  4KGC A;  3WKJ A;  3KUY C;  2HUE C;  4Z66 C;  4KHA B;  5GT3 B;  3AV2 B;  3B6G D;  3W99 B;  1M18 C;  1KX5 A;  5JRG D;  5B2I C;  4H9N A;  3AV2 A;  3UTB C;  4XZQ B;  5B1L C;  1Q9C A;  1BFM A;  5C3I C;  3MGP C;  5B31 D;  5B33 B;  5B40 A;  3REI A;  5B1M B;  3AZG B;  1KX3 D;  1F66 C;  1P3A D;  4J8U D;  2LY8 A;  4J8V B;  2YFW A;  3WTP E;  3AZK B;  5B0Y A;  5GXQ A;  1KX4 A;  5GT0 A;  4G92 C;  1TAF B;  5GT3 D;  3MVD A;  1N1J A;  3AZL C;  5CPK A;  5CP6 A;  1KX3 C;  1F66 D;  5CPK B;  1EQZ C;  4J8U C;  1N1J B;  5B1M C;  3AZG C;  3A6N C;  4YS3 C;  3C1C B;  4XUJ A;  5BNV B;  4YM6 C;  5KDM B;  5B2J A;  5CHL B;  3AZH C;  1P3F C;  3X1V B;  3REL A;  1M19 C;  3MNN A;  4AWL C;  4NE6 A;  2HIO C;  1P3L A;  5B40 B;  3TU4 A;  3W96 B;  1F1E A;  4WNN B;  1P3G B;  5B24 D;  3REK B;  5DNM D;  3NQU A;  2CV5 C;  1KX5 D;  2FJ7 D;  1M19 A;  2YFV B;  1JFI B;  1P3O A;  5JA4 B;  4YM6 A;  1P3O B;  1AOI B;  3REJ D;  3W98 B;  3REK C;  3AZE C;  2CWE A;  3KWQ A;  3MVD B;  3LJA A;  1KX3 A;  3VH6 T;  4DRB A;  5BO0 B;  3X1T A;  1P3A A;  3MGS D;  5AVC B;  5CPI A;  5CPI B;  3LEL D;  5GT0 D;  2BYM A;  5GT3 C;  3X1V C;  5B33 A;  3AFA C;  3X1U D;  4CSR A;  1P3M B;  3X1S D;  3W98 C;  1F66 A;  5GSU A;  3W98 D;  1A7W A;  1P3B C;  1ZLA A;  5B1L A;  2YFV A;  3KUY B;  1TZY D;  4E45 A;  2IO5 C;  2F8N D;  3AZF D;  1TZY C;  5AVB A;  1KX4 B;  2PYO B;  1P34 B;  2ARO D;  4J8U B;  3R45 A;  5B32 G;  3WA9 C;  1P3I C;  4H9P B;  3VH5 W;  5DNM A;  5B2J B;  5F99 B;  3AZM D;  3REH D;  4XZQ C;  3AZE B;  3A6N B;  4YM6 D;  4UUZ B;  4H9Q B;  4QLC C;  3WAA D;  3LZ0 B;  4Z5T C;  3O62 C;  3C1B C;  3LZ0 A;  4JJN B;  3AYW A;  3B6G C;  4H9Q A;  2JSS A;  3LJA D;  1ID3 D;  1M19 B;  3C1C D;  3WKJ D;  2CV5 B;  3VH5 T;  3AN2 A;  2F8N G;  1U35 C;  5GXQ B;  1BH9 A;  5B32 B;  3AV2 D;  4YS3 B;  3B6G B;  1HQ3 B;  4J8W A;  4H9O B;  5B0Z C;  5B31 B;  5B33 D;  3MGS C;  3AZN D;  3AZL B;  2HUE B;  3X1U A;  2PYO C;  1ZLA C;  5B40 D;  5FUG B;  1P3A B;  3X1S C;  3O62 B;  1ID3 C;  3LJA B;  3AV1 C;  5GSU D;  2FJ7 B;  3W98 A;  4H9N B;  5B0Y D;  4E44 A;  5GXQ D;  3WTP B;  5AV6 A;  4M6B A;  3B0D C;  5AV6 B;  2F8N A;  4WU8 D;  5GT3 A;  3AZF C;  4ZBJ C;  4R8P B;  3KXB A;  4YS3 D;  3W96 A;  5CPK D;  3AZK C;  3AZK A;  1P3L B;  3MGQ A;  3LJA C;  4XUJ D;  4J8V A;  2BYK A;  5E5A A;  4EO5 C;  3UT9 C;  2L5A A;  3UT9 A;  4WU8 C;  1U35 D;  1HQ3 C;  1M1A C;  4J8X C;  4LD9 A;  3MGQ C;  1ID3 A;  3TU4 D;  3WAA C;  2FJ7 A;  1P3O