4H9RA

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9rA00
3MGSA 3AZGC 1KX3B 5F99A 3REHC 3C1CA 5AY8A 1ZLAD 1P34D 5DNNA 2IO5C 5B24D 3AV1B 5AV5B 1M1AA 5JRGD 5E5AA 3AZIA 1P3BA 5C3IB 3X1VD 2YFVB 5B33B 5B2JC 4NE6A 3WAAA 4UUZB 4CSRB 4ZBJC 4WU8A 4J8VD 1KX5A 4DRBA 5AV9A 2BYMA 5CPIA 1S32D 1P3FB 1P3IC 4E44A 3W96D 1N1JB 4Z66C 3RELA 5AV6A 3UTAC 5CPJB 3V9RA 5B32D 2YFWA 3MGSC 2HIOD 5F99C 3C1CC 3C1BA 1P3KB 4M6BA 5AY8C 2CV5B 4Z2MG 3MNNB 5AV8B 3B0DC 5DNNC 4YM6B 1M1AC 5E5AC 3AZIC 3REHB 1WWIA 3REKA 2PYOD 1M19A 2CWEA 4J8WA 1P3BC 4Z5TD 1M18D 4JJNA 3WAAC 5B0ZA 3REID 3KXBD 5BNVB 1KX3D 4WU8C 1KX5C 5AV9C 3UT9A 3AZFA 5CPIC 3AV1D 5AV5D 5GXQA 4ZBJB 4H9RB 5AV6C 1R4VA 5B33D 5BNXA 3C1BC 1P3IB 3B6GA 4ZUXA 4QLCA 4Z66B 3WTPE 1P3OA 2JSSA 1F1EA 3MGSB 5F99B 3REKC 1P3FD 3C1CB 1M19C 4J8WC 2F8NK 3B0CW 5AY8B 5CPJD 4JJNC 5B2IA 3AYWB 3WA9A 5B0ZC 1M1AB 5E5AB 5GSUA 1BH8B 4NE3A 3AN2A 1P3KD 5B40B 2CV5D 4XZQA 3MNND 5AV8D 3WAAB 4YM6D 4H9SA 3UT9C 3TU4A 3R45A 3AZFC 5GXQC 4WU8B 1B67A 4G92B 3REHD 1KX5B 3AFAA 4H9PA 2BYMB 5CPIB 2LY8A 3B6GC 4ZUXC 4QLCC 2F8NA 5AV6B 3V9RB 5BO0A 1P3OC 2YFWB 2NZDD 3C1BB 5B2IC 1KX4D 3WA9C 4YS3A 4H9OA 4EO5C 3W98A 3A6NB 5GSUC 5CP6A 4R8PA 1KU5A 3VH6A 4J8XB 3REKB 3AN2C 4J8WB 1P3ID 4KUDC 4Z66D 4XZQC 4JJNB 5B0ZB 3LELA 4H9SC 3TU4C 2FJ7B 4KGCA 5F99D 5DNMA 2F8NH 3C1CD 3B0CT 5AY8D 3MGRA 3AFAC 3AYWD 1P3AA 2RVQC 3UT9B 3VH5W 1M1AD 5E5AD 3WKJC 1JFIA 5B40D 1BH9B 2L5AA 3WAAD 5BNXB 3LZ1A 3X1UA 4CAYA 4HGAC 3VH6T 4WU8D 4ZUXB 4QLCB 1KX5D 1U35B 1B6WA 4YS3C 1P3OB 3AZJA 3W98C 1Q9CA 4R8PC 5CP6C 5CPID 3X1SA 4X23A 4LD9A 2BYKB 5AV6D 5B2IB 3WA9B 3LELC 3LZ0A 3VH5A 4EO5B 5CPKC 4KGCC 5GSUB 5DNMC 3MGPA 5B0YA 3C1BD 4KUDB 3MGRC 4WV4B 4XZQB 1P3AC 3TU4B 3R45B 1P3MA 3A6ND 1F66D 3KUYA 1ID3A 4J8XD 3REKD 4J8WD 3AZND 4JJND 5B24A 4H9PB 5B0ZD 5FUGA 3LZ1C 5JRGA 2FJ7D 3X1UC 2HUEC 3NQJA 1A7WA 3AZGB 3WKJB 2F8NB 3LJAA 5GT3A 1EQZA 3AZJC 3VH5T 2IO5B 5B31D 3UT9D 3AZKA 3X1SC 4HGAB 4X23C 4G91C 4YS3B 1TZYA 4H9OB 5B2JB 3B6FA 5CP6B 4R8PB 3MGPC 3O62A 5B0YC 4ZUXD 4QLCD 3RELC 1U35D 1BFMA 3LELB 1P3OD 1P3MC 5CPKB 4KGCB 3KUYC 5DNMB 3AZLA 1ID3C 1AOIA 4E45A 3MGRB 3AV2A 3UTAB 1P3AB 3MVDA 5B24C 3WA9D 5JRGC 3W97A 5GSUD 1M18A 4KUDD 3LJAC 1JFIB 3MGQA 5BS7A 5JA4A 5B1MA 5GT3C 4XZQD 1EQZC 2NQBA 3KXBA 3B0DB 5DNNB 3LZ1B 3AZKC 3TU4D 4CAYB 3REJA 3AZIB 5B32G 1P3BB 3AZEA 1TZYC 2RVQD 3AZJB 1P3PA 4WNNA 3B6FC 3O62C 3X1SB 3AZGD 3WKJD 2F8ND 1P3GA 4G91B 5AV9B 4UUZA 3AZLC 3MGPB 1AOIC 5B0YB 5B31G 3AV2C 3RELB 3MVDC 3AZMA 4YS3D 3W97C 5B2JD 1P3MB 5CP6D 4R8PD 3KUYB 1ID3B 4H9QA 1M18C 4WU9A 3MGQC 5BS7C 3X1TA 5B1MC 2NQBC 3KXBC 3LELD 5FUGB 5JRGB 3REJC 3KWQA 5CPKD 3NQJB 4AWLC 4KGCD 5DNMD 1M19B 3AZEC 3LJAB 3MGRD 5GT3B 3UTAD 1P3AD 1EQZB 1P3PC 1P3LA 3AZKB 3AZHA 3REHA 3MGSD 1P3GC 5BT1C 5AVBA 1TZYB 4H9NA 1HQ3A 5DNND 3B6FB 3LZ1D 2AROA 3AZFB 3O62B 5GXQB 3AZID 1P3BD 1TAFA 3AZMC 2NZDA 3W99A 3AZLB 1AOIB 3X1SD 4KHAA 4WU9C 1KX4A 3B6GB 3AV2B 3X1TC 3MVDB 5AV9D 5CHLB 3W97B 3KWQC 4NFTA 3WTPA 3MGPD 3NQUA 5GT0A 5B0YD 5AVCA 5KDMA 4WZSB 4NE5A 3MGQB 3UTBA 2NQBB 5B1MB 1H3OA 3RELD 3KXBB 1P3LC 3AZHC 1P3MD 3REJB 5B1LA 4AWLB 3KUYD 1ID3D 3AN2B 3AYWA 3AZEB 3KSYA 5AVBC 4XUJA 4J8UA 1HQ3C 1P3PB 4WNNB 2AROC 1BH8A 1M19D 1P3GB 5B40A 3LJAD 1ZLAA 5GT3D 3AFAB 1P34A 1EQZD 2NZDC 3W99C 3AZKD 4Z2MH 1HTAA 1KX4C 3X1VA 3AZMB 1TZYD 5BO0B 3B6FD 5G49A 3WTPC 3AZFD 3O62D 4H9QB 5GXQD 5GT0C 4J8VA 5AVCC 4LD9C 4WU9B 3UTBC 3X1TB 3LZ0C 5B1LC 3KWQB 3W98B 1S32A 3AZLD 1AOID 3W96A 3AYWC 3B6GD 3AV2D 4XUJC 4J8UC 3MVDD 1P3LB 5B32A 3W97D 3A6NA 3AZHB 2HIOA 1F66A 4J8XA 5B40C 3AZNA 5AVBB 3MGQD 1ZLAC 2NQBD 5B1MD 1P34C 4H9NB 5B2ID 1HQ3B 2FJ7A 2AROB 3REJD 4G92C 2PYOA 3AN2D 4Z5TA 3X1VC 1TAFB 3AZED 3REIA 5B31A 1P3PD 2NZDB 3W99B 3X1UB 1KX3A 2HUEB 4J8VC 4KHAB 1KX4B 1P3GD 5BT1D 1BH9A 3AFAD 3AV1A 5AV5A 1S32C 3WTPB 3NQUB 5GT0B 3W96C 4X23B 5AVCB 5KDMB 4LD9B 1U35A 3UTBB 1H3OB 2YFVA 3AZMD 5B33A 5B32C 3LZ0B 3A6NC 2HIOC 1F66C 5B1LB 4CSRA 4J8XC 4DRAA 2BYKA 3AZNC 4WU9D 3X1TD 4XUJB 4J8UB 2FJ7C 3KWQD 3W98D 1P3FA 2PYOC 4KUDA 1N1JA 4Z5TC 5CPJA 1ZLAB 1P34B 3REIC 5B31C 5B24B 1P3LD 3AZHD 1KX3C 3VH6W 1P3KA 3X1VB 2CV5A 5AVBD 3MNNA 5AV8A 1HQ3D 4YM6A 3AV1C 2AROD 5G49B 5AV5C 3AZGA 3WKJA 4J8VB 1ULYA 1U35C 5C3IC 5B33C 3W99D 5BNVA 1S32B 3X1UD 3W96B 3B0BA 5B32B 5B2JA 2HIOB 3AZJD 1F66B 1P3FC 3WTPD 4H9RA 5GT0D 4X23D 5AVCD 3AZNB 5CPJC 4LD9D 3UTBD 1WWSA 3LZ0D 5CPKA 2F8NG 5B1LD 2PYOB 1P3IA 1P3KC 4Z5TB 4Z66A 3UTAA 2CV5C 1M18B 3MNNC 4XUJD 5JA4B 5AV8C 4J8UD 3REIB 5B31B 4YM6C
