4H9RA

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9rA00
3AV2C 4J8UA 3O62C 4WNNA 5DNND 5AV8B 3AZJA 3X1TC 5GT0A 2HIOB 2F8NH 5DNMD 1HTAA 3KWQA 3REIC 3X1SD 2IO5B 4UUZA 3WA9C 2HIOC 5KDMA 2IO5C 3RELC 1ZLAB 4NE5A 5DNMA 4J8UC 3AZEB 3AZKC 4XZQC 5AV8C 1KX5D 2NQBD 1A7WA 3AZEC 3AZKB 5B40B 5B40A 5B31C 2FJ7B 1AOIC 4H9PB 5F99D 4G92B 3VH6A 1P3PD 3MVDC 3A6ND 5B0ZB 3X1UC 1ID3C 4H9OA 1KX3B 1ZLAA 5B40D 4G91B 1U35A 3RELD 1EQZC 4UUZB 3KWQB 2HIOA 3AV1C 4YM6C 3AZMA 3X1VB 3RELA 4CSRB 5AV9D 5JRGB 3AN2B 4Z5TD 5B40C 4ZUXC 1F1EA 5JRGA 3AN2A 4CSRA 3RELB 5AV8A 3AZJB 3VH5T 3AZMB 3AFAC 3X1VA 4WNNB 4J8UB 3MNND 1U35B 5B1MC 5AV5D 1KU5A 4NFTA 3AZIC 1H3OB 3NQUB 1S32D 3W96C 3VH5A 4X23B 4J8UD 1KX3A 3MNNA 3AZGB 4H9OB 1M1AD 4J8XD 5B0ZA 5B1LD 5E5AD 3WTPC 4H9PA 2FJ7A 3MGQD 1P3OA 3AZKA 4H9SA 3MNNC 3AZEA 5DNMB 1B67A 5CPJC 5KDMB 5C3IC 4LD9C 4CAYB 3LZ0A 3REID 3AV2B 5G49A 2YFVB 4Z2MH 4H9QB 3LZ0D 2YFWB 3UT9B 5GT0B 3B0DC 3KWQD 1P3OC 4YM6D 3AV1D 3WTPA 1AOID 1F66B 5B31D 3LZ1A 3O62A 3LELD 2AROD 1P3PB 5AV5B 3B6GA 3WAAB 3AZIA 4HGAB 4J8VA 5B1MA 1M18A 3LZ1D 2CV5A 3LZ0C 3B6GD 5B32D 5B1LB 1S32C 3W96A 1TAFB 4WU9C 5JRGD 5FUGB 3AN2D 3X1TB 5B0ZC 1M18D 5DNNB 1ID3B 2CV5D 2HUEB 3REIB 2HUEC 5BT1C 4KUDB 3AZMD 5AV9A 1BFMA 3MGRB 5B0ZD 3A6NB 1M18C 5JRGC 3AN2C 1EQZD 3X1TD 4J8XC 3KXBA 1N1JA 5CPIB 1HQ3B 2BYKA 4Z66B 3MVDD 5AV6C 1EQZA 1KX3C 4J8XA 1R4VA 1HQ3C 4Z66C 3C1CB 3LELB 4ZBJC 4G91C 1JFIB 3REJC 5F99B 3X1SB 5CPKD 4E44A 3KSYA 1AOIB 1P3GB 5B0YC 1F66D 2NQBC 3REKA 3LJAC 3AZKD 4WU8D 1P34D 1ULYA 5CHLB 2RVQD 5B33B 3X1UB 2BYMA 3UTBA 5AV9C 1P3GC 1B6WA 1KX4B 4YM6B 3X1VC 3W99B 3AYWB 4R8PB 3NQJA 5GSUB 4Z2MG 4QLCA 3C1CC 4J8VD 4H9NB 3REJB 1P3MD 3UTAB 5CPIC 5BNXB 5B0YB 3VH5W 4QLCD 3UT9C 3AV1A 5AV6B 2NQBA 1KX4C 5E5AC 4J8WA 1P3IB 3AYWC 5B31A 1KX5B 4NE6A 5E5AB 2AROA 3R45B 2PYOB 3AFAA 4AWLC 3UTBC 1ZLAD 4ZUXB 1P3LC 5B2JB 5B32A 3AZJC 3AFAD 5AY8A 3MGSC 5B2ID 1P3BB 4KGCD 1BH8A 2CWEA 5DNNC 4Z5TA 2F8NG 3KXBD 5CPJB 4X23C 3W98A 5CP6A 4YS3A 3B0CT 3UTAC 3C1BA 3VH6W 5GT3A 5BNVA 4KUDC 2NZDB 4XUJA 5GSUD 2JSSA 1P3FB 1P3LA 5GT0C 4LD9A 5BO0B 4XZQA 1S32A 3AZNC 3REKD 3W99D 4JJNB 1M1AA 5B2IB 1P3BD 1Q9CA 3W97B 5AVCC 5AVBB 5CPKB 4XZQD 3MGQA 5B2JC 4WU9B 5B32G 5B24C 3MGPC 1P3AC 3MGSB 3AZFA 3AZHA 1P3FD 4WU8A 1BH9A 1P34A 3REKC 3X1SC 3UTBD 3AZFD 5GXQA 5JA4A 4XUJC 5B33C 4H9RA 1TZYC 3REHD 3AZNA 3WA9B 5AVBC 1P3MB 3B6FC 3REHB 1M19D 5B24B 3MGPB 1P3AB 4KHAA 3C1BC 3V9RB 5AVCB 2FJ7C 3AZFC 1M19B 4R8PD 3TU4C 1P3KB 5AY8D 4J8WD 3AZHC 3AZLB 4KGCB 1ZLAC 3TU4B 2F8NA 5AVCD 3LJAB 3WKJC 2F8NB 4KGCA 1P3IC 5GXQC 3AZLA 1P3GD 3W99C 5B24D 3MGPD 1P3AD 3W98D 5AVCA 3WKJA 4G92C 3V9RA 3AZLD 1HQ3D 4Z66D 4KHAB 3MVDB 5B24A 1TZYB 3MGPA 1P3AA 3KUYA 3B6FB 3B0BA 3WA9A 3B6FD 5GSUC 5AVBD 3B0CW 4H9RB 1TZYD 5CP6D 4YS3D 3W98C 3MGRD 3KUYC 5GXQB 4ZBJB 3MGSD 3B6FA 1M19C 3KUYB 2L5AA 1TZYA 1P3LD 3AZHB 3AZLC 2NZDC 4KGCC 3MVDA 3AZHD 3WKJB 5AY8C 3MGSA 4WU9A 5GXQD 4JJNC 5CPKA 5BS7C 1P3KD 3W97C 2PYOD 3LJAA 3TU4A 2NZDD 5BO0A 5C3IB 4LD9B 1P3KA 5GT3C 1P3LB 1P3FA 3WTPE 1M19A 2NZDA 5BNVB 5GT3B 2F8NK 3W98B 1P3BC 3REHA 3AZND 4Z5TB 5BT1D 1P3MA 5GT0D 1BH8B 3AZNB 4ZUXD 5B2IC 4M6BA 4H9SC 5AY8B 5JA4B 3WAAC 5B32B 5CPKC 1P3FC 4ZUXA 3WKJD 1BH9B 4WU8B 1P34B 1P3ID 5AV6D 2RVQC 3AZFB 3W97D 2AROB 2F8ND 1P3KC 1KX5A 4JJND 1P3IA 3REJD 4E45A 3MGQB 5AVBA 5AV6A 3W97A 5B2IA 1M1AB 4JJNA 3REJA 5B31G 5B1LC 4XZQB 1S32B 1P3MC 3MGRC 3KUYD 4XUJB 5CP6C 4YS3C 3C1BD 5GT3D 2HIOD 4XUJD 3C1BB 5CP6B 3NQJB 5GSUA 3KXBC 4YS3B 5CPID 5CPJA 3AYWA 4LD9D 3REHC 4EO5B 1KX4A 3W99A 1P3BA 5B33A 3X1UA 4WV4B 3REKB 2CV5C 3AYWD 4DRBA 1JFIA 1KX4D 3C1CA 5B2JA 4J8XB 3LZ1C 3B6GC 3AFAB 3WAAD 2PYOA 3R45A 3C1CD 4J8VC 5E5AA 5B2JD 4J8WC 3KXBB 1U35C 5B31B 4R8PC 3TU4D 1WWIA 2FJ7D 3LELC 4J8WB 5F99C 2NQBB 3AV1B 3AZED 5BNXA 5B0YA 3UTAA 4X23D 5AV9B 4H9NA 4KUDA 4EO5C 3KWQC 4QLCB 3REIA 3UTAD 5BS7A 5DNNA 3AZJD 5DNMC 4R8PA 1TAFA 1WWSA 3W96B 2PYOC 4YM6A 3AZMC 2BYMB 3UTBB 3WTPD 5B1MB 1P3GA 1AOIA 4WZSB 4J8VB 3X1SA 5F99A 3AZIB 3O62D 3LELA 1P3PA 3AZID 3VH6T 4DRAA 1KX5C 4QLCC 3UT9D 2LY8A 5B1MD 1EQZB 1HQ3A 2BYKB 4Z66A 4AWLB 3WTPB 5CPIA 1N1JB 3W96D 3UT9A 2YFWA 4H9QA 3WA9D 5AV5C 5B33D 2YFVA 3A6NA 3MGRA 5G49B 3B0DB 3LZ0B 4CAYA 3AV2A 3X1VD 4NE3A 4Z5TC 5CPJD 3AV2D 3X1UD 3AZGC 4WU9D 1P3PC 1ID3A 3X1TA 1P3OB 5FUGA 4HGAC 1KX3D 5B32C 5B1LA 2CV5B 3LJAD 5AV8D 4WU8C 1P34C 5B0YD 1F66C 3MNNB 3AZGA 1U35D 3A6NC 1M18B 4X23A 1ID3D 1P3OD 1M1AC 3NQUA 1H3OA 2AROC 4KUDD 3WAAA 5AV5A 3O62B 3LZ1B 3B6GB 3MGQC 3AZGD 1F66A