D;  4H9P A;  3REJ A;  3W97 A;  3AZN A;  2FJ7 C;  4R8P C;  4Z66 D;  3KWQ D;  3AZJ D;  3B6F B;  5B1M A;  3AZG A;  3AZH B;  1P3F B;  3B0C T;  4Z5T A;  3MGS A;  5CPI D;  5BNX A;  5B1L B;  1S32 B;  4WU8 A;  1R4V A;  5AV9 A;  1P3G C;  5DNN D;  5CP6 B;  5AV9 B;  3AZI C;  3B0B A;  1S32 A;  5B0Y C;  3KXB D;  3UTA C;  3AN2 C;  3W99 C;  4Z66 B;  3WKJ B;  3AZJ C;  3AZK D;  3B0C W;  1P3K D;  1S32 C;  5F99 A;  5AY8 C;  5FUG A;  3VH6 A;  3REI C;  2NZD B;  4QLC A;  1TZY A;  3AFA B;  3AZH D;  1P3F D;  5AVC A;  3AZF A;  3UT9 D;  4DRA A;  3AZN B;  5DNM C;  4LD9 D;  3W99 D;  3KUY A;  3V9R A;  1P3K B;  2ARO B;  4WU9 B;  3NQJ B;  5B0Z D;  3REJ C;  4H9S A;  4WU8 B;  1P3P B;  3MGP D;  1WWS A;  3MGS B;  3WTP C;  4H9S C;  2NZD D;  3WAA A;  3AZM C;  5AY8 A;  3AYW D;  4CAY B;  4X23 A;  3AZJ A;  4H9O A;  3AV1 B;  5B1M D;  3AZG D;  4J8X B;  3AN2 D;  4WV4 B;  3AZI A;  3REL B;  4Z5T D;  5CPJ C;  1AOI D;  5AV9 C;  1P3B B;  3UTB D;  5BNV A;  4WU9 D;  4JJN C;  4XZQ A;  4J8W D;  5DNN A;  1H3O A;  5BS7 C;  5F99 C;  4H9R B;  1P3A C;  3AZL D;  4UUZ A;  3MGR C;  3V9R B;  1P3K A;  1F66 B;  3UTA A;  3KWQ C;  4J8X D;  3AZN C;  5AV8 D;  3REK A;  1TAF A;  4Z5T B;  4WNN A;  1P3G A;  3X1V D;  5AV6 D;  4QLC D;  5JRG B;  3AZH A;  3X1U B;  1P3F A;  3UTB B;  4HGA B;  5B2I D;  3X1S B;  5BT1 D;  3REH B;  3AZJ B;  3AV1 A;  4YS3 A;  3W96 D;  4X23 B;  1P34 A;  3X1T B;  3WAA B;  5KDM A;  5CP6 C;  3KUY D;  3MGQ D;  4XUJ B;  5B0Z A;  1P3L C;  4LD9 C;  2HIO A;  4J8V D;  5AV5 C;  5CPJ B;  5E5A D;  4NFT A;  5B33 C;  1U35 B;  1U35 A;  5E5A C;  5B2J C;  3VH6 W;  4KUD D;  4G91 C;  4XUJ C;  3MGR A;  5CPI C;  3NQU B;  4Z2M G;  3WA9 B;  4X23 D;  3TU4 B;  1M18 B;  3LZ0 C;  5DNN C;  3B6F A;  3AZI D;  2YFW B;  1HQ3 A;  3MVD C;  3UTB A;  5B32 A;  4JJN D;  4WU9 C;  3B0D B;  5AV6 C;  1EQZ B;  5AVB B;  3W97 D;  5CPJ D;  1AOI C;  3KWQ B;  4NE5 A;  4Z66 A;  4X23 C;  3WA9 D;  1P3M D;  4KGC C;  3W96 C;  3KXB C;  3WTP A;  3UTA D;  1P3P D;  3KSY A;  1P3G D;  5AV5 B;  2HIO B;  2F8N K;  4ZUX D;  5AV9 D;  5B2I A;  1P3B A;  2BYM B;  1S32 D;  1P3I D;  3AV1 D;  2NQB D;  2BYK B;  1P34 D;  3LZ1 A;  1P3M C;  3C1C C;  4KGC D;  3W97 B;  3B6G A;  5F99 D;  3AZM B;  1M1A D;  5JRG A;  5AVC C;  4ZUX C;  5AVC D;  3UTA B;  3REH C;  5GT0 C;  4YM6 B;  5AV5 D;  1ID3 B;  3REI D;  1KX5 B;  2RVQ D;  5JRG C;  4KHA A;  3W99 A;  4KGC B;  4LD9 B;  3AZE A;  5B0Z B;  3AYW C;  4AWL B;  4Z2M H;  3O62 A;  1P3I B;  2F8N H;  