chains in the Genus database with same CATH superfamily
3MGSA 3AZGC 1KX3B 5F99A 3REHC 2F2AC 3C1CA 5AY8A 2Y2IA 1ZLAD 1P34D 5DNNA 2IO5C 5B24D 3AV1B 5AV5B 1M1AA 5JRGD 5E5AA 3AZIA 1P3BA 2Y2MA 5C3IB 3X1VD 2YFVB 5B33B 5B2JC 4NE6A 3WAAA 4UUZB 3P5JB 4CSRB 4ZBJC 4WU8A 4J8VD 1KX5A 4DRBA 5AV9A 2DF4C 2BYMA 5CPIA 1S32D 1P3FB 1P3IC 4E44A 3W96D 1N1JB 4Z66C 3RELA 5AV6A 3UTAC 5CPJB 3V9RA 5B32D 2YFWA 3MGSC 2HIOD 5F99C 3C1CC 3C1BA 1P3KB 4M6BA 5AY8C 2CV5B 4Z2MG 3MNNB 5AV8B 3B0DC 5DNNC 4YM6B 2Y2GA 1M1AC 5E5AC 3AZIC 3AL0C 3IP4C 3REHB 1WWIA 3REKA 2PYOD 1M19A 2CWEA 4J8WA 1P3BC 4Z5TD 1M18D 4JJNA 3WAAC 3H0RC 5B0ZA 3REID 3KXBD 5BNVB 1KX3D 4WU8C 1KX5C 5AV9C 3EPKA 2DQNC 3UT9A 3AZFA 5CPIC 3AV1D 5AV5D 5GXQA 4ZBJB 4H9RB 5AV6C 4WJ3C 1R4VA 5B33D 5BNXA 3C1BC 1P3IB 3B6GA 4ZUXA 4QLCA 4Z66B 3WTPE 2BG1A 1P3OA 2JSSA 1F1EA 3MGSB 5F99B 3REKC 1P3FD 3C1CB 1M19C 4J8WC 2F8NK 3B0CW 5AY8B 5CPJD 4JJNC 5B2IA 3AYWB 3WA9A 5B0ZC 1M1AB 5E5AB 5GSUA 1BH8B 4NE3A 3AN2A 1P3KD 2Y2JA 5B40B 2ZY2A 4XZQA 2CV5D 3MNND 5AV8D 3WAAB 4YM6D 4H9SA 3UT9C 3TU4A 3R45A 3AZFC 5GXQC 4WU8B 1B67A 4G92B 3REHD 1KX5B 3AFAA 4H9PA 2BYMB 5CPIB 2LY8A 3B6GC 4ZUXC 4QLCC 2F8NA 5AV6B 3V9RB 5BO0A 1P3OC 2YFWB 2Y2QA 2NZDD 3C1BB 5B2IC 1KX4D 1W2EA 3WA9C 4YS3A 4H9OA 4EO5C 2XD5A 3W98A 3A6NB 5GSUC 5CP6A 4R8PA 1KU5A 3VH6A 4J8XB 3REKB 3AN2C 4J8WB 1P3ID 4KUDC 4Z66D 4XZQC 4JJNB 2UWXA 5B0ZB 3LELA 4H9SC 3TU4C 2FJ7B 4KGCA 5F99D 5DNMA 2F8NH 3C1CD 3B0CT 2Y2PA 5AY8D 3MGRA 3AFAC 3AYWD 1P3AA 2RVQC 2XD1A 2ZY3A 3UT9B 3VH5W 1M1AD 5E5AD 3EG5B 3WKJC 1JFIA 5B40D 1BH9B 2L5AA 3WAAD 5BNXB 3LZ1A 3X1UA 4CAYA 4HGAC 3VH6T 4WU8D 4ZUXB 3F6TA 4QLCB 1KX5D 1U35B 1B6WA 4YS3C 1P3OB 3AZJA 3W98C 1Q9CA 4R8PC 3H0MC 5CP6C 5CPID 3X1SA 4X23A 4LD9A 2BYKB 5AV6D 5B2IB 3WA9B 3LELC 3LZ0A 3VH5A 4EO5B 5CPKC 4KGCC 5GSUB 5DNMC 3MGPA 2G5IC 5B0YA 3C1BD 4KUDB 3MGRC 4WV4B 4XZQB 1P3AC 3TU4B 3R45B 1P3MA 3A6ND 1F66D 3KUYA 1ID3A 4J8XD 3REKD 4J8WD 3AZND 4JJND 5B24A 4H9PB 5B0ZD 5FUGA 3LZ1C 5JRGA 2FJ7D 3X1UC 2HUEC 3NQJA 1A7WA 3AZGB 3WKJB 2F8NB 3LJAA 5GT3A 1EQZA 3AZJC 3VH5T 2IO5B 5B31D 3UT9D 3AZKA 3A1IA 3X1SC 4HGAB 4X23C 4G91C 4YS3B 1TZYA 4H9OB 5B2JB 3B6FA 5CP6B 4R8PB 3MGPC 3O62A 5B0YC 4ZUXD 4QLCD 3RELC 1U35D 1BFMA 3LELB 1P3OD 1P3MC 5CPKB 4KGCB 3KUYC 5DNMB 3AZLA 1ID3C 1AOIA 4E45A 3MGRB 3AV2A 3UTAB 1P3AB 3MVDA 5B24C 3WA9D 5JRGC 3W97A 5GSUD 1M18A 4KUDD 3LJAC 1JFIB 3MGQA 5BS7A 5JA4A 5B1MA 5GT3C 4XZQD 1EQZC 2NQBA 3KXBA 3B0DB 5DNNB 3LZ1B 3AZKC 3TU4D 4CAYB 3REJA 3AZIB 5B32G 3EPLA 1P3BB 3AZEA 1TZYC 2RVQD 3AZJB 1P3PA 4WNNA 3B6FC 3O62C 3X1SB 2Y2LA 3AZGD 3WKJD 2F8ND 1P3GA 4G91B 5AV9B 4UUZA 3AZLC 3MGPB 1AOIC 5B0YB 5B31G 3AV2C 3RELB 3MVDC 3AZMA 4YS3D 3W97C 2Y2HA 5B2JD 1P3MB 5CP6D 4R8PD 3KUYB 1ID3B 4H9QA 1M18C 4WU9A 3MGQC 5BS7C 3X1TA 5B1MC 2NQBC 3KXBC 3LELD 5FUGB 5JRGB 3REJC 3KWQA 5CPKD 3NQJB 4AWLC 4KGCD 5DNMD 1M19B 3AZEC 3LJAB 3MGRD 5GT3B 3UTAD 1P3AD 1EQZB 1P3PC 1P3LA 2ZY5A 3AZKB 3AZHA 3REHA 3MGSD 1P3GC 5BT1C 5AVBA 1TZYB 4H9NA 1HQ3A 5DNND 3B6FB 3LZ1D 2AROA 3AZFB 3O62B 5GXQB 3AZID 1P3BD 1TAFA 2G5HC 3AZMC 2NZDA 3W99A 3AZLB 1AOIB 3X1SD 4KHAA 4WU9C 1KX4A 3B6GB 3AV2B 3X1TC 3MVDB 5AV9D 5CHLB 3W97B 3KWQC 4NFTA 3WTPA 3MGPD 3NQUA 5GT0A 5B0YD 5AVCA 5KDMA 4WZSB 4NE5A 1Z2CB 3MGQB 3UTBA 5B1MB 1H3OA 3RELD 2NQBB 3KXBB 1P3LC 3AZHC 1P3MD 3REJB 5B1LA 4AWLB 2Y2KA 3KUYD 1ID3D 3AN2B 3AYWA 3AZEB 3KSYA 5AVBC 4XUJA 4J8UA 3EPHA 1HQ3C 1P3PB 4WNNB 2AROC 3FDDA 1BH8A 1M19D 1P3GB 5B40A 3LJAD 2JCHA 1ZLAA 5GT3D 3AFAB 1P34A 1EQZD 2NZDC 3W99C 3AZKD 4Z2MH 1HTAA 1KX4C 3X1VA 3AZMB 1TZYD 5BO0B 2J8PA 3B6FD 5G49A 3WTPC 3AZFD 3O62D 4H9QB 5GXQD 5GT0C 4J8VA 5AVCC 4LD9C 4WU9B 2Y2NA 3UTBC 3X1TB 3H0LC 3LZ0C 5B1LC 3KWQB 3W98B 1S32A 3AZLD 1AOID 3W96A 3AYWC 3B6GD 3AV2D 4XUJC 4J8UC 3MVDD 1P3LB 5B32A 3W97D 3A6NA 3AZHB 2HIOA 1F66A 4J8XA 5B40C 3AZNA 5AVBB 3MGQD 1ZLAC 2NQBD 5B1MD 1P34C 4H9NB 5B2ID 1HQ3B 2FJ7A 1T3UA 2AROB 3REJD 4G92C 2PYOA 3AN2D 4Z5TA 3X1VC 1TAFB 3AZED 3REIA 5B31A 1P3PD 2NZDB 3W99B 3X1UB 1KX3A 2HUEB 4J8VC 2Y2OA 4KHAB 1KX4B 1P3GD 5BT1D 1BH9A 3AFAD 3AV1A 5AV5A 3EPJA 3WTPB 1S32C 3KFUG 3NQUB 5GT0B 3W96C 4X23B 5AVCB 5KDMB 4LD9B 1U35A 3UTBB 1H3OB 2YFVA 3AZMD 5B33A 5B32C 3LZ0B 3A6NC 2HIOC 1F66C 5B1LB 4CSRA 4J8XC 2RIQA 4DRAA 2BYKA 3AZNC 4WU9D 3X1TD 4XUJB 4J8UB 2VQRA 2FJ7C 2FFFB 4DQYB 3KWQD 3W98D 2ZM5A 1P3FA 2PYOC 4KUDA 1N1JA 4Z5TC 5CPJA 1ZLAB 1P34B 3REIC 5B31C 5B24B 1P3LD 3AZHD 1KX3C 3VH6W 1P3KA 3X1VB 2CV5A 4UPKA 5AVBD 3MNNA 5AV8A 2W8SA 1HQ3D 4YM6A 3A1KA 3AV1C 2AROD 5G49B 5AV5C 3AZGA 3WKJA 4J8VB 1ULYA 1U35C 5C3IC 5B33C 3W99D 5BNVA 1S32B 3X1UD 3W96B 3B0BA 5B32B 5B2JA 2HIOB 3AZJD 1F66B 1P3FC 3WTPD 4H9RA 5GT0D 4X23D 5AVCD 3AZNB 5CPJC 4LD9D 3UTBD 1PZRA 1WWSA 3LZ0D 2JE5A 5CPKA 2F8NG 2ZY4A 5B1LD 2PYOB 1P3IA 1P3KC 4Z5TB 4Z66A 3UTAA 2CV5C 1M18B 3MNNC 4XUJD 5JA4B 5AV8C 4J8UD 3REIB 5B31B 4YM6C