chains in the Genus database with same CATH superfamily
3AV2C 4J8UA 3O62C 4WNNA 2J8PA 5DNND 5AV8B 3AZJA 3X1TC 5GT0A 2ZY3A 2FFFB 2HIOB 2F8NH 5DNMD 1HTAA 3KWQA 3REIC 3X1SD 2IO5B 4UUZA 3WA9C 2HIOC 5KDMA 2IO5C 3RELC 1ZLAB 4NE5A 5DNMA 2G5IC 4J8UC 3AZEB 3AZKC 4XZQC 5AV8C 1KX5D 2NQBD 1A7WA 3AZEC 3AZKB 5B40B 5B40A 3EG5B 5B31C 2FJ7B 1PZRA 1AOIC 4H9PB 5F99D 4G92B 3VH6A 1P3PD 3MVDC 5B0ZB 3X1UC 3A6ND 1ID3C 4H9OA 1KX3B 1ZLAA 5B40D 2F2AC 4G91B 1U35A 3RELD 3H0LC 1EQZC 4UUZB 2JCHA 3KWQB 2HIOA 3AV1C 4YM6C 3AZMA 3X1VB 3RELA 4CSRB 5AV9D 5JRGB 3AN2B 4Z5TD 5B40C 4ZUXC 1F1EA 5JRGA 3AN2A 4CSRA 3RELB 5AV8A 3AZJB 3VH5T 3AZMB 3AFAC 3X1VA 2NQBC 4WNNB 4J8UB 3MNND 1U35B 5B1MC 5AV5D 1KU5A 4NFTA 3AZIC 1H3OB 3NQUB 1S32D 3W96C 3VH5A 4X23B 4J8UD 1KX3A 3MNNA 3AZGB 4H9OB 1M1AD 4J8XD 5B0ZA 5B1LD 3AL0C 5E5AD 3WTPC 4H9PA 2FJ7A 3MGQD 1P3OA 3AZKA 4H9SA 3MNNC 3AZEA 5DNMB 1B67A 5CPJC 5KDMB 5C3IC 2DF4C 4LD9C 4CAYB 3LZ0A 3REID 3AV2B 5G49A 2YFVB 4Z2MH 3EPLA 4H9QB 2YFWB 3LZ0D 3UT9B 5GT0B 3B0DC 3KWQD 2Y2MA 2Y2NA 1P3OC 4YM6D 3AV1D 3WTPA 2XD1A 1AOID 1F66B 5B31D 3LZ1A 3O62A 3LELD 2AROD 1P3PB 5AV5B 3B6GA 3WAAB 3AZIA 4HGAB 4J8VA 5B1MA 1M18A 3LZ1D 2CV5A 3LZ0C 3B6GD 5B32D 5B1LB 1S32C 3W96A 1TAFB 4WU9C 5JRGD 5FUGB 3AN2D 3X1TB 5B0ZC 1M18D 5DNNB 1ID3B 2CV5D 2HUEB 3H0RC 3REIB 2HUEC 5BT1C 4KUDB 3AZMD 3P5JB 5AV9A 1BFMA 3MGRB 5B0ZD 3A6NB 1M18C 5JRGC 3AN2C 2Y2LA 1EQZD 3X1TD 4J8XC 2G5HC 3KXBA 1N1JA 5CPIB 4DQYB 1HQ3B 2BYKA 4Z66B 3MVDD 5AV6C 1EQZA 1KX3C 4J8XA 1R4VA 1HQ3C 4Z66C 3C1CB 3LELB 4ZBJC 4G91C 1JFIB 3REJC 5F99B 2DQNC 3X1SB 4E44A 3KSYA 5CPKD 1P3GB 5B0YC 1AOIB 1F66D 3REKA 3LJAC 3AZKD 4WU8D 1P34D 1ULYA 3H0MC 5CHLB 3X1UB 2RVQD 5B33B 2BYMA 3UTBA 5AV9C 1P3GC 1B6WA 1KX4B 4YM6B 3X1VC 3W99B 3AYWB 4R8PB 3NQJA 5GSUB 2RIQA 4Z2MG 4QLCA 3C1CC 4J8VD 4H9NB 3REJB 1P3MD 2Y2HA 5CPIC 3UTAB 5BNXB 5B0YB 3VH5W 4QLCD 3UT9C 3AV1A 5AV6B 2NQBA 1KX4C 5E5AC 4J8WA 1P3IB 3AYWC 5B31A 1KX5B 4NE6A 5E5AB 2AROA 3R45B 2PYOB 3AFAA 4AWLC 3UTBC 3F6TA 1ZLAD 4ZUXB 1P3LC 5B2JB 5B32A 3AZJC 3AFAD 5AY8A 3MGSC 5B2ID 1P3BB 4KGCD 1BH8A 2ZY4A 2CWEA 5DNNC 4Z5TA 2F8NG 3KXBD 5CPJB 4X23C 3W98A 5CP6A 4YS3A 3B0CT 2Y2QA 3UTAC 3C1BA 3VH6W 5GT3A 5BNVA 4KUDC 2NZDB 4XUJA 5GSUD 2JSSA 1P3FB 1P3LA 5GT0C 3KFUG 4LD9A 5BO0B 4XZQA 1S32A 3AZNC 3REKD 3W99D 4JJNB 1M1AA 5B2IB 1P3BD 1Q9CA 3W97B 5AVCC 5AVBB 5CPKB 4XZQD 3MGQA 5B2JC 4WU9B 5B32G 5B24C 3MGPC 1P3AC 3MGSB 3AZFA 3AZHA 1P3FD 4WU8A 1BH9A 1P34A 3REKC 3X1SC 3UTBD 3AZFD 5GXQA 5JA4A 4XUJC 5B33C 4WJ3C 4H9RA 1TZYC 3REHD 3AZNA 3WA9B 5AVBC 1P3MB 3B6FC 3REHB 1M19D 5B24B 3MGPB 1P3AB 3A1IA 4KHAA 2Y2GA 3C1BC 3V9RB 5AVCB 2ZY5A 2FJ7C 3AZFC 1M19B 4R8PD 3TU4C 1P3KB 5AY8D 3EPJA 3A1KA 4J8WD 3AZHC 3AZLB 2VQRA 4KGCB 1ZLAC 3TU4B 2F8NA 5AVCD 3LJAB 3WKJC 2F8NB 4KGCA 1P3IC 5GXQC 3AZLA 1P3GD 3W99C 5B24D 3FDDA 3MGPD 1P3AD 3W98D 5AVCA 3WKJA 4G92C 3V9RA 3AZLD 1HQ3D 4Z66D 4KHAB 3MVDB 5B24A 1TZYB 3MGPA 1P3AA 3KUYA 3B6FB 3B0BA 3WA9A 3B6FD 5GSUC 5AVBD 3B0CW 4H9RB 1TZYD 5CP6D 4YS3D 3W98C 3MGRD 3KUYC 5GXQB 3IP4C 4ZBJB 3MGSD 3B6FA 1M19C 3KUYB 2L5AA 1TZYA 1P3LD 3AZHB 3AZLC 2NZDC 4KGCC 3MVDA 3AZHD 3WKJB 5AY8C 3MGSA 4WU9A 2Y2KA 5GXQD 4JJNC 5CPKA 5BS7C 1P3KD 3W97C 2PYOD 2Y2IA 3LJAA 3TU4A 2NZDD 5BO0A 5C3IB 4LD9B 1P3KA 5GT3C 1P3LB 1P3FA 3WTPE 1M19A 2NZDA 5BNVB 2XD5A 5GT3B 2F8NK 3W98B 1P3BC 2UWXA 3REHA 3AZND 4Z5TB 5BT1D 1P3MA 5GT0D 1BH8B 3AZNB 4ZUXD 5B2IC 4M6BA 4H9SC 5AY8B 5JA4B 3WAAC 5B32B 5CPKC 1P3FC 4ZUXA 3WKJD 1BH9B 4WU8B 1P34B 1P3ID 5AV6D 2RVQC 3AZFB 3W97D 2AROB 2F8ND 1P3KC 1KX5A 4JJND 1P3IA 3REJD 4E45A 3MGQB 5AVBA 5AV6A 3W97A 5B2IA 1M1AB 4JJNA 4UPKA 3REJA 5B31G 5B1LC 4XZQB 1S32B 1P3MC 1W2EA 3MGRC 3KUYD 4XUJB 5CP6C 4YS3C 3C1BD 5GT3D 2HIOD 4XUJD 3C1BB 5CP6B 3NQJB 5GSUA 3KXBC 4YS3B 5CPID 5CPJA 3AYWA 4LD9D 3REHC 4EO5B 1KX4A 3W99A 1P3BA 5B33A 3X1UA 4WV4B 3REKB 2CV5C 3AYWD 4DRBA 2BG1A 1JFIA 1KX4D 3C1CA 5B2JA 4J8XB 1T3UA 3LZ1C 3B6GC 3AFAB 3WAAD 2PYOA 3R45A 3C1CD 4J8VC 5E5AA 5B2JD 4J8WC 3KXBB 1U35C 5B31B 4R8PC 3TU4D 3EPHA 1WWIA 2FJ7D 3LELC 4J8WB 2ZM5A 5F99C 2NQBB 3AV1B 3AZED 5BNXA 2Y2OA 5B0YA 2Y2JA 3UTAA 4X23D 5AV9B 4H9NA 4KUDA 4EO5C 3KWQC 4QLCB 3REIA 3UTAD 5BS7A 5DNNA 3AZJD 5DNMC 4R8PA 1TAFA 1WWSA 3W96B 2PYOC 4YM6A 3AZMC 2BYMB 3UTBB 3WTPD 2Y2PA 2W8SA 5B1MB 1P3GA 1AOIA 4WZSB 4J8VB 3X1SA 5F99A 2JE5A 3AZIB 3O62D 3LELA 1P3PA 3AZID 3VH6T 4DRAA 3EPKA 4QLCC 1KX5C 3UT9D 2LY8A 5B1MD 1EQZB 1HQ3A 2BYKB 4Z66A 4AWLB 3WTPB 5CPIA 1N1JB 3W96D 3UT9A 2YFWA 4H9QA 3WA9D 5AV5C 5B33D 2YFVA 3A6NA 3MGRA 5G49B 3B0DB 3LZ0B 4CAYA 3AV2A 3X1VD 4NE3A 4Z5TC 5CPJD 3AV2D 3X1UD 3AZGC 4WU9D 1P3PC 1ID3A 3X1TA 1P3OB 5FUGA 4HGAC 1KX3D 5B32C 2ZY2A 5B1LA 2CV5B 3LJAD 5AV8D 4WU8C 1P34C 5B0YD 1F66C 3MNNB 3AZGA 1U35D 1Z2CB 3A6NC 4X23A 1M18B 1P3OD 1M1AC 1ID3D 3NQUA 1H3OA 2AROC 4KUDD 3WAAA 5AV5A 3O62B 3LZ1B 3B6GB 3MGQC 3AZGD 1F66A