5AVB C;  1HQ3 D;  3MGP A;  3MVD D;  5B32 D;  1M1A B;  3LZ1 B;  1TZY B;  3MNN B;  5C3I B;  3MGP B;  2NZD A;  3TU4 C;  3REI B;  5AY8 D;  5GSU C;  1M18 A;  3C1B B;  3WA9 A;  4R8P A;  2PYO D;  3LEL B;  3AN2 B;  3WKJ C;  1B6W A;  3W97 C;  3WTP D;  5B31 C;  3MNN C;  1HTA A;  1P3P A;  3REL C;  1AOI A;  5JA4 A;  4HGA C;  3REL D;  4WU9 A;  5B32 C;  1B67 A;  4XZQ D;  1P3B D;  3A6N D;  3VH5 A;  2NQB A;  1EQZ A;  3UT9 B;  5DNM B;  3B6F C;  3X1T C;  3LZ1 D;  3C1B D; 
#chains in the Genus database with same CATH topology
 3AZL A;  3AZI B;  3AZF B;  5AV8 B;  5B24 A;  4J8X A;  5G49 B;  1M1A A;  3AFA A;  5AV8 A;  2Y2P A;  2ARO C;  5B24 B;  2IO5 B;  4QLC B;  3REK D;  1M19 D;  3REJ B;  3X1V A;  1P3O C;  1KU5 A;  5B2I B;  4J8V C;  3KXB B;  2CV5 A;  5AV8 C;  3MGR B;  5AV5 A;  1ZLA B;  3X1T D;  4WZS B;  5B40 C;  2UWX A;  3AZE D;  3NQJ A;  1JFI A;  2NQB C;  1P34 C;  3O62 D;  2NZD C;  2HIO D;  5BNX B;  3LEL A;  4KUD C;  3AV2 C;  5GT0 B;  5B0Y B;  1BH8 A;  4NE3 A;  5E5A B;  4EO5 B;  3LEL C;  4KUD A;  5B31 A;  1P3P C;  3MGR D;  5G49 A;  3R45 B;  3X1S A;  1M18 D;  4J8U A;  4KUD B;  4CAY A;  4R8P D;  3X1U C;  1P3K C;  2PYO A;  5CPK C;  2RVQ C;  5BO0 A;  2Y2J A;  4J8W C;  3B6F D;  3A1I A;  5BS7 A;  5B1L D;  1ZLA D;  3FDD A;  1KX4 D;  4ZBJ B;  5BT1 C;  2F8N B;  1KX4 C;  4H9R A;  4JJN A;  5AVB D;  3AYW B;  5GSU B;  1H3O B;  4G92 B;  5CPJ A;  2ARO A;  1WWI A;  5DNN B;  5CP6 D;  3A6N A;  5B24 C;  1EQZ D;  4CSR B;  1P3M A;  3LZ1 C;  3C1B A;  5B31 G;  3AFA D;  4G91 B;  3AZM A;  5B2J D;  3REH A;  4J8W B;  4ZUX B;  4ZUX A;  3MGQ B;  3MNN D;  1ULY A;  5GXQ C;  1BH8 B;  1BH9 B;  5AY8 B;  1P3L D;  2XD5 A;  2CV5 D;  3LZ0 D;  1KX5 C;  2NQB B;  1P3I A;  1KX3 B;  2VQR A;  2Y2I A;  3C1C A;  4KGC A;  3WKJ A;  3KUY C;  2HUE C;  4KHA B;  4Z66 C;  5GT3 B;  3AV2 B;  3B6G D;  3W99 B;  1M18 C;  1KX5 A;  5JRG D;  5B2I C;  4H9N A;  3AV2 A;  3UTB C;  4XZQ B;  5B1L C;  1Q9C A;  1BFM A;  5C3I C;  3MGP C;  5B31 D;  5B33 B;  5B40 A;  3REI A;  1W2E A;  5B1M B;  3AZG B;  1KX3 D;  1F66 C;  1P3A D;  4J8U D;  2LY8 A;  4J8V B;  2YFW A;  3WTP E;  2ZM5 A;  3AZK B;  2BG1 A;  5B0Y A;  5GXQ A;  1KX4 A;  5GT0 A;  4G92 C;  1TAF B;  5GT3 D;  3MVD A;  2F2A C;  1N1J A;  3AZL C;  5CPK A;  5CP6 A;  1KX3 C;  1F66 D;  5CPK B;  2XD1 A;  1EQZ C;  4J8U C;  1N1J B;  3EPK A;  5B1M C;  3AZG C;  3A6N C;  4YS3 C;  3C1C B;  4XUJ A;  5BNV B;  4YM6 C;  5KDM B;  5B2J A;  5CHL B;  3AZH C;  1P3F C;  3X1V