4H9RA

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9rA00
2HIOD 4J8UA 1P3MC 1M19A 4WU8D 1P3LB 5AY8D 1AOIA 3REIC 4J8VC 3B6FA 2RVQC 3MNNC 4H9RB 4R8PC 1U35D 1P3MB 1ZLAA 4Z2MG 1BH9B 4CAYB 3LELD 4J8VB 3REIB 3AZGA 3MNNB 4R8PB 1N1JA 3W96D 3WKJA 2YFVA 3REKB 3AZKC 5B2JA 5CP6B 4AWLC 3UT9D 5GSUA 4G91C 3UTBD 2CWEA 1JFIB 2FJ7C 1ID3D 1P3AA 3AZKB 4JJNC 5BT1C 5DNMC 4G91B 4XUJC 5CPKD 2FJ7B 1WWSA 4JJNB 1P3OD 1TZYC 5DNMB 3AZJC 4DRAA 4XUJB 5CPJC 4J8WA 5GT0D 3AZID 1P3BA 1TZYB 1KX4C 3AZJB 1KX3D 3REJC 3X1TD 5B1MA 5CPJB 3LZ1C 3MGPC 4KGCC 5B33D 5AVBD 1KX4B 4H9RA 3KWQD 4YM6D 3VH6T 3REJB 5B0ZD 3AYWD 3LZ1B 4KGCB 4CAYA 4J8VA 2BYKB 5AVCA 3REIA 1WWIA 3MNNA 3O62D 4R8PA 3AV2C 3W99C 1P3GC 2PYOC 4UUZB 3MGSA 5FUGA 5GXQC 5AV8C 4J8UD 1JFIA 4X23B 3AV2B 3W99B 2AROC 1M19D 1P3GB 1AOID 3B6FD 3WA9A 5GXQB 5AV8B 3KUYC 1ZLAD 2FJ7A 2AROB 3REHC 5B32C 2NQBB 4XUJA 3KUYB 3WKJD 5E5AD 3REHB 5B32B 3AV1A 1TZYA 3AZJA 4ZUXD 5GSUD 4HGAC 5JRGC 1P3AD 3REJA 4KUDC 4HGAB 3X1UC 5JRGB 2YFWB 2LY8A 3LZ1A 3MGPA 4KGCA 5B40C 5AV5A 5BO0B 4KUDB 5BNVB 3X1UB 3RELC 1M18C 4H9QB 4UUZA 4QLCC 4J8WD 5B1LC 1P3BD 5B40B 4H9NB 3W99A 3RELB 1P3GA 1M18B 2PYOA 4QLCB 5B1LB 3UTAA 3W97C 4YS3C 1KX5C 1P3MD 2AROA 4G92C 1P3IC 3REID 4J8VD 2RVQD 3W97B 3MNND 1HTAA 4YS3B 1KX5B 4R8PD 5BNXA 4E44A 5AV6B 3V9RA 5B32A 4G92B 3REHA 3AZFC 1P3IB 2JSSA 4J8XB 1ULYA 5GT0A 3AZIA 5G49A 3AZFB 1KX3A 5F99C 5B33A 5B0YC 3WTPC 4WV4B 2FJ7D 5BT1D 5F99B 1F66C 5BO0A 5B0YB 3R45B 4KUDA 3WTPB 4XUJD 5BNVA 3X1UA 3O62A 1P34C 4XZQC 1F66B 1TZYD 4CSRA 3AZJD 3MVDC 1P34B 3NQJA 4QLCA 2F8NH 4XZQB 3AZLC 3AFAC 1P3LC 3MVDB 3REJD 2BYMB 3LZ1D 3MGPD 4KGCD 3W97A 3AZLB 3AFAB 3REKC 4YS3A 5B32G 5AV5D 1P3IA 3C1BC 5CP6C 3LZ0C 5E5AA 4LD9C 3NQUA 2NZDC 3AV2D 3W99D 4ZUXA 3C1BB 3AZNC 3AZFA 1P3GD 2PYOD 3LZ0B 5JA4B 4LD9B 3UTAD 4Z5TC 5BS7C 2NZDB 3AZNB 2AROD 3MGRA 5F99A 4Z5TB 4NE6A 5B0YA 3KXBB 3X1SC 3W98C 3REHD 5B32D 2F8NB 3WTPE 3LJAC 3AZEC 3MGQC 1P34A 3X1SB 3W98B 3LJAB 3AZEB 1P3LA 5CPIC 3MGQB 2BYMA 5JRGD 1P3MA 5KDMB 3AFAA 3TU4C 1BH9A 5C3IC 5CPIB 3VH5A 3A6NC 4KUDD 3X1UD 4X23C 1H3OB 3REKA 3TU4B 5C3IB 4Z66C 3A6NB 5CP6A 3LZ0A 3AN2C 4QLCD 4NE3A 5JA4A 1S32C 4LD9A 2NZDA 4Z66B 3AZKA 3AZNA 4Z2MH 2HIOB 3AN2B 2NQBC 1P3FC 1S32B 3W97D 4WU8B 4NFTA 4YS3D 4JJNA 1KX5D 3WAAC 5DNMA 3AZMC 1P3ID 1P3FB 3W96C 1M1AC 3B6GC 3LELB 3X1SA 3AZMB 3WAAB 5DNNC 3AZFD 1M1AB 3W96B 3UTBC 3B6GB 3LJAA 5CPJA 1KX4A 5DNNB 5AV9C 3MGRD 3UTBB 5F99D 5CPIA 2BYKA 5B0YD 3WTPD 5AV9B 1H3OA 3TU4A 3A6NA 1P3OB 1A7WA 1P34D 4X23A 3AV2A 3X1TC 1P3LD 5GT3C 4H9OB 2CV5C 3AN2A 5GXQA 5AV8A 1S32A 2F8NK 5B0ZC 3X1TB 3AFAD 5AV6C 1P3PC 5GT3B 2CV5B 4J8XC 2NQBA 1P3FA 3KUYA 5B0ZB 3REKD 1P3PB 3WAAA 5CP6D 1BH8B 3LZ0D 4LD9D 1M19C 3VH5T 2NZDD 3AZKD 3B6FC 3AZND 5DNNA 1ZLAC 2YFWA 5JRGA 1M19B 4Z5TD 4NE5A 4JJND 3AZGC 3B6FB 5DNMD 3X1VC 1ZLAB 4H9QA 3AZGB 5B40A 4H9NA 3X1SD 3W98D 3X1VB 5B2JC 5B2IC 1N1JB 3RELA 1M18A 3LJAD 5CPJD 3AZED 1HQ3C 5B1LA 1P3AC 3VH6W 1KX4D 5B2JB 5B2IB 5CPID 1HQ3B 5GT3A 1P3AB 2CV5A 1KX5A 5AV6A 3TU4D 1P3PA 3A6ND 4J8XA 4X23D 5B1MC 4Z66D 5B31C 3KXBC 5GXQD 5AV8D 3AN2D 1S32D 1P3KC 5B1MB 5AVCC 5B24C 5B31B 2NQBD 3R45A 1P3FD 3WTPA 1P3KB 3KUYD 3KSYA 1F66A 5AVCB 5B24B 3AZMD 3AZHC 3MGSC 3C1CC 3X1VA 3WAAD 1M1AD 3B6GD 4H9PB 2IO5C 4XZQA 4WU9C 3AZHB 3MGSB 3C1CB 5FUGB 3MVDA 5DNND 5B2IA 3WA9C 2IO5B 1HQ3A 3AZLA 4WU9B 1EQZC 5AV9D 4AWLB 4M6BA 3WA9B 3AV1C 5B40D 1EQZB 3B0CT 3C1BA 3RELD 2HIOC 1M18D 3AV1B 4WNNB 5B1LD 3B0BA 4WU8C 5AY8C 5GT3D 1U35C 4KHAB 4Z5TA 5B31A 2CV5D 5BS7A 3KXBA 5AV5C 5AY8B 3LELC 1P3KA 5AV6D 3MGPB 2F8NA 1P3PD 1U35B 5B24A 2HUEC 4J8XD 3B0DC 5AV5B 3VH5W 3W98A 4H9PA 3UT9C 1B6WA 3AZHA 2HUEB 3C1CA 1F1EA 3B0DB 3UTAC 3AZEA 1ID3C 3MGQA 1TAFB 2PYOB 5KDMA 3UT9B 4EO5C 4WU9A 3WKJB 5CPKC 3UTAB 4ZBJC 1ID3B 1P3OC 4EO5B 3AZGD 5CPKB 1F66D 1EQZA 4ZBJB 1Q9CA 3X1VD 5GT0C 3AZIC 5BNXB 3V9RB 4WNNA 1KX3C 1R4VA 4XZQD 4Z66A 5B2JD 5GT0B 3MVDD 5B2ID 5AVBC 5B33C 3AZIB 5G49B 2HIOA 4H9SC 5B31G 3KWQC 4YM6C 1HQ3D 1KX3B 4KHAA 3AZLD 4WU8A 3AYWC 4WZSB 5AY8A 2F8NG 5B33B 5AVBB 3O62C 3KWQB 4YM6B 1U35A 3AYWB 3LELA 3AZMA 3O62B 3C1BD 1BFMA 3W96A 1M1AA 4J8UC 3B6GA 4CSRB 1AOIC 1TAFA 3NQJB 5B1MD 4J8UB 3UT9A 3UTBA 1ID3A 5B31D 3KXBD 1AOIB 1P3KD 2L5AA 5AV9A 2F8ND 1B67A 4E45A 5CPKA 5AVCD 3WKJC 5B24D 5E5AC 1P3OA 4ZUXC 3VH6A 1KU5A 2YFVB 5E5AB 4DRBA 5GSUC 3NQUB 3MGSD 3C1CD 3AZHD 3MGQD 4H9OA 4ZUXB 3MGRC 3X1TA 5CHLB 5GSUB 4WU9D 3WA9D 5AVBA 4H9SA 3KWQA 4YM6A 5B0ZA 3MGRB 3AYWA 3B0CW 1EQZD 4J8WC 1P3BC 3AV1D 1BH8A 4J8WB 1P3BB