chains in the Genus database with same CATH topology
3AV2C 4J8UA 3O62C 4WNNA 2J8PA 5DNND 5AV8B 3AZJA 3X1TC 5GT0A 2ZY3A 2FFFB 2HIOB 2F8NH 5DNMD 1HTAA 3KWQA 3REIC 3X1SD 2IO5B 4UUZA 3WA9C 2HIOC 5KDMA 2IO5C 3RELC 1ZLAB 4NE5A 5DNMA 2G5IC 4J8UC 3AZEB 3AZKC 4XZQC 5AV8C 1KX5D 2NQBD 1A7WA 3AZEC 3AZKB 5B40B 5B40A 3EG5B 5B31C 2FJ7B 1PZRA 1AOIC 4H9PB 5F99D 4G92B 3VH6A 1P3PD 3MVDC 5B0ZB 3X1UC 3A6ND 1ID3C 4H9OA 1KX3B 1ZLAA 5B40D 2F2AC 4G91B 1U35A 3RELD 3H0LC 1EQZC 4UUZB 2JCHA 3KWQB 2HIOA 3AV1C 4YM6C 3AZMA 3X1VB 3RELA 4CSRB 5AV9D 5JRGB 3AN2B 4Z5TD 5B40C 4ZUXC 1F1EA 5JRGA 3AN2A 4CSRA 3RELB 5AV8A 3AZJB 3VH5T 3AZMB 3AFAC 3X1VA 2NQBC 4WNNB 4J8UB 3MNND 1U35B 5B1MC 5AV5D 1KU5A 4NFTA 3AZIC 1H3OB 3NQUB 1S32D 3W96C 3VH5A 4X23B 4J8UD 1KX3A 3MNNA 3AZGB 4H9OB 1M1AD 4J8XD 5B0ZA 5B1LD 3AL0C 5E5AD 3WTPC 4H9PA 2FJ7A 3MGQD 1P3OA 3AZKA 4H9SA 3MNNC 3AZEA 5DNMB 1B67A 5CPJC 5KDMB 5C3IC 2DF4C 4LD9C 4CAYB 3LZ0A 3REID 3AV2B 5G49A 2YFVB 4Z2MH 3EPLA 4H9QB 2YFWB 3LZ0D 3UT9B 5GT0B 3B0DC 3KWQD 2Y2MA 2Y2NA 1P3OC 4YM6D 3AV1D 3WTPA 2XD1A 1AOID 1F66B 5B31D 3LZ1A 3O62A 3LELD 2AROD 1P3PB 5AV5B 3B6GA 3WAAB 3AZIA 4HGAB 4J8VA 5B1MA 1M18A 3LZ1D 2CV5A 3LZ0C 3B6GD 5B32D 5B1LB 1S32C 3W96A 1TAFB 4WU9C 5JRGD 5FUGB 3AN2D 3X1TB 5B0ZC 1M18D 5DNNB 1ID3B 2CV5D 2HUEB 3H0RC 3REIB 2HUEC 5BT1C 4KUDB 3AZMD 3P5JB 5AV9A 1BFMA 3MGRB 5B0ZD 3A6NB 1M18C 5JRGC 3AN2C 2Y2LA 1EQZD 3X1TD 4J8XC 2G5HC 3KXBA 1N1JA 5CPIB 4DQYB 1HQ3B 2BYKA 4Z66B 3MVDD 5AV6C 1EQZA 1KX3C 4J8XA 1R4VA 1HQ3C 4Z66C 3C1CB 3LELB 4ZBJC 4G91C 1JFIB 3REJC 5F99B 2DQNC 3X1SB 4E44A 3KSYA 5CPKD 1P3GB 5B0YC 1AOIB 1F66D 3REKA 3LJAC 3AZKD 4WU8D 1P34D 1ULYA 3H0MC 5CHLB 3X1UB 2RVQD 5B33B 2BYMA 3UTBA 5AV9C 1P3GC 1B6WA 1KX4B 4YM6B 3X1VC 3W99B 3AYWB 4R8PB 3NQJA 5GSUB 2RIQA 4Z2MG 4QLCA 3C1CC 4J8VD 4H9NB 3REJB 1P3MD 2Y2HA 5CPIC 3UTAB 5BNXB 5B0YB 3VH5W 4QLCD 3UT9C 3AV1A 5AV6B 2NQBA 1KX4C 5E5AC 4J8WA 1P3IB 3AYWC 5B31A 1KX5B 4NE6A 5E5AB 2AROA 3R45B 2PYOB 3AFAA 4AWLC 3UTBC 3F6TA 1ZLAD 4ZUXB 1P3LC 5B2JB 5B32A 3AZJC 3AFAD 5AY8A 3MGSC 5B2ID 1P3BB 4KGCD 1BH8A 2ZY4A 2CWEA 5DNNC 4Z5TA 2F8NG 3KXBD 5CPJB 4X23C 3W98A 5CP6A 4YS3A 3B0CT 2Y2QA 3UTAC 3C1BA 3VH6W 5GT3A 5BNVA 4KUDC 2NZDB 4XUJA 5GSUD 2JSSA 1P3FB 1P3LA 5GT0C 3KFUG 4LD9A 5BO0B 4XZQA 1S32A 3AZNC 3REKD 3W99D 4JJNB 1M1AA 5B2IB 1P3BD 1Q9CA 3W97B 5AVCC 5AVBB 5CPKB 4XZQD 3MGQA 5B2JC 4WU9B 5B32G 5B24C 3MGPC 1P3AC 3MGSB 3AZFA 3AZHA 1P3FD 4WU8A 1BH9A 1P34A 3REKC 3X1SC 3UTBD 3AZFD 5GXQA 5JA4A 4XUJC 5B33C 4WJ3C 4H9RA 1TZYC 3REHD 3AZNA 3WA9B 5AVBC 1P3MB 3B6FC 3REHB 1M19D 5B24B 3MGPB 1P3AB 3A1IA 4KHAA 2Y2GA 3C1BC 3V9RB 5AVCB 2ZY5A 2FJ7C 3AZFC 1M19B 4R8PD 3TU4C 1P3KB 5AY8D 3EPJA 3A1KA 4J8WD 3AZHC 3AZLB 2VQRA 4KGCB 1ZLAC 3TU4B 2F8NA 5AVCD 3LJAB 3WKJC 2F8NB 4KGCA 1P3IC 5GXQC 3AZLA 1P3GD 3W99C 5B24D 3FDDA 3MGPD 1P3AD 3W98D 5AVCA 3WKJA 4G92C 3V9RA 3AZLD 1HQ3D 4Z66D 4KHAB 3MVDB 5B24A 1TZYB 3MGPA 1P3AA 3KUYA 3B6FB 3B0BA 3WA9A 3B6FD 5GSUC 5AVBD 3B0CW 4H9RB 1TZYD 5CP6D 4YS3D 3W98C 3MGRD 3KUYC 5GXQB 3IP4C 4ZBJB 3MGSD 3B6FA 1M19C 3KUYB 2L5AA 1TZYA 1P3LD 3AZHB 3AZLC 2NZDC 4KGCC 3MVDA 3AZHD 3WKJB 5AY8C 3MGSA 4WU9A 2Y2KA 5GXQD 4JJNC 5CPKA 5BS7C 1P3KD 3W97C 2PYOD 2Y2IA 3LJAA 3TU4A 2NZDD 5BO0A 5C3IB 4LD9B 1P3KA 5GT3C 1P3LB 1P3FA 3WTPE 1M19A 2NZDA 5BNVB 2XD5A 5GT3B 2F8NK 3W98B 1P3BC 2UWXA 3REHA 3AZND 4Z5TB 5BT1D 1P3MA 5GT0D 1BH8B 3AZNB 4ZUXD 5B2IC 4M6BA 4H9SC 5AY8B 5JA4B 3WAAC 5B32B 5CPKC 1P3FC 4ZUXA 3WKJD 1BH9B 4WU8B 1P34B 1P3ID 5AV6D 2RVQC 3AZFB 3W97D 2AROB 2F8ND 1P3KC 1KX5A 4JJND 1P3IA 3REJD 4E45A 3MGQB 5AVBA 5AV6A 3W97A 5B2IA 1M1AB 4JJNA 4UPKA 3REJA 5B31G 5B1LC 4XZQB 1S32B 1P3MC 1W2EA 3MGRC 3KUYD 4XUJB 5CP6C 4YS3C 3C1BD 5GT3D 2HIOD 4XUJD 3C1BB 5CP6B 3NQJB 5GSUA 3KXBC 4YS3B 5CPID 5CPJA 3AYWA 4LD9D 3REHC 4EO5B 1KX4A 3W99A 1P3BA 5B33A 3X1UA 4WV4B 3REKB 2CV5C 3AYWD 4DRBA 2BG1A 1JFIA 1KX4D 3C1CA 5B2JA 4J8XB 1T3UA 3LZ1C 3B6GC 3AFAB 3WAAD 2PYOA 