chains in the Genus database with same CATH topology
3MGSA 3AZGC 1KX3B 5F99A 3REHC 2F2AC 3C1CA 5AY8A 2Y2IA 1ZLAD 1P34D 5DNNA 2IO5C 5B24D 3AV1B 5AV5B 1M1AA 5JRGD 5E5AA 3AZIA 1P3BA 2Y2MA 5C3IB 3X1VD 2YFVB 5B33B 5B2JC 4NE6A 3WAAA 4UUZB 3P5JB 4CSRB 4ZBJC 4WU8A 4J8VD 1KX5A 4DRBA 5AV9A 2DF4C 2BYMA 5CPIA 1S32D 1P3FB 1P3IC 4E44A 3W96D 1N1JB 4Z66C 3RELA 5AV6A 3UTAC 5CPJB 3V9RA 5B32D 2YFWA 3MGSC 2HIOD 5F99C 3C1CC 3C1BA 1P3KB 4M6BA 5AY8C 2CV5B 4Z2MG 3MNNB 5AV8B 3B0DC 5DNNC 4YM6B 2Y2GA 1M1AC 5E5AC 3AZIC 3AL0C 3IP4C 3REHB 1WWIA 3REKA 2PYOD 1M19A 2CWEA 4J8WA 1P3BC 4Z5TD 1M18D 4JJNA 3WAAC 3H0RC 5B0ZA 3REID 3KXBD 5BNVB 1KX3D 4WU8C 1KX5C 5AV9C 3EPKA 2DQNC 3UT9A 3AZFA 5CPIC 3AV1D 5AV5D 5GXQA 4ZBJB 4H9RB 5AV6C 4WJ3C 1R4VA 5B33D 5BNXA 3C1BC 1P3IB 3B6GA 4ZUXA 4QLCA 4Z66B 3WTPE 2BG1A 1P3OA 2JSSA 1F1EA 3MGSB 5F99B 3REKC 1P3FD 3C1CB 1M19C 4J8WC 2F8NK 3B0CW 5AY8B 5CPJD 4JJNC 5B2IA 3AYWB 3WA9A 5B0ZC 1M1AB 5E5AB 5GSUA 1BH8B 4NE3A 3AN2A 1P3KD 2Y2JA 5B40B 2ZY2A 4XZQA 2CV5D 3MNND 5AV8D 3WAAB 4YM6D 4H9SA 3UT9C 3TU4A 3R45A 3AZFC 5GXQC 4WU8B 1B67A 4G92B 3REHD 1KX5B 3AFAA 4H9PA 2BYMB 5CPIB 2LY8A 3B6GC 4ZUXC 4QLCC 2F8NA 5AV6B 3V9RB 5BO0A 1P3OC 2YFWB 2Y2QA 2NZDD 3C1BB 5B2IC 1KX4D 1W2EA 3WA9C 4YS3A 4H9OA 4EO5C 2XD5A 3W98A 3A6NB 5GSUC 5CP6A 4R8PA 1KU5A 3VH6A 4J8XB 3REKB 3AN2C 4J8WB 1P3ID 4KUDC 4Z66D 4XZQC 4JJNB 2UWXA 5B0ZB 3LELA 4H9SC 3TU4C 2FJ7B 4KGCA 5F99D 5DNMA 2F8NH 3C1CD 3B0CT 2Y2PA 5AY8D 3MGRA 3AFAC 3AYWD 1P3AA 2RVQC 2XD1A 2ZY3A 3UT9B 3VH5W 1M1AD 5E5AD 3EG5B 3WKJC 1JFIA 5B40D 1BH9B 2L5AA 3WAAD 5BNXB 3LZ1A 3X1UA 4CAYA 4HGAC 3VH6T 4WU8D 4ZUXB 3F6TA 4QLCB 1KX5D 1U35B 1B6WA 4YS3C 1P3OB 3AZJA 3W98C 1Q9CA 4R8PC 3H0MC 5CP6C 5CPID 3X1SA 4X23A 4LD9A 2BYKB 5AV6D 5B2IB 3WA9B 3LELC 3LZ0A 3VH5A 4EO5B 5CPKC 4KGCC 5GSUB 5DNMC 3MGPA 2G5IC 5B0YA 3C1BD 4KUDB 3MGRC 4WV4B 4XZQB 1P3AC 3TU4B 3R45B 1P3MA 3A6ND 1F66D 3KUYA 1ID3A 4J8XD 3REKD 4J8WD 3AZND 4JJND 5B24A 4H9PB 5B0ZD 5FUGA 3LZ1C 5JRGA 2FJ7D 3X1UC 2HUEC 3NQJA 1A7WA 3AZGB 3WKJB 2F8NB 3LJAA 5GT3A 1EQZA 3AZJC 3VH5T 2IO5B 5B31D 3UT9D 3AZKA 3A1IA 3X1SC 4HGAB 4X23C 4G91C 4YS3B 1TZYA 4H9OB 5B2JB 3B6FA 5CP6B 4R8PB 3MGPC 3O62A 5B0YC 4ZUXD 4QLCD 3RELC 1U35D 1BFMA 3LELB 1P3OD 1P3MC 5CPKB 4KGCB 3KUYC 5DNMB 3AZLA 1ID3C 1AOIA 4E45A 3MGRB 3AV2A 3UTAB 1P3AB 3MVDA 5B24C 3WA9D 5JRGC 3W97A 5GSUD 1M18A 4KUDD 3LJAC 1JFIB 3MGQA 5BS7A 5JA4A 5B1MA 5GT3C 4XZQD 1EQZC 2NQBA 3KXBA 3B0DB 5DNNB 3LZ1B 3AZKC 3TU4D 4CAYB 3REJA 3AZIB 5B32G 3EPLA 1P3BB 3AZEA 1TZYC 2RVQD 3AZJB 1P3PA 4WNNA 3B6FC 3O62C 3X1SB 2Y2LA 3AZGD 3WKJD 2F8ND 1P3GA 4G91B 5AV9B 4UUZA 3AZLC 3MGPB 1AOIC 5B0YB 5B31G 3AV2C 3RELB 3MVDC 3AZMA 4YS3D 3W97C 2Y2HA 5B2JD 1P3MB 5CP6D 4R8PD 3KUYB 1ID3B 4H9QA 1M18C 4WU9A 3MGQC 5BS7C 3X1TA 5B1MC 2NQBC 3KXBC 3LELD 5FUGB 5JRGB 3REJC 3KWQA 5CPKD 3NQJB 4AWLC 4KGCD 5DNMD 1M19B 3AZEC 3LJAB 3MGRD 5GT3B 3UTAD 1P3AD 1EQZB 1P3PC 1P3LA 2ZY5A 3AZKB 3AZHA 3REHA 3MGSD 1P3GC 5BT1C 5AVBA 1TZYB 4H9NA 1HQ3A 5DNND 3B6FB 3LZ1D 2AROA 3AZFB 3O62B 5GXQB 3AZID 1P3BD 1TAFA 2G5HC 3AZMC 2NZDA 3W99A 3AZLB 1AOIB 3X1SD 4KHAA 4WU9C 1KX4A 3B6GB 3AV2B 3X1TC 3MVDB 5AV9D 5CHLB 3W97B 3KWQC 4NFTA 3WTPA 3MGPD 3NQUA 5GT0A 5B0YD 5AVCA 5KDMA 4WZSB 4NE5A 1Z2CB 3MGQB 3UTBA 5B1MB 1H3OA 3RELD 2NQBB 3KXBB 1P3LC 3AZHC 1P3MD 3REJB 5B1LA 4AWLB 2Y2KA 3KUYD 1ID3D 3AN2B 3AYWA 3AZEB 3KSYA 5AVBC 4XUJA 4J8UA 3EPHA 1HQ3C 1P3PB 4WNNB 2AROC 3FDDA 1BH8A 1M19D 1P3GB 5B40A 3LJAD 2JCHA 1ZLAA 5GT3D 3AFAB 1P34A 1EQZD 2NZDC 3W99C 3AZKD 4Z2MH 1HTAA 1KX4C 3X1VA 3AZMB 1TZYD 5BO0B 2J8PA 3B6FD 5G49A 3WTPC 3AZFD 3O62D 4H9QB 5GXQD 5GT0C 4J8VA 5AVCC 4LD9C 4WU9B 2Y2NA 3UTBC 3X1TB 3H0LC 3LZ0C 5B1LC 3KWQB 3W98B 1S32A 3AZLD 1AOID 3W96A 3AYWC 3B6GD 3AV2D 4XUJC 4J8UC 3MVDD 1P3LB 5B32A 3W97D 3A6NA 3AZHB 2HIOA 1F66A 4J8XA 5B40C 3AZNA 5AVBB 3MGQD 1ZLAC 2NQBD 5B1MD 1P34C 4H9NB 5B2ID 1HQ3B 2FJ7A 1T3UA 2AROB 3REJD 4G92C 2PYOA 3AN2D 4Z5TA 3X1VC 