4H9RB

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
molecule keywords Histone H3.3
molecule tags Dna binding protein/apoptosis
source organism Homo sapiens
total genus 26
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9rB00
3REKD 3LZ0B 5B0YC 2NZDD 5B1LB 5BNVA 5GSUD 5AV5D 3X1UA 3MGPC 3AZMD 4H9NB 2F8NB 5DNNB 4J8WC 3LELA 5CPJC 1Q9CA 5GT0C 5JA4B 1P3FD 5AVCD 3UTBB 1P3MD 3AV2C 5F99C 1EQZD 1BH9A 2CV5C 3REJD 5B1MC 3V9RB 4J8VC 3B0BA 3B6FC 3AZFB 5B0YB 4H9SA 3A6NA 1U35C 1KX5C 3AN2D 4Z66C 5GT0B 5B31B 3AZEA 3X1UC 1P3KA 3REKA 3RELA 2NZDA 4H9QB 3AV2B 5AV5A 5GSUA 3AZMA 5F99B 3LELC 3LJAD 5AV8B 5B1MB 3UT9A 1AOIB 3AZHD 3B6FB 1P3FA 1U35B 5AVCA 1KX5B 1P3MA 3NQUA 4ZUXB 1EQZA 3W98D 3REJA 3AZNC 4J8XD 4YM6B 4H9PB 5B33B 4H9SC 3A6NC 3MGSD 3X1TA 4KUDD 3LELB 4G91B 1N1JB 3AN2A 3AYWD 3REIC 1P3AB 3AZEC 4J8UD 1M19B 4H9RA 1P3KC 3W97D 4XUJD 5KDMA 3REKC 2NZDC 3MVDA 5AV5C 5GSUC 3AZMC 1P3LD 4JJND 5B2ID 3LJAA 3AZNB 1P3GD 1P34D 2HIOD 1P3FC 4H9OA 5AVCC 5GXQB 1P3MC 4M6BA 1EQZC 3REIB 1KX4D 5BNXA 5FUGA 3REJC 3KXBD 3AZGD 3R45B 2FJ7D 4J8XA 5JRGD 5AV5B 3AZMB 3MGRD 3MGSA 3MGQB 4WNNB 3AN2C 4KUDA 4E45A 4KGCB 3X1SB 3AZLD 1TAFA 2YFVA 3LZ1D 1F66B 3AYWA 4Z5TD 3AZIA 4J8UA 5B31G 3AFAD 4ZBJC 3W97A 4R8PB 4X23B 1P3PD 2RVQD 3NQUB 5AV6A 1P3LA 3LJAC 5E5AB 4JJNA 3AZHC 4QLCB 2YFWA 1P34A 2HIOA 2BYKA 1HTAA 5AY8D 1TZYD 2NQBB 4WU9D 5CHLB 5BT1D 3W98C 5AVBD 1KX4A 4J8XC 3KXBA 5AV9A 5B0ZB 2FJ7A 3MGSC 3W96B 4KUDC 3WAAA 1ZLAD 1M18D 3MGRA 3AYWC 1KX3D 1JFIA 3AZLA 3AZIC 3AZHB 1HQ3D 3LZ1A 4J8UC 2CWEA 5CPIB 3W97C 4Z5TA 4XUJC 5B2JB 5B40B 3RELD 3AFAA 5G49B 1P3LC 3X1VA 1P3PA 4CAYA 5BNXB 4JJNC 5CPKD 3MNND 4HGAB 3REHD 3UT9D 5B2IC 3C1CA 4YS3A 3W98B 2LY8A 1P3GC 1P34C 5GT3B 3WTPE 2HIOC 3O62B 5B24D 5B32B 1S32D 1M1AD 5AY8A 1H3OB 2YFVB 3WKJD 4DRAA 4LD9A 1TZYA 1BFMA 4WU9A 1KX4C 4EO5B 3UTAB 3KXBC 4J8UB 3AZGC 3NQJB 2FJ7C 4XUJB 5BO0A 5AVBA 4G92C 3WA9D 3X1TD 5JRGC 3MGPB 3MGRC 1ZLAA 1M18A 3AZLC 4J8WB 5B2IB 3LZ1C 1KX3A 3B0CT 1P3GB 5CPJB 4Z5TC 4KHAA 1HQ3A 2BYMA 2AROA 3AFAC 4UUZA 3KWQA 3MVDD 5DNMD 1P3PC 2RVQC 3AV1D 3W99A 1P3ID 4YS3C 3C1CC 1ULYA 2CV5B 5CPKA 3MNNA 3B6GD 3REHA 4J8VB 3AZGB 3AZKD 4WZSB 5JRGB 3TU4D 5AY8C 5B24A 4LD9C 1TZYC 4WU9C 1S32A 1M1AA 3LZ1B 4Z66B 3WKJA 5BT1C 5CP6D 5AVBC 5BNVB 3VH5A 3X1UB 1P3PB 3WA9A 4NE6A 4DRBA 1ZLAC 1M18C 1KX3C 4WU8A 4NE3A 1HQ3C 3AZID 2AROC 4XZQA 3RELC 3W99C 5C3IC 5AV6D 1BH8A 5DNMA 3LZ0D 3AV1A 5B1LD 3C1BD 1BH9B 5CPKC 1B67A 3MNNC 3REHC 1P3IA 3UT9C 2F8ND 5DNND 3B6GA 3VH6W 3AZKA 3A6NB 5B24C 1M18B 5B32G 1S32C 3UTBD 3TU4A 1M1AC 2PYOA 1KX3B 3WKJC 3AZEB 5CP6A 5AV9D 1P3KB 3WA9C 4AWLC 3WTPA 3REKB 3RELB 3X1TC 1P3OD 3WAAD 2NZDB 5GSUB 3AZFD 3UT9B 1P3FB 5AVCB 3AZJD 4CSRA 5DNMC 3MVDC 3AV1C 3X1VD 1P3MB 1P3IC 1WWIA 3LZ0A 4YS3D 3C1CD 5B1LA 3C1BA 1EQZB 4Z2MG 3REJB 3B6GC 3AZKC 4H9NA 2F8NA 5AV8D 5DNNA 1AOID 3X1TB 3TU4C 5JA4A 3AN2B 4LD9D 3UTBA 5CP6C 4H9RB 5KDMB 4ZUXD 3MVDB 3V9RA 4ZBJB 4YM6D 5B33D 1P3OA 3AZFA 5B0YA 3LJAB 3AZKB 4E44A 3VH6T 4H9OB 2AROD 3KWQD 1P3AD 1M19D 5B31A 5AV6C 3AZJA 3W99D 3LZ0C 4Z2MH 5B1LC 3C1BC 5FUGB 4H9QA 5DNNC 2HUEC 2JSSA 4J8XB 5AV8A 3MGSB 1AOIA 4KUDB 3B6FA 3UTBC 1TAFB 5GXQD 3AYWB 1U35A 1KX5A 3AZIB 5AV9C 3W97B 4ZUXA 1P3OC 3WAAC 5AV6B 4YM6A 4H9PA 3AZFC 5B33A 1P3LB 3C1BB 3MGQD 3KUYD 4JJNB 4WU8D 4KGCD 3X1SD 2YFWB 2HUEB 1P34B 4XZQD 1N1JA 1R4VA 1F66D 2HIOB 2BYKB 5B31C 3AZJC 1P3AA 3X1VC 1M19A 4R8PD 4X23D 1KX4B 3KXBB 5E5AD 1B6WA 5AV8C 5AV9B 1KU5A 2FJ7B 1AOIC 4G92B 4QLCD 1P3OB 3WAAB 3AZNA 3MGRB 1P3BD 2PYOD 1ID3D 1JFIB 3AZLB 5GXQA 2NQBD 4Z5TB 4ZUXC 3REIA 3WTPD 3AZJB 3AFAB 4YM6C 5B33C 3X1VB 3R45A 4CAYB 5B0ZD 3W96D 3VH5W 4YS3B 3C1CB 3MGQA 3KUYA 4G91C 4WNNA 4KGCA 3X1SA 3KWQC 1P3AC 1F66A 1M19C 5CPID 5B2JD 5AY8B 5B40D 4LD9B 1TZYB 4R8PA 4WU9B 4X23A 5BS7A 5AVBB 5BO0B 2F8NK 5E5AA 5GT3D 4QLCA 3O62D 1ZLAB 5B32D 1P3BA 5GXQC 1ID3A 4KHAB 1HQ3B 2NQBA 4NFTA 2BYMB 2AROB 3KWQB 2IO5C 4UUZB 3UTAD 3KSYA 1A7WA 3W99B 5C3IB 5B0ZA 5B0YD 3W96A 3MGPD 3MGQC 3KUYC 4WU8C 5CPKB 3MNNB 3REHB 4KGCC 3X1SC 3VH6A 4J8WD 2F8NG 4XZQC 1F66C 5CPJD 5GT0D 5B31D 3AZHA 5B24B 5CPIA 4R8PC 2L5AA 1S32B 4X23C 5B2JA 1M1AB 5B40A 3WKJB 5BS7C 5G49A 3AV2D 5E5AC 5F99D 2IO5B 2CV5D 5B1MD 4J8VD 3WA9B 4NE5A 4QLCC 4AWLB 3W98A 5GT3A 3B6FD 3VH5T 1P3BC 3O62A 2PYOC 4WU8B 3KUYB 1ID3C 1U35D 1KX5D 5B32A 2NQBC 3B0DC 1H3OA 4XZQB 4Z66D 3WTPC 1BH8B 3UTAA 5DNMB 5B0ZC 3NQJA 3W96C 3X1UD 4XUJA 3AV1B 1P3IB 2F8NH 1F1EA 3MGPA 1WWSA 3B6GB 3LELD 4J8WA 5B2IA 3B0CW 5CPIC 1P3GA 5CPJA 5GT0A 5B2JC 3TU4B 1P3BB 5B40C 2PYOB 1ID3B 3B0DB 4HGAC 5CP6B 4WV4B 3AV2A 3WTPB 5F99A 2CV5A 5GT3C 3AZND 5B1MA 4J8VA 3AZGA 3O62C 3A6ND 5B32C 5JRGA 3REID 4EO5C 3UTAC 4CSRB 4Z66A 3AZED 1P3KD