3R45A 3C1CD 4J8VC 5E5AA 5B2JD 4J8WC 3KXBB 1U35C 5B31B 4R8PC 3TU4D 3EPHA 1WWIA 2FJ7D 3LELC 4J8WB 2ZM5A 5F99C 2NQBB 3AV1B 3AZED 5BNXA 2Y2OA 5B0YA 2Y2JA 3UTAA 4X23D 5AV9B 4H9NA 4KUDA 4EO5C 3KWQC 4QLCB 3REIA 3UTAD 5BS7A 5DNNA 3AZJD 5DNMC 4R8PA 1TAFA 1WWSA 3W96B 2PYOC 4YM6A 3AZMC 2BYMB 3UTBB 3WTPD 2Y2PA 2W8SA 5B1MB 1P3GA 1AOIA 4WZSB 4J8VB 3X1SA 5F99A 2JE5A 3AZIB 3O62D 3LELA 1P3PA 3AZID 3VH6T 4DRAA 3EPKA 4QLCC 1KX5C 3UT9D 2LY8A 5B1MD 1EQZB 1HQ3A 2BYKB 4Z66A 4AWLB 3WTPB 5CPIA 1N1JB 3W96D 3UT9A 2YFWA 4H9QA 3WA9D 5AV5C 5B33D 2YFVA 3A6NA 3MGRA 5G49B 3B0DB 3LZ0B 4CAYA 3AV2A 3X1VD 4NE3A 4Z5TC 5CPJD 3AV2D 3X1UD 3AZGC 4WU9D 1P3PC 1ID3A 3X1TA 1P3OB 5FUGA 4HGAC 1KX3D 5B32C 2ZY2A 5B1LA 2CV5B 3LJAD 5AV8D 4WU8C 1P34C 5B0YD 1F66C 3MNNB 3AZGA 1U35D 1Z2CB 3A6NC 4X23A 1M18B 1P3OD 1M1AC 1ID3D 3NQUA 1H3OA 2AROC 4KUDD 3WAAA 5AV5A 3O62B 3LZ1B 3B6GB 3MGQC 3AZGD 1F66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 C;  4J8U A;  3O62 C;  4WNN A;  5DNN D;  5AV8 B;  3AZJ A;  3X1T C;  5GT0 A;  2HIO B;  2F8N H;  5DNM D;  1HTA A;  3KWQ A;  3REI C;  3X1S D;  2IO5 B;  4UUZ A;  3WA9 C;  2HIO C;  5KDM A;  2IO5 C;  3REL C;  1ZLA B;  4NE5 A;  5DNM A;  4J8U C;  3AZE B;  3AZK C;  4XZQ C;  5AV8 C;  1KX5 D;  2NQB D;  1A7W A;  3AZE C;  3AZK B;  5B40 B;  5B40 A;  5B31 C;  2FJ7 B;  1AOI C;  4H9P B;  5F99 D;  4G92 B;  3VH6 A;  1P3P D;  3MVD C;  3A6N D;  5B0Z B;  3X1U C;  1ID3 C;  4H9O A;  1KX3 B;  1ZLA A;  5B40 D;  4G91 B;  1U35 A;  3REL D;  1EQZ C;  4UUZ B;  3KWQ B;  2HIO A;  3AV1 C;  4YM6 C;  3AZM A;  3X1V B;  3REL A;  4CSR B;  5AV9 D;  5JRG B;  3AN2 B;  4Z5T D;  5B40 C;  4ZUX C;  1F1E A;  5JRG A;  3AN2 A;  4CSR A;  3REL B;  5AV8 A;  3AZJ B;  3VH5 T;  3AZM B;  3AFA C;  3X1V A;  4WNN B;  4J8U B;  3MNN D;  1U35 B;  5B1M C;  5AV5 D;  1KU5 A;  4NFT A;  3AZI C;  1H3O B;  3NQU B;  1S32 D;  3W96 C;  3VH5 A;  4X23 B;  4J8U D;  1KX3 A;  3MNN A;  3AZG B;  4H9O B;  1M1A D;  4J8X D;  5B0Z A;  5B1L D;  5E5A D;  3WTP C;  4H9P A;  2FJ7 A;  3MGQ D;  1P3O A;  3AZK A;  4H9S A;  3MNN C;  3AZE A;  5DNM B;  1B67 A;  5CPJ C;  5KDM B;  5C3I C;  4LD9 C;  4CAY B;  3LZ0 A;  3REI D;  3AV2 B;  5G49 A;  2YFV B;  4Z2M H;  4H9Q B;  3LZ0 D;  2YFW B;  3UT9 B;  5GT0 B;  3B0D C;  3KWQ D;  1P3O C;  4YM6 D;  3AV1 D;  3WTP A;  1AOI D;  1F66 B;  5B31 D;  3LZ1 A;  3O62 A;  3LEL D;  2ARO D;  1P3P B;  5AV5 B;  3B6G A;  3WAA B;  3AZI A;  4HGA B;  4J8V A;  5B1M A;  1M18 A;  3LZ1 D;  2CV5 A;  3LZ0 C;  3B6G D;  5B32 D;  5B1L B;  1S32 C;  3W96 A;  1TAF B;  4WU9 C;  5JRG D;  5FUG B;  3AN2 D;  3X1T B;  5B0Z C;  1M18 D;  5DNN B;  1ID3 B;  2CV5 D;  2HUE B;  3REI B;  2HUE C;  5BT1 C;  4KUD B;  3AZM D;  5AV9 A;  1BFM A;  3MGR B;  5B0Z D;  3A6N B;  1M18 C;  5JRG C;  3AN2 C;  1EQZ D;  3X1T D;  4J8X C;  3KXB A;  1N1J A;  5CPI B;  1HQ3 B;  2BYK A;  4Z66 B;  3MVD D;  5AV6 C;  1EQZ A;  1KX3 C;  4J8X A;  1R4V A;  1HQ3 C;  4Z66 C;  3C1C B;  3LEL B;  4ZBJ C;  4G91 C;  1JFI B;  3REJ C;  5F99 B;  3X1S B;  5CPK D;  4E44 A;  3KSY A;  1AOI B;  1P3G B;  5B0Y C;  1F66 D;  2NQB C;  3REK A;  3LJA C;  3AZK D;  4WU8 D;  1P34 D;  1ULY A;  5CHL B;  2RVQ D;  5B33 B;  3X1U B;  2BYM A;  3UTB A;  5AV9 C;  1P3G C;  1B6W A;  1KX4 B;  4YM6 B;  3X1V C;  3W99 B;  3AYW B;  4R8P B;  3NQJ A;  5GSU B;  4Z2M G;  4QLC A;  3C1C C;  4J8V D;  4H9N B;  3REJ B;  1P3M D;  3UTA B;  5CPI C;  5BNX B;  5B0Y B;  3VH5 W;  4QLC D;  3UT9 C;  3AV1 A;  5AV6 B;  2NQB A;  1KX4 C;  5E5A C;  4J8W A;  1P3I B;  3AYW C;  5B31 A;  1KX5 B;  4NE6 A;  5E5A B;  2ARO A;  3R45 B;  2PYO B;  3AFA A;  4AWL C;  3UTB C;  1ZLA D;  4ZUX B;  1P3L C;  5B2J B;  5B32 A;  3AZJ C;  3AFA D;  5AY8 A;  3MGS C;  5B2I D;  1P3B B;  4KGC D;  1BH8 A;  2CWE A;  5DNN C;  4Z5T A;  2F8N G;  3KXB D;  5CPJ B;  4X23 C;  3W98 A;  5CP6 A;  4YS3 A;  3B0C T;  3UTA C;  3C1B A;  3VH6 W;  5GT3 A;  5BNV A;  4KUD C;  2NZD B;  4XUJ A;  5GSU D;  2JSS A;  1P3F B;  1P3L A;  5GT0 C;  4LD9 A;  5BO0 B;  4XZQ A;  1S32 A;  3AZN C;  3REK D;  3W99 D;  4JJN B;  1M1A A;  5B2I B;  1P3B D;  1Q9C A;  3W97 B;  5AVC C;  5AVB B;  5CPK B;  4XZQ D;  3MGQ A;  5B2J C;  4WU9 B;  5B32 G;  5B24 C;  3MGP C;  1P3A C;  3MGS B;  3AZF A;  3AZH A;  1P3F D;  4WU8 A;  1BH9 A;  1P34 A;  3REK C;  3X1S C;  3UTB D;  3AZF D;  5GXQ A;  5JA4 A;  4XUJ C;  5B33 C;  4H9R A;  1TZY C;  3REH D;  3AZN A;  3WA9 B;  5AVB C;  1P3M