chains in the Genus database with same CATH superfamily
2RIQA 2HIOD 4J8UA 1P3MC 1M19A 4WU8D 1P3LB 5AY8D 1AOIA 3REIC 4J8VC 3B6FA 2RVQC 3MNNC 4H9RB 4R8PC 1U35D 1P3MB 1ZLAA 4Z2MG 1BH9B 4CAYB 3LELD 4J8VB 3REIB 3AZGA 3KFUG 3MNNB 4R8PB 1N1JA 3W96D 3WKJA 2YFVA 3REKB 3AZKC 5B2JA 2Y2LA 5CP6B 4AWLC 3FDDA 3UT9D 5GSUA 4G91C 3UTBD 2CWEA 1JFIB 2FJ7C 1ID3D 1P3AA 3AZKB 2ZM5A 4JJNC 5BT1C 5DNMC 4G91B 4XUJC 5CPKD 2FJ7B 1WWSA 4JJNB 1P3OD 1TZYC 5DNMB 3AZJC 4DRAA 4XUJB 5CPJC 4J8WA 5GT0D 3AZID 1P3BA 1TZYB 1KX4C 3AZJB 1KX3D 3REJC 3X1TD 5B1MA 5CPJB 3LZ1C 3MGPC 4KGCC 5B33D 5AVBD 1KX4B 4H9RA 3KWQD 4YM6D 3VH6T 3REJB 5B0ZD 3AYWD 3LZ1B 4KGCB 4CAYA 4J8VA 2BYKB 5AVCA 3REIA 1WWIA 3MNNA 3O62D 3H0MC 4R8PA 3AV2C 3W99C 1P3GC 2PYOC 4UUZB 3MGSA 5FUGA 5GXQC 5AV8C 4J8UD 1JFIA 4X23B 3AV2B 3W99B 2AROC 1M19D 1P3GB 1AOID 3B6FD 3WA9A 5GXQB 5AV8B 3KUYC 1ZLAD 2FJ7A 2AROB 3REHC 5B32C 2Y2JA 2NQBB 4XUJA 3KUYB 3WKJD 5E5AD 3REHB 5B32B 3AV1A 1TZYA 3AZJA 4ZUXD 5GSUD 4HGAC 5JRGC 2Y2HA 1P3AD 3REJA 4KUDC 4HGAB 2YFWB 5JRGB 2LY8A 2W8SA 3X1UC 3LZ1A 3MGPA 4KGCA 5B40C 5AV5A 5BO0B 4KUDB 5BNVB 3X1UB 3RELC 1M18C 4H9QB 4UUZA 4QLCC 4J8WD 5B1LC 1P3BD 5B40B 2ZY4A 4H9NB 3W99A 3RELB 1P3GA 1M18B 2PYOA 4QLCB 5B1LB 3UTAA 3W97C 4YS3C 1KX5C 1P3MD 2AROA 4G92C 1P3IC 3REID 4J8VD 2RVQD 3W97B 3MNND 1HTAA 4YS3B 1KX5B 4R8PD 5BNXA 4E44A 5AV6B 3V9RA 5B32A 4G92B 3REHA 3AZFC 1P3IB 2JSSA 4J8XB 1ULYA 5GT0A 3AZIA 5G49A 3AZFB 1KX3A 5F99C 2BG1A 5B33A 5B0YC 3WTPC 4WV4B 2FJ7D 5BT1D 5F99B 1F66C 5BO0A 5B0YB 3R45B 4KUDA 3WTPB 4XUJD 5BNVA 3X1UA 3O62A 1P34C 3EG5B 4XZQC 1F66B 1TZYD 4CSRA 3AZJD 3MVDC 4WJ3C 1P34B 3NQJA 4QLCA 2F8NH 4XZQB 3AZLC 3AFAC 1P3LC 3MVDB 2Y2NA 3REJD 2BYMB 3IP4C 3LZ1D 3MGPD 4KGCD 3W97A 3AZLB 3AFAB 3REKC 4YS3A 5B32G 5AV5D 1P3IA 3C1BC 5CP6C 3LZ0C 5E5AA 4LD9C 3NQUA 2NZDC 2JE5A 3W99D 4ZUXA 3C1BB 3AZNC 3AZFA 2XD1A 3AV2D 3LZ0B 1P3GD 2PYOD 5JA4B 4LD9B 3UTAD 4Z5TC 5BS7C 2NZDB 3AZNB 2AROD 3MGRA 3EPKA 5F99A 4Z5TB 4NE6A 5B0YA 3KXBB 3X1SC 3W98C 3REHD 5B32D 2F8NB 3EPHA 3WTPE 2VQRA 3LJAC 3AZEC 3MGQC 1P34A 3X1SB 3W98B 3LJAB 3AZEB 1P3LA 5CPIC 3MGQB 2BYMA 5JRGD 1P3MA 5KDMB 3AFAA 3TU4C 1BH9A 5C3IC 5CPIB 3VH5A 3A6NC 4KUDD 3X1UD 2Y2KA 2Y2IA 4X23C 1H3OB 3REKA 3TU4B 5C3IB 4Z66C 3A6NB 5CP6A 3LZ0A 3AN2C 4QLCD 4NE3A 5JA4A 1S32C 4LD9A 2NZDA 4Z66B 3AZKA 3AZNA 4Z2MH 2HIOB 3AN2B 2NQBC 1P3FC 1S32B 3W97D 4WU8B 4NFTA 4YS3D 4JJNA 1KX5D 3WAAC 5DNMA 3AZMC 3AL0C 1P3ID 1P3FB 3W96C 1M1AC 3B6GC 3LELB 3X1SA 3AZMB 3WAAB 5DNNC 3AZFD 1M1AB 3W96B 3UTBC 3B6GB 3LJAA 5CPJA 1KX4A 5DNNB 5AV9C 3MGRD 3UTBB 5F99D 5CPIA 2BYKA 5B0YD 3WTPD 5AV9B 2J8PA 3P5JB 1H3OA 3TU4A 3A6NA 1P3OB 1A7WA 1P34D 4X23A 3AV2A 3X1TC 1P3LD 5GT3C 4H9OB 2CV5C 3EPJA 5GXQA 5AV8A 3AN2A 1S32A 2F8NK 5B0ZC 3X1TB 3AFAD 5AV6C 1P3PC 5GT3B 2CV5B 4J8XC 2NQBA 1P3FA 1T3UA 3KUYA 5B0ZB 3REKD 2Y2OA 1P3PB 3WAAA 2JCHA 5CP6D 1BH8B 3LZ0D 4LD9D 1M19C 3VH5T 2NZDD 3AZKD 3B6FC 3AZND 5DNNA 1ZLAC 2YFWA 5JRGA 1M19B 4Z5TD 4NE5A 4JJND 3AZGC 3B6FB 2ZY2A 5DNMD 3X1VC 1ZLAB 4H9QA 3AZGB 5B40A 4H9NA 2DF4C 3X1SD 3W98D 3X1VB 5B2JC 5B2IC 1N1JB 3RELA 1M18A 3LJAD 5CPJD 3AZED 1HQ3C 5B1LA 1P3AC 3VH6W 1KX4D 5B2JB 5B2IB 1W2EA 5CPID 1HQ3B 5GT3A 1P3AB 2CV5A 1KX5A 5AV6A 3TU4D 1P3PA 3A6ND 4J8XA 4X23D 5B1MC 4Z66D 5B31C 3KXBC 5GXQD 5AV8D 3AN2D 1S32D 1P3KC 5B1MB 5AVCC 5B24C 5B31B 2NQBD 3R45A 1P3FD 3WTPA 1P3KB 3KUYD 3KSYA 1F66A 5AVCB 5B24B 3AZMD 3AZHC 3MGSC 3C1CC 3X1VA 3WAAD 1M1AD 3B6GD 2ZY5A 4H9PB 2IO5C 4XZQA 3A1IA 3AZHB 3MGSB 3C1CB 4WU9C 5FUGB 1Z2CB 5DNND 5B2IA 3MVDA 3WA9C 2IO5B 1HQ3A 3AZLA 4WU9B 1EQZC 5AV9D 4AWLB 4M6BA 3WA9B 3AV1C 5B40D 1EQZB 2XD5A 3B0CT 3C1BA 3RELD 2HIOC 1M18D 3AV1B 4WNNB 5B1LD 3B0BA 4WU8C 5AY8C 5GT3D 1U35C 4KHAB 4Z5TA 5B31A 2CV5D 5BS7A 3KXBA 5AV5C 5AY8B 3LELC 1P3KA 2Y2PA 5AV6D 3MGPB 2F8NA 1P3PD 1U35B 5B24A 2HUEC 4J8XD 3B0DC 5AV5B 3VH5W 3W98A 4H9PA 3UT9C 1B6WA 2Y2QA 2HUEB 3C1CA 1F1EA 3B0DB 3UTAC 3AZEA 3AZHA 3MGQA 1ID3C 1TAFB 2PYOB 2Y2GA 5KDMA 3UT9B 4EO5C 4WU9A 3WKJB 5CPKC 3UTAB 4ZBJC 1ID3B 1P3OC 4EO5B 3AZGD 5CPKB 1F66D 1EQZA 4ZBJB 1Q9CA 3X1VD 5GT0C 3AZIC 5BNXB 2Y2MA 3V9RB 4WNNA 1KX3C 1R4VA 4XZQD 4Z66A 2ZY3A 5GT0B 5B2JD 5B2ID 5AVBC 3MVDD 5B33C 5G49B 2HIOA 3AZIB 4H9SC 5B31G 3KWQC 4YM6C 1HQ3D 1KX3B 4KHAA 3AZLD 4WU8A 3H0LC 4WZSB 3AYWC 5AY8A 2F8NG 5B33B 5AVBB 3O62C 3KWQB 3A1KA 4YM6B 1U35A 3AYWB 1PZRA 3LELA 2G5HC 4DQYB 3AZMA 3O62B 3EPLA 3C1BD 1BFMA 3W96A 1M1AA 4J8UC 3B6GA 3F6TA 4CSRB 1AOIC 1TAFA 3NQJB 4UPKA 5B1MD 2G5IC 4J8UB 3UT9A 2F2AC 3UTBA 1ID3A 5B31D 3KXBD 1AOIB 1P3KD 2L5AA 5AV9A 2F8ND 1B67A 4E45A 5CPKA 5AVCD 3WKJC 5B24D 5E5AC 1P3OA 4ZUXC 5GSUC 3VH6A 1KU5A 2YFVB 5E5AB 4DRBA 3NQUB 3MGSD 3C1CD 3AZHD 3MGQD 4H9OA 2DQNC 4ZUXB 3MGRC 3X1TA 5CHLB 5GSUB 4WU9D 3WA9D 5AVBA 4H9SA 3KWQA 4YM6A 5B0ZA 3MGRB 3AYWA 3B0CW 1EQZD 2UWXA 4J8WC 1P3BC 3AV1D 1BH8A 3H0RC 2FFFB 4J8WB 1P3BB