1TAFB 3AZED 3REIA 5B31A 1P3PD 2NZDB 3W99B 3X1UB 1KX3A 2HUEB 4J8VC 2Y2OA 4KHAB 1KX4B 1P3GD 5BT1D 1BH9A 3AFAD 3AV1A 5AV5A 3EPJA 3WTPB 1S32C 3KFUG 3NQUB 5GT0B 3W96C 4X23B 5AVCB 5KDMB 4LD9B 1U35A 3UTBB 1H3OB 2YFVA 3AZMD 5B33A 5B32C 3LZ0B 3A6NC 2HIOC 1F66C 5B1LB 4CSRA 4J8XC 2RIQA 4DRAA 2BYKA 3AZNC 4WU9D 3X1TD 4XUJB 4J8UB 2VQRA 2FJ7C 2FFFB 4DQYB 3KWQD 3W98D 2ZM5A 1P3FA 2PYOC 4KUDA 1N1JA 4Z5TC 5CPJA 1ZLAB 1P34B 3REIC 5B31C 5B24B 1P3LD 3AZHD 1KX3C 3VH6W 1P3KA 3X1VB 2CV5A 4UPKA 5AVBD 3MNNA 5AV8A 2W8SA 1HQ3D 4YM6A 3A1KA 3AV1C 2AROD 5G49B 5AV5C 3AZGA 3WKJA 4J8VB 1ULYA 1U35C 5C3IC 5B33C 3W99D 5BNVA 1S32B 3X1UD 3W96B 3B0BA 5B32B 5B2JA 2HIOB 3AZJD 1F66B 1P3FC 3WTPD 4H9RA 5GT0D 4X23D 5AVCD 3AZNB 5CPJC 4LD9D 3UTBD 1PZRA 1WWSA 3LZ0D 2JE5A 5CPKA 2F8NG 2ZY4A 5B1LD 2PYOB 1P3IA 1P3KC 4Z5TB 4Z66A 3UTAA 2CV5C 1M18B 3MNNC 4XUJD 5JA4B 5AV8C 4J8UD 3REIB 5B31B 4YM6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGS A;  3AZG C;  1KX3 B;  5F99 A;  3REH C;  3C1C A;  5AY8 A;  1ZLA D;  1P34 D;  5DNN A;  2IO5 C;  5B24 D;  3AV1 B;  5AV5 B;  1M1A A;  5JRG D;  5E5A A;  3AZI A;  1P3B A;  5C3I B;  3X1V D;  2YFV B;  5B33 B;  5B2J C;  4NE6 A;  3WAA A;  4UUZ B;  4CSR B;  4ZBJ C;  4WU8 A;  4J8V D;  1KX5 A;  4DRB A;  5AV9 A;  2BYM A;  5CPI A;  1S32 D;  1P3F B;  1P3I C;  4E44 A;  3W96 D;  1N1J B;  4Z66 C;  3REL A;  5AV6 A;  3UTA C;  5CPJ B;  3V9R A;  5B32 D;  2YFW A;  3MGS C;  2HIO D;  5F99 C;  3C1C C;  3C1B A;  1P3K B;  4M6B A;  5AY8 C;  2CV5 B;  4Z2M G;  3MNN B;  5AV8 B;  3B0D C;  5DNN C;  4YM6 B;  1M1A C;  5E5A C;  3AZI C;  3REH B;  1WWI A;  3REK A;  2PYO D;  1M19 A;  2CWE A;  4J8W A;  1P3B C;  4Z5T D;  1M18 D;  4JJN A;  3WAA C;  5B0Z A;  3REI D;  3KXB D;  5BNV B;  1KX3 D;  4WU8 C;  1KX5 C;  5AV9 C;  3UT9 A;  3AZF A;  5CPI C;  3AV1 D;  5AV5 D;  5GXQ A;  4ZBJ B;  4H9R B;  5AV6 C;  1R4V A;  5B33 D;  5BNX A;  3C1B C;  1P3I B;  3B6G A;  4ZUX A;  4QLC A;  4Z66 B;  3WTP E;  1P3O A;  2JSS A;  1F1E A;  3MGS B;  5F99 B;  3REK C;  1P3F D;  3C1C B;  1M19 C;  4J8W C;  2F8N K;  3B0C W;  5AY8 B;  5CPJ D;  4JJN C;  5B2I A;  3AYW B;  3WA9 A;  5B0Z C;  1M1A B;  5E5A B;  5GSU A;  1BH8 B;  4NE3 A;  3AN2 A;  1P3K D;  5B40 B;  2CV5 D;  4XZQ A;  3MNN D;  5AV8 D;  3WAA B;  4YM6 D;  4H9S A;  3UT9 C;  3TU4 A;  3R45 A;  3AZF C;  5GXQ C;  4WU8 B;  1B67 A;  4G92 B;  3REH D;  1KX5 B;  3AFA A;  4H9P A;  2BYM B;  5CPI B;  2LY8 A;  3B6G C;  4ZUX C;  4QLC C;  2F8N A;  5AV6 B;  3V9R B;  5BO0 A;  1P3O C;  2YFW B;  2NZD D;  3C1B B;  5B2I C;  1KX4 D;  3WA9 C;  4YS3 A;  4H9O A;  4EO5 C;  3W98 A;  3A6N B;  5GSU C;  5CP6 A;  4R8P A;  1KU5 A;  3VH6 A;  4J8X B;  3REK B;  3AN2 C;  4J8W B;  1P3I D;  4KUD C;  4Z66 D;  4XZQ C;  4JJN B;  5B0Z B;  3LEL A;  4H9S C;  3TU4 C;  2FJ7 B;  4KGC A;  5F99 D;  5DNM A;  2F8N H;  3C1C D;  3B0C T;  5AY8 D;  3MGR A;  3AFA C;  3AYW D;  1P3A A;  2RVQ C;  3UT9 B;  3VH5 W;  1M1A D;  5E5A D;  3WKJ C;  1JFI A;  5B40 D;  1BH9 B;  2L5A A;  3WAA D;  5BNX B;  3LZ1 A;  3X1U A;  4CAY A;  4HGA C;  3VH6 T;  4WU8 D;  4ZUX B;  4QLC B;  1KX5 D;  1U35 B;  1B6W A;  4YS3 C;  1P3O B;  3AZJ A;  3W98 C;  1Q9C A;  4R8P C;  5CP6 C;  5CPI D;  3X1S A;  4X23 A;  4LD9 A;  2BYK B;  5AV6 D;  5B2I B;  3WA9 B;  3LEL C;  3LZ0 A;  3VH5 A;  4EO5 B;  5CPK C;  4KGC C;  5GSU B;  5DNM C;  3MGP A;  5B0Y A;  3C1B D;  4KUD B;  3MGR C;  4WV4 B;  4XZQ B;  1P3A C;  3TU4 B;  3R45 B;  1P3M A;  3A6N D;  1F66 D;  3KUY A;  1ID3 A;  4J8X D;  3REK D;  4J8W D;  3AZN D;  4JJN D;  5B24 A;  4H9P B;  5B0Z D;  5FUG A;  3LZ1 C;  5JRG A;  2FJ7 D;  3X1U C;  2HUE C;  3NQJ A;  1A7W A;  3AZG B;  3WKJ B;  2F8N B;  3LJA A;  5GT3 A;  1EQZ A;  3AZJ C;  3VH5 T;  2IO5 B;  5B31 D;  3UT9 D;  3AZK A;  3X1S C;  4HGA B;  4X23 C;  4G91 C;  4YS3 B;  1TZY A;  4H9O B;  5B2J B;  3B6F A;  5CP6 B;  4R8P B;  3MGP C;  3O62 A;  5B0Y C;  4ZUX D;  4QLC D;  3REL C;  1U35 D;  1BFM A;  3LEL B;  1P3O D;  1P3M C;  5CPK B;  4KGC B;  3KUY C;  5DNM B;  3AZL A;  1ID3 C;  1AOI A;  4E45 A;  3MGR B;  3AV2 A;  3UTA B;  1P3A B;  3MVD A;  5B24 C;  3WA9 D;  5JRG C;  3W97 A;  5GSU D;  1M18 A;  4KUD D;  3LJA C;  1JFI B;  3MGQ A;  5BS7 A;  5JA4 A;  5B1M A;  5GT3 C;  4XZQ D;  1EQZ C;  2NQB A;  3KXB A;  3B0D B;  5DNN B;  3LZ1 B;  3AZK C;  3TU4 D;  4CAY B;  3REJ A;  3AZI B;  5B32 G;  1P3B B;  3AZE A;  1TZY C;  2RVQ D;  3AZJ B;  1P3P A;  4WNN