B;  3B6F C;  3REH B;  1M19 D;  5B24 B;  3MGP B;  1P3A B;  4KHA A;  3C1B C;  3V9R B;  5AVC B;  2FJ7 C;  3AZF C;  1M19 B;  4R8P D;  3TU4 C;  1P3K B;  5AY8 D;  4J8W D;  3AZH C;  3AZL B;  4KGC B;  1ZLA C;  3TU4 B;  2F8N A;  5AVC D;  3LJA B;  3WKJ C;  2F8N B;  4KGC A;  1P3I C;  5GXQ C;  3AZL A;  1P3G D;  3W99 C;  5B24 D;  3MGP D;  1P3A D;  3W98 D;  5AVC A;  3WKJ A;  4G92 C;  3V9R A;  3AZL D;  1HQ3 D;  4Z66 D;  4KHA B;  3MVD B;  5B24 A;  1TZY B;  3MGP A;  1P3A A;  3KUY A;  3B6F B;  3B0B A;  3WA9 A;  3B6F D;  5GSU C;  5AVB D;  3B0C W;  4H9R B;  1TZY D;  5CP6 D;  4YS3 D;  3W98 C;  3MGR D;  3KUY C;  5GXQ B;  4ZBJ B;  3MGS D;  3B6F A;  1M19 C;  3KUY B;  2L5A A;  1TZY A;  1P3L D;  3AZH B;  3AZL C;  2NZD C;  4KGC C;  3MVD A;  3AZH D;  3WKJ B;  5AY8 C;  3MGS A;  4WU9 A;  5GXQ D;  4JJN C;  5CPK A;  5BS7 C;  1P3K D;  3W97 C;  2PYO D;  3LJA A;  3TU4 A;  2NZD D;  5BO0 A;  5C3I B;  4LD9 B;  1P3K A;  5GT3 C;  1P3L B;  1P3F A;  3WTP E;  1M19 A;  2NZD A;  5BNV B;  5GT3 B;  2F8N K;  3W98 B;  1P3B C;  3REH A;  3AZN D;  4Z5T B;  5BT1 D;  1P3M A;  5GT0 D;  1BH8 B;  3AZN B;  4ZUX D;  5B2I C;  4M6B A;  4H9S C;  5AY8 B;  5JA4 B;  3WAA C;  5B32 B;  5CPK C;  1P3F C;  4ZUX A;  3WKJ D;  1BH9 B;  4WU8 B;  1P34 B;  1P3I D;  5AV6 D;  2RVQ C;  3AZF B;  3W97 D;  2ARO B;  2F8N D;  1P3K C;  1KX5 A;  4JJN D;  1P3I A;  3REJ D;  4E45 A;  3MGQ B;  5AVB A;  5AV6 A;  3W97 A;  5B2I A;  1M1A B;  4JJN A;  3REJ A;  5B31 G;  5B1L C;  4XZQ B;  1S32 B;  1P3M C;  3MGR C;  3KUY D;  4XUJ B;  5CP6 C;  4YS3 C;  3C1B D;  5GT3 D;  2HIO D;  4XUJ D;  3C1B B;  5CP6 B;  3NQJ B;  5GSU A;  3KXB C;  4YS3 B;  5CPI D;  5CPJ A;  3AYW A;  4LD9 D;  3REH C;  4EO5 B;  1KX4 A;  3W99 A;  1P3B A;  5B33 A;  3X1U A;  4WV4 B;  3REK B;  2CV5 C;  3AYW D;  4DRB A;  1JFI A;  1KX4 D;  3C1C A;  5B2J A;  4J8X B;  3LZ1 C;  3B6G C;  3AFA B;  3WAA D;  2PYO A;  3R45 A;  3C1C D;  4J8V C;  5E5A A;  5B2J D;  4J8W C;  3KXB B;  1U35 C;  5B31 B;  4R8P C;  3TU4 D;  1WWI A;  2FJ7 D;  3LEL C;  4J8W B;  5F99 C;  2NQB B;  3AV1 B;  3AZE D;  5BNX A;  5B0Y A;  3UTA A;  4X23 D;  5AV9 B;  4H9N A;  4KUD A;  4EO5 C;  3KWQ C;  4QLC B;  3REI A;  3UTA D;  5BS7 A;  5DNN A;  3AZJ D;  5DNM C;  4R8P A;  1TAF A;  1WWS A;  3W96 B;  2PYO C;  4YM6 A;  3AZM C;  2BYM B;  3UTB B;  3WTP D;  5B1M B;  1P3G A;  1AOI A;  4WZS B;  4J8V B;  3X1S A;  5F99 A;  3AZI B;  3O62 D;  3LEL A;  1P3P A;  3AZI D;  3VH6 T;  4DRA A;  1KX5 C;  4QLC C;  3UT9 D;  2LY8 A;  5B1M D;  1EQZ B;  1HQ3 A;  2BYK B;  4Z66 A;  4AWL B;  3WTP B;  5CPI A;  1N1J B;  3W96 D;  3UT9 A;  2YFW A;  4H9Q A;  3WA9 D;  5AV5 C;  5B33 D;  2YFV A;  3A6N A;  3MGR A;  5G49 B;  3B0D B;  3LZ0 B;  4CAY A;  3AV2 A;  3X1V D;  4NE3 A;  4Z5T C;  5CPJ D;  3AV2 D;  3X1U D;  3AZG C;  4WU9 D;  1P3P C;  1ID3 A;  3X1T A;  1P3O B;  5FUG A;  4HGA C;  1KX3 D;  5B32 C;  5B1L A;  2CV5 B;  3LJA D;  5AV8 D;  4WU8 C;  1P34 C;  5B0Y D;  1F66 C;  3MNN B;  3AZG A;  1U35 D;  3A6N C;  1M18 B;  4X23 A;  1ID3 D;  1P3O D;  1M1A C;  3NQU A;  1H3O A;  2ARO C;  4KUD D;  3WAA A;  5AV5 A;  3O62 B;  3LZ1 B;  3B6G B;  3MGQ C;  3AZG D;  1F66 A; 
#chains in the Genus database with same CATH topology
 3AV2 C;  4J8U A;  3O62 C;  4WNN A;  2J8P A;  5DNN D;  5AV8 B;  3AZJ A;  3X1T C;  5GT0 A;  2ZY3 A;  2FFF B;  2HIO B;  2F8N H;  5DNM D;  1HTA A;  3KWQ A;  3REI C;  3X1S D;  2IO5 B;  4UUZ A;  3WA9 C;  2HIO C;  5KDM A;  2IO5 C;  3REL C;  1ZLA B;  4NE5 A;  5DNM A;  2G5I C;  4J8U C;  3AZE B;  3AZK C;  4XZQ C;  5AV8 C;  1KX5 D;  2NQB D;  1A7W A;  3AZE C;  3AZK B;  5B40 B;  5B40 A;  3EG5 B;  5B31 C;  2FJ7 B;  1PZR A;  1AOI C;  4H9P B;  5F99 D;  4G92 B;  3VH6 A;  1P3P D;  3MVD C;  5B0Z B;  3X1U C;  3A6N D;  1ID3 C;  4H9O A;  1KX3 B;  1ZLA A;  5B40 D;  2F2A C;  4G91 B;  1U35 A;  3REL D;  3H0L C;  1EQZ C;  4UUZ B;  2JCH A;  3KWQ B;  2HIO A;  3AV1 C;  4YM6 C;  3AZM A;  3X1V B;  3REL A;  4CSR B;  5AV9 D;  5JRG B;  3AN2 B;  4Z5T D;  5B40 C;  4ZUX C;  1F1E A;  5JRG A;  3AN2 A;  4CSR A;  3REL B;  5AV8 A;  3AZJ B;  3VH5 T;  3AZM B;  3AFA C;  3X1V A;  2NQB C;  4WNN B;  4J8U B;  3MNN D;  1U35 B;  5B1M C;  5AV5 D;  1KU5 A;  4NFT A;  3AZI C;  1H3O B;  3NQU B;  1S32 D;  3W96 C;  3VH5 A;  4X23 B;  4J8U D;  1KX3 A;  3MNN A;  3AZG B;  4H9O B;  1M1A D;  4J8X D;  5B0Z A;  5B1L D;  3AL0 C;  5E5A D;  3WTP C;  4H9P A;  2FJ7 A;  