chains in the Genus database with same CATH topology
2RIQA 2HIOD 4J8UA 1P3MC 1M19A 4WU8D 1P3LB 5AY8D 1AOIA 3REIC 4J8VC 3B6FA 2RVQC 3MNNC 4H9RB 4R8PC 1U35D 1P3MB 1ZLAA 4Z2MG 1BH9B 4CAYB 3LELD 4J8VB 3REIB 3AZGA 3KFUG 3MNNB 4R8PB 1N1JA 3W96D 3WKJA 2YFVA 3REKB 3AZKC 5B2JA 2Y2LA 5CP6B 4AWLC 3FDDA 3UT9D 5GSUA 4G91C 3UTBD 2CWEA 1JFIB 2FJ7C 1ID3D 1P3AA 3AZKB 2ZM5A 4JJNC 5BT1C 5DNMC 4G91B 4XUJC 5CPKD 2FJ7B 1WWSA 4JJNB 1P3OD 1TZYC 5DNMB 3AZJC 4DRAA 4XUJB 5CPJC 4J8WA 5GT0D 3AZID 1P3BA 1TZYB 1KX4C 3AZJB 1KX3D 3REJC 3X1TD 5B1MA 5CPJB 3LZ1C 3MGPC 4KGCC 5B33D 5AVBD 1KX4B 4H9RA 3KWQD 4YM6D 3VH6T 3REJB 5B0ZD 3AYWD 3LZ1B 4KGCB 4CAYA 4J8VA 2BYKB 5AVCA 3REIA 1WWIA 3MNNA 3O62D 3H0MC 4R8PA 3AV2C 3W99C 1P3GC 2PYOC 4UUZB 3MGSA 5FUGA 5GXQC 5AV8C 4J8UD 1JFIA 4X23B 3AV2B 3W99B 2AROC 1M19D 1P3GB 1AOID 3B6FD 3WA9A 5GXQB 5AV8B 3KUYC 1ZLAD 2FJ7A 2AROB 3REHC 5B32C 2Y2JA 2NQBB 4XUJA 3KUYB 3WKJD 5E5AD 3REHB 5B32B 3AV1A 1TZYA 3AZJA 4ZUXD 5GSUD 4HGAC 5JRGC 2Y2HA 1P3AD 3REJA 4KUDC 4HGAB 2YFWB 5JRGB 2LY8A 2W8SA 3X1UC 3LZ1A 3MGPA 4KGCA 5B40C 5AV5A 5BO0B 4KUDB 5BNVB 3X1UB 3RELC 1M18C 4H9QB 4UUZA 4QLCC 4J8WD 5B1LC 1P3BD 5B40B 2ZY4A 4H9NB 3W99A 3RELB 1P3GA 1M18B 2PYOA 4QLCB 5B1LB 3UTAA 3W97C 4YS3C 1KX5C 1P3MD 2AROA 4G92C 1P3IC 3REID 4J8VD 2RVQD 3W97B 3MNND 1HTAA 4YS3B 1KX5B 4R8PD 5BNXA 4E44A 5AV6B 3V9RA 5B32A 4G92B 3REHA 3AZFC 1P3IB 2JSSA 4J8XB 1ULYA 5GT0A 3AZIA 5G49A 3AZFB 1KX3A 5F99C 2BG1A 5B33A 5B0YC 3WTPC 4WV4B 2FJ7D 5BT1D 5F99B 1F66C 5BO0A 5B0YB 3R45B 4KUDA 3WTPB 4XUJD 5BNVA 3X1UA 3O62A 1P34C 3EG5B 4XZQC 1F66B 1TZYD 4CSRA 3AZJD 3MVDC 4WJ3C 1P34B 3NQJA 4QLCA 2F8NH 4XZQB 3AZLC 3AFAC 1P3LC 3MVDB 2Y2NA 3REJD 2BYMB 3IP4C 3LZ1D 3MGPD 4KGCD 3W97A 3AZLB 3AFAB 3REKC 4YS3A 5B32G 5AV5D 1P3IA 3C1BC 5CP6C 3LZ0C 5E5AA 4LD9C 3NQUA 2NZDC 2JE5A 3W99D 4ZUXA 3C1BB 3AZNC 3AZFA 2XD1A 3AV2D 3LZ0B 1P3GD 2PYOD 5JA4B 4LD9B 3UTAD 4Z5TC 5BS7C 2NZDB 3AZNB 2AROD 3MGRA 3EPKA 5F99A 4Z5TB 4NE6A 5B0YA 3KXBB 3X1SC 3W98C 3REHD 5B32D 2F8NB 3EPHA 3WTPE 2VQRA 3LJAC 3AZEC 3MGQC 1P34A 3X1SB 3W98B 3LJAB 3AZEB 1P3LA 5CPIC 3MGQB 2BYMA 5JRGD 1P3MA 5KDMB 3AFAA 3TU4C 1BH9A 5C3IC 5CPIB 3VH5A 3A6NC 4KUDD 3X1UD 2Y2KA 2Y2IA 4X23C 1H3OB 3REKA 3TU4B 5C3IB 4Z66C 3A6NB 5CP6A 3LZ0A 3AN2C 4QLCD 4NE3A 5JA4A 1S32C 4LD9A 2NZDA 4Z66B 3AZKA 3AZNA 4Z2MH 2HIOB 3AN2B 2NQBC 1P3FC 1S32B 3W97D 4WU8B 4NFTA 4YS3D 4JJNA 1KX5D 3WAAC 5DNMA 3AZMC 3AL0C 1P3ID 1P3FB 3W96C 1M1AC 3B6GC 3LELB 3X1SA 3AZMB 3WAAB 5DNNC 3AZFD 1M1AB 3W96B 3UTBC 3B6GB 3LJAA 5CPJA 1KX4A 5DNNB 5AV9C 3MGRD 3UTBB 5F99D 5CPIA 2BYKA 5B0YD 3WTPD 5AV9B 2J8PA 3P5JB 1H3OA 3TU4A 3A6NA 1P3OB 1A7WA 1P34D 4X23A 3AV2A 3X1TC 1P3LD 5GT3C 4H9OB 2CV5C 3EPJA 5GXQA 5AV8A 3AN2A 1S32A 2F8NK 5B0ZC 3X1TB 3AFAD 5AV6C 1P3PC 5GT3B 2CV5B 4J8XC 2NQBA 1P3FA 1T3UA 3KUYA 5B0ZB 3REKD 2Y2OA 1P3PB 3WAAA 2JCHA 5CP6D 1BH8B 3LZ0D 4LD9D 1M19C 3VH5T 2NZDD 3AZKD 3B6FC 3AZND 5DNNA 1ZLAC 2YFWA 5JRGA 1M19B 4Z5TD 4NE5A 4JJND 3AZGC 3B6FB 2ZY2A 5DNMD 3X1VC 1ZLAB 4H9QA 3AZGB 5B40A 4H9NA 2DF4C 3X1SD 3W98D 3X1VB 5B2JC 5B2IC 1N1JB 3RELA 1M18A 3LJAD 5CPJD 3AZED 1HQ3C 5B1LA 1P3AC 3VH6W 1KX4D 5B2JB 5B2IB 1W2EA 5CPID 1HQ3B 5GT3A 1P3AB 2CV5A 1KX5A 5AV6A 3TU4D 1P3PA 3A6ND 4J8XA 4X23D 5B1MC 4Z66D 5B31C 3KXBC 5GXQD 5AV8D 3AN2D 1S32D 1P3KC 5B1MB 5AVCC 5B24C 5B31B 2NQBD 3R45A 1P3FD 3WTPA 1P3KB 3KUYD 3KSYA 1F66A 5AVCB 5B24B 3AZMD 3AZHC 3MGSC 3C1CC 3X1VA 3WAAD 1M1AD 3B6GD 2ZY5A 4H9PB 2IO5C 4XZQA 3A1IA 3AZHB 3MGSB 3C1CB 4WU9C 5FUGB 1Z2CB 5DNND 5B2IA 3MVDA 3WA9C 2IO5B 1HQ3A 3AZLA 4WU9B 1EQZC 5AV9D 4AWLB 4M6BA 3WA9B 3AV1C 5B40D 1EQZB 2XD5A 3B0CT 3C1BA 3RELD 2HIOC 1M18D 3AV1B 4WNNB 5B1LD 3B0BA 4WU8C 5AY8C 5GT3D 1U35C 4KHAB 4Z5TA 5B31A 2CV5D 5BS7A 3KXBA 5AV5C 5AY8B 3LELC 1P3KA 2Y2PA 5AV6D 3MGPB 2F8NA 1P3PD 1U35B 5B24A 2HUEC 4J8XD 3B0DC 5AV5B 3VH5W 3W98A 4H9PA 3UT9C 1B6WA 2Y2QA 2HUEB 3C1CA 1F1EA 3B0DB 3UTAC 3AZEA 3AZHA 3MGQA 1ID3C 1TAFB 