chains in the Genus database with same CATH superfamily
3REKD 3LZ0B 5B0YC 2NZDD 5B1LB 5BNVA 5GSUD 5AV5D 3X1UA 3MGPC 3AZMD 4H9NB 2F8NB 5DNNB 4J8WC 3LELA 2J8PA 5CPJC 1Q9CA 5GT0C 5JA4B 1P3FD 2Y2JA 5AVCD 3UTBB 1P3MD 3AV2C 5F99C 1EQZD 1BH9A 2CV5C 3REJD 5B1MC 3V9RB 4J8VC 3B0BA 3B6FC 3AZFB 5B0YB 4H9SA 3A6NA 1U35C 1KX5C 3EPHA 3AN2D 4Z66C 4UPKA 5GT0B 5B31B 3AZEA 3X1UC 1P3KA 3REKA 3RELA 2NZDA 4H9QB 3AV2B 5AV5A 5GSUA 3AZMA 5F99B 3LELC 3LJAD 5AV8B 5B1MB 3UT9A 1AOIB 3AZHD 3B6FB 1P3FA 1U35B 5AVCA 1KX5B 1P3MA 3NQUA 4ZUXB 1EQZA 3W98D 3REJA 3AZNC 4J8XD 4YM6B 4H9PB 5B33B 4H9SC 3A6NC 3MGSD 3X1TA 4KUDD 3LELB 4G91B 1N1JB 3AN2A 3H0LC 3AYWD 3REIC 2RIQA 1P3AB 3AZEC 4J8UD 1M19B 4H9RA 1P3KC 3W97D 4XUJD 5KDMA 3REKC 2NZDC 3MVDA 5AV5C 5GSUC 3AZMC 1P3LD 2Y2IA 4JJND 5B2ID 3LJAA 2Y2KA 3A1KA 3AZNB 1P3GD 1P34D 2HIOD 1P3FC 4H9OA 5AVCC 5GXQB 1P3MC 4M6BA 1EQZC 3REIB 1KX4D 5BNXA 5FUGA 3REJC 3KXBD 3AZGD 3R45B 2FJ7D 4J8XA 1Z2CB 5JRGD 5AV5B 3AZMB 3MGRD 3MGSA 3MGQB 4WNNB 3AN2C 4KUDA 4E45A 4KGCB 3X1SB 3AZLD 1TAFA 2YFVA 3LZ1D 1F66B 3AYWA 4Z5TD 3AZIA 4J8UA 5B31G 3AFAD 4ZBJC 3W97A 4R8PB 4X23B 1P3PD 2RVQD 3NQUB 2Y2MA 5AV6A 1P3LA 3LJAC 5E5AB 4JJNA 3AZHC 4QLCB 2YFWA 1P34A 2HIOA 2BYKA 1HTAA 5AY8D 1TZYD 2NQBB 4WU9D 5CHLB 2G5HC 5BT1D 3W98C 5AVBD 1KX4A 4J8XC 3KXBA 5AV9A 5B0ZB 2FJ7A 3MGSC 3W96B 3H0MC 4KUDC 3WAAA 1ZLAD 1M18D 3MGRA 1W2EA 3AYWC 1KX3D 1JFIA 3AZLA 3AZIC 3AZHB 1HQ3D 3LZ1A 4J8UC 2CWEA 5CPIB 3W97C 4Z5TA 4XUJC 5B2JB 5B40B 3RELD 3AFAA 5G49B 1P3LC 3EPJA 3X1VA 1P3PA 4CAYA 5BNXB 4JJNC 5CPKD 3MNND 4HGAB 3REHD 3UT9D 5B2IC 3C1CA 4YS3A 3W98B 2LY8A 1P3GC 1P34C 5GT3B 3WTPE 2HIOC 3O62B 5B24D 5B32B 1S32D 1M1AD 5AY8A 1H3OB 2YFVB 3WKJD 4DRAA 4LD9A 1TZYA 1BFMA 4WU9A 1KX4C 4EO5B 3UTAB 3KXBC 4J8UB 3AZGC 3NQJB 2FJ7C 4XUJB 5BO0A 5AVBA 4G92C 3WA9D 3X1TD 1T3UA 5JRGC 2ZY2A 3IP4C 3MGPB 3MGRC 1ZLAA 1M18A 3AZLC 4J8WB 5B2IB 3LZ1C 1KX3A 3B0CT 1P3GB 5CPJB 4Z5TC 4KHAA 1HQ3A 2BYMA 2AROA 3AFAC 4UUZA 3KWQA 3MVDD 5DNMD 1P3PC 2RVQC 3AV1D 3W99A 1P3ID 4YS3C 3C1CC 1ULYA 2Y2LA 2CV5B 5CPKA 3P5JB 3MNNA 3REHA 3EG5B 4J8VB 3AZKD 3AZGB 3B6GD 4WZSB 5JRGB 2Y2QA 3TU4D 5AY8C 5B24A 3AL0C 4LD9C 1TZYC 4WU9C 1S32A 1M1AA 3LZ1B 4Z66B 3WKJA 5BT1C 5CP6D 5AVBC 5BNVB 2DQNC 3VH5A 3X1UB 1P3PB 3WA9A 4NE6A 4DRBA 1ZLAC 1M18C 3EPLA 1KX3C 4WU8A 4NE3A 1HQ3C 3AZID 2AROC 3EPKA 4XZQA 3RELC 3W99C 5C3IC 5AV6D 1BH8A 2Y2GA 5DNMA 3LZ0D 3AV1A 5B1LD 3C1BD 1BH9B 5CPKC 1B67A 3MNNC 3REHC 1P3IA 3UT9C 2F8ND 5DNND 3B6GA 3VH6W 3AZKA 3A6NB 5B24C 1M18B 5B32G 1S32C 3UTBD 3TU4A 1M1AC 2PYOA 1KX3B 3WKJC 3AZEB 5CP6A 5AV9D 1P3KB 3KFUG 2DF4C 4AWLC 3WA9C 3WTPA 3REKB 3RELB 3X1TC 1P3OD 3WAAD 2NZDB 5GSUB 3AZFD 3UT9B 1P3FB 5AVCB 3AZJD 4CSRA 5DNMC 3MVDC 3AV1C 3X1VD 1P3MB 1P3IC 1WWIA 4DQYB 3LZ0A 4YS3D 3C1CD 5B1LA 3C1BA 1EQZB 4Z2MG 3REJB 3B6GC 2ZY3A 3AZKC 4H9NA 2F8NA 5AV8D 5DNNA 1AOID 3X1TB 3TU4C 5JA4A 3AN2B 4LD9D 3UTBA 5CP6C 4H9RB 5KDMB 4ZUXD 3MVDB 3V9RA 4ZBJB 4YM6D 5B33D 1P3OA 3AZFA 5B0YA 3LJAB 3AZKB 4E44A 3VH6T 4H9OB 2AROD 3KWQD 1P3AD 1M19D 5B31A 5AV6C 3AZJA 3W99D 2FFFB 3LZ0C 4Z2MH 5B1LC 3C1BC 5FUGB 4H9QA 5DNNC 2HUEC 2JSSA 4J8XB 5AV8A 3MGSB 1AOIA 4KUDB 3B6FA 3UTBC 3F6TA 1TAFB 5GXQD 3AYWB 1U35A 1KX5A 2VQRA 3AZIB 5AV9C 3W97B 4ZUXA 1P3OC 3WAAC 5AV6B 4YM6A 4H9PA 3AZFC 5B33A 1P3LB 3C1BB 2JCHA 3MGQD 3KUYD 4JJNB 4WU8D 4KGCD 3X1SD 2YFWB 2HUEB 1P34B 4XZQD 1N1JA 1R4VA 1F66D 2HIOB 2BYKB 5B31C 3AZJC 1P3AA 3X1VC 1M19A 4R8PD 4X23D 1KX4B 3KXBB 5E5AD 2F2AC 1B6WA 5AV8C 5AV9B 1KU5A 2FJ7B 1AOIC 4G92B 4QLCD 1P3OB 3WAAB 3AZNA 3MGRB 1P3BD 2PYOD 1ID3D 1JFIB 3AZLB 5GXQA 2NQBD 4Z5TB 4ZUXC 2Y2OA 3REIA 3WTPD 2ZY5A 3AZJB 3AFAB 4YM6C 5B33C 3X1VB 3R45A 4CAYB 5B0ZD 3W96D 3VH5W 4YS3B 3C1CB 2BG1A 3H0RC 3MGQA 4G91C 4WNNA 3KUYA 2W8SA 4KGCA 3X1SA 3KWQC 1P3AC 1F66A 2UWXA 1M19C 5CPID 5B2JD 5AY8B 5B40D 4WJ3C 4LD9B 1TZYB 4R8PA 4WU9B 4X23A 5BS7A 5AVBB 5BO0B 2F8NK 5E5AA 1PZRA 5GT3D 4QLCA 3O62D 2Y2HA 1ZLAB 5B32D 1P3BA 5GXQC 1ID3A 4KHAB 1HQ3B 2NQBA 4NFTA 2BYMB 