3MGQ D;  1P3O A;  3AZK A;  4H9S A;  3MNN C;  3AZE A;  5DNM B;  1B67 A;  5CPJ C;  5KDM B;  5C3I C;  2DF4 C;  4LD9 C;  4CAY B;  3LZ0 A;  3REI D;  3AV2 B;  5G49 A;  2YFV B;  4Z2M H;  3EPL A;  4H9Q B;  2YFW B;  3LZ0 D;  3UT9 B;  5GT0 B;  3B0D C;  3KWQ D;  2Y2M A;  2Y2N A;  1P3O C;  4YM6 D;  3AV1 D;  3WTP A;  2XD1 A;  1AOI D;  1F66 B;  5B31 D;  3LZ1 A;  3O62 A;  3LEL D;  2ARO D;  1P3P B;  5AV5 B;  3B6G A;  3WAA B;  3AZI A;  4HGA B;  4J8V A;  5B1M A;  1M18 A;  3LZ1 D;  2CV5 A;  3LZ0 C;  3B6G D;  5B32 D;  5B1L B;  1S32 C;  3W96 A;  1TAF B;  4WU9 C;  5JRG D;  5FUG B;  3AN2 D;  3X1T B;  5B0Z C;  1M18 D;  5DNN B;  1ID3 B;  2CV5 D;  2HUE B;  3H0R C;  3REI B;  2HUE C;  5BT1 C;  4KUD B;  3AZM D;  3P5J B;  5AV9 A;  1BFM A;  3MGR B;  5B0Z D;  3A6N B;  1M18 C;  5JRG C;  3AN2 C;  2Y2L A;  1EQZ D;  3X1T D;  4J8X C;  2G5H C;  3KXB A;  1N1J A;  5CPI B;  4DQY B;  1HQ3 B;  2BYK A;  4Z66 B;  3MVD D;  5AV6 C;  1EQZ A;  1KX3 C;  4J8X A;  1R4V A;  1HQ3 C;  4Z66 C;  3C1C B;  3LEL B;  4ZBJ C;  4G91 C;  1JFI B;  3REJ C;  5F99 B;  2DQN C;  3X1S B;  4E44 A;  3KSY A;  5CPK D;  1P3G B;  5B0Y C;  1AOI B;  1F66 D;  3REK A;  3LJA C;  3AZK D;  4WU8 D;  1P34 D;  1ULY A;  3H0M C;  5CHL B;  3X1U B;  2RVQ D;  5B33 B;  2BYM A;  3UTB A;  5AV9 C;  1P3G C;  1B6W A;  1KX4 B;  4YM6 B;  3X1V C;  3W99 B;  3AYW B;  4R8P B;  3NQJ A;  5GSU B;  2RIQ A;  4Z2M G;  4QLC A;  3C1C C;  4J8V D;  4H9N B;  3REJ B;  1P3M D;  2Y2H A;  5CPI C;  3UTA B;  5BNX B;  5B0Y B;  3VH5 W;  4QLC D;  3UT9 C;  3AV1 A;  5AV6 B;  2NQB A;  1KX4 C;  5E5A C;  4J8W A;  1P3I B;  3AYW C;  5B31 A;  1KX5 B;  4NE6 A;  5E5A B;  2ARO A;  3R45 B;  2PYO B;  3AFA A;  4AWL C;  3UTB C;  3F6T A;  1ZLA D;  4ZUX B;  1P3L C;  5B2J B;  5B32 A;  3AZJ C;  3AFA D;  5AY8 A;  3MGS C;  5B2I D;  1P3B B;  4KGC D;  1BH8 A;  2ZY4 A;  2CWE A;  5DNN C;  4Z5T A;  2F8N G;  3KXB D;  5CPJ B;  4X23 C;  3W98 A;  5CP6 A;  4YS3 A;  3B0C T;  2Y2Q A;  3UTA C;  3C1B A;  3VH6 W;  5GT3 A;  5BNV A;  4KUD C;  2NZD B;  4XUJ A;  5GSU D;  2JSS A;  1P3F B;  1P3L A;  5GT0 C;  3KFU G;  4LD9 A;  5BO0 B;  4XZQ A;  1S32 A;  3AZN C;  3REK D;  3W99 D;  4JJN B;  1M1A A;  5B2I B;  1P3B D;  1Q9C A;  3W97 B;  5AVC C;  5AVB B;  5CPK B;  4XZQ D;  3MGQ A;  5B2J C;  4WU9 B;  5B32 G;  5B24 C;  3MGP C;  1P3A C;  3MGS B;  3AZF A;  3AZH A;  1P3F D;  4WU8 A;  1BH9 A;  1P34 A;  3REK C;  3X1S C;  3UTB D;  3AZF D;  5GXQ A;  5JA4 A;  4XUJ C;  5B33 C;  4WJ3 C;  4H9R A;  1TZY C;  3REH D;  3AZN A;  3WA9 B;  5AVB C;  1P3M B;  3B6F C;  3REH B;  1M19 D;  5B24 B;  3MGP B;  1P3A B;  3A1I A;  4KHA A;  2Y2G A;  3C1B C;  3V9R B;  5AVC B;  2ZY5 A;  2FJ7 C;  3AZF C;  1M19 B;  4R8P D;  3TU4 C;  1P3K B;  5AY8 D;  3EPJ A;  3A1K A;  4J8W D;  3AZH C;  3AZL B;  2VQR A;  4KGC B;  1ZLA C;  3TU4 B;  2F8N A;  5AVC D;  3LJA B;  3WKJ C;  2F8N B;  4KGC A;  1P3I C;  5GXQ C;  3AZL A;  1P3G D;  3W99 C;  5B24 D;  3FDD A;  3MGP D;  1P3A D;  3W98 D;  5AVC A;  3WKJ A;  4G92 C;  3V9R A;  3AZL D;  1HQ3 D;  4Z66 D;  4KHA B;  3MVD B;  5B24 A;  1TZY B;  3MGP A;  1P3A A;  3KUY A;  3B6F B;  3B0B A;  3WA9 A;  3B6F D;  5GSU C;  5AVB D;  3B0C W;  4H9R B;  1TZY D;  5CP6 D;  4YS3 D;  3W98 C;  3MGR D;  3KUY C;  5GXQ B;  3IP4 C;  4ZBJ B;  3MGS D;  3B6F A;  1M19 C;  3KUY B;  2L5A A;  1TZY A;  1P3L D;  3AZH B;  3AZL C;  2NZD C;  4KGC C;  3MVD A;  3AZH D;  3WKJ B;  5AY8 C;  3MGS A;  4WU9 A;  2Y2K A;  5GXQ D;  4JJN C;  5CPK A;  5BS7 C;  1P3K D;  3W97 C;  2PYO D;  2Y2I A;  3LJA A;  3TU4 A;  2NZD D;  5BO0 A;  5C3I B;  4LD9 B;  1P3K A;  5GT3 C;  1P3L B;  1P3F A;  3WTP E;  1M19 A;  2NZD A;  5BNV B;  2XD5 A;  5GT3 B;  2F8N K;  3W98 B;  1P3B C;  2UWX A;  3REH A;  3AZN D;  4Z5T B;  5BT1 D;  1P3M A;  5GT0 D;  1BH8 B;  3AZN B;  4ZUX D;  5B2I C;  4M6B A;  4H9S C;  5AY8 B;  5JA4 B;  3WAA C;  5B32 B;  5CPK C;  1P3F C;  4ZUX A;  3WKJ D;  1BH9 B;  4WU8 B;  1P34 B;  1P3I D;  5AV6 D;  2RVQ C;  3AZF B;  3W97 D;  2ARO B;  2F8N D;  1P3K C;  1KX5 A;  4JJN D;  1P3I A;  3REJ D;  4E45 A;  3MGQ B;  5AVB A;  5AV6 A;  3W97 A;  5B2I A;  1M1A B;  4JJN A;  4UPK A;  3REJ A;  5B31 G;  5B1L C;  4XZQ B;  1S32 B;  1P3M C;  1W2E A;  3MGR C;  3KUY D;  4XUJ B;  5CP6 C;  4YS3 C;  3C1B D;  5GT3 D;  2HIO D;  4XUJ D;  3C1B B;  5CP6 B;  3NQJ B;  5GSU A;  3KXB C;  4YS3 B;  5CPI D;  5CPJ A;  3AYW A;  4LD9 D;  3REH C;  4EO5 B;  1KX4 