B;  3REL A;  1M19 C;  3MNN A;  4AWL C;  4NE6 A;  2HIO C;  1P3L A;  5B40 B;  3TU4 A;  3W96 B;  1F1E A;  4WNN B;  1P3G B;  5B24 D;  3REK B;  5DNM D;  3NQU A;  2CV5 C;  1KX5 D;  2FJ7 D;  1M19 A;  2YFV B;  1JFI B;  1P3O A;  5JA4 B;  4YM6 A;  1P3O B;  1AOI B;  3REJ D;  3W98 B;  3REK C;  3AZE C;  2CWE A;  3KWQ A;  3MVD B;  3LJA A;  1KX3 A;  3VH6 T;  4DRB A;  5BO0 B;  3X1T A;  1P3A A;  2ZY2 A;  1PZR A;  3MGS D;  5AVC B;  5CPI A;  5CPI B;  3LEL D;  5GT0 D;  2BYM A;  5GT3 C;  3X1V C;  5B33 A;  3AFA C;  3X1U D;  4CSR A;  1P3M B;  3X1S D;  3W98 C;  1F66 A;  5GSU A;  3W98 D;  1A7W A;  1P3B C;  1ZLA A;  5B1L A;  2YFV A;  3KUY B;  1TZY D;  4E45 A;  2IO5 C;  2F8N D;  3AZF D;  1TZY C;  5AVB A;  1KX4 B;  2DQN C;  2PYO B;  1P34 B;  2ARO D;  4J8U B;  3R45 A;  5B32 G;  3WA9 C;  1P3I C;  4H9P B;  3VH5 W;  3H0R C;  5DNM A;  5B2J B;  5F99 B;  3AZM D;  2JCH A;  3REH D;  4XZQ C;  3AZE B;  3A6N B;  4YM6 D;  4UUZ B;  4H9Q B;  4QLC C;  3WAA D;  3LZ0 B;  2G5I C;  4Z5T C;  3O62 C;  3C1B C;  3LZ0 A;  4JJN B;  3AYW A;  3B6G C;  2JSS A;  4H9Q A;  3LJA D;  1ID3 D;  1M19 B;  3C1C D;  3WKJ D;  2CV5 B;  3VH5 T;  3AN2 A;  2F8N G;  1U35 C;  5GXQ B;  1BH9 A;  5B32 B;  3AV2 D;  4YS3 B;  3B6G B;  3EPL A;  1HQ3 B;  4J8W A;  4H9O B;  5B0Z C;  5B31 B;  5B33 D;  3MGS C;  3AZN D;  3AZL B;  2HUE B;  3X1U A;  2PYO C;  1ZLA C;  5B40 D;  5FUG B;  1P3A B;  2G5H C;  3O62 B;  3X1S C;  3LJA B;  1ID3 C;  3AV1 C;  5GSU D;  2FJ7 B;  3W98 A;  4H9N B;  5B0Y D;  4E44 A;  5GXQ D;  3WTP B;  5AV6 A;  4M6B A;  3B0D C;  5AV6 B;  2F8N A;  4WU8 D;  5GT3 A;  3AZF C;  2W8S A;  4ZBJ C;  4R8P B;  3KXB A;  4YS3 D;  3W96 A;  5CPK D;  2Y2O A;  3AZK C;  3AZK A;  1P3L B;  3MGQ A;  3LJA C;  4XUJ D;  4J8V A;  2BYK A;  5E5A A;  2FFF B;  4EO5 C;  3UT9 C;  2L5A A;  3UT9 A;  4WU8 C;  1U35 D;  1HQ3 C;  1M1A C;  4J8X C;  4LD9 A;  2Y2Q A;  3MGQ C;  1ID3 A;  3TU4 D;  3WAA C;  2FJ7 A;  1P3O D;  4H9P A;  3H0L C;  3REJ A;  3W97 A;  3AZN A;  2FJ7 C;  4R8P C;  4Z66 D;  3KWQ D;  3AZJ D;  2Y2L A;  3B6F B;  5B1M A;  3AZG A;  3AZH B;  1P3F B;  3B0C T;  3P5J B;  1Z2C B;  4Z5T A;  3MGS A;  5CPI D;  5BNX A;  3AL0 C;  5B1L B;  1S32 B;  4WU8 A;  1R4V A;  5AV9 A;  1P3G C;  5DNN D;  5CP6 B;  5AV9 B;  3AZI C;  3B0B A;  1S32 A;  5B0Y C;  3KXB D;  3UTA C;  3AN2 C;  3W99 C;  4Z66 B;  3WKJ B;  3AZJ C;  3AZK D;  3B0C W;  1P3K D;  1S32 C;  5F99 A;  5AY8 C;  5FUG A;  3VH6 A;  3REI C;  2NZD B;  4QLC A;  1TZY A;  3AFA B;  