2PYOB 2Y2GA 5KDMA 3UT9B 4EO5C 4WU9A 3WKJB 5CPKC 3UTAB 4ZBJC 1ID3B 1P3OC 4EO5B 3AZGD 5CPKB 1F66D 1EQZA 4ZBJB 1Q9CA 3X1VD 5GT0C 3AZIC 5BNXB 2Y2MA 3V9RB 4WNNA 1KX3C 1R4VA 4XZQD 4Z66A 2ZY3A 5GT0B 5B2JD 5B2ID 5AVBC 3MVDD 5B33C 5G49B 2HIOA 3AZIB 4H9SC 5B31G 3KWQC 4YM6C 1HQ3D 1KX3B 4KHAA 3AZLD 4WU8A 3H0LC 4WZSB 3AYWC 5AY8A 2F8NG 5B33B 5AVBB 3O62C 3KWQB 3A1KA 4YM6B 1U35A 3AYWB 1PZRA 3LELA 2G5HC 4DQYB 3AZMA 3O62B 3EPLA 3C1BD 1BFMA 3W96A 1M1AA 4J8UC 3B6GA 3F6TA 4CSRB 1AOIC 1TAFA 3NQJB 4UPKA 5B1MD 2G5IC 4J8UB 3UT9A 2F2AC 3UTBA 1ID3A 5B31D 3KXBD 1AOIB 1P3KD 2L5AA 5AV9A 2F8ND 1B67A 4E45A 5CPKA 5AVCD 3WKJC 5B24D 5E5AC 1P3OA 4ZUXC 5GSUC 3VH6A 1KU5A 2YFVB 5E5AB 4DRBA 3NQUB 3MGSD 3C1CD 3AZHD 3MGQD 4H9OA 2DQNC 4ZUXB 3MGRC 3X1TA 5CHLB 5GSUB 4WU9D 3WA9D 5AVBA 4H9SA 3KWQA 4YM6A 5B0ZA 3MGRB 3AYWA 3B0CW 1EQZD 2UWXA 4J8WC 1P3BC 3AV1D 1BH8A 3H0RC 2FFFB 4J8WB 1P3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO D;  4J8U A;  1P3M C;  1M19 A;  4WU8 D;  1P3L B;  5AY8 D;  1AOI A;  3REI C;  4J8V C;  3B6F A;  2RVQ C;  3MNN C;  4H9R B;  4R8P C;  1U35 D;  1P3M B;  1ZLA A;  4Z2M G;  1BH9 B;  4CAY B;  3LEL D;  4J8V B;  3REI B;  3AZG A;  3MNN B;  4R8P B;  1N1J A;  3W96 D;  3WKJ A;  2YFV A;  3REK B;  3AZK C;  5B2J A;  5CP6 B;  4AWL C;  3UT9 D;  5GSU A;  4G91 C;  3UTB D;  2CWE A;  1JFI B;  2FJ7 C;  1ID3 D;  1P3A A;  3AZK B;  4JJN C;  5BT1 C;  5DNM C;  4G91 B;  4XUJ C;  5CPK D;  2FJ7 B;  1WWS A;  4JJN B;  1P3O D;  1TZY C;  5DNM B;  3AZJ C;  4DRA A;  4XUJ B;  5CPJ C;  4J8W A;  5GT0 D;  3AZI D;  1P3B A;  1TZY B;  1KX4 C;  3AZJ B;  1KX3 D;  3REJ C;  3X1T D;  5B1M A;  5CPJ B;  3LZ1 C;  3MGP C;  4KGC C;  5B33 D;  5AVB D;  1KX4 B;  4H9R A;  3KWQ D;  4YM6 D;  3VH6 T;  3REJ B;  5B0Z D;  3AYW D;  3LZ1 B;  4KGC B;  4CAY A;  4J8V A;  2BYK B;  5AVC A;  3REI A;  1WWI A;  3MNN A;  3O62 D;  4R8P A;  3AV2 C;  3W99 C;  1P3G C;  2PYO C;  4UUZ B;  3MGS A;  5FUG A;  5GXQ C;  5AV8 C;  4J8U D;  1JFI A;  4X23 B;  3AV2 B;  3W99 B;  2ARO C;  1M19 D;  1P3G B;  1AOI D;  3B6F D;  3WA9 A;  5GXQ B;  5AV8 B;  3KUY C;  1ZLA D;  2FJ7 A;  2ARO B;  3REH C;  5B32 C;  2NQB B;  4XUJ A;  3KUY B;  3WKJ D;  5E5A D;  3REH B;  5B32 B;  3AV1 A;  1TZY A;  3AZJ A;  4ZUX D;  5GSU D;  4HGA C;  5JRG C;  1P3A D;  3REJ A;  4KUD C;  4HGA B;  3X1U C;  5JRG B;  2YFW B;  2LY8 A;  3LZ1 A;  3MGP A;  4KGC A;  5B40 C;  5AV5 A;  5BO0 B;  4KUD B;  5BNV B;  3X1U B;  3REL C;  1M18 C;  4H9Q B;  4UUZ A;  4QLC C;  4J8W D;  5B1L C;  1P3B D;  5B40 B;  4H9N B;  3W99 A;  3REL B;  1P3G A;  1M18 B;  2PYO A;  4QLC B;  5B1L B;  3UTA A;  3W97 C;  4YS3 C;  1KX5 C;  1P3M D;  2ARO A;  4G92 C;  1P3I C;  3REI D;  4J8V D;  2RVQ D;  3W97 B;  3MNN D;  1HTA A;  4YS3 B;  1KX5 B;  4R8P D;  5BNX A;  4E44 A;  5AV6 B;  3V9R A;  5B32 A;  4G92 B;  3REH A;  3AZF C;  1P3I B;  2JSS A;  4J8X B;  1ULY A;  5GT0 A;  3AZI A;  5G49 A;  3AZF B;  1KX3 A;  5F99 C;  5B33 A;  5B0Y C;  3WTP C;  4WV4 B;  2FJ7 D;  5BT1 D;  5F99 B;  1F66 C;  5BO0 A;  5B0Y B;  3R45 B;  4KUD A;  3WTP B;  4XUJ D;  5BNV A;  3X1U A;  3O62 A;  1P34 C;  4XZQ C;  1F66 B;  1TZY D;  4CSR A;  3AZJ D;  3MVD C;  1P34 B;  3NQJ A;  4QLC A;  2F8N H;  4XZQ B;  3AZL C;  3AFA C;  1P3L C;  3MVD B;  3REJ D;  2BYM B;  3LZ1 D;  3MGP D;  4KGC D;  3W97 A;  3AZL B;  3AFA B;  3REK C;  4YS3 A;  5B32 G;  5AV5 D;  1P3I A;  3C1B C;  5CP6 C;  3LZ0 C;  5E5A A;  4LD9 C;  3NQU A;  2NZD C;  3AV2 D;  3W99 D;  4ZUX A;  3C1B B;  3AZN C;  3AZF A;  1P3G D;  2PYO D;  3LZ0 B;  5JA4 B;  4LD9 B;  3UTA D;  4Z5T C;  5BS7 C;  2NZD B;  3AZN B;  2ARO D;  3MGR A;  5F99 A;  4Z5T B;  4NE6 A;  5B0Y A;  3KXB B;  3X1S C;  3W98 C;  3REH D;  5B32 D;  2F8N B;  3WTP E;  3LJA C;  3AZE C;  3MGQ C;  1P34 A;  3X1S B;  3W98 B;  3LJA B;  3AZE B;  1P3L A;  5CPI C;  3MGQ B;  2BYM A;  5JRG D;  1P3M A;  5KDM B;  3AFA A;  3TU4 C;  1BH9 A;  5C3I C;  5CPI B;  3VH5 A;  3A6N C;  4KUD D;  3X1U D;  4X23 C;  1H3O B;  3REK A;  3TU4 B;  5C3I B;  4Z66 C;  3A6N B;  5CP6 A;  3LZ0 A;  3AN2 C;  4QLC D;  4NE3 A;  5JA4 A;  1S32 C;  4LD9 A;  2NZD A;  4Z66 B;  3AZK A;  3AZN A;  4Z2M H;  2HIO B;  3AN2 B;  2NQB C;  1P3F C;  1S32 B;  3W97 D;  4WU8 B;  4NFT A;  4YS3 D;  4JJN A;  1KX5 D;  3WAA C;  5DNM A;  3AZM C;  1P3I D;  1P3F B;  3W96 C;  1M1A C;  3B6G C;  3LEL B;  3X1S A;  3AZM B;  3WAA B;  5DNN C;  3AZF D;  1M1A B;  3W96 B;  3UTB