2AROB 3KWQB 2IO5C 4UUZB 3UTAD 3KSYA 1A7WA 3W99B 5C3IB 5B0ZA 5B0YD 3W96A 3MGPD 3MGQC 3KUYC 4WU8C 5CPKB 3MNNB 3REHB 4KGCC 3X1SC 3VH6A 4J8WD 2F8NG 4XZQC 1F66C 5CPJD 5GT0D 2XD1A 5B31D 5B24B 3AZHA 5CPIA 2ZY4A 4R8PC 2L5AA 1S32B 4X23C 5B2JA 1M1AB 5B40A 3WKJB 5BS7C 5G49A 3AV2D 5E5AC 5F99D 2IO5B 2CV5D 5B1MD 4J8VD 3WA9B 4NE5A 4QLCC 4AWLB 3W98A 5GT3A 3B6FD 3VH5T 1P3BC 3O62A 2PYOC 4WU8B 3KUYB 1ID3C 1U35D 1KX5D 5B32A 2NQBC 3B0DC 1H3OA 4XZQB 4Z66D 3WTPC 1BH8B 3UTAA 5DNMB 5B0ZC 3NQJA 3W96C 3X1UD 4XUJA 3AV1B 1P3IB 2ZM5A 2F8NH 3FDDA 1F1EA 3MGPA 1WWSA 2Y2NA 3B6GB 3LELD 4J8WA 2JE5A 5B2IA 3B0CW 5CPIC 1P3GA 5CPJA 2Y2PA 5GT0A 5B2JC 3TU4B 1P3BB 5B40C 2PYOB 1ID3B 3A1IA 3B0DB 2XD5A 4HGAC 5CP6B 4WV4B 3AV2A 3WTPB 5F99A 2CV5A 5GT3C 3AZND 2G5IC 5B1MA 4J8VA 3AZGA 3O62C 3A6ND 5B32C 5JRGA 3REID 4EO5C 3UTAC 4CSRB 4Z66A 3AZED 1P3KD
chains in the Genus database with same CATH topology
3REKD 3LZ0B 5B0YC 2NZDD 5B1LB 5BNVA 5GSUD 5AV5D 3X1UA 3MGPC 3AZMD 4H9NB 2F8NB 5DNNB 4J8WC 3LELA 2J8PA 5CPJC 1Q9CA 5GT0C 5JA4B 1P3FD 2Y2JA 5AVCD 3UTBB 1P3MD 3AV2C 5F99C 1EQZD 1BH9A 2CV5C 3REJD 5B1MC 3V9RB 4J8VC 3B0BA 3B6FC 3AZFB 5B0YB 4H9SA 3A6NA 1U35C 1KX5C 3EPHA 3AN2D 4Z66C 4UPKA 5GT0B 5B31B 3AZEA 3X1UC 1P3KA 3REKA 3RELA 2NZDA 4H9QB 3AV2B 5AV5A 5GSUA 3AZMA 5F99B 3LELC 3LJAD 5AV8B 5B1MB 3UT9A 1AOIB 3AZHD 3B6FB 1P3FA 1U35B 5AVCA 1KX5B 1P3MA 3NQUA 4ZUXB 1EQZA 3W98D 3REJA 3AZNC 4J8XD 4YM6B 4H9PB 5B33B 4H9SC 3A6NC 3MGSD 3X1TA 4KUDD 3LELB 4G91B 1N1JB 3AN2A 3H0LC 3AYWD 3REIC 2RIQA 1P3AB 3AZEC 4J8UD 1M19B 4H9RA 1P3KC 3W97D 4XUJD 5KDMA 3REKC 2NZDC 3MVDA 5AV5C 5GSUC 3AZMC 1P3LD 2Y2IA 4JJND 5B2ID 3LJAA 2Y2KA 3A1KA 3AZNB 1P3GD 1P34D 2HIOD 1P3FC 4H9OA 5AVCC 5GXQB 1P3MC 4M6BA 1EQZC 3REIB 1KX4D 5BNXA 5FUGA 3REJC 3KXBD 3AZGD 3R45B 2FJ7D 4J8XA 1Z2CB 5JRGD 5AV5B 3AZMB 3MGRD 3MGSA 3MGQB 4WNNB 3AN2C 4KUDA 4E45A 4KGCB 3X1SB 3AZLD 1TAFA 2YFVA 3LZ1D 1F66B 3AYWA 4Z5TD 3AZIA 4J8UA 5B31G 3AFAD 4ZBJC 3W97A 4R8PB 4X23B 1P3PD 2RVQD 3NQUB 2Y2MA 5AV6A 1P3LA 3LJAC 5E5AB 4JJNA 3AZHC 4QLCB 2YFWA 1P34A 2HIOA 2BYKA 1HTAA 5AY8D 1TZYD 2NQBB 4WU9D 5CHLB 2G5HC 5BT1D 3W98C 5AVBD 1KX4A 4J8XC 3KXBA 5AV9A 5B0ZB 2FJ7A 3MGSC 3W96B 3H0MC 4KUDC 3WAAA 1ZLAD 1M18D 3MGRA 1W2EA 3AYWC 1KX3D 1JFIA 3AZLA 3AZIC 3AZHB 1HQ3D 3LZ1A 4J8UC 2CWEA 5CPIB 3W97C 4Z5TA 4XUJC 5B2JB 5B40B 3RELD 3AFAA 5G49B 1P3LC 3EPJA 3X1VA 1P3PA 4CAYA 5BNXB 4JJNC 5CPKD 3MNND 4HGAB 3REHD 3UT9D 5B2IC 3C1CA 4YS3A 3W98B 2LY8A 1P3GC 1P34C 5GT3B 3WTPE 2HIOC 3O62B 5B24D 5B32B 1S32D 1M1AD 5AY8A 1H3OB 2YFVB 3WKJD 4DRAA 4LD9A 1TZYA 1BFMA 4WU9A 1KX4C 4EO5B 3UTAB 3KXBC 4J8UB 3AZGC 3NQJB 2FJ7C 4XUJB 5BO0A 5AVBA 4G92C 3WA9D 3X1TD 1T3UA 5JRGC 2ZY2A 3IP4C 3MGPB 3MGRC 1ZLAA 1M18A 3AZLC 4J8WB 5B2IB 3LZ1C 1KX3A 3B0CT 1P3GB 5CPJB 4Z5TC 4KHAA 1HQ3A 2BYMA 2AROA 3AFAC 4UUZA 3KWQA 3MVDD 5DNMD 1P3PC 2RVQC 3AV1D 3W99A 1P3ID 4YS3C 3C1CC 1ULYA 2Y2LA 2CV5B 5CPKA 3P5JB 3MNNA 3REHA 3EG5B 4J8VB 3AZKD 3AZGB 3B6GD 4WZSB 5JRGB 2Y2QA 3TU4D 5AY8C 5B24A 3AL0C 4LD9C 1TZYC 4WU9C 1S32A 1M1AA 3LZ1B 4Z66B 3WKJA 5BT1C 5CP6D 5AVBC 5BNVB 2DQNC 3VH5A 3X1UB 1P3PB 3WA9A 4NE6A 4DRBA 1ZLAC 1M18C 3EPLA 1KX3C 4WU8A 4NE3A 1HQ3C 3AZID 2AROC 3EPKA 4XZQA 3RELC 3W99C 5C3IC 5AV6D 1BH8A 2Y2GA 5DNMA 3LZ0D 3AV1A 5B1LD 3C1BD 1BH9B 5CPKC 1B67A 3MNNC 3REHC 1P3IA 3UT9C 2F8ND 5DNND 3B6GA 3VH6W 3AZKA 3A6NB 5B24C 1M18B 5B32G 1S32C 3UTBD 3TU4A 1M1AC 2PYOA 1KX3B 3WKJC 3AZEB 5CP6A 5AV9D 1P3KB 3KFUG 2DF4C 4AWLC 3WA9C 3WTPA 3REKB 3RELB 3X1TC 1P3OD 3WAAD 2NZDB 5GSUB 3AZFD 3UT9B 1P3FB 5AVCB 3AZJD 4CSRA 5DNMC 3MVDC 3AV1C 3X1VD 1P3MB 1P3IC 1WWIA 4DQYB 3LZ0A 4YS3D 3C1CD 5B1LA 3C1BA 1EQZB 4Z2MG 3REJB 3B6GC 2ZY3A 3AZKC 4H9NA 2F8NA 5AV8D 5DNNA 1AOID 3X1TB 3TU4C 5JA4A 3AN2B 4LD9D 3UTBA 5CP6C 4H9RB 5KDMB 4ZUXD 3MVDB 3V9RA 4ZBJB 4YM6D 5B33D 1P3OA 3AZFA 5B0YA 3LJAB 3AZKB 4E44A 3VH6T 4H9OB 2AROD 3KWQD 1P3AD 1M19D 5B31A 5AV6C 3AZJA 3W99D 2FFFB 3LZ0C 4Z2MH 5B1LC 3C1BC 5FUGB 4H9QA 5DNNC 2HUEC 2JSSA 4J8XB 5AV8A 3MGSB 1AOIA 4KUDB 3B6FA 3UTBC 3F6TA 1TAFB 5GXQD 3AYWB 1U35A 1KX5A 2VQRA 3AZIB 5AV9C 3W97B 4ZUXA 1P3OC 3WAAC 5AV6B 4YM6A 4H9PA 3AZFC 5B33A 1P3LB 3C1BB 2JCHA 3MGQD 3KUYD 4JJNB 4WU8D 4KGCD 3X1SD 2YFWB 2HUEB 1P34B 4XZQD 1N1JA 1R4VA 1F66D 2HIOB 2BYKB 5B31C 3AZJC 1P3AA 3X1VC 1M19A 4R8PD 4X23D 1KX4B 3KXBB 5E5AD 2F2AC 1B6WA 5AV8C 