A;  3W99 A;  1P3B A;  5B33 A;  3X1U A;  4WV4 B;  3REK B;  2CV5 C;  3AYW D;  4DRB A;  2BG1 A;  1JFI A;  1KX4 D;  3C1C A;  5B2J A;  4J8X B;  1T3U A;  3LZ1 C;  3B6G C;  3AFA B;  3WAA D;  2PYO A;  3R45 A;  3C1C D;  4J8V C;  5E5A A;  5B2J D;  4J8W C;  3KXB B;  1U35 C;  5B31 B;  4R8P C;  3TU4 D;  3EPH A;  1WWI A;  2FJ7 D;  3LEL C;  4J8W B;  2ZM5 A;  5F99 C;  2NQB B;  3AV1 B;  3AZE D;  5BNX A;  2Y2O A;  5B0Y A;  2Y2J A;  3UTA A;  4X23 D;  5AV9 B;  4H9N A;  4KUD A;  4EO5 C;  3KWQ C;  4QLC B;  3REI A;  3UTA D;  5BS7 A;  5DNN A;  3AZJ D;  5DNM C;  4R8P A;  1TAF A;  1WWS A;  3W96 B;  2PYO C;  4YM6 A;  3AZM C;  2BYM B;  3UTB B;  3WTP D;  2Y2P A;  2W8S A;  5B1M B;  1P3G A;  1AOI A;  4WZS B;  4J8V B;  3X1S A;  5F99 A;  2JE5 A;  3AZI B;  3O62 D;  3LEL A;  1P3P A;  3AZI D;  3VH6 T;  4DRA A;  3EPK A;  4QLC C;  1KX5 C;  3UT9 D;  2LY8 A;  5B1M D;  1EQZ B;  1HQ3 A;  2BYK B;  4Z66 A;  4AWL B;  3WTP B;  5CPI A;  1N1J B;  3W96 D;  3UT9 A;  2YFW A;  4H9Q A;  3WA9 D;  5AV5 C;  5B33 D;  2YFV A;  3A6N A;  3MGR A;  5G49 B;  3B0D B;  3LZ0 B;  4CAY A;  3AV2 A;  3X1V D;  4NE3 A;  4Z5T C;  5CPJ D;  3AV2 D;  3X1U D;  3AZG C;  4WU9 D;  1P3P C;  1ID3 A;  3X1T A;  1P3O B;  5FUG A;  4HGA C;  1KX3 D;  5B32 C;  2ZY2 A;  5B1L A;  2CV5 B;  3LJA D;  5AV8 D;  4WU8 C;  1P34 C;  5B0Y D;  1F66 C;  3MNN B;  3AZG A;  1U35 D;  1Z2C B;  3A6N C;  4X23 A;  1M18 B;  1P3O D;  1M1A C;  1ID3 D;  3NQU A;  1H3O A;  2ARO C;  4KUD D;  3WAA A;  5AV5 A;  3O62 B;  3LZ1 B;  3B6G B;  3MGQ C;  3AZG D;  1F66 A; 
#chains in the Genus database with same CATH homology
 3AV2 C;  4J8U A;  3O62 C;  4WNN A;  2J8P A;  5DNN D;  5AV8 B;  3AZJ A;  3X1T C;  5GT0 A;  2ZY3 A;  2FFF B;  2HIO B;  2F8N H;  5DNM D;  1HTA A;  3KWQ A;  3REI C;  3X1S D;  2IO5 B;  4UUZ A;  3WA9 C;  2HIO C;  5KDM A;  2IO5 C;  3REL C;  1ZLA B;  4NE5 A;  5DNM A;  2G5I C;  4J8U C;  3AZE B;  3AZK C;  4XZQ C;  5AV8 C;  1KX5 D;  2NQB D;  1A7W A;  3AZE C;  3AZK B;  5B40 B;  5B40 A;  3EG5 B;  5B31 C;  2FJ7 B;  1PZR A;  1AOI C;  4H9P B;  5F99 D;  4G92 B;  3VH6 A;  1P3P D;  3MVD C;  5B0Z B;  3X1U C;  3A6N D;  1ID3 C;  4H9O A;  1KX3 B;  1ZLA A;  5B40 D;  2F2A C;  4G91 B;  1U35 A;  3REL D;  3H0L C;  1EQZ C;  4UUZ B;  2JCH A;  3KWQ B;  2HIO A;  3AV1 C;  4YM6 C;  3AZM A;  3X1V B;  3REL A;  4CSR B;  5AV9 D;  5JRG B;  3AN2 B;  4Z5T D;  5B40 C;  4ZUX C;  1F1E A;  5JRG A;  3AN2 A;  4CSR A;  3REL B;  5AV8 A;  3AZJ B;  3VH5 T;  3AZM B;  3AFA C;  3X1V A;  2NQB C;  4WNN B;  4J8U B;  3MNN D;  1U35 B;  5B1M C;  5AV5 D;  1KU5 A;  4NFT A;  3AZI C;  1H3O B;  3NQU B;  1S32 D;  3W96 C;  3VH5 A;  4X23 B;  4J8U D;  1KX3 A;  3MNN A;  3AZG B;  4H9O B;  1M1A D;  4J8X D;  5B0Z A;  5B1L D;  3AL0 C;  5E5A D;  3WTP C;  4H9P A;  2FJ7 A;  3MGQ D;  1P3O A;  3AZK A;  4H9S A;  3MNN C;  3AZE A;  5DNM B;  1B67 A;  5CPJ C;  5KDM B;  5C3I C;  2DF4 C;  4LD9 C;  4CAY B;  3LZ0 A;  3REI D;  3AV2 B;  5G49 A;  2YFV B;  4Z2M H;  3EPL A;  4H9Q B;  2YFW B;  3LZ0 D;  3UT9 B;  5GT0 B;  3B0D C;  3KWQ D;  2Y2M A;  2Y2N A;  1P3O C;  4YM6 D;  3AV1 D;  3WTP A;  2XD1 A;  1AOI D;  1F66 B;  5B31 D;  3LZ1 A;  3O62 A;  3LEL D;  2ARO D;  1P3P B;  5AV5 B;  3B6G A;  3WAA B;  3AZI A;  4HGA B;  4J8V A;  5B1M A;  1M18 A;  3LZ1 D;  2CV5 A;  3LZ0 C;  3B6G D;  5B32 D;  5B1L B;  1S32 C;  3W96 A;  1TAF B;  4WU9 C;  5JRG D;  5FUG B;  3AN2 D;  3X1T B;  5B0Z C;  1M18 D;  5DNN B;  1ID3 B;  2CV5 D;  2HUE B;  3H0R C;  3REI B;  2HUE C;  5BT1 C;  4KUD B;  3AZM D;  3P5J B;  5AV9 A;  1BFM A;  3MGR B;  5B0Z D;  3A6N B;  1M18 C;  5JRG C;  3AN2 C;  2Y2L A;  1EQZ D;  3X1T D;  4J8X C;  2G5H C;  3KXB A;  1N1J A;  5CPI B;  4DQY B;  1HQ3 B;  2BYK A;  4Z66 B;  3MVD D;  5AV6 C;  1EQZ A;  1KX3 C;  4J8X A;  1R4V A;  1HQ3 C;  4Z66 C;  3C1C B;  3LEL B;  4ZBJ C;  4G91 C;  1JFI B;  3REJ C;  5F99 B;  2DQN C;  3X1S B;  4E44 A;  3KSY A;  5CPK D;  1P3G B;  5B0Y C;  1AOI B;  1F66 D;  3REK A;  3LJA C;  3AZK D;  4WU8 D;  1P34 D;  1ULY A;  3H0M C;  5CHL B;  3X1U B;  2RVQ D;  5B33 B;  2BYM A;  3UTB A;  5AV9 C;  1P3G C;  1B6W A;  1KX4 B;  4YM6 B;  3X1V C;  3W99 B;  3AYW B;  4R8P B;  3NQJ A;  5GSU B;  2RIQ A;  4Z2M G;  4QLC A;  3C1C C;  4J8V D;  4H9N B;  3REJ B;  1P3M D;  2Y2H A;  5CPI C;  3UTA B;  5BNX B;  5B0Y B;  3VH5 W;  4QLC D;  3UT9 C;  3AV1 A;  5AV6 B;  2NQB A;  1KX4 C;  5E5A C;  4J8W A;  1P3I B;  