3AZH D;  1P3F D;  5AVC A;  3AZF A;  3UT9 D;  4DRA A;  3AZN B;  5DNM C;  4LD9 D;  4WJ3 C;  3W99 D;  3KUY A;  3V9R A;  1P3K B;  2ARO B;  4WU9 B;  3NQJ B;  5B0Z D;  3REJ C;  4H9S A;  4WU8 B;  1P3P B;  3MGP D;  1WWS A;  3MGS B;  3WTP C;  4H9S C;  2NZD D;  3WAA A;  3AZM C;  5AY8 A;  3AYW D;  4CAY B;  4X23 A;  3AZJ A;  4H9O A;  3AV1 B;  5B1M D;  3AZG D;  4J8X B;  2Y2M A;  4WV4 B;  3AN2 D;  3AZI A;  3REL B;  4Z5T D;  5CPJ C;  1AOI D;  5AV9 C;  1P3B B;  3UTB D;  5BNV A;  4WU9 D;  4JJN C;  4XZQ A;  4J8W D;  3F6T A;  5DNN A;  1H3O A;  5BS7 C;  5F99 C;  4H9R B;  1P3A C;  3AZL D;  4UUZ A;  3MGR C;  3V9R B;  1P3K A;  1F66 B;  3UTA A;  3KWQ C;  4J8X D;  3AZN C;  5AV8 D;  3REK A;  1TAF A;  4Z5T B;  4WNN A;  1P3G A;  3X1V D;  5AV6 D;  4QLC D;  5JRG B;  3AZH A;  3X1U B;  1P3F A;  3UTB B;  3H0M C;  4HGA B;  5B2I D;  3X1S B;  5BT1 D;  3REH B;  3AZJ B;  3AV1 A;  4YS3 A;  3W96 D;  4X23 B;  1P34 A;  2Y2N A;  3X1T B;  2JE5 A;  3WAA B;  5KDM A;  5CP6 C;  3KUY D;  3MGQ D;  2J8P A;  4XUJ B;  5B0Z A;  2RIQ A;  1P3L C;  4LD9 C;  2HIO A;  2ZY3 A;  4J8V D;  5AV5 C;  5CPJ B;  5E5A D;  4NFT A;  5B33 C;  1T3U A;  1U35 B;  4UPK A;  1U35 A;  5E5A C;  5B2J C;  3VH6 W;  4KUD D;  4G91 C;  4XUJ C;  3MGR A;  5CPI C;  3NQU B;  2Y2G A;  4Z2M G;  3WA9 B;  4X23 D;  3TU4 B;  1M18 B;  3LZ0 C;  5DNN C;  3B6F A;  3AZI D;  2YFW B;  1HQ3 A;  3MVD C;  3EG5 B;  5B32 A;  3UTB A;  4JJN D;  4WU9 C;  3B0D B;  5AV6 C;  1EQZ B;  5AVB B;  3W97 D;  5CPJ D;  1AOI C;  3KWQ B;  4NE5 A;  4Z66 A;  4X23 C;  3WA9 D;  1P3M D;  4KGC C;  3W96 C;  3KXB C;  3WTP A;  3UTA D;  1P3P D;  3KSY A;  1P3G D;  5AV5 B;  2HIO B;  2F8N K;  4ZUX D;  5AV9 D;  5B2I A;  1P3B A;  2BYM B;  4DQY B;  1S32 D;  2ZY5 A;  3AV1 D;  1P3I D;  2NQB D;  2BYK B;  1P34 D;  3LZ1 A;  1P3M C;  3C1C C;  4KGC D;  3A1K A;  3W97 B;  3B6G A;  5F99 D;  3AZM B;  1M1A D;  5JRG A;  5AVC C;  2ZY4 A;  4ZUX C;  5AVC D;  3UTA B;  3REH C;  5GT0 C;  4YM6 B;  5AV5 D;  2Y2K A;  1ID3 B;  3REI D;  2DF4 C;  1KX5 B;  2RVQ D;  5JRG C;  4KHA A;  3W99 A;  3EPH A;  3EPJ A;  4KGC B;  4LD9 B;  3AZE A;  5B0Z B;  3AYW C;  4AWL B;  4Z2M H;  3O62 A;  1P3I B;  2F8N H;  5AVB C;  3KFU G;  1HQ3 D;  3MGP A;  3MVD D;  5B32 D;  1M1A B;  3LZ1 B;  1TZY B;  2Y2H A;  3MNN B;  5C3I B;  3MGP B;  2NZD A;  3TU4 C;  3REI B;  5AY8 D;  5GSU C;  1M18 A;  3C1B B;  3WA9 A;  4R8P A;  2PYO D;  3LEL B;  3AN2 B;  3WKJ C;  1B6W A;  3W97 C;  3WTP D;  5B31 C;  3MNN C;  1HTA A;  3IP4 C;  3REL C;  1P3P A;  1AOI A;  5JA4 A;  4HGA C;  3REL D;  4WU9 A;  5B32 C;  1B67 A;  4XZQ D;  1P3B D;  3A6N D;  3VH5 A;  2NQB A;  1EQZ A;  3UT9 B;  5DNM B;  3B6F C;  3X1T C;  3LZ1 D;  3C1B D; 