5AV9B 1KU5A 2FJ7B 1AOIC 4G92B 4QLCD 1P3OB 3WAAB 3AZNA 3MGRB 1P3BD 2PYOD 1ID3D 1JFIB 3AZLB 5GXQA 2NQBD 4Z5TB 4ZUXC 2Y2OA 3REIA 3WTPD 2ZY5A 3AZJB 3AFAB 4YM6C 5B33C 3X1VB 3R45A 4CAYB 5B0ZD 3W96D 3VH5W 4YS3B 3C1CB 2BG1A 3H0RC 3MGQA 4G91C 4WNNA 3KUYA 2W8SA 4KGCA 3X1SA 3KWQC 1P3AC 1F66A 2UWXA 1M19C 5CPID 5B2JD 5AY8B 5B40D 4WJ3C 4LD9B 1TZYB 4R8PA 4WU9B 4X23A 5BS7A 5AVBB 5BO0B 2F8NK 5E5AA 1PZRA 5GT3D 4QLCA 3O62D 2Y2HA 1ZLAB 5B32D 1P3BA 5GXQC 1ID3A 4KHAB 1HQ3B 2NQBA 4NFTA 2BYMB 2AROB 3KWQB 2IO5C 4UUZB 3UTAD 3KSYA 1A7WA 3W99B 5C3IB 5B0ZA 5B0YD 3W96A 3MGPD 3MGQC 3KUYC 4WU8C 5CPKB 3MNNB 3REHB 4KGCC 3X1SC 3VH6A 4J8WD 2F8NG 4XZQC 1F66C 5CPJD 5GT0D 2XD1A 5B31D 5B24B 3AZHA 5CPIA 2ZY4A 4R8PC 2L5AA 1S32B 4X23C 5B2JA 1M1AB 5B40A 3WKJB 5BS7C 5G49A 3AV2D 5E5AC 5F99D 2IO5B 2CV5D 5B1MD 4J8VD 3WA9B 4NE5A 4QLCC 4AWLB 3W98A 5GT3A 3B6FD 3VH5T 1P3BC 3O62A 2PYOC 4WU8B 3KUYB 1ID3C 1U35D 1KX5D 5B32A 2NQBC 3B0DC 1H3OA 4XZQB 4Z66D 3WTPC 1BH8B 3UTAA 5DNMB 5B0ZC 3NQJA 3W96C 3X1UD 4XUJA 3AV1B 1P3IB 2ZM5A 2F8NH 3FDDA 1F1EA 3MGPA 1WWSA 2Y2NA 3B6GB 3LELD 4J8WA 2JE5A 5B2IA 3B0CW 5CPIC 1P3GA 5CPJA 2Y2PA 5GT0A 5B2JC 3TU4B 1P3BB 5B40C 2PYOB 1ID3B 3A1IA 3B0DB 2XD5A 4HGAC 5CP6B 4WV4B 3AV2A 3WTPB 5F99A 2CV5A 5GT3C 3AZND 2G5IC 5B1MA 4J8VA 3AZGA 3O62C 3A6ND 5B32C 5JRGA 3REID 4EO5C 3UTAC 4CSRB 4Z66A 3AZED 1P3KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REK D;  3LZ0 B;  5B0Y C;  2NZD D;  5B1L B;  5BNV A;  5GSU D;  5AV5 D;  3X1U A;  3MGP C;  3AZM D;  4H9N B;  2F8N B;  5DNN B;  4J8W C;  3LEL A;  5CPJ C;  1Q9C A;  5GT0 C;  5JA4 B;  1P3F D;  5AVC D;  3UTB B;  1P3M D;  3AV2 C;  5F99 C;  1EQZ D;  1BH9 A;  2CV5 C;  3REJ D;  5B1M C;  3V9R B;  4J8V C;  3B0B A;  3B6F C;  3AZF B;  5B0Y B;  4H9S A;  3A6N A;  1U35 C;  1KX5 C;  3AN2 D;  4Z66 C;  5GT0 B;  5B31 B;  3AZE A;  3X1U C;  1P3K A;  3REK A;  3REL A;  2NZD A;  4H9Q B;  3AV2 B;  5AV5 A;  5GSU A;  3AZM A;  5F99 B;  3LEL C;  3LJA D;  5AV8 B;  5B1M B;  3UT9 A;  1AOI B;  3AZH D;  3B6F B;  1P3F A;  1U35 B;  5AVC A;  1KX5 B;  1P3M A;  3NQU A;  4ZUX B;  1EQZ A;  3W98 D;  3REJ A;  3AZN C;  4J8X D;  4YM6 B;  4H9P B;  5B33 B;  4H9S C;  3A6N C;  3MGS D;  3X1T A;  4KUD D;  3LEL B;  4G91 B;  1N1J B;  3AN2 A;  3AYW D;  3REI C;  1P3A B;  3AZE C;  4J8U D;  1M19 B;  4H9R A;  1P3K C;  3W97 D;  4XUJ D;  5KDM A;  3REK C;  2NZD C;  3MVD A;  5AV5 C;  5GSU C;  3AZM C;  1P3L D;  4JJN D;  5B2I D;  3LJA A;  3AZN B;  1P3G D;  1P34 D;  2HIO D;  1P3F C;  4H9O A;  5AVC C;  5GXQ B;  1P3M C;  4M6B A;  1EQZ C;  3REI B;  1KX4 D;  5BNX A;  5FUG A;  3REJ C;  3KXB D;  3AZG D;  3R45 B;  2FJ7 D;  4J8X A;  5JRG D;  5AV5 B;  3AZM B;  3MGR D;  3MGS A;  3MGQ B;  4WNN B;  3AN2 C;  4KUD A;  4E45 A;  4KGC B;  3X1S B;  3AZL D;  1TAF A;  2YFV A;  3LZ1 D;  1F66 B;  3AYW A;  4Z5T D;  3AZI A;  4J8U A;  5B31 G;  3AFA D;  4ZBJ C;  3W97 A;  4R8P B;  4X23 B;  1P3P D;  2RVQ D;  3NQU B;  5AV6 A;  1P3L A;  3LJA C;  5E5A B;  4JJN A;  3AZH C;  4QLC B;  2YFW A;  1P34 A;  2HIO A;  2BYK A;  1HTA A;  5AY8 D;  1TZY D;  2NQB B;  4WU9 D;  5CHL B;  5BT1 D;  3W98 C;  5AVB D;  1KX4 A;  4J8X C;  3KXB A;  5AV9 A;  5B0Z B;  2FJ7 A;  3MGS C;  3W96 B;  4KUD C;  3WAA A;  1ZLA D;  1M18 D;  3MGR A;  3AYW C;  1KX3 D;  1JFI A;  3AZL A;  3AZI C;  3AZH B;  1HQ3 D;  3LZ1 A;  4J8U C;  2CWE A;  5CPI B;  3W97 C;  4Z5T A;  4XUJ C;  5B2J B;  5B40 B;  3REL D;  3AFA A;  5G49 B;  1P3L C;  3X1V A;  1P3P A;  4CAY A;  5BNX B;  4JJN C;  5CPK D;  3MNN D;  4HGA B;  3REH D;  3UT9 D;  5B2I C;  3C1C A;  4YS3 A;  3W98 B;  2LY8 A;  1P3G C;  1P34 C;  5GT3 B;  3WTP E;  2HIO C;  3O62 B;  5B24 D;  5B32 B;  1S32 D;  1M1A D;  5AY8 A;  1H3O B;  2YFV B;  3WKJ D;  4DRA A;  4LD9 A;  1TZY A;  1BFM A;  4WU9 A;  1KX4 C;  4EO5 B;  3UTA B;  3KXB C;  4J8U B;  3AZG C;  3NQJ B;  2FJ7 C;  4XUJ B;  5BO0 A;  5AVB A;  4G92 C;  3WA9 D;  3X1T D;  5JRG C;  3MGP B;  3MGR C;  1ZLA A;  1M18 A;  3AZL C;  4J8W B;  5B2I B;  3LZ1 C;  1KX3 A;  3B0C T;  1P3G B;  5CPJ B;  4Z5T C;  4KHA A;  1HQ3 A;  2BYM A;  2ARO A;  3AFA C;  4UUZ A;  3KWQ A;  3MVD D;  5DNM D;  1P3P C;  2RVQ C;  3AV1 D;  3W99 A;  1P3I D;  4YS3 C;  3C1C C;  1ULY A;  2CV5 B;  5CPK A;  3MNN A;  3B6G D;  3REH A;  4J8V B;  3AZG B;  3AZK D;  4WZS B;  5JRG B;  3TU4 D;  5AY8 C;  