C;  3B6G B;  3LJA A;  5CPJ A;  1KX4 A;  5DNN B;  5AV9 C;  3MGR D;  3UTB B;  5F99 D;  5CPI A;  2BYK A;  5B0Y D;  3WTP D;  5AV9 B;  1H3O A;  3TU4 A;  3A6N A;  1P3O B;  1A7W A;  1P34 D;  4X23 A;  3AV2 A;  3X1T C;  1P3L D;  5GT3 C;  4H9O B;  2CV5 C;  3AN2 A;  5GXQ A;  5AV8 A;  1S32 A;  2F8N K;  5B0Z C;  3X1T B;  3AFA D;  5AV6 C;  1P3P C;  5GT3 B;  2CV5 B;  4J8X C;  2NQB A;  1P3F A;  3KUY A;  5B0Z B;  3REK D;  1P3P B;  3WAA A;  5CP6 D;  1BH8 B;  3LZ0 D;  4LD9 D;  1M19 C;  3VH5 T;  2NZD D;  3AZK D;  3B6F C;  3AZN D;  5DNN A;  1ZLA C;  2YFW A;  5JRG A;  1M19 B;  4Z5T D;  4NE5 A;  4JJN D;  3AZG C;  3B6F B;  5DNM D;  3X1V C;  1ZLA B;  4H9Q A;  3AZG B;  5B40 A;  4H9N A;  3X1S D;  3W98 D;  3X1V B;  5B2J C;  5B2I C;  1N1J B;  3REL A;  1M18 A;  3LJA D;  5CPJ D;  3AZE D;  1HQ3 C;  5B1L A;  1P3A C;  3VH6 W;  1KX4 D;  5B2J B;  5B2I B;  5CPI D;  1HQ3 B;  5GT3 A;  1P3A B;  2CV5 A;  1KX5 A;  5AV6 A;  3TU4 D;  1P3P A;  3A6N D;  4J8X A;  4X23 D;  5B1M C;  4Z66 D;  5B31 C;  3KXB C;  5GXQ D;  5AV8 D;  3AN2 D;  1S32 D;  1P3K C;  5B1M B;  5AVC C;  5B24 C;  5B31 B;  2NQB D;  3R45 A;  1P3F D;  3WTP A;  1P3K B;  3KUY D;  3KSY A;  1F66 A;  5AVC B;  5B24 B;  3AZM D;  3AZH C;  3MGS C;  3C1C C;  3X1V A;  3WAA D;  1M1A D;  3B6G D;  4H9P B;  2IO5 C;  4XZQ A;  4WU9 C;  3AZH B;  3MGS B;  3C1C B;  5FUG B;  3MVD A;  5DNN D;  5B2I A;  3WA9 C;  2IO5 B;  1HQ3 A;  3AZL A;  4WU9 B;  1EQZ C;  5AV9 D;  4AWL B;  4M6B A;  3WA9 B;  3AV1 C;  5B40 D;  1EQZ B;  3B0C T;  3C1B A;  3REL D;  2HIO C;  1M18 D;  3AV1 B;  4WNN B;  5B1L D;  3B0B A;  4WU8 C;  5AY8 C;  5GT3 D;  1U35 C;  4KHA B;  4Z5T A;  5B31 A;  2CV5 D;  5BS7 A;  3KXB A;  5AV5 C;  5AY8 B;  3LEL C;  1P3K A;  5AV6 D;  3MGP B;  2F8N A;  1P3P D;  1U35 B;  5B24 A;  2HUE C;  4J8X D;  3B0D C;  5AV5 B;  3VH5 W;  3W98 A;  4H9P A;  3UT9 C;  1B6W A;  3AZH A;  2HUE B;  3C1C A;  1F1E A;  3B0D B;  3UTA C;  3AZE A;  1ID3 C;  3MGQ A;  1TAF B;  2PYO B;  5KDM A;  3UT9 B;  4EO5 C;  4WU9 A;  3WKJ B;  5CPK C;  3UTA B;  4ZBJ C;  1ID3 B;  1P3O C;  4EO5 B;  3AZG D;  5CPK B;  1F66 D;  1EQZ A;  4ZBJ B;  1Q9C A;  3X1V D;  5GT0 C;  3AZI C;  5BNX B;  3V9R B;  4WNN A;  1KX3 C;  1R4V A;  4XZQ D;  4Z66 A;  5B2J D;  5GT0 B;  3MVD D;  5B2I D;  5AVB C;  5B33 C;  3AZI B;  5G49 B;  2HIO A;  4H9S C;  5B31 G;  3KWQ C;  4YM6 C;  1HQ3 D;  1KX3 B;  4KHA A;  3AZL D;  4WU8 A;  3AYW C;  4WZS B;  5AY8 A;  2F8N G;  5B33 B;  5AVB B;  3O62 C;  3KWQ B;  4YM6 B;  1U35 A;  3AYW B;  3LEL A;  3AZM A;  3O62 B;  3C1B D;  1BFM A;  3W96 A;  1M1A A;  4J8U C;  3B6G A;  4CSR B;  1AOI C;  1TAF A;  3NQJ B;  5B1M D;  4J8U B;  3UT9 A;  3UTB A;  1ID3 A;  5B31 D;  3KXB D;  1AOI B;  1P3K D;  2L5A A;  5AV9 A;  2F8N D;  1B67 A;  4E45 A;  5CPK A;  5AVC D;  3WKJ C;  5B24 D;  5E5A C;  1P3O A;  4ZUX C;  3VH6 A;  1KU5 A;  2YFV B;  5E5A B;  4DRB A;  5GSU C;  3NQU B;  3MGS D;  3C1C D;  3AZH D;  3MGQ D;  4H9O A;  4ZUX B;  3MGR C;  3X1T A;  5CHL B;  5GSU B;  4WU9 D;  3WA9 D;  5AVB A;  4H9S A;  3KWQ A;  4YM6 A;  5B0Z A;  3MGR B;  3AYW A;  3B0C W;  1EQZ D;  4J8W C;  1P3B C;  3AV1 D;  1BH8 A;  4J8W B;  1P3B B; 
#chains in the Genus database with same CATH topology
 2RIQ A;  2HIO D;  4J8U A;  1P3M C;  1M19 A;  4WU8 D;  1P3L B;  5AY8 D;  1AOI A;  3REI C;  4J8V C;  3B6F A;  2RVQ C;  3MNN C;  4H9R B;  4R8P C;  1U35 D;  1P3M B;  1ZLA A;  4Z2M G;  1BH9 B;  4CAY B;  3LEL D;  4J8V B;  3REI B;  3AZG A;  3KFU G;  3MNN B;  4R8P B;  1N1J A;  3W96 D;  3WKJ A;  2YFV A;  3REK B;  3AZK C;  5B2J A;  2Y2L A;  5CP6 B;  4AWL C;  3FDD A;  3UT9 D;  5GSU A;  4G91 C;  3UTB D;  2CWE A;  1JFI B;  2FJ7 C;  1ID3 D;  1P3A A;  3AZK B;  2ZM5 A;  4JJN C;  5BT1 C;  5DNM C;  4G91 B;  4XUJ C;  5CPK D;  2FJ7 B;  1WWS A;  4JJN B;  1P3O D;  1TZY C;  5DNM B;  3AZJ C;  4DRA A;  4XUJ B;  5CPJ C;  4J8W A;  5GT0 D;  3AZI D;  1P3B A;  1TZY B;  1KX4 C;  3AZJ B;  1KX3 D;  3REJ C;  3X1T D;  5B1M A;  5CPJ B;  3LZ1 C;  3MGP C;  4KGC C;  5B33 D;  5AVB D;  1KX4 B;  4H9R A;  3KWQ D;  4YM6 D;  3VH6 T;  3REJ B;  5B0Z D;  3AYW D;  3LZ1 B;  4KGC B;  4CAY A;  4J8V A;  2BYK B;  5AVC A;  3REI A;  1WWI A;  3MNN A;  3O62 D;  3H0M C;  4R8P A;  3AV2 C;  3W99 C;  1P3G C;  2PYO C;  4UUZ B;  3MGS A;  5FUG A;  5GXQ C;  5AV8 C;  4J8U D;  1JFI A;  4X23 B;  3AV2 B;  3W99 B;  2ARO C;  1M19 D;  1P3G B;  1AOI D;  3B6F D;  3WA9 A;  