A;  3B6F C;  3O62 C;  3X1S B;  3AZG D;  3WKJ D;  2F8N D;  1P3G A;  4G91 B;  5AV9 B;  4UUZ A;  3AZL C;  3MGP B;  1AOI C;  5B0Y B;  5B31 G;  3AV2 C;  3REL B;  3MVD C;  3AZM A;  4YS3 D;  3W97 C;  5B2J D;  1P3M B;  5CP6 D;  4R8P D;  3KUY B;  1ID3 B;  4H9Q A;  1M18 C;  4WU9 A;  3MGQ C;  5BS7 C;  3X1T A;  5B1M C;  2NQB C;  3KXB C;  3LEL D;  5FUG B;  5JRG B;  3REJ C;  3KWQ A;  5CPK D;  3NQJ B;  4AWL C;  4KGC D;  5DNM D;  1M19 B;  3AZE C;  3LJA B;  3MGR D;  5GT3 B;  3UTA D;  1P3A D;  1EQZ B;  1P3P C;  1P3L A;  3AZK B;  3AZH A;  3REH A;  3MGS D;  1P3G C;  5BT1 C;  5AVB A;  1TZY B;  4H9N A;  1HQ3 A;  5DNN D;  3B6F B;  3LZ1 D;  2ARO A;  3AZF B;  3O62 B;  5GXQ B;  3AZI D;  1P3B D;  1TAF A;  3AZM C;  2NZD A;  3W99 A;  3AZL B;  1AOI B;  3X1S D;  4KHA A;  4WU9 C;  1KX4 A;  3B6G B;  3AV2 B;  3X1T C;  3MVD B;  5AV9 D;  5CHL B;  3W97 B;  3KWQ C;  4NFT A;  3WTP A;  3MGP D;  3NQU A;  5GT0 A;  5B0Y D;  5AVC A;  5KDM A;  4WZS B;  4NE5 A;  3MGQ B;  3UTB A;  2NQB B;  5B1M B;  1H3O A;  3REL D;  3KXB B;  1P3L C;  3AZH C;  1P3M D;  3REJ B;  5B1L A;  4AWL B;  3KUY D;  1ID3 D;  3AN2 B;  3AYW A;  3AZE B;  3KSY A;  5AVB C;  4XUJ A;  4J8U A;  1HQ3 C;  1P3P B;  4WNN B;  2ARO C;  1BH8 A;  1M19 D;  1P3G B;  5B40 A;  3LJA D;  1ZLA A;  5GT3 D;  3AFA B;  1P34 A;  1EQZ D;  2NZD C;  3W99 C;  3AZK D;  4Z2M H;  1HTA A;  1KX4 C;  3X1V A;  3AZM B;  1TZY D;  5BO0 B;  3B6F D;  5G49 A;  3WTP C;  3AZF D;  3O62 D;  4H9Q B;  5GXQ D;  5GT0 C;  4J8V A;  5AVC C;  4LD9 C;  4WU9 B;  3UTB C;  3X1T B;  3LZ0 C;  5B1L C;  3KWQ B;  3W98 B;  1S32 A;  3AZL D;  1AOI D;  3W96 A;  3AYW C;  3B6G D;  3AV2 D;  4XUJ C;  4J8U C;  3MVD D;  1P3L B;  5B32 A;  3W97 D;  3A6N A;  3AZH B;  2HIO A;  1F66 A;  4J8X A;  5B40 C;  3AZN A;  5AVB B;  3MGQ D;  1ZLA C;  2NQB D;  5B1M D;  1P34 C;  4H9N B;  5B2I D;  1HQ3 B;  2FJ7 A;  2ARO B;  3REJ D;  4G92 C;  2PYO A;  3AN2 D;  4Z5T A;  3X1V C;  1TAF B;  3AZE D;  3REI A;  5B31 A;  1P3P D;  2NZD B;  3W99 B;  3X1U B;  1KX3 A;  2HUE B;  4J8V C;  4KHA B;  1KX4 B;  1P3G D;  5BT1 D;  1BH9 A;  3AFA D;  3AV1 A;  5AV5 A;  1S32 C;  3WTP B;  3NQU B;  5GT0 B;  3W96 C;  4X23 B;  5AVC B;  5KDM B;  4LD9 B;  1U35 A;  3UTB B;  1H3O B;  2YFV A;  3AZM D;  5B33 A;  5B32 C;  3LZ0 B;  3A6N C;  2HIO C;  1F66 C;  5B1L B;  4CSR A;  4J8X C;  4DRA A;  2BYK A;  3AZN C;  4WU9 D;  3X1T D;  4XUJ B;  4J8U B;  2FJ7 C;  3KWQ D;  3W98 D;  1P3F A;  2PYO C;  4KUD A;  1N1J A;  4Z5T C;  5CPJ A;  1ZLA B;  1P34 B;  3REI C;  5B31 C;  5B24 B;  1P3L D;  3AZH D;  1KX3 C;  3VH6 W;  1P3K A;  3X1V B;  2CV5 A;  5AVB D;  3MNN A;  5AV8 A;  1HQ3 D;  4YM6 A;  3AV1 C;  2ARO D;  5G49 B;  5AV5 C;  3AZG A;  3WKJ A;  4J8V B;  1ULY A;  1U35 C;  5C3I C;  5B33 C;  3W99 D;  5BNV A;  1S32 B;  3X1U D;  3W96 B;  3B0B A;  5B32 B;  5B2J A;  2HIO B;  3AZJ D;  1F66 B;  1P3F C;  3WTP D;  4H9R A;  5GT0 D;  4X23 D;  5AVC D;  3AZN B;  5CPJ C;  4LD9 D;  3UTB D;  1WWS A;  3LZ0 D;  5CPK A;  2F8N G;  5B1L D;  2PYO B;  1P3I A;  1P3K C;  4Z5T B;  4Z66 A;  3UTA A;  2CV5 C;  1M18 B;  3MNN C;  4XUJ D;  5JA4 B;  5AV8 C;  4J8U D;  3REI B;  5B31 B;  4YM6 C; 
#chains in the Genus database with same CATH topology
 3MGS A;  3AZG C;  1KX3 B;  5F99 A;  3REH C;  2F2A C;  3C1C A;  5AY8 A;  2Y2I A;  1ZLA D;  1P34 D;  5DNN A;  2IO5 C;  5B24 D;  3AV1 B;  5AV5 B;  1M1A A;  5JRG D;  5E5A A;  3AZI A;  1P3B A;  2Y2M A;  5C3I B;  3X1V D;  2YFV B;  5B33 B;  5B2J C;  4NE6 A;  3WAA A;  4UUZ B;  3P5J B;  4CSR B;  4ZBJ C;  4WU8 A;  4J8V D;  1KX5 A;  4DRB A;  5AV9 A;  2DF4 C;  2BYM A;  5CPI A;  1S32 D;  1P3F B;  1P3I C;  4E44 A;  3W96 D;  1N1J B;  4Z66 C;  3REL A;  5AV6 A;  3UTA C;  5CPJ B;  3V9R A;  5B32 D;  2YFW A;  3MGS C;  2HIO D;  5F99 C;  3C1C C;  3C1B A;  1P3K B;  4M6B A;  5AY8 C;  2CV5 B;  4Z2M G;  3MNN B;  5AV8 B;  3B0D C;  5DNN C;  4YM6 B;  2Y2G A;  1M1A C;  5E5A C;  3AZI C;  3AL0 C;  3IP4 C;  3REH B;  1WWI A;  3REK A;  2PYO D;  1M19 A;  2CWE A;  4J8W A;  1P3B C;  4Z5T D;  1M18 D;  4JJN A;  3WAA C;  3H0R C;  5B0Z A;  3REI D;  3KXB D;  5BNV B;  1KX3 D;  4WU8 C;  1KX5 C;  5AV9 C;  3EPK A;  2DQN C;  3UT9 A;  3AZF A;  5CPI C;  3AV1 D;  5AV5 D;  5GXQ A;  4ZBJ B;  4H9R B;  5AV6 C;  4WJ3 C;  1R4V A;  5B33 D;  5BNX A;  3C1B C;  1P3I B;  3B6G A;  4ZUX A;  4QLC A;  4Z66 B;  3WTP E;  2BG1 A;  1P3O A;  2JSS A;  1F1E A;  3MGS B;  