5B24 A;  4LD9 C;  1TZY C;  4WU9 C;  1S32 A;  1M1A A;  3LZ1 B;  4Z66 B;  3WKJ A;  5BT1 C;  5CP6 D;  5AVB C;  5BNV B;  3VH5 A;  3X1U B;  1P3P B;  3WA9 A;  4NE6 A;  4DRB A;  1ZLA C;  1M18 C;  1KX3 C;  4WU8 A;  4NE3 A;  1HQ3 C;  3AZI D;  2ARO C;  4XZQ A;  3REL C;  3W99 C;  5C3I C;  5AV6 D;  1BH8 A;  5DNM A;  3LZ0 D;  3AV1 A;  5B1L D;  3C1B D;  1BH9 B;  5CPK C;  1B67 A;  3MNN C;  3REH C;  1P3I A;  3UT9 C;  2F8N D;  5DNN D;  3B6G A;  3VH6 W;  3AZK A;  3A6N B;  5B24 C;  1M18 B;  5B32 G;  1S32 C;  3UTB D;  3TU4 A;  1M1A C;  2PYO A;  1KX3 B;  3WKJ C;  3AZE B;  5CP6 A;  5AV9 D;  1P3K B;  3WA9 C;  4AWL C;  3WTP A;  3REK B;  3REL B;  3X1T C;  1P3O D;  3WAA D;  2NZD B;  5GSU B;  3AZF D;  3UT9 B;  1P3F B;  5AVC B;  3AZJ D;  4CSR A;  5DNM C;  3MVD C;  3AV1 C;  3X1V D;  1P3M B;  1P3I C;  1WWI A;  3LZ0 A;  4YS3 D;  3C1C D;  5B1L A;  3C1B A;  1EQZ B;  4Z2M G;  3REJ B;  3B6G C;  3AZK C;  4H9N A;  2F8N A;  5AV8 D;  5DNN A;  1AOI D;  3X1T B;  3TU4 C;  5JA4 A;  3AN2 B;  4LD9 D;  3UTB A;  5CP6 C;  4H9R B;  5KDM B;  4ZUX D;  3MVD B;  3V9R A;  4ZBJ B;  4YM6 D;  5B33 D;  1P3O A;  3AZF A;  5B0Y A;  3LJA B;  3AZK B;  4E44 A;  3VH6 T;  4H9O B;  2ARO D;  3KWQ D;  1P3A D;  1M19 D;  5B31 A;  5AV6 C;  3AZJ A;  3W99 D;  3LZ0 C;  4Z2M H;  5B1L C;  3C1B C;  5FUG B;  4H9Q A;  5DNN C;  2HUE C;  2JSS A;  4J8X B;  5AV8 A;  3MGS B;  1AOI A;  4KUD B;  3B6F A;  3UTB C;  1TAF B;  5GXQ D;  3AYW B;  1U35 A;  1KX5 A;  3AZI B;  5AV9 C;  3W97 B;  4ZUX A;  1P3O C;  3WAA C;  5AV6 B;  4YM6 A;  4H9P A;  3AZF C;  5B33 A;  1P3L B;  3C1B B;  3MGQ D;  3KUY D;  4JJN B;  4WU8 D;  4KGC D;  3X1S D;  2YFW B;  2HUE B;  1P34 B;  4XZQ D;  1N1J A;  1R4V A;  1F66 D;  2HIO B;  2BYK B;  5B31 C;  3AZJ C;  1P3A A;  3X1V C;  1M19 A;  4R8P D;  4X23 D;  1KX4 B;  3KXB B;  5E5A D;  1B6W A;  5AV8 C;  5AV9 B;  1KU5 A;  2FJ7 B;  1AOI C;  4G92 B;  4QLC D;  1P3O B;  3WAA B;  3AZN A;  3MGR B;  1P3B D;  2PYO D;  1ID3 D;  1JFI B;  3AZL B;  5GXQ A;  2NQB D;  4Z5T B;  4ZUX C;  3REI A;  3WTP D;  3AZJ B;  3AFA B;  4YM6 C;  5B33 C;  3X1V B;  3R45 A;  4CAY B;  5B0Z D;  3W96 D;  3VH5 W;  4YS3 B;  3C1C B;  3MGQ A;  3KUY A;  4G91 C;  4WNN A;  4KGC A;  3X1S A;  3KWQ C;  1P3A C;  1F66 A;  1M19 C;  5CPI D;  5B2J D;  5AY8 B;  5B40 D;  4LD9 B;  1TZY B;  4R8P A;  4WU9 B;  4X23 A;  5BS7 A;  5AVB B;  5BO0 B;  2F8N K;  5E5A A;  5GT3 D;  4QLC A;  3O62 D;  1ZLA B;  5B32 D;  1P3B A;  5GXQ C;  1ID3 A;  4KHA B;  1HQ3 B;  2NQB A;  4NFT A;  2BYM B;  2ARO B;  3KWQ B;  2IO5 C;  4UUZ B;  3UTA D;  3KSY A;  1A7W A;  3W99 B;  5C3I B;  5B0Z A;  5B0Y D;  3W96 A;  3MGP D;  3MGQ C;  3KUY C;  4WU8 C;  5CPK B;  3MNN B;  3REH B;  4KGC C;  3X1S C;  3VH6 A;  4J8W D;  2F8N G;  4XZQ C;  1F66 C;  5CPJ D;  5GT0 D;  5B31 D;  3AZH A;  5B24 B;  5CPI A;  4R8P C;  2L5A A;  1S32 B;  4X23 C;  5B2J A;  1M1A B;  5B40 A;  3WKJ B;  5BS7 C;  5G49 A;  3AV2 D;  5E5A C;  5F99 D;  2IO5 B;  2CV5 D;  5B1M D;  4J8V D;  3WA9 B;  4NE5 A;  4QLC C;  4AWL B;  3W98 A;  5GT3 A;  3B6F D;  3VH5 T;  1P3B C;  3O62 A;  2PYO C;  4WU8 B;  3KUY B;  1ID3 C;  1U35 D;  1KX5 D;  5B32 A;  2NQB C;  3B0D C;  1H3O A;  4XZQ B;  4Z66 D;  3WTP C;  1BH8 B;  3UTA A;  5DNM B;  5B0Z C;  3NQJ A;  3W96 C;  3X1U D;  4XUJ A;  3AV1 B;  1P3I B;  2F8N H;  1F1E A;  3MGP A;  1WWS A;  3B6G B;  3LEL D;  4J8W A;  5B2I A;  3B0C W;  5CPI C;  1P3G A;  5CPJ A;  5GT0 A;  5B2J C;  3TU4 B;  1P3B B;  5B40 C;  2PYO B;  1ID3 B;  3B0D B;  4HGA C;  5CP6 B;  4WV4 B;  3AV2 A;  3WTP B;  5F99 A;  2CV5 A;  5GT3 C;  3AZN D;  5B1M A;  4J8V A;  3AZG A;  3O62 C;  3A6N D;  5B32 C;  5JRG A;  3REI D;  4EO5 C;  3UTA C;  4CSR B;  4Z66 A;  3AZE D;  1P3K D; 
#chains in the Genus database with same CATH topology