5GXQ B;  5AV8 B;  3KUY C;  1ZLA D;  2FJ7 A;  2ARO B;  3REH C;  5B32 C;  2Y2J A;  2NQB B;  4XUJ A;  3KUY B;  3WKJ D;  5E5A D;  3REH B;  5B32 B;  3AV1 A;  1TZY A;  3AZJ A;  4ZUX D;  5GSU D;  4HGA C;  5JRG C;  2Y2H A;  1P3A D;  3REJ A;  4KUD C;  4HGA B;  2YFW B;  5JRG B;  2LY8 A;  2W8S A;  3X1U C;  3LZ1 A;  3MGP A;  4KGC A;  5B40 C;  5AV5 A;  5BO0 B;  4KUD B;  5BNV B;  3X1U B;  3REL C;  1M18 C;  4H9Q B;  4UUZ A;  4QLC C;  4J8W D;  5B1L C;  1P3B D;  5B40 B;  2ZY4 A;  4H9N B;  3W99 A;  3REL B;  1P3G A;  1M18 B;  2PYO A;  4QLC B;  5B1L B;  3UTA A;  3W97 C;  4YS3 C;  1KX5 C;  1P3M D;  2ARO A;  4G92 C;  1P3I C;  3REI D;  4J8V D;  2RVQ D;  3W97 B;  3MNN D;  1HTA A;  4YS3 B;  1KX5 B;  4R8P D;  5BNX A;  4E44 A;  5AV6 B;  3V9R A;  5B32 A;  4G92 B;  3REH A;  3AZF C;  1P3I B;  2JSS A;  4J8X B;  1ULY A;  5GT0 A;  3AZI A;  5G49 A;  3AZF B;  1KX3 A;  5F99 C;  2BG1 A;  5B33 A;  5B0Y C;  3WTP C;  4WV4 B;  2FJ7 D;  5BT1 D;  5F99 B;  1F66 C;  5BO0 A;  5B0Y B;  3R45 B;  4KUD A;  3WTP B;  4XUJ D;  5BNV A;  3X1U A;  3O62 A;  1P34 C;  3EG5 B;  4XZQ C;  1F66 B;  1TZY D;  4CSR A;  3AZJ D;  3MVD C;  4WJ3 C;  1P34 B;  3NQJ A;  4QLC A;  2F8N H;  4XZQ B;  3AZL C;  3AFA C;  1P3L C;  3MVD B;  2Y2N A;  3REJ D;  2BYM B;  3IP4 C;  3LZ1 D;  3MGP D;  4KGC D;  3W97 A;  3AZL B;  3AFA B;  3REK C;  4YS3 A;  5B32 G;  5AV5 D;  1P3I A;  3C1B C;  5CP6 C;  3LZ0 C;  5E5A A;  4LD9 C;  3NQU A;  2NZD C;  2JE5 A;  3W99 D;  4ZUX A;  3C1B B;  3AZN C;  3AZF A;  2XD1 A;  3AV2 D;  3LZ0 B;  1P3G D;  2PYO D;  5JA4 B;  4LD9 B;  3UTA D;  4Z5T C;  5BS7 C;  2NZD B;  3AZN B;  2ARO D;  3MGR A;  3EPK A;  5F99 A;  4Z5T B;  4NE6 A;  5B0Y A;  3KXB B;  3X1S C;  3W98 C;  3REH D;  5B32 D;  2F8N B;  3EPH A;  3WTP E;  2VQR A;  3LJA C;  3AZE C;  3MGQ C;  1P34 A;  3X1S B;  3W98 B;  3LJA B;  3AZE B;  1P3L A;  5CPI C;  3MGQ B;  2BYM A;  5JRG D;  1P3M A;  5KDM B;  3AFA A;  3TU4 C;  1BH9 A;  5C3I C;  5CPI B;  3VH5 A;  3A6N C;  4KUD D;  3X1U D;  2Y2K A;  2Y2I A;  4X23 C;  1H3O B;  3REK A;  3TU4 B;  5C3I B;  4Z66 C;  3A6N B;  5CP6 A;  3LZ0 A;  3AN2 C;  4QLC D;  4NE3 A;  5JA4 A;  1S32 C;  4LD9 A;  2NZD A;  4Z66 B;  3AZK A;  3AZN A;  4Z2M H;  2HIO B;  3AN2 B;  2NQB C;  1P3F C;  1S32 B;  3W97 D;  4WU8 B;  4NFT A;  4YS3 D;  4JJN A;  1KX5 D;  3WAA C;  5DNM A;  3AZM C;  3AL0 C;  1P3I D;  1P3F B;  3W96 C;  1M1A C;  3B6G C;  3LEL B;  3X1S A;  3AZM B;  3WAA B;  5DNN C;  3AZF D;  1M1A B;  3W96 B;  3UTB C;  3B6G B;  3LJA A;  5CPJ A;  1KX4 A;  5DNN B;  5AV9 C;  3MGR D;  3UTB B;  5F99 D;  5CPI A;  2BYK A;  5B0Y D;  3WTP D;  5AV9 B;  2J8P A;  3P5J B;  1H3O A;  3TU4 A;  3A6N A;  1P3O B;  1A7W A;  1P34 D;  4X23 A;  3AV2 A;  3X1T C;  1P3L D;  5GT3 C;  4H9O B;  2CV5 C;  3EPJ A;  5GXQ A;  5AV8 A;  3AN2 A;  1S32 A;  2F8N K;  5B0Z C;  3X1T B;  3AFA D;  5AV6 C;  1P3P C;  5GT3 B;  2CV5 B;  4J8X C;  2NQB A;  1P3F A;  1T3U A;  3KUY A;  5B0Z B;  3REK D;  2Y2O A;  1P3P B;  3WAA A;  2JCH A;  5CP6 D;  1BH8 B;  3LZ0 D;  4LD9 D;  1M19 C;  3VH5 T;  2NZD D;  3AZK D;  3B6F C;  3AZN D;  5DNN A;  1ZLA C;  2YFW A;  5JRG A;  1M19 B;  4Z5T D;  4NE5 A;  4JJN D;  3AZG C;  3B6F B;  2ZY2 A;  5DNM D;  3X1V C;  1ZLA B;  4H9Q A;  3AZG B;  5B40 A;  4H9N A;  2DF4 C;  3X1S D;  3W98 D;  3X1V B;  5B2J C;  5B2I C;  1N1J B;  3REL A;  1M18 A;  3LJA D;  5CPJ D;  3AZE D;  1HQ3 C;  5B1L A;  1P3A C;  3VH6 W;  1KX4 D;  5B2J B;  5B2I B;  1W2E A;  5CPI D;  1HQ3 B;  5GT3 A;  1P3A B;  2CV5 A;  1KX5 A;  5AV6 A;  3TU4 D;  1P3P A;  3A6N D;  4J8X A;  4X23 D;  5B1M C;  4Z66 D;  5B31 C;  3KXB C;  5GXQ D;  5AV8 D;  3AN2 D;  1S32 D;  1P3K C;  5B1M B;  5AVC C;  5B24 C;  5B31 B;  2NQB D;  3R45 A;  1P3F D;  3WTP A;  1P3K B;  3KUY D;  3KSY A;  1F66 A;  5AVC B;  5B24 B;  3AZM D;  3AZH C;  3MGS C;  3C1C C;  3X1V A;  3WAA D;  1M1A D;  3B6G D;  2ZY5 A;  4H9P B;  2IO5 C;  4XZQ A;  3A1I A;  3AZH B;  3MGS B;  3C1C B;  4WU9 C;  5FUG B;  1Z2C B;  5DNN D;  5B2I A;  3MVD A;  3WA9 C;  2IO5 B;  1HQ3 A;  3AZL A;  4WU9 B;  1EQZ C;  5AV9 D;  4AWL B;  4M6B A;  3WA9 B;  3AV1 C;  5B40 D;  1EQZ B;  2XD5 A;  3B0C T;  3C1B A;  3REL D;  2HIO C;  1M18 D;  3AV1 B;  4WNN B;  5B1L D;  3B0B A;  4WU8 C;  5AY8 C;  5GT3 D;  1U35 C;  4KHA B;  4Z5T A;  5B31 A;  2CV5 D;  5BS7 A;  3KXB A;  5AV5 C;  5AY8 B;  3LEL C;  1P3K A;  2Y2P A;  5AV6 D;  3MGP B;  2F8N A;  1P3P D;  1U35 