5F99 B;  3REK C;  1P3F D;  3C1C B;  1M19 C;  4J8W C;  2F8N K;  3B0C W;  5AY8 B;  5CPJ D;  4JJN C;  5B2I A;  3AYW B;  3WA9 A;  5B0Z C;  1M1A B;  5E5A B;  5GSU A;  1BH8 B;  4NE3 A;  3AN2 A;  1P3K D;  2Y2J A;  5B40 B;  2ZY2 A;  4XZQ A;  2CV5 D;  3MNN D;  5AV8 D;  3WAA B;  4YM6 D;  4H9S A;  3UT9 C;  3TU4 A;  3R45 A;  3AZF C;  5GXQ C;  4WU8 B;  1B67 A;  4G92 B;  3REH D;  1KX5 B;  3AFA A;  4H9P A;  2BYM B;  5CPI B;  2LY8 A;  3B6G C;  4ZUX C;  4QLC C;  2F8N A;  5AV6 B;  3V9R B;  5BO0 A;  1P3O C;  2YFW B;  2Y2Q A;  2NZD D;  3C1B B;  5B2I C;  1KX4 D;  1W2E A;  3WA9 C;  4YS3 A;  4H9O A;  4EO5 C;  2XD5 A;  3W98 A;  3A6N B;  5GSU C;  5CP6 A;  4R8P A;  1KU5 A;  3VH6 A;  4J8X B;  3REK B;  3AN2 C;  4J8W B;  1P3I D;  4KUD C;  4Z66 D;  4XZQ C;  4JJN B;  2UWX A;  5B0Z B;  3LEL A;  4H9S C;  3TU4 C;  2FJ7 B;  4KGC A;  5F99 D;  5DNM A;  2F8N H;  3C1C D;  3B0C T;  2Y2P A;  5AY8 D;  3MGR A;  3AFA C;  3AYW D;  1P3A A;  2RVQ C;  2XD1 A;  2ZY3 A;  3UT9 B;  3VH5 W;  1M1A D;  5E5A D;  3EG5 B;  3WKJ C;  1JFI A;  5B40 D;  1BH9 B;  2L5A A;  3WAA D;  5BNX B;  3LZ1 A;  3X1U A;  4CAY A;  4HGA C;  3VH6 T;  4WU8 D;  4ZUX B;  3F6T A;  4QLC B;  1KX5 D;  1U35 B;  1B6W A;  4YS3 C;  1P3O B;  3AZJ A;  3W98 C;  1Q9C A;  4R8P C;  3H0M C;  5CP6 C;  5CPI D;  3X1S A;  4X23 A;  4LD9 A;  2BYK B;  5AV6 D;  5B2I B;  3WA9 B;  3LEL C;  3LZ0 A;  3VH5 A;  4EO5 B;  5CPK C;  4KGC C;  5GSU B;  5DNM C;  3MGP A;  2G5I C;  5B0Y A;  3C1B D;  4KUD B;  3MGR C;  4WV4 B;  4XZQ B;  1P3A C;  3TU4 B;  3R45 B;  1P3M A;  3A6N D;  1F66 D;  3KUY A;  1ID3 A;  4J8X D;  3REK D;  4J8W D;  3AZN D;  4JJN D;  5B24 A;  4H9P B;  5B0Z D;  5FUG A;  3LZ1 C;  5JRG A;  2FJ7 D;  3X1U C;  2HUE C;  3NQJ A;  1A7W A;  3AZG B;  3WKJ B;  2F8N B;  3LJA A;  5GT3 A;  1EQZ A;  3AZJ C;  3VH5 T;  2IO5 B;  5B31 D;  3UT9 D;  3AZK A;  3A1I A;  3X1S C;  4HGA B;  4X23 C;  4G91 C;  4YS3 B;  1TZY A;  4H9O B;  5B2J B;  3B6F A;  5CP6 B;  4R8P B;  3MGP C;  3O62 A;  5B0Y C;  4ZUX D;  4QLC D;  3REL C;  1U35 D;  1BFM A;  3LEL B;  1P3O D;  1P3M C;  5CPK B;  4KGC B;  3KUY C;  5DNM B;  3AZL A;  1ID3 C;  1AOI A;  4E45 A;  3MGR B;  3AV2 A;  3UTA B;  1P3A B;  3MVD A;  5B24 C;  3WA9 D;  5JRG C;  3W97 A;  5GSU D;  1M18 A;  4KUD D;  3LJA C;  1JFI B;  3MGQ A;  5BS7 A;  5JA4 A;  5B1M A;  5GT3 C;  4XZQ D;  1EQZ C;  2NQB A;  3KXB A;  3B0D B;  5DNN B;  3LZ1 B;  3AZK C;  3TU4 D;  4CAY B;  3REJ A;  3AZI B;  5B32 G;  3EPL A;  1P3B B;  3AZE A;  1TZY C;  2RVQ D;  3AZJ B;  1P3P A;  4WNN A;  3B6F C;  3O62 C;  3X1S B;  2Y2L A;  3AZG D;  3WKJ D;  2F8N D;  1P3G A;  4G91 B;  5AV9 B;  4UUZ A;  3AZL C;  3MGP B;  1AOI C;  5B0Y B;  5B31 G;  3AV2 C;  3REL B;  3MVD C;  3AZM A;  4YS3 D;  3W97 C;  2Y2H A;  5B2J D;  1P3M B;  5CP6 D;  4R8P D;  3KUY B;  1ID3 B;  4H9Q A;  1M18 C;  4WU9 A;  3MGQ C;  5BS7 C;  3X1T A;  5B1M C;  2NQB C;  3KXB C;  3LEL D;  5FUG B;  5JRG B;  3REJ C;  3KWQ A;  5CPK D;  3NQJ B;  4AWL C;  4KGC D;  5DNM D;  1M19 B;  3AZE C;  3LJA B;  3MGR D;  5GT3 B;  3UTA D;  1P3A D;  1EQZ B;  1P3P C;  1P3L A;  2ZY5 A;  3AZK B;  3AZH A;  3REH A;  3MGS D;  1P3G C;  5BT1 C;  5AVB A;  1TZY B;  4H9N A;  1HQ3 A;  5DNN D;  3B6F B;  3LZ1 D;  2ARO A;  3AZF B;  3O62 B;  5GXQ B;  3AZI D;  1P3B D;  1TAF A;  2G5H C;  3AZM C;  2NZD A;  3W99 A;  3AZL B;  1AOI B;  3X1S D;  4KHA A;  4WU9 C;  1KX4 A;  3B6G B;  3AV2 B;  3X1T C;  3MVD B;  5AV9 D;  5CHL B;  3W97 B;  3KWQ C;  4NFT A;  3WTP A;  3MGP D;  3NQU A;  5GT0 A;  5B0Y D;  5AVC A;  5KDM A;  4WZS B;  4NE5 A;  1Z2C B;  3MGQ B;  3UTB A;  5B1M B;  1H3O A;  3REL D;  2NQB B;  3KXB B;  1P3L C;  3AZH C;  1P3M D;  3REJ B;  5B1L A;  4AWL B;  2Y2K A;  3KUY D;  1ID3 D;  3AN2 B;  3AYW A;  3AZE B;  3KSY A;  5AVB C;  4XUJ A;  4J8U A;  3EPH A;  1HQ3 C;  1P3P B;  4WNN B;  2ARO C;  3FDD A;  1BH8 A;  1M19 D;  1P3G B;  5B40 A;  3LJA D;  2JCH A;  1ZLA A;  5GT3 D;  3AFA B;  1P34 A;  1EQZ D;  2NZD C;  3W99 C;  3AZK D;  4Z2M H;  1HTA A;  1KX4 C;  3X1V A;  3AZM B;  1TZY D;  5BO0 B;  2J8P A;  3B6F D;  5G49 A;  3WTP C;  3AZF D;  3O62 D;  4H9Q B;  5GXQ D;  5GT0 C;  4J8V A;  5AVC C;  4LD9 C;  4WU9 B;  2Y2N A;  3UTB C;  3X1T B;  3H0L C;  3LZ0 C;  5B1L C;  3KWQ B;  3W98 B;  1S32 A;  3AZL D;  1AOI D;  3W96 A;  3AYW C;  3B6G D;  3AV2 D;  4XUJ C;  4J8U C;  3MVD D;  1P3L B;  5B32 A;  3W97 D;  3A6N A;  3AZH B;  2HIO A;  1F66 