 3REK D;  3LZ0 B;  5B0Y C;  2NZD D;  5B1L B;  5BNV A;  5GSU D;  5AV5 D;  3X1U A;  3MGP C;  3AZM D;  4H9N B;  2F8N B;  5DNN B;  4J8W C;  3LEL A;  2J8P A;  5CPJ C;  1Q9C A;  5GT0 C;  5JA4 B;  1P3F D;  2Y2J A;  5AVC D;  3UTB B;  1P3M D;  3AV2 C;  5F99 C;  1EQZ D;  1BH9 A;  2CV5 C;  3REJ D;  5B1M C;  3V9R B;  4J8V C;  3B0B A;  3B6F C;  3AZF B;  5B0Y B;  4H9S A;  3A6N A;  1U35 C;  1KX5 C;  3EPH A;  3AN2 D;  4Z66 C;  4UPK A;  5GT0 B;  5B31 B;  3AZE A;  3X1U C;  1P3K A;  3REK A;  3REL A;  2NZD A;  4H9Q B;  3AV2 B;  5AV5 A;  5GSU A;  3AZM A;  5F99 B;  3LEL C;  3LJA D;  5AV8 B;  5B1M B;  3UT9 A;  1AOI B;  3AZH D;  3B6F B;  1P3F A;  1U35 B;  5AVC A;  1KX5 B;  1P3M A;  3NQU A;  4ZUX B;  1EQZ A;  3W98 D;  3REJ A;  3AZN C;  4J8X D;  4YM6 B;  4H9P B;  5B33 B;  4H9S C;  3A6N C;  3MGS D;  3X1T A;  4KUD D;  3LEL B;  4G91 B;  1N1J B;  3AN2 A;  3H0L C;  3AYW D;  3REI C;  2RIQ A;  1P3A B;  3AZE C;  4J8U D;  1M19 B;  4H9R A;  1P3K C;  3W97 D;  4XUJ D;  5KDM A;  3REK C;  2NZD C;  3MVD A;  5AV5 C;  5GSU C;  3AZM C;  1P3L D;  2Y2I A;  4JJN D;  5B2I D;  3LJA A;  2Y2K A;  3A1K A;  3AZN B;  1P3G D;  1P34 D;  2HIO D;  1P3F C;  4H9O A;  5AVC C;  5GXQ B;  1P3M C;  4M6B A;  1EQZ C;  3REI B;  1KX4 D;  5BNX A;  5FUG A;  3REJ C;  3KXB D;  3AZG D;  3R45 B;  2FJ7 D;  4J8X A;  1Z2C B;  5JRG D;  5AV5 B;  3AZM B;  3MGR D;  3MGS A;  3MGQ B;  4WNN B;  3AN2 C;  4KUD A;  4E45 A;  4KGC B;  3X1S B;  3AZL D;  1TAF A;  2YFV A;  3LZ1 D;  1F66 B;  3AYW A;  4Z5T D;  3AZI A;  4J8U A;  5B31 G;  3AFA D;  4ZBJ C;  3W97 A;  4R8P B;  4X23 B;  1P3P D;  2RVQ D;  3NQU B;  2Y2M A;  5AV6 A;  1P3L A;  3LJA C;  5E5A B;  4JJN A;  3AZH C;  4QLC B;  2YFW A;  1P34 A;  2HIO A;  2BYK A;  1HTA A;  5AY8 D;  1TZY D;  2NQB B;  4WU9 D;  5CHL B;  2G5H C;  5BT1 D;  3W98 C;  5AVB D;  1KX4 A;  4J8X C;  3KXB A;  5AV9 A;  5B0Z B;  2FJ7 A;  3MGS C;  3W96 B;  3H0M C;  4KUD C;  3WAA A;  1ZLA D;  1M18 D;  3MGR A;  1W2E A;  3AYW C;  1KX3 D;  1JFI A;  3AZL A;  3AZI C;  3AZH B;  1HQ3 D;  3LZ1 A;  4J8U C;  2CWE A;  5CPI B;  3W97 C;  4Z5T A;  4XUJ C;  5B2J B;  5B40 B;  3REL D;  3AFA A;  5G49 B;  1P3L C;  3EPJ A;  3X1V A;  1P3P A;  4CAY A;  5BNX B;  4JJN C;  5CPK D;  3MNN D;  4HGA B;  3REH D;  3UT9 D;  5B2I C;  3C1C A;  4YS3 A;  3W98 B;  2LY8 A;  1P3G C;  1P34 C;  5GT3 B;  3WTP E;  2HIO C;  3O62 B;  5B24 D;  5B32 B;  1S32 D;  1M1A D;  5AY8 A;  1H3O B;  2YFV B;  3WKJ D;  4DRA A;  4LD9 A;  1TZY A;  1BFM A;  4WU9 A;  1KX4 C;  4EO5 B;  3UTA B;  3KXB C;  4J8U B;  3AZG C;  3NQJ B;  2FJ7 C;  4XUJ B;  5BO0 A;  5AVB A;  4G92 C;  3WA9 D;  3X1T D;  1T3U A;  5JRG C;  2ZY2 A;  3IP4 C;  3MGP B;  3MGR C;  1ZLA A;  1M18 A;  3AZL C;  4J8W B;  5B2I B;  3LZ1 C;  1KX3 A;  3B0C T;  1P3G B;  5CPJ B;  4Z5T C;  4KHA A;  1HQ3 A;  2BYM A;  2ARO A;  3AFA C;  4UUZ A;  3KWQ A;  3MVD D;  5DNM D;  1P3P C;  2RVQ C;  3AV1 D;  3W99 A;  1P3I D;  4YS3 C;  3C1C C;  1ULY A;  2Y2L A;  2CV5 B;  5CPK A;  3P5J B;  3MNN A;  3REH A;  3EG5 B;  4J8V B;  3AZK D;  3AZG B;  3B6G D;  4WZS B;  5JRG B;  2Y2Q A;  3TU4 D;  5AY8 C;  5B24 A;  3AL0 C;  4LD9 C;  1TZY C;  4WU9 C;  1S32 A;  1M1A A;  3LZ1 B;  4Z66 B;  3WKJ A;  5BT1 C;  5CP6 D;  5AVB C;  5BNV B;  2DQN C;  3VH5 A;  3X1U B;  1P3P B;  3WA9 A;  4NE6 A;  4DRB A;  1ZLA C;  1M18 C;  3EPL A;  1KX3 C;  4WU8 A;  4NE3 A;  1HQ3 C;  3AZI D;  2ARO C;  3EPK A;  4XZQ A;  3REL C;  3W99 C;  5C3I C;  5AV6 D;  1BH8 A;  2Y2G A;  5DNM A;  3LZ0 D;  3AV1 A;  5B1L D;  3C1B D;  1BH9 B;  5CPK C;  1B67 A;  3MNN C;  3REH C;  1P3I A;  3UT9 C;  2F8N D;  5DNN D;  3B6G A;  3VH6 W;  3AZK A;  3A6N B;  5B24 C;  1M18 B;  5B32 G;  1S32 C;  3UTB D;  3TU4 A;  1M1A C;  2PYO A;  1KX3 B;  3WKJ C;  3AZE B;  5CP6 A;  5AV9 D;  1P3K B;  3KFU G;  2DF4 C;  4AWL C;  3WA9 C;  3WTP A;  3REK B;  3REL B;  3X1T C;  1P3O D;  3WAA D;  2NZD B;  5GSU B;  3AZF D;  3UT9 B;  1P3F B;  5AVC B;  3AZJ D;  4CSR A;  5DNM C;  3MVD C;  3AV1 C;  3X1V D;  1P3M B;  1P3I C;  1WWI A;  4DQY B;  3LZ0 A;  4YS3 D;  3C1C D;  5B1L A;  3C1B A;  1EQZ B;  4Z2M G;  3REJ B;  3B6G C;  2ZY3 A;  3AZK C;  4H9N A;  2F8N A;  5AV8 D;  5DNN A;  1AOI D;  3X1T B;  3TU4 C;  5JA4 A;  3AN2 B;  4LD9 D;  3UTB A;  5CP6 C;  4H9R B;  5KDM B;  4ZUX D;  3MVD B;  3V9R A;  4ZBJ B;  4YM6 D;  5B33 D;  1P3O A;  3AZF A;  5B0Y A;  3LJA B;  3AZK B;  4E44 A;  3VH6 T;  4H9O B;  2ARO D;  3KWQ D;  1P3A D;  1M19 D;  5B31 A;  5AV6 C;  3AZJ A;  3W99 D;  2FFF B;  3LZ0 C;  4Z2M H;  5B1L C;  3C1B C;  5FUG B;  4H9Q A;  5DNN C;  2HUE C;  2JSS A;  4J8X B;  5AV8 A;  3MGS B;  1AOI A;  4KUD B;  3B6F A;  3UTB C;  3F6T A;  1TAF B;  5GXQ D;  3AYW B;  1U35 A;  1KX5 A;  2VQR A;  3AZI B;  5AV9 C;  3W97 B;  4ZUX A;  1P3O C;  3WAA C;  5AV6 B;  4YM6 A;  4H9P A;  3AZF C;  5B33 A;  1P3L B;  3C1B B;  2JCH A;  3MGQ D;  3KUY D;  4JJN