#chains in the Genus database with same CATH homology
 3AZL A;  3AZI B;  3AZF B;  5AV8 B;  5B24 A;  4J8X A;  5G49 B;  1M1A A;  3AFA A;  5AV8 A;  2Y2P A;  2ARO C;  5B24 B;  2IO5 B;  4QLC B;  3REK D;  1M19 D;  3REJ B;  3X1V A;  1P3O C;  1KU5 A;  5B2I B;  4J8V C;  3KXB B;  2CV5 A;  5AV8 C;  3MGR B;  5AV5 A;  1ZLA B;  3X1T D;  4WZS B;  5B40 C;  2UWX A;  3AZE D;  3NQJ A;  1JFI A;  2NQB C;  1P34 C;  3O62 D;  2NZD C;  2HIO D;  5BNX B;  3LEL A;  4KUD C;  3AV2 C;  5GT0 B;  5B0Y B;  1BH8 A;  4NE3 A;  5E5A B;  4EO5 B;  3LEL C;  4KUD A;  5B31 A;  1P3P C;  3MGR D;  5G49 A;  3R45 B;  3X1S A;  1M18 D;  4J8U A;  4KUD B;  4CAY A;  4R8P D;  3X1U C;  1P3K C;  2PYO A;  5CPK C;  2RVQ C;  5BO0 A;  2Y2J A;  4J8W C;  3B6F D;  3A1I A;  5BS7 A;  5B1L D;  1ZLA D;  3FDD A;  1KX4 D;  4ZBJ B;  5BT1 C;  2F8N B;  1KX4 C;  4H9R A;  4JJN A;  5AVB D;  3AYW B;  5GSU B;  1H3O B;  4G92 B;  5CPJ A;  2ARO A;  1WWI A;  5DNN B;  5CP6 D;  3A6N A;  5B24 C;  1EQZ D;  4CSR B;  1P3M A;  3LZ1 C;  3C1B A;  5B31 G;  3AFA D;  4G91 B;  3AZM A;  5B2J D;  3REH A;  4J8W B;  4ZUX B;  4ZUX A;  3MGQ B;  3MNN D;  1ULY A;  5GXQ C;  1BH8 B;  1BH9 B;  5AY8 B;  1P3L D;  2XD5 A;  2CV5 D;  3LZ0 D;  1KX5 C;  2NQB B;  1P3I A;  1KX3 B;  2VQR A;  2Y2I A;  3C1C A;  4KGC A;  3WKJ A;  3KUY C;  2HUE C;  4KHA B;  4Z66 C;  5GT3 B;  3AV2 B;  3B6G D;  3W99 B;  1M18 C;  1KX5 A;  5JRG D;  5B2I C;  4H9N A;  3AV2 A;  3UTB C;  4XZQ B;  5B1L C;  1Q9C A;  1BFM A;  5C3I C;  3MGP C;  5B31 D;  5B33 B;  5B40 A;  3REI A;  1W2E A;  5B1M B;  3AZG B;  1KX3 D;  1F66 C;  1P3A D;  4J8U D;  2LY8 A;  4J8V B;  2YFW A;  3WTP E;  2ZM5 A;  3AZK B;  2BG1 A;  5B0Y A;  5GXQ A;  1KX4 A;  5GT0 A;  4G92 C;  1TAF B;  5GT3 D;  3MVD A;  2F2A C;  1N1J A;  3AZL C;  5CPK A;  5CP6 A;  1KX3 C;  1F66 D;  5CPK B;  2XD1 A;  1EQZ C;  4J8U C;  1N1J B;  3EPK A;  5B1M C;  3AZG C;  3A6N C;  4YS3 C;  3C1C B;  4XUJ A;  5BNV B;  4YM6 C;  5KDM B;  5B2J A;  5CHL B;  3AZH C;  1P3F C;  3X1V B;  3REL A;  1M19 C;  3MNN A;  4AWL C;  4NE6 A;  2HIO C;  1P3L A;  5B40 B;  3TU4 A;  3W96 B;  1F1E A;  4WNN B;  1P3G B;  5B24 D;  3REK B;  5DNM D;  3NQU A;  2CV5 C;  1KX5 D;  2FJ7 D;  1M19 A;  2YFV B;  1JFI B;  1P3O A;  5JA4 B;  4YM6 A;  1P3O B;  1AOI B;  