A;  4J8X A;  5B40 C;  3AZN A;  5AVB B;  3MGQ D;  1ZLA C;  2NQB D;  5B1M D;  1P34 C;  4H9N B;  5B2I D;  1HQ3 B;  2FJ7 A;  1T3U A;  2ARO B;  3REJ D;  4G92 C;  2PYO A;  3AN2 D;  4Z5T A;  3X1V C;  1TAF B;  3AZE D;  3REI A;  5B31 A;  1P3P D;  2NZD B;  3W99 B;  3X1U B;  1KX3 A;  2HUE B;  4J8V C;  2Y2O A;  4KHA B;  1KX4 B;  1P3G D;  5BT1 D;  1BH9 A;  3AFA D;  3AV1 A;  5AV5 A;  3EPJ A;  3WTP B;  1S32 C;  3KFU G;  3NQU B;  5GT0 B;  3W96 C;  4X23 B;  5AVC B;  5KDM B;  4LD9 B;  1U35 A;  3UTB B;  1H3O B;  2YFV A;  3AZM D;  5B33 A;  5B32 C;  3LZ0 B;  3A6N C;  2HIO C;  1F66 C;  5B1L B;  4CSR A;  4J8X C;  2RIQ A;  4DRA A;  2BYK A;  3AZN C;  4WU9 D;  3X1T D;  4XUJ B;  4J8U B;  2VQR A;  2FJ7 C;  2FFF B;  4DQY B;  3KWQ D;  3W98 D;  2ZM5 A;  1P3F A;  2PYO C;  4KUD A;  1N1J A;  4Z5T C;  5CPJ A;  1ZLA B;  1P34 B;  3REI C;  5B31 C;  5B24 B;  1P3L D;  3AZH D;  1KX3 C;  3VH6 W;  1P3K A;  3X1V B;  2CV5 A;  4UPK A;  5AVB D;  3MNN A;  5AV8 A;  2W8S A;  1HQ3 D;  4YM6 A;  3A1K A;  3AV1 C;  2ARO D;  5G49 B;  5AV5 C;  3AZG A;  3WKJ A;  4J8V B;  1ULY A;  1U35 C;  5C3I C;  5B33 C;  3W99 D;  5BNV A;  1S32 B;  3X1U D;  3W96 B;  3B0B A;  5B32 B;  5B2J A;  2HIO B;  3AZJ D;  1F66 B;  1P3F C;  3WTP D;  4H9R A;  5GT0 D;  4X23 D;  5AVC D;  3AZN B;  5CPJ C;  4LD9 D;  3UTB D;  1PZR A;  1WWS A;  3LZ0 D;  2JE5 A;  5CPK A;  2F8N G;  2ZY4 A;  5B1L D;  2PYO B;  1P3I A;  1P3K C;  4Z5T B;  4Z66 A;  3UTA A;  2CV5 C;  1M18 B;  3MNN C;  4XUJ D;  5JA4 B;  5AV8 C;  4J8U D;  3REI B;  5B31 B;  4YM6 C; 
#chains in the Genus database with same CATH homology
 3MGS A;  3AZG C;  1KX3 B;  5F99 A;  3REH C;  2F2A C;  3C1C A;  5AY8 A;  2Y2I A;  1ZLA D;  1P34 D;  5DNN A;  2IO5 C;  5B24 D;  3AV1 B;  5AV5 B;  1M1A A;  5JRG D;  5E5A A;  3AZI A;  1P3B A;  2Y2M A;  5C3I B;  3X1V D;  2YFV B;  5B33 B;  5B2J C;  4NE6 A;  3WAA A;  4UUZ B;  3P5J B;  4CSR B;  4ZBJ C;  4WU8 A;  4J8V D;  1KX5 A;  4DRB A;  5AV9 A;  2DF4 C;  2BYM A;  5CPI A;  1S32 D;  1P3F B;  1P3I C;  4E44 A;  3W96 D;  1N1J B;  4Z66 C;  3REL A;  5AV6 A;  3UTA C;  5CPJ B;  3V9R A;  5B32 D;  2YFW A;  3MGS C;  2HIO D;  5F99 C;  3C1C C;  3C1B A;  1P3K B;  4M6B A;  5AY8 C;  2CV5 B;  4Z2M G;  3MNN B;  5AV8 B;  3B0D C;  5DNN C;  4YM6 B;  2Y2G A;  1M1A C;  5E5A C;  3AZI C;  3AL0 C;  3IP4 C;  3REH B;  1WWI A;  3REK A;  2PYO D;  1M19 A;  2CWE A;  4J8W A;  1P3B C;  4Z5T D;  1M18 D;  4JJN A;  3WAA C;  3H0R C;  5B0Z A;  3REI D;  3KXB D;  5BNV B;  1KX3 D;  4WU8 C;  1KX5 C;  5AV9 C;  3EPK A;  2DQN C;  3UT9 A;  3AZF A;  5CPI C;  3AV1 D;  5AV5 D;  5GXQ A;  4ZBJ B;  4H9R B;  5AV6 C;  4WJ3 C;  1R4V A;  5B33 D;  5BNX A;  3C1B C;  1P3I B;  3B6G A;  4ZUX A;  4QLC A;  4Z66 B;  3WTP E;  2BG1 A;  1P3O A;  2JSS A;  1F1E A;  3MGS B;  5F99 B;  3REK C;  1P3F D;  3C1C B;  1M19 C;  4J8W C;  2F8N K;  3B0C W;  5AY8 B;  5CPJ D;  4JJN C;  5B2I A;  3AYW B;  3WA9 A;  5B0Z C;  1M1A B;  5E5A B;  5GSU A;  1BH8 B;  4NE3 A;  3AN2 A;  1P3K D;  2Y2J A;  5B40 B;  2ZY2 A;  4XZQ A;  2CV5 D;  3MNN D;  5AV8 D;  3WAA B;  4YM6 D;  4H9S A;  3UT9 C;  3TU4 A;  3R45 A;  3AZF C;  5GXQ C;  4WU8 B;  1B67 A;  4G92 B;  3REH D;  1KX5 B;  3AFA A;  4H9P A;  2BYM B;  5CPI B;  2LY8 A;  3B6G C;  4ZUX C;  4QLC C;  2F8N A;  5AV6 B;  3V9R B;  5BO0 A;  1P3O C;  2YFW B;  2Y2Q A;  2NZD D;  3C1B B;  5B2I C;  1KX4 D;  1W2E A;  3WA9 C;  4YS3 A;  4H9O A;  4EO5 C;  2XD5 A;  3W98 A;  3A6N B;  5GSU C;  5CP6 A;  4R8P A;  1KU5 A;  3VH6 A;  4J8X B;  3REK B;  3AN2 C;  4J8W B;  1P3I D;  4KUD C;  4Z66 D;  4XZQ C;  4JJN B;  2UWX A;  5B0Z B;  3LEL A;  4H9S C;  3TU4 C;  2FJ7 B;  4KGC A;  5F99 D;  5DNM A;  2F8N H;  3C1C D;  3B0C T;  2Y2P A;  5AY8 D;  3MGR A;  3AFA C;  3AYW D;  1P3A A;  2RVQ C;  2XD1 A;  2ZY3 A;  3UT9 B;  3VH5 W;  1M1A D;  5E5A D;  3EG5 B;  3WKJ C;  1JFI A;  5B40 D;  1BH9 B;  2L5A A;  3WAA D;  5BNX B;  3LZ1 A;  3X1U A;  4CAY A;  4HGA C;  3VH6 T;  4WU8 D;  4ZUX B;  3F6T A;  4QLC B;  1KX5 D;  1U35 B;  1B6W A;  4YS3 C;  1P3O B;  3AZJ A;  3W98 C;  1Q9C A;  4R8P C;  3H0M C;  5CP6 C;  5CPI D;  3X1S A;  4X23 A;  4LD9 A;  2BYK B;  5AV6 D;  5B2I B;  3WA9 B;  3LEL C;  3LZ0 A;  3VH5 A;  4EO5 B;  5CPK C;  4KGC C;  5GSU B;  5DNM C;  3MGP A;  2G5I C;  5B0Y A;  3C1B D;  4KUD B;  3MGR C;  4WV4 B;  4XZQ B;  1P3A C;  3TU4 B;  3R45 B;  1P3M A;  3A6N D;  1F66 D;  3KUY A;  1ID3 A;  4J8X D;  