B;  4WU8 D;  4KGC D;  3X1S D;  2YFW B;  2HUE B;  1P34 B;  4XZQ D;  1N1J A;  1R4V A;  1F66 D;  2HIO B;  2BYK B;  5B31 C;  3AZJ C;  1P3A A;  3X1V C;  1M19 A;  4R8P D;  4X23 D;  1KX4 B;  3KXB B;  5E5A D;  2F2A C;  1B6W A;  5AV8 C;  5AV9 B;  1KU5 A;  2FJ7 B;  1AOI C;  4G92 B;  4QLC D;  1P3O B;  3WAA B;  3AZN A;  3MGR B;  1P3B D;  2PYO D;  1ID3 D;  1JFI B;  3AZL B;  5GXQ A;  2NQB D;  4Z5T B;  4ZUX C;  2Y2O A;  3REI A;  3WTP D;  2ZY5 A;  3AZJ B;  3AFA B;  4YM6 C;  5B33 C;  3X1V B;  3R45 A;  4CAY B;  5B0Z D;  3W96 D;  3VH5 W;  4YS3 B;  3C1C B;  2BG1 A;  3H0R C;  3MGQ A;  4G91 C;  4WNN A;  3KUY A;  2W8S A;  4KGC A;  3X1S A;  3KWQ C;  1P3A C;  1F66 A;  2UWX A;  1M19 C;  5CPI D;  5B2J D;  5AY8 B;  5B40 D;  4WJ3 C;  4LD9 B;  1TZY B;  4R8P A;  4WU9 B;  4X23 A;  5BS7 A;  5AVB B;  5BO0 B;  2F8N K;  5E5A A;  1PZR A;  5GT3 D;  4QLC A;  3O62 D;  2Y2H A;  1ZLA B;  5B32 D;  1P3B A;  5GXQ C;  1ID3 A;  4KHA B;  1HQ3 B;  2NQB A;  4NFT A;  2BYM B;  2ARO B;  3KWQ B;  2IO5 C;  4UUZ B;  3UTA D;  3KSY A;  1A7W A;  3W99 B;  5C3I B;  5B0Z A;  5B0Y D;  3W96 A;  3MGP D;  3MGQ C;  3KUY C;  4WU8 C;  5CPK B;  3MNN B;  3REH B;  4KGC C;  3X1S C;  3VH6 A;  4J8W D;  2F8N G;  4XZQ C;  1F66 C;  5CPJ D;  5GT0 D;  2XD1 A;  5B31 D;  5B24 B;  3AZH A;  5CPI A;  2ZY4 A;  4R8P C;  2L5A A;  1S32 B;  4X23 C;  5B2J A;  1M1A B;  5B40 A;  3WKJ B;  5BS7 C;  5G49 A;  3AV2 D;  5E5A C;  5F99 D;  2IO5 B;  2CV5 D;  5B1M D;  4J8V D;  3WA9 B;  4NE5 A;  4QLC C;  4AWL B;  3W98 A;  5GT3 A;  3B6F D;  3VH5 T;  1P3B C;  3O62 A;  2PYO C;  4WU8 B;  3KUY B;  1ID3 C;  1U35 D;  1KX5 D;  5B32 A;  2NQB C;  3B0D C;  1H3O A;  4XZQ B;  4Z66 D;  3WTP C;  1BH8 B;  3UTA A;  5DNM B;  5B0Z C;  3NQJ A;  3W96 C;  3X1U D;  4XUJ A;  3AV1 B;  1P3I B;  2ZM5 A;  2F8N H;  3FDD A;  1F1E A;  3MGP A;  1WWS A;  2Y2N A;  3B6G B;  3LEL D;  4J8W A;  2JE5 A;  5B2I A;  3B0C W;  5CPI C;  1P3G A;  5CPJ A;  2Y2P A;  5GT0 A;  5B2J C;  3TU4 B;  1P3B B;  5B40 C;  2PYO B;  1ID3 B;  3A1I A;  3B0D B;  2XD5 A;  4HGA C;  5CP6 B;  4WV4 B;  3AV2 A;  3WTP B;  5F99 A;  2CV5 A;  5GT3 C;  3AZN D;  2G5I C;  5B1M A;  4J8V A;  3AZG A;  3O62 C;  3A6N D;  5B32 C;  5JRG A;  3REI D;  4EO5 C;  3UTA C;  4CSR B;  4Z66 A;  3AZE D;  1P3K D; 
#chains in the Genus database with same CATH homology
 3REK D;  3LZ0 B;  5B0Y C;  2NZD D;  5B1L B;  5BNV A;  5GSU D;  5AV5 D;  3X1U A;  3MGP C;  3AZM D;  4H9N B;  2F8N B;  5DNN B;  4J8W C;  3LEL A;  2J8P A;  5CPJ C;  1Q9C A;  5GT0 C;  5JA4 B;  1P3F D;  2Y2J A;  5AVC D;  3UTB B;  1P3M D;  3AV2 C;  5F99 C;  1EQZ D;  1BH9 A;  2CV5 C;  3REJ D;  5B1M C;  3V9R B;  4J8V C;  3B0B A;  3B6F C;  3AZF B;  5B0Y B;  4H9S A;  3A6N A;  1U35 C;  1KX5 C;  3EPH A;  3AN2 D;  4Z66 C;  4UPK A;  5GT0 B;  5B31 B;  3AZE A;  3X1U C;  1P3K A;  3REK A;  3REL A;  2NZD A;  4H9Q B;  3AV2 B;  5AV5 A;  5GSU A;  3AZM A;  5F99 B;  3LEL C;  3LJA D;  5AV8 B;  5B1M B;  3UT9 A;  1AOI B;  3AZH D;  3B6F B;  1P3F A;  1U35 B;  5AVC A;  1KX5 B;  1P3M A;  3NQU A;  4ZUX B;  1EQZ A;  3W98 D;  3REJ A;  3AZN C;  4J8X D;  4YM6 B;  4H9P B;  5B33 B;  4H9S C;  3A6N C;  3MGS D;  3X1T A;  4KUD D;  3LEL B;  4G91 B;  1N1J B;  3AN2 A;  3H0L C;  3AYW D;  3REI C;  2RIQ A;  1P3A B;  3AZE C;  4J8U D;  1M19 B;  4H9R A;  1P3K C;  3W97 D;  4XUJ D;  5KDM A;  3REK C;  2NZD C;  3MVD A;  5AV5 C;  5GSU C;  3AZM C;  1P3L D;  2Y2I A;  4JJN D;  5B2I D;  3LJA A;  2Y2K A;  3A1K A;  3AZN B;  1P3G D;  1P34 D;  2HIO D;  1P3F C;  4H9O A;  5AVC C;  5GXQ B;  1P3M C;  4M6B A;  1EQZ C;  3REI B;  1KX4 D;  5BNX A;  5FUG A;  3REJ C;  3KXB D;  3AZG D;  3R45 B;  2FJ7 D;  4J8X A;  1Z2C B;  5JRG D;  5AV5 B;  3AZM B;  3MGR D;  3MGS A;  3MGQ B;  4WNN B;  3AN2 C;  4KUD A;  4E45 A;  4KGC B;  3X1S B;  3AZL D;  1TAF A;  2YFV A;  3LZ1 D;  1F66 B;  3AYW A;  4Z5T D;  3AZI A;  4J8U A;  5B31 G;  3AFA D;  4ZBJ C;  3W97 A;  4R8P B;  4X23 B;  1P3P D;  2RVQ D;  3NQU B;  2Y2M A;  5AV6 A;  1P3L A;  3LJA C;  5E5A B;  4JJN A;  3AZH C;  4QLC B;  2YFW A;  1P34 A;  2HIO A;  2BYK A;  1HTA A;  5AY8 D;  1TZY D;  2NQB B;  4WU9 D;  5CHL B;  2G5H C;  5BT1 D;  3W98 C;  5AVB D;  1KX4 A;  4J8X C;  3KXB A;  5AV9 A;  5B0Z B;  2FJ7 A;  3MGS C;  3W96 B;  3H0M C;  4KUD C;  3WAA A;  1ZLA D;  1M18 D;  3MGR A;  1W2E