B;  5B24 A;  2HUE C;  4J8X D;  3B0D C;  5AV5 B;  3VH5 W;  3W98 A;  4H9P A;  3UT9 C;  1B6W A;  2Y2Q A;  2HUE B;  3C1C A;  1F1E A;  3B0D B;  3UTA C;  3AZE A;  3AZH A;  3MGQ A;  1ID3 C;  1TAF B;  2PYO B;  2Y2G A;  5KDM A;  3UT9 B;  4EO5 C;  4WU9 A;  3WKJ B;  5CPK C;  3UTA B;  4ZBJ C;  1ID3 B;  1P3O C;  4EO5 B;  3AZG D;  5CPK B;  1F66 D;  1EQZ A;  4ZBJ B;  1Q9C A;  3X1V D;  5GT0 C;  3AZI C;  5BNX B;  2Y2M A;  3V9R B;  4WNN A;  1KX3 C;  1R4V A;  4XZQ D;  4Z66 A;  2ZY3 A;  5GT0 B;  5B2J D;  5B2I D;  5AVB C;  3MVD D;  5B33 C;  5G49 B;  2HIO A;  3AZI B;  4H9S C;  5B31 G;  3KWQ C;  4YM6 C;  1HQ3 D;  1KX3 B;  4KHA A;  3AZL D;  4WU8 A;  3H0L C;  4WZS B;  3AYW C;  5AY8 A;  2F8N G;  5B33 B;  5AVB B;  3O62 C;  3KWQ B;  3A1K A;  4YM6 B;  1U35 A;  3AYW B;  1PZR A;  3LEL A;  2G5H C;  4DQY B;  3AZM A;  3O62 B;  3EPL A;  3C1B D;  1BFM A;  3W96 A;  1M1A A;  4J8U C;  3B6G A;  3F6T A;  4CSR B;  1AOI C;  1TAF A;  3NQJ B;  4UPK A;  5B1M D;  2G5I C;  4J8U B;  3UT9 A;  2F2A C;  3UTB A;  1ID3 A;  5B31 D;  3KXB D;  1AOI B;  1P3K D;  2L5A A;  5AV9 A;  2F8N D;  1B67 A;  4E45 A;  5CPK A;  5AVC D;  3WKJ C;  5B24 D;  5E5A C;  1P3O A;  4ZUX C;  5GSU C;  3VH6 A;  1KU5 A;  2YFV B;  5E5A B;  4DRB A;  3NQU B;  3MGS D;  3C1C D;  3AZH D;  3MGQ D;  4H9O A;  2DQN C;  4ZUX B;  3MGR C;  3X1T A;  5CHL B;  5GSU B;  4WU9 D;  3WA9 D;  5AVB A;  4H9S A;  3KWQ A;  4YM6 A;  5B0Z A;  3MGR B;  3AYW A;  3B0C W;  1EQZ D;  2UWX A;  4J8W C;  1P3B C;  3AV1 D;  1BH8 A;  3H0R C;  2FFF B;  4J8W B;  1P3B B; 
#chains in the Genus database with same CATH homology
 2RIQ A;  2HIO D;  4J8U A;  1P3M C;  1M19 A;  4WU8 D;  1P3L B;  5AY8 D;  1AOI A;  3REI C;  4J8V C;  3B6F A;  2RVQ C;  3MNN C;  4H9R B;  4R8P C;  1U35 D;  1P3M B;  1ZLA A;  4Z2M G;  1BH9 B;  4CAY B;  3LEL D;  4J8V B;  3REI B;  3AZG A;  3KFU G;  3MNN B;  4R8P B;  1N1J A;  3W96 D;  3WKJ A;  2YFV A;  3REK B;  3AZK C;  5B2J A;  2Y2L A;  5CP6 B;  4AWL C;  3FDD A;  3UT9 D;  5GSU A;  4G91 C;  3UTB D;  2CWE A;  1JFI B;  2FJ7 C;  1ID3 D;  1P3A A;  3AZK B;  2ZM5 A;  4JJN C;  5BT1 C;  5DNM C;  4G91 B;  4XUJ C;  5CPK D;  2FJ7 B;  1WWS A;  4JJN B;  1P3O D;  1TZY C;  5DNM B;  3AZJ C;  4DRA A;  4XUJ B;  5CPJ C;  4J8W A;  5GT0 D;  3AZI D;  1P3B A;  1TZY B;  1KX4 C;  3AZJ B;  1KX3 D;  3REJ C;  3X1T D;  5B1M A;  5CPJ B;  3LZ1 C;  3MGP C;  4KGC C;  5B33 D;  5AVB D;  1KX4 B;  4H9R A;  3KWQ D;  4YM6 D;  3VH6 T;  3REJ B;  5B0Z D;  3AYW D;  3LZ1 B;  4KGC B;  4CAY A;  4J8V A;  2BYK B;  5AVC A;  3REI A;  1WWI A;  3MNN A;  3O62 D;  3H0M C;  4R8P A;  3AV2 C;  3W99 C;  1P3G C;  2PYO C;  4UUZ B;  3MGS A;  5FUG A;  5GXQ C;  5AV8 C;  4J8U D;  1JFI A;  4X23 B;  3AV2 B;  3W99 B;  2ARO C;  1M19 D;  1P3G B;  1AOI D;  3B6F D;  3WA9 A;  5GXQ B;  5AV8 B;  3KUY C;  1ZLA D;  2FJ7 A;  2ARO B;  3REH C;  5B32 C;  2Y2J A;  2NQB B;  4XUJ A;  3KUY B;  3WKJ D;  5E5A D;  3REH B;  5B32 B;  3AV1 A;  1TZY A;  3AZJ A;  4ZUX D;  5GSU D;  4HGA C;  5JRG C;  2Y2H A;  1P3A D;  3REJ A;  4KUD C;  4HGA B;  2YFW B;  5JRG B;  2LY8 A;  2W8S A;  3X1U C;  3LZ1 A;  3MGP A;  4KGC A;  5B40 C;  5AV5 A;  5BO0 B;  4KUD B;  5BNV B;  3X1U B;  3REL C;  1M18 C;  4H9Q B;  4UUZ A;  4QLC C;  4J8W D;  5B1L C;  1P3B D;  5B40 B;  2ZY4 A;  4H9N B;  3W99 A;  3REL B;  1P3G A;  1M18 B;  2PYO A;  4QLC B;  5B1L B;  3UTA A;  3W97 C;  4YS3 C;  1KX5 C;  1P3M D;  2ARO A;  4G92 C;  1P3I C;  3REI D;  4J8V D;  2RVQ D;  3W97 B;  3MNN D;  1HTA A;  4YS3 B;  1KX5 B;  4R8P D;  5BNX A;  4E44 A;  5AV6 B;  3V9R A;  5B32 A;  4G92 B;  3REH A;  3AZF C;  1P3I B;  2JSS A;  4J8X B;  1ULY A;  5GT0 A;  3AZI A;  5G49 A;  3AZF B;  1KX3 A;  5F99 C;  2BG1 A;  5B33 A;  5B0Y C;  3WTP C;  4WV4 B;  2FJ7 D;  5BT1 D;  5F99 B;  1F66 C;  5BO0 A;  5B0Y B;  3R45 B;  4KUD A;  3WTP B;  4XUJ D;  5BNV A;  3X1U A;  3O62 A;  1P34 C;  3EG5 B;  4XZQ C;  1F66 B;  1TZY D;  4CSR A;  3AZJ D;  3MVD C;  4WJ3 C;  1P34 B;  3NQJ A;  4QLC A;  2F8N H;  4XZQ B;  3AZL C;  3AFA C;  1P3L C;  3MVD B;  2Y2N A;  3REJ D;  2BYM B;  3IP4 C;  3LZ1 D;  3MGP D;  4KGC D;  3W97 A;  3AZL B;  3AFA B;  3REK C;  4YS3 A;  5B32 G;  5AV5 D;  1P3I A;  3C1B C;  5CP6 C;  3LZ0 C;  5E5A A;  4LD9 C;  3NQU A;  2NZD C;  2JE5 A;  3W99 D;  4ZUX A;  3C1B B;  3AZN C;  3AZF A;  2XD1 A;  3AV2 D;  3LZ0 B;  1P3G D;  2PYO D;  5JA4 B;  4LD9 B;  3UTA D;  4Z5T C;  5BS7 C;  