3AYW C;  5B31 A;  1KX5 B;  4NE6 A;  5E5A B;  2ARO A;  3R45 B;  2PYO B;  3AFA A;  4AWL C;  3UTB C;  3F6T A;  1ZLA D;  4ZUX B;  1P3L C;  5B2J B;  5B32 A;  3AZJ C;  3AFA D;  5AY8 A;  3MGS C;  5B2I D;  1P3B B;  4KGC D;  1BH8 A;  2ZY4 A;  2CWE A;  5DNN C;  4Z5T A;  2F8N G;  3KXB D;  5CPJ B;  4X23 C;  3W98 A;  5CP6 A;  4YS3 A;  3B0C T;  2Y2Q A;  3UTA C;  3C1B A;  3VH6 W;  5GT3 A;  5BNV A;  4KUD C;  2NZD B;  4XUJ A;  5GSU D;  2JSS A;  1P3F B;  1P3L A;  5GT0 C;  3KFU G;  4LD9 A;  5BO0 B;  4XZQ A;  1S32 A;  3AZN C;  3REK D;  3W99 D;  4JJN B;  1M1A A;  5B2I B;  1P3B D;  1Q9C A;  3W97 B;  5AVC C;  5AVB B;  5CPK B;  4XZQ D;  3MGQ A;  5B2J C;  4WU9 B;  5B32 G;  5B24 C;  3MGP C;  1P3A C;  3MGS B;  3AZF A;  3AZH A;  1P3F D;  4WU8 A;  1BH9 A;  1P34 A;  3REK C;  3X1S C;  3UTB D;  3AZF D;  5GXQ A;  5JA4 A;  4XUJ C;  5B33 C;  4WJ3 C;  4H9R A;  1TZY C;  3REH D;  3AZN A;  3WA9 B;  5AVB C;  1P3M B;  3B6F C;  3REH B;  1M19 D;  5B24 B;  3MGP B;  1P3A B;  3A1I A;  4KHA A;  2Y2G A;  3C1B C;  3V9R B;  5AVC B;  2ZY5 A;  2FJ7 C;  3AZF C;  1M19 B;  4R8P D;  3TU4 C;  1P3K B;  5AY8 D;  3EPJ A;  3A1K A;  4J8W D;  3AZH C;  3AZL B;  2VQR A;  4KGC B;  1ZLA C;  3TU4 B;  2F8N A;  5AVC D;  3LJA B;  3WKJ C;  2F8N B;  4KGC A;  1P3I C;  5GXQ C;  3AZL A;  1P3G D;  3W99 C;  5B24 D;  3FDD A;  3MGP D;  1P3A D;  3W98 D;  5AVC A;  3WKJ A;  4G92 C;  3V9R A;  3AZL D;  1HQ3 D;  4Z66 D;  4KHA B;  3MVD B;  5B24 A;  1TZY B;  3MGP A;  1P3A A;  3KUY A;  3B6F B;  3B0B A;  3WA9 A;  3B6F D;  5GSU C;  5AVB D;  3B0C W;  4H9R B;  1TZY D;  5CP6 D;  4YS3 D;  3W98 C;  3MGR D;  3KUY C;  5GXQ B;  3IP4 C;  4ZBJ B;  3MGS D;  3B6F A;  1M19 C;  3KUY B;  2L5A A;  1TZY A;  1P3L D;  3AZH B;  3AZL C;  2NZD C;  4KGC C;  3MVD A;  3AZH D;  3WKJ B;  5AY8 C;  3MGS A;  4WU9 A;  2Y2K A;  5GXQ D;  4JJN C;  5CPK A;  5BS7 C;  1P3K D;  3W97 C;  2PYO D;  2Y2I A;  3LJA A;  3TU4 A;  2NZD D;  5BO0 A;  5C3I B;  4LD9 B;  1P3K A;  5GT3 C;  1P3L B;  1P3F A;  3WTP E;  1M19 A;  2NZD A;  5BNV B;  2XD5 A;  5GT3 B;  2F8N K;  3W98 B;  1P3B C;  2UWX A;  3REH A;  3AZN D;  4Z5T B;  5BT1 D;  1P3M A;  5GT0 D;  1BH8 B;  3AZN B;  4ZUX D;  5B2I C;  4M6B A;  4H9S C;  5AY8 B;  5JA4 B;  3WAA C;  5B32 B;  5CPK C;  1P3F C;  4ZUX A;  3WKJ D;  1BH9 B;  4WU8 B;  1P34 B;  1P3I D;  5AV6 D;  2RVQ C;  3AZF B;  3W97 D;  2ARO B;  2F8N D;  1P3K C;  1KX5 A;  4JJN D;  1P3I A;  3REJ D;  4E45 A;  3MGQ B;  5AVB A;  5AV6 A;  3W97 A;  5B2I A;  1M1A B;  4JJN A;  4UPK A;  3REJ A;  5B31 G;  5B1L C;  4XZQ B;  1S32 B;  1P3M C;  1W2E A;  3MGR C;  3KUY D;  4XUJ B;  5CP6 C;  4YS3 C;  3C1B D;  5GT3 D;  2HIO D;  4XUJ D;  3C1B B;  5CP6 B;  3NQJ B;  5GSU A;  3KXB C;  4YS3 B;  5CPI D;  5CPJ A;  3AYW A;  4LD9 D;  3REH C;  4EO5 B;  1KX4 A;  3W99 A;  1P3B A;  5B33 A;  3X1U A;  4WV4 B;  3REK B;  2CV5 C;  3AYW D;  4DRB A;  2BG1 A;  1JFI A;  1KX4 D;  3C1C A;  5B2J A;  4J8X B;  1T3U A;  3LZ1 C;  3B6G C;  3AFA B;  3WAA D;  2PYO A;  3R45 A;  3C1C D;  4J8V C;  5E5A A;  5B2J D;  4J8W C;  3KXB B;  1U35 C;  5B31 B;  4R8P C;  3TU4 D;  3EPH A;  1WWI A;  2FJ7 D;  3LEL C;  4J8W B;  2ZM5 A;  5F99 C;  2NQB B;  3AV1 B;  3AZE D;  5BNX A;  2Y2O A;  5B0Y A;  2Y2J A;  3UTA A;  4X23 D;  5AV9 B;  4H9N A;  4KUD A;  4EO5 C;  3KWQ C;  4QLC B;  3REI A;  3UTA D;  5BS7 A;  5DNN A;  3AZJ D;  5DNM C;  4R8P A;  1TAF A;  1WWS A;  3W96 B;  2PYO C;  4YM6 A;  3AZM C;  2BYM B;  3UTB B;  3WTP D;  2Y2P A;  2W8S A;  5B1M B;  1P3G A;  1AOI A;  4WZS B;  4J8V B;  3X1S A;  5F99 A;  2JE5 A;  3AZI B;  3O62 D;  3LEL A;  1P3P A;  3AZI D;  3VH6 T;  4DRA A;  3EPK A;  4QLC C;  1KX5 C;  3UT9 D;  2LY8 A;  5B1M D;  1EQZ B;  1HQ3 A;  2BYK B;  4Z66 A;  4AWL B;  3WTP B;  5CPI A;  1N1J B;  3W96 D;  3UT9 A;  2YFW A;  4H9Q A;  3WA9 D;  5AV5 C;  5B33 D;  2YFV A;  3A6N A;  3MGR A;  5G49 B;  3B0D B;  3LZ0 B;  4CAY A;  3AV2 A;  3X1V D;  4NE3 A;  4Z5T C;  5CPJ D;  3AV2 D;  3X1U D;  3AZG C;  4WU9 D;  1P3P C;  1ID3 A;  3X1T A;  1P3O B;  5FUG A;  4HGA C;  1KX3 D;  5B32 C;  2ZY2 A;  5B1L A;  2CV5 B;  3LJA D;  5AV8 D;  4WU8 C;  1P34 C;  5B0Y D;  1F66 C;  3MNN B;  3AZG A;  1U35 D;  1Z2C B;  3A6N C;  4X23 A;  1M18 B;  1P3O D;  1M1A C;  1ID3 D;  3NQU A;  1H3O A;  2ARO C;  4KUD D;  3WAA A;  5AV5 A;  3O62 B;  3LZ1 B;  3B6G B;  3MGQ C;  3AZG D;  1F66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...