A;  3AYW C;  1KX3 D;  1JFI A;  3AZL A;  3AZI C;  3AZH B;  1HQ3 D;  3LZ1 A;  4J8U C;  2CWE A;  5CPI B;  3W97 C;  4Z5T A;  4XUJ C;  5B2J B;  5B40 B;  3REL D;  3AFA A;  5G49 B;  1P3L C;  3EPJ A;  3X1V A;  1P3P A;  4CAY A;  5BNX B;  4JJN C;  5CPK D;  3MNN D;  4HGA B;  3REH D;  3UT9 D;  5B2I C;  3C1C A;  4YS3 A;  3W98 B;  2LY8 A;  1P3G C;  1P34 C;  5GT3 B;  3WTP E;  2HIO C;  3O62 B;  5B24 D;  5B32 B;  1S32 D;  1M1A D;  5AY8 A;  1H3O B;  2YFV B;  3WKJ D;  4DRA A;  4LD9 A;  1TZY A;  1BFM A;  4WU9 A;  1KX4 C;  4EO5 B;  3UTA B;  3KXB C;  4J8U B;  3AZG C;  3NQJ B;  2FJ7 C;  4XUJ B;  5BO0 A;  5AVB A;  4G92 C;  3WA9 D;  3X1T D;  1T3U A;  5JRG C;  2ZY2 A;  3IP4 C;  3MGP B;  3MGR C;  1ZLA A;  1M18 A;  3AZL C;  4J8W B;  5B2I B;  3LZ1 C;  1KX3 A;  3B0C T;  1P3G B;  5CPJ B;  4Z5T C;  4KHA A;  1HQ3 A;  2BYM A;  2ARO A;  3AFA C;  4UUZ A;  3KWQ A;  3MVD D;  5DNM D;  1P3P C;  2RVQ C;  3AV1 D;  3W99 A;  1P3I D;  4YS3 C;  3C1C C;  1ULY A;  2Y2L A;  2CV5 B;  5CPK A;  3P5J B;  3MNN A;  3REH A;  3EG5 B;  4J8V B;  3AZK D;  3AZG B;  3B6G D;  4WZS B;  5JRG B;  2Y2Q A;  3TU4 D;  5AY8 C;  5B24 A;  3AL0 C;  4LD9 C;  1TZY C;  4WU9 C;  1S32 A;  1M1A A;  3LZ1 B;  4Z66 B;  3WKJ A;  5BT1 C;  5CP6 D;  5AVB C;  5BNV B;  2DQN C;  3VH5 A;  3X1U B;  1P3P B;  3WA9 A;  4NE6 A;  4DRB A;  1ZLA C;  1M18 C;  3EPL A;  1KX3 C;  4WU8 A;  4NE3 A;  1HQ3 C;  3AZI D;  2ARO C;  3EPK A;  4XZQ A;  3REL C;  3W99 C;  5C3I C;  5AV6 D;  1BH8 A;  2Y2G A;  5DNM A;  3LZ0 D;  3AV1 A;  5B1L D;  3C1B D;  1BH9 B;  5CPK C;  1B67 A;  3MNN C;  3REH C;  1P3I A;  3UT9 C;  2F8N D;  5DNN D;  3B6G A;  3VH6 W;  3AZK A;  3A6N B;  5B24 C;  1M18 B;  5B32 G;  1S32 C;  3UTB D;  3TU4 A;  1M1A C;  2PYO A;  1KX3 B;  3WKJ C;  3AZE B;  5CP6 A;  5AV9 D;  1P3K B;  3KFU G;  2DF4 C;  4AWL C;  3WA9 C;  3WTP A;  3REK B;  3REL B;  3X1T C;  1P3O D;  3WAA D;  2NZD B;  5GSU B;  3AZF D;  3UT9 B;  1P3F B;  5AVC B;  3AZJ D;  4CSR A;  5DNM C;  3MVD C;  3AV1 C;  3X1V D;  1P3M B;  1P3I C;  1WWI A;  4DQY B;  3LZ0 A;  4YS3 D;  3C1C D;  5B1L A;  3C1B A;  1EQZ B;  4Z2M G;  3REJ B;  3B6G C;  2ZY3 A;  3AZK C;  4H9N A;  2F8N A;  5AV8 D;  5DNN A;  1AOI D;  3X1T B;  3TU4 C;  5JA4 A;  3AN2 B;  4LD9 D;  3UTB A;  5CP6 C;  4H9R B;  5KDM B;  4ZUX D;  3MVD B;  3V9R A;  4ZBJ B;  4YM6 D;  5B33 D;  1P3O A;  3AZF A;  5B0Y A;  3LJA B;  3AZK B;  4E44 A;  3VH6 T;  4H9O B;  2ARO D;  3KWQ D;  1P3A D;  1M19 D;  5B31 A;  5AV6 C;  3AZJ A;  3W99 D;  2FFF B;  3LZ0 C;  4Z2M H;  5B1L C;  3C1B C;  5FUG B;  4H9Q A;  5DNN C;  2HUE C;  2JSS A;  4J8X B;  5AV8 A;  3MGS B;  1AOI A;  4KUD B;  3B6F A;  3UTB C;  3F6T A;  1TAF B;  5GXQ D;  3AYW B;  1U35 A;  1KX5 A;  2VQR A;  3AZI B;  5AV9 C;  3W97 B;  4ZUX A;  1P3O C;  3WAA C;  5AV6 B;  4YM6 A;  4H9P A;  3AZF C;  5B33 A;  1P3L B;  3C1B B;  2JCH A;  3MGQ D;  3KUY D;  4JJN B;  4WU8 D;  4KGC D;  3X1S D;  2YFW B;  2HUE B;  1P34 B;  4XZQ D;  1N1J A;  1R4V A;  1F66 D;  2HIO B;  2BYK B;  5B31 C;  3AZJ C;  1P3A A;  3X1V C;  1M19 A;  4R8P D;  4X23 D;  1KX4 B;  3KXB B;  5E5A D;  2F2A C;  1B6W A;  5AV8 C;  5AV9 B;  1KU5 A;  2FJ7 B;  1AOI C;  4G92 B;  4QLC D;  1P3O B;  3WAA B;  3AZN A;  3MGR B;  1P3B D;  2PYO D;  1ID3 D;  1JFI B;  3AZL B;  5GXQ A;  2NQB D;  4Z5T B;  4ZUX C;  2Y2O A;  3REI A;  3WTP D;  2ZY5 A;  3AZJ B;  3AFA B;  4YM6 C;  5B33 C;  3X1V B;  3R45 A;  4CAY B;  5B0Z D;  3W96 D;  3VH5 W;  4YS3 B;  3C1C B;  2BG1 A;  3H0R C;  3MGQ A;  4G91 C;  4WNN A;  3KUY A;  2W8S A;  4KGC A;  3X1S A;  3KWQ C;  1P3A C;  1F66 A;  2UWX A;  1M19 C;  5CPI D;  5B2J D;  5AY8 B;  5B40 D;  4WJ3 C;  4LD9 B;  1TZY B;  4R8P A;  4WU9 B;  4X23 A;  5BS7 A;  5AVB B;  5BO0 B;  2F8N K;  5E5A A;  1PZR A;  5GT3 D;  4QLC A;  3O62 D;  2Y2H A;  1ZLA B;  5B32 D;  1P3B A;  5GXQ C;  1ID3 A;  4KHA B;  1HQ3 B;  2NQB A;  4NFT A;  2BYM B;  2ARO B;  3KWQ B;  2IO5 C;  4UUZ B;  3UTA D;  3KSY A;  1A7W A;  3W99 B;  5C3I B;  5B0Z A;  5B0Y D;  3W96 A;  3MGP D;  3MGQ C;  3KUY C;  4WU8 C;  5CPK B;  3MNN B;  3REH B;  4KGC C;  3X1S C;  3VH6 A;  4J8W D;  2F8N G;  4XZQ C;  1F66 C;  5CPJ D;  5GT0 D;  2XD1 A;  5B31 D;  5B24 B;  3AZH A;  5CPI A;  2ZY4 A;  4R8P C;  2L5A A;  1S32 B;  4X23 C;  5B2J A;  1M1A B;  5B40 A;  3WKJ B;  5BS7 C;  5G49 A;  3AV2 D;  5E5A C;