3REJ D;  3W98 B;  3REK C;  3AZE C;  2CWE A;  3KWQ A;  3MVD B;  3LJA A;  1KX3 A;  3VH6 T;  4DRB A;  5BO0 B;  3X1T A;  1P3A A;  2ZY2 A;  1PZR A;  3MGS D;  5AVC B;  5CPI A;  5CPI B;  3LEL D;  5GT0 D;  2BYM A;  5GT3 C;  3X1V C;  5B33 A;  3AFA C;  3X1U D;  4CSR A;  1P3M B;  3X1S D;  3W98 C;  1F66 A;  5GSU A;  3W98 D;  1A7W A;  1P3B C;  1ZLA A;  5B1L A;  2YFV A;  3KUY B;  1TZY D;  4E45 A;  2IO5 C;  2F8N D;  3AZF D;  1TZY C;  5AVB A;  1KX4 B;  2DQN C;  2PYO B;  1P34 B;  2ARO D;  4J8U B;  3R45 A;  5B32 G;  3WA9 C;  1P3I C;  4H9P B;  3VH5 W;  3H0R C;  5DNM A;  5B2J B;  5F99 B;  3AZM D;  2JCH A;  3REH D;  4XZQ C;  3AZE B;  3A6N B;  4YM6 D;  4UUZ B;  4H9Q B;  4QLC C;  3WAA D;  3LZ0 B;  2G5I C;  4Z5T C;  3O62 C;  3C1B C;  3LZ0 A;  4JJN B;  3AYW A;  3B6G C;  2JSS A;  4H9Q A;  3LJA D;  1ID3 D;  1M19 B;  3C1C D;  3WKJ D;  2CV5 B;  3VH5 T;  3AN2 A;  2F8N G;  1U35 C;  5GXQ B;  1BH9 A;  5B32 B;  3AV2 D;  4YS3 B;  3B6G B;  3EPL A;  1HQ3 B;  4J8W A;  4H9O B;  5B0Z C;  5B31 B;  5B33 D;  3MGS C;  3AZN D;  3AZL B;  2HUE B;  3X1U A;  2PYO C;  1ZLA C;  5B40 D;  5FUG B;  1P3A B;  2G5H C;  3O62 B;  3X1S C;  3LJA B;  1ID3 C;  3AV1 C;  5GSU D;  2FJ7 B;  3W98 A;  4H9N B;  5B0Y D;  4E44 A;  5GXQ D;  3WTP B;  5AV6 A;  4M6B A;  3B0D C;  5AV6 B;  2F8N A;  4WU8 D;  5GT3 A;  3AZF C;  2W8S A;  4ZBJ C;  4R8P B;  3KXB A;  4YS3 D;  3W96 A;  5CPK D;  2Y2O A;  3AZK C;  3AZK A;  1P3L B;  3MGQ A;  3LJA C;  4XUJ D;  4J8V A;  2BYK A;  5E5A A;  2FFF B;  4EO5 C;  3UT9 C;  2L5A A;  3UT9 A;  4WU8 C;  1U35 D;  1HQ3 C;  1M1A C;  4J8X C;  4LD9 A;  2Y2Q A;  3MGQ C;  1ID3 A;  3TU4 D;  3WAA C;  2FJ7 A;  1P3O D;  4H9P A;  3H0L C;  3REJ A;  3W97 A;  3AZN A;  2FJ7 C;  4R8P C;  4Z66 D;  3KWQ D;  3AZJ D;  2Y2L A;  3B6F B;  5B1M A;  3AZG A;  3AZH B;  1P3F B;  3B0C T;  3P5J B;  1Z2C B;  4Z5T A;  3MGS A;  5CPI D;  5BNX A;  3AL0 C;  5B1L B;  1S32 B;  4WU8 A;  1R4V A;  5AV9 A;  1P3G C;  5DNN D;  5CP6 B;  5AV9 B;  3AZI C;  3B0B A;  1S32 A;  5B0Y C;  3KXB D;  3UTA C;  3AN2 C;  3W99 C;  4Z66 B;  3WKJ B;  3AZJ C;  3AZK D;  3B0C W;  1P3K D;  1S32 C;  5F99 A;  5AY8 C;  5FUG A;  3VH6 A;  3REI C;  2NZD B;  4QLC A;  1TZY A;  3AFA B;  3AZH D;  1P3F D;  5AVC A;  3AZF A;  3UT9 D;  4DRA A;  3AZN B;  5DNM C;  4LD9 D;  4WJ3 C;  3W99 D;  3KUY A;  3V9R A;  1P3K B;  2ARO B;  4WU9 B;  3NQJ B;  5B0Z D;  3REJ C;  4H9S A;  4WU8 B;  1P3P B;  3MGP D;  1WWS A;  3MGS B;  3WTP C;  4H9S C;  2NZD D;  3WAA