2NZD B;  3AZN B;  2ARO D;  3MGR A;  3EPK A;  5F99 A;  4Z5T B;  4NE6 A;  5B0Y A;  3KXB B;  3X1S C;  3W98 C;  3REH D;  5B32 D;  2F8N B;  3EPH A;  3WTP E;  2VQR A;  3LJA C;  3AZE C;  3MGQ C;  1P34 A;  3X1S B;  3W98 B;  3LJA B;  3AZE B;  1P3L A;  5CPI C;  3MGQ B;  2BYM A;  5JRG D;  1P3M A;  5KDM B;  3AFA A;  3TU4 C;  1BH9 A;  5C3I C;  5CPI B;  3VH5 A;  3A6N C;  4KUD D;  3X1U D;  2Y2K A;  2Y2I A;  4X23 C;  1H3O B;  3REK A;  3TU4 B;  5C3I B;  4Z66 C;  3A6N B;  5CP6 A;  3LZ0 A;  3AN2 C;  4QLC D;  4NE3 A;  5JA4 A;  1S32 C;  4LD9 A;  2NZD A;  4Z66 B;  3AZK A;  3AZN A;  4Z2M H;  2HIO B;  3AN2 B;  2NQB C;  1P3F C;  1S32 B;  3W97 D;  4WU8 B;  4NFT A;  4YS3 D;  4JJN A;  1KX5 D;  3WAA C;  5DNM A;  3AZM C;  3AL0 C;  1P3I D;  1P3F B;  3W96 C;  1M1A C;  3B6G C;  3LEL B;  3X1S A;  3AZM B;  3WAA B;  5DNN C;  3AZF D;  1M1A B;  3W96 B;  3UTB C;  3B6G B;  3LJA A;  5CPJ A;  1KX4 A;  5DNN B;  5AV9 C;  3MGR D;  3UTB B;  5F99 D;  5CPI A;  2BYK A;  5B0Y D;  3WTP D;  5AV9 B;  2J8P A;  3P5J B;  1H3O A;  3TU4 A;  3A6N A;  1P3O B;  1A7W A;  1P34 D;  4X23 A;  3AV2 A;  3X1T C;  1P3L D;  5GT3 C;  4H9O B;  2CV5 C;  3EPJ A;  5GXQ A;  5AV8 A;  3AN2 A;  1S32 A;  2F8N K;  5B0Z C;  3X1T B;  3AFA D;  5AV6 C;  1P3P C;  5GT3 B;  2CV5 B;  4J8X C;  2NQB A;  1P3F A;  1T3U A;  3KUY A;  5B0Z B;  3REK D;  2Y2O A;  1P3P B;  3WAA A;  2JCH A;  5CP6 D;  1BH8 B;  3LZ0 D;  4LD9 D;  1M19 C;  3VH5 T;  2NZD D;  3AZK D;  3B6F C;  3AZN D;  5DNN A;  1ZLA C;  2YFW A;  5JRG A;  1M19 B;  4Z5T D;  4NE5 A;  4JJN D;  3AZG C;  3B6F B;  2ZY2 A;  5DNM D;  3X1V C;  1ZLA B;  4H9Q A;  3AZG B;  5B40 A;  4H9N A;  2DF4 C;  3X1S D;  3W98 D;  3X1V B;  5B2J C;  5B2I C;  1N1J B;  3REL A;  1M18 A;  3LJA D;  5CPJ D;  3AZE D;  1HQ3 C;  5B1L A;  1P3A C;  3VH6 W;  1KX4 D;  5B2J B;  5B2I B;  1W2E A;  5CPI D;  1HQ3 B;  5GT3 A;  1P3A B;  2CV5 A;  1KX5 A;  5AV6 A;  3TU4 D;  1P3P A;  3A6N D;  4J8X A;  4X23 D;  5B1M C;  4Z66 D;  5B31 C;  3KXB C;  5GXQ D;  5AV8 D;  3AN2 D;  1S32 D;  1P3K C;  5B1M B;  5AVC C;  5B24 C;  5B31 B;  2NQB D;  3R45 A;  1P3F D;  3WTP A;  1P3K B;  3KUY D;  3KSY A;  1F66 A;  5AVC B;  5B24 B;  3AZM D;  3AZH C;  3MGS C;  3C1C C;  3X1V A;  3WAA D;  1M1A D;  3B6G D;  2ZY5 A;  4H9P B;  2IO5 C;  4XZQ A;  3A1I A;  3AZH B;  3MGS B;  3C1C B;  4WU9 C;  5FUG B;  1Z2C B;  5DNN D;  5B2I A;  3MVD A;  3WA9 C;  2IO5 B;  1HQ3 A;  3AZL A;  4WU9 B;  1EQZ C;  5AV9 D;  4AWL B;  4M6B A;  3WA9 B;  3AV1 C;  5B40 D;  1EQZ B;  2XD5 A;  3B0C T;  3C1B A;  3REL D;  2HIO C;  1M18 D;  3AV1 B;  4WNN B;  5B1L D;  3B0B A;  4WU8 C;  5AY8 C;  5GT3 D;  1U35 C;  4KHA B;  4Z5T A;  5B31 A;  2CV5 D;  5BS7 A;  3KXB A;  5AV5 C;  5AY8 B;  3LEL C;  1P3K A;  2Y2P A;  5AV6 D;  3MGP B;  2F8N A;  1P3P D;  1U35 B;  5B24 A;  2HUE C;  4J8X D;  3B0D C;  5AV5 B;  3VH5 W;  3W98 A;  4H9P A;  3UT9 C;  1B6W A;  2Y2Q A;  2HUE B;  3C1C A;  1F1E A;  3B0D B;  3UTA C;  3AZE A;  3AZH A;  3MGQ A;  1ID3 C;  1TAF B;  2PYO B;  2Y2G A;  5KDM A;  3UT9 B;  4EO5 C;  4WU9 A;  3WKJ B;  5CPK C;  3UTA B;  4ZBJ C;  1ID3 B;  1P3O C;  4EO5 B;  3AZG D;  5CPK B;  1F66 D;  1EQZ A;  4ZBJ B;  1Q9C A;  3X1V D;  5GT0 C;  3AZI C;  5BNX B;  2Y2M A;  3V9R B;  4WNN A;  1KX3 C;  1R4V A;  4XZQ D;  4Z66 A;  2ZY3 A;  5GT0 B;  5B2J D;  5B2I D;  5AVB C;  3MVD D;  5B33 C;  5G49 B;  2HIO A;  3AZI B;  4H9S C;  5B31 G;  3KWQ C;  4YM6 C;  1HQ3 D;  1KX3 B;  4KHA A;  3AZL D;  4WU8 A;  3H0L C;  4WZS B;  3AYW C;  5AY8 A;  2F8N G;  5B33 B;  5AVB B;  3O62 C;  3KWQ B;  3A1K A;  4YM6 B;  1U35 A;  3AYW B;  1PZR A;  3LEL A;  2G5H C;  4DQY B;  3AZM A;  3O62 B;  3EPL A;  3C1B D;  1BFM A;  3W96 A;  1M1A A;  4J8U C;  3B6G A;  3F6T A;  4CSR B;  1AOI C;  1TAF A;  3NQJ B;  4UPK A;  5B1M D;  2G5I C;  4J8U B;  3UT9 A;  2F2A C;  3UTB A;  1ID3 A;  5B31 D;  3KXB D;  1AOI B;  1P3K D;  2L5A A;  5AV9 A;  2F8N D;  1B67 A;  4E45 A;  5CPK A;  5AVC D;  3WKJ C;  5B24 D;  5E5A C;  1P3O A;  4ZUX C;  5GSU C;  3VH6 A;  1KU5 A;  2YFV B;  5E5A B;  4DRB A;  3NQU B;  3MGS D;  3C1C D;  3AZH D;  3MGQ D;  4H9O A;  2DQN C;  4ZUX B;  3MGR C;  3X1T A;  5CHL B;  5GSU B;  4WU9 D;  3WA9 D;  5AVB A;  4H9S A;  3KWQ A;  4YM6 A;  5B0Z A;  3MGR B;  3AYW A;  3B0C W;  1EQZ D;  2UWX A;  4J8W C;  1P3B C;  3AV1 D;  1BH8 A;  3H0R C;  2FFF B;  4J8W B;  1P3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...