3REK D;  4J8W D;  3AZN D;  4JJN D;  5B24 A;  4H9P B;  5B0Z D;  5FUG A;  3LZ1 C;  5JRG A;  2FJ7 D;  3X1U C;  2HUE C;  3NQJ A;  1A7W A;  3AZG B;  3WKJ B;  2F8N B;  3LJA A;  5GT3 A;  1EQZ A;  3AZJ C;  3VH5 T;  2IO5 B;  5B31 D;  3UT9 D;  3AZK A;  3A1I A;  3X1S C;  4HGA B;  4X23 C;  4G91 C;  4YS3 B;  1TZY A;  4H9O B;  5B2J B;  3B6F A;  5CP6 B;  4R8P B;  3MGP C;  3O62 A;  5B0Y C;  4ZUX D;  4QLC D;  3REL C;  1U35 D;  1BFM A;  3LEL B;  1P3O D;  1P3M C;  5CPK B;  4KGC B;  3KUY C;  5DNM B;  3AZL A;  1ID3 C;  1AOI A;  4E45 A;  3MGR B;  3AV2 A;  3UTA B;  1P3A B;  3MVD A;  5B24 C;  3WA9 D;  5JRG C;  3W97 A;  5GSU D;  1M18 A;  4KUD D;  3LJA C;  1JFI B;  3MGQ A;  5BS7 A;  5JA4 A;  5B1M A;  5GT3 C;  4XZQ D;  1EQZ C;  2NQB A;  3KXB A;  3B0D B;  5DNN B;  3LZ1 B;  3AZK C;  3TU4 D;  4CAY B;  3REJ A;  3AZI B;  5B32 G;  3EPL A;  1P3B B;  3AZE A;  1TZY C;  2RVQ D;  3AZJ B;  1P3P A;  4WNN A;  3B6F C;  3O62 C;  3X1S B;  2Y2L A;  3AZG D;  3WKJ D;  2F8N D;  1P3G A;  4G91 B;  5AV9 B;  4UUZ A;  3AZL C;  3MGP B;  1AOI C;  5B0Y B;  5B31 G;  3AV2 C;  3REL B;  3MVD C;  3AZM A;  4YS3 D;  3W97 C;  2Y2H A;  5B2J D;  1P3M B;  5CP6 D;  4R8P D;  3KUY B;  1ID3 B;  4H9Q A;  1M18 C;  4WU9 A;  3MGQ C;  5BS7 C;  3X1T A;  5B1M C;  2NQB C;  3KXB C;  3LEL D;  5FUG B;  5JRG B;  3REJ C;  3KWQ A;  5CPK D;  3NQJ B;  4AWL C;  4KGC D;  5DNM D;  1M19 B;  3AZE C;  3LJA B;  3MGR D;  5GT3 B;  3UTA D;  1P3A D;  1EQZ B;  1P3P C;  1P3L A;  2ZY5 A;  3AZK B;  3AZH A;  3REH A;  3MGS D;  1P3G C;  5BT1 C;  5AVB A;  1TZY B;  4H9N A;  1HQ3 A;  5DNN D;  3B6F B;  3LZ1 D;  2ARO A;  3AZF B;  3O62 B;  5GXQ B;  3AZI D;  1P3B D;  1TAF A;  2G5H C;  3AZM C;  2NZD A;  3W99 A;  3AZL B;  1AOI B;  3X1S D;  4KHA A;  4WU9 C;  1KX4 A;  3B6G B;  3AV2 B;  3X1T C;  3MVD B;  5AV9 D;  5CHL B;  3W97 B;  3KWQ C;  4NFT A;  3WTP A;  3MGP D;  3NQU A;  5GT0 A;  5B0Y D;  5AVC A;  5KDM A;  4WZS B;  4NE5 A;  1Z2C B;  3MGQ B;  3UTB A;  5B1M B;  1H3O A;  3REL D;  2NQB B;  3KXB B;  1P3L C;  3AZH C;  1P3M D;  3REJ B;  5B1L A;  4AWL B;  2Y2K A;  3KUY D;  1ID3 D;  3AN2 B;  3AYW A;  3AZE B;  3KSY A;  5AVB C;  4XUJ A;  4J8U A;  3EPH A;  1HQ3 C;  1P3P B;  4WNN B;  2ARO C;  3FDD A;  1BH8 A;  1M19 D;  1P3G B;  5B40 A;  3LJA D;  2JCH A;  1ZLA A;  5GT3 D;  3AFA B;  1P34 A;  1EQZ D;  2NZD C;  3W99 C;  3AZK D;  4Z2M H;  1HTA A;  1KX4 C;  3X1V A;  3AZM B;  1TZY D;  5BO0 B;  2J8P A;  3B6F D;  5G49 A;  3WTP C;  3AZF D;  3O62 D;  4H9Q B;  5GXQ D;  5GT0 C;  4J8V A;  5AVC C;  4LD9 C;  4WU9 B;  2Y2N A;  3UTB C;  3X1T B;  3H0L C;  3LZ0 C;  5B1L C;  3KWQ B;  3W98 B;  1S32 A;  3AZL D;  1AOI D;  3W96 A;  3AYW C;  3B6G D;  3AV2 D;  4XUJ C;  4J8U C;  3MVD D;  1P3L B;  5B32 A;  3W97 D;  3A6N A;  3AZH B;  2HIO A;  1F66 A;  4J8X A;  5B40 C;  3AZN A;  5AVB B;  3MGQ D;  1ZLA C;  2NQB D;  5B1M D;  1P34 C;  4H9N B;  5B2I D;  1HQ3 B;  2FJ7 A;  1T3U A;  2ARO B;  3REJ D;  4G92 C;  2PYO A;  3AN2 D;  4Z5T A;  3X1V C;  1TAF B;  3AZE D;  3REI A;  5B31 A;  1P3P D;  2NZD B;  3W99 B;  3X1U B;  1KX3 A;  2HUE B;  4J8V C;  2Y2O A;  4KHA B;  1KX4 B;  1P3G D;  5BT1 D;  1BH9 A;  3AFA D;  3AV1 A;  5AV5 A;  3EPJ A;  3WTP B;  1S32 C;  3KFU G;  3NQU B;  5GT0 B;  3W96 C;  4X23 B;  5AVC B;  5KDM B;  4LD9 B;  1U35 A;  3UTB B;  1H3O B;  2YFV A;  3AZM D;  5B33 A;  5B32 C;  3LZ0 B;  3A6N C;  2HIO C;  1F66 C;  5B1L B;  4CSR A;  4J8X C;  2RIQ A;  4DRA A;  2BYK A;  3AZN C;  4WU9 D;  3X1T D;  4XUJ B;  4J8U B;  2VQR A;  2FJ7 C;  2FFF B;  4DQY B;  3KWQ D;  3W98 D;  2ZM5 A;  1P3F A;  2PYO C;  4KUD A;  1N1J A;  4Z5T C;  5CPJ A;  1ZLA B;  1P34 B;  3REI C;  5B31 C;  5B24 B;  1P3L D;  3AZH D;  1KX3 C;  3VH6 W;  1P3K A;  3X1V B;  2CV5 A;  4UPK A;  5AVB D;  3MNN A;  5AV8 A;  2W8S A;  1HQ3 D;  4YM6 A;  3A1K A;  3AV1 C;  2ARO D;  5G49 B;  5AV5 C;  3AZG A;  3WKJ A;  4J8V B;  1ULY A;  1U35 C;  5C3I C;  5B33 C;  3W99 D;  5BNV A;  1S32 B;  3X1U D;  3W96 B;  3B0B A;  5B32 B;  5B2J A;  2HIO B;  3AZJ D;  1F66 B;  1P3F C;  3WTP D;  4H9R A;  5GT0 D;  4X23 D;  5AVC D;  3AZN B;  5CPJ C;  4LD9 D;  3UTB D;  1PZR A;  1WWS A;  3LZ0 D;  2JE5 A;  5CPK A;  2F8N G;  2ZY4 A;  5B1L D;  2PYO B;  1P3I A;  1P3K C;  4Z5T B;  4Z66 A;  3UTA A;  2CV5 C;  1M18 B;  3MNN C;  4XUJ D;  5JA4 B;  5AV8 C;  4J8U D;  3REI B;  5B31 B;  4YM6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...