A;  3AZM C;  5AY8 A;  3AYW D;  4CAY B;  4X23 A;  3AZJ A;  4H9O A;  3AV1 B;  5B1M D;  3AZG D;  4J8X B;  2Y2M A;  4WV4 B;  3AN2 D;  3AZI A;  3REL B;  4Z5T D;  5CPJ C;  1AOI D;  5AV9 C;  1P3B B;  3UTB D;  5BNV A;  4WU9 D;  4JJN C;  4XZQ A;  4J8W D;  3F6T A;  5DNN A;  1H3O A;  5BS7 C;  5F99 C;  4H9R B;  1P3A C;  3AZL D;  4UUZ A;  3MGR C;  3V9R B;  1P3K A;  1F66 B;  3UTA A;  3KWQ C;  4J8X D;  3AZN C;  5AV8 D;  3REK A;  1TAF A;  4Z5T B;  4WNN A;  1P3G A;  3X1V D;  5AV6 D;  4QLC D;  5JRG B;  3AZH A;  3X1U B;  1P3F A;  3UTB B;  3H0M C;  4HGA B;  5B2I D;  3X1S B;  5BT1 D;  3REH B;  3AZJ B;  3AV1 A;  4YS3 A;  3W96 D;  4X23 B;  1P34 A;  2Y2N A;  3X1T B;  2JE5 A;  3WAA B;  5KDM A;  5CP6 C;  3KUY D;  3MGQ D;  2J8P A;  4XUJ B;  5B0Z A;  2RIQ A;  1P3L C;  4LD9 C;  2HIO A;  2ZY3 A;  4J8V D;  5AV5 C;  5CPJ B;  5E5A D;  4NFT A;  5B33 C;  1T3U A;  1U35 B;  4UPK A;  1U35 A;  5E5A C;  5B2J C;  3VH6 W;  4KUD D;  4G91 C;  4XUJ C;  3MGR A;  5CPI C;  3NQU B;  2Y2G A;  4Z2M G;  3WA9 B;  4X23 D;  3TU4 B;  1M18 B;  3LZ0 C;  5DNN C;  3B6F A;  3AZI D;  2YFW B;  1HQ3 A;  3MVD C;  3EG5 B;  5B32 A;  3UTB A;  4JJN D;  4WU9 C;  3B0D B;  5AV6 C;  1EQZ B;  5AVB B;  3W97 D;  5CPJ D;  1AOI C;  3KWQ B;  4NE5 A;  4Z66 A;  4X23 C;  3WA9 D;  1P3M D;  4KGC C;  3W96 C;  3KXB C;  3WTP A;  3UTA D;  1P3P D;  3KSY A;  1P3G D;  5AV5 B;  2HIO B;  2F8N K;  4ZUX D;  5AV9 D;  5B2I A;  1P3B A;  2BYM B;  4DQY B;  1S32 D;  2ZY5 A;  3AV1 D;  1P3I D;  2NQB D;  2BYK B;  1P34 D;  3LZ1 A;  1P3M C;  3C1C C;  4KGC D;  3A1K A;  3W97 B;  3B6G A;  5F99 D;  3AZM B;  1M1A D;  5JRG A;  5AVC C;  2ZY4 A;  4ZUX C;  5AVC D;  3UTA B;  3REH C;  5GT0 C;  4YM6 B;  5AV5 D;  2Y2K A;  1ID3 B;  3REI D;  2DF4 C;  1KX5 B;  2RVQ D;  5JRG C;  4KHA A;  3W99 A;  3EPH A;  3EPJ A;  4KGC B;  4LD9 B;  3AZE A;  5B0Z B;  3AYW C;  4AWL B;  4Z2M H;  3O62 A;  1P3I B;  2F8N H;  5AVB C;  3KFU G;  1HQ3 D;  3MGP A;  3MVD D;  5B32 D;  1M1A B;  3LZ1 B;  1TZY B;  2Y2H A;  3MNN B;  5C3I B;  3MGP B;  2NZD A;  3TU4 C;  3REI B;  5AY8 D;  5GSU C;  1M18 A;  3C1B B;  3WA9 A;  4R8P A;  2PYO D;  3LEL B;  3AN2 B;  3WKJ C;  1B6W A;  3W97 C;  3WTP D;  5B31 C;  3MNN C;  1HTA A;  3IP4 C;  3REL C;  1P3P A;  1AOI A;  5JA4 A;  4HGA C;  3REL D;  4WU9 A;  5B32 C;  1B67 A;  4XZQ D;  1P3B D;  3A6N D;  3VH5 A;  2NQB A;  1EQZ A;  3UT9 B;  5DNM B;  3B6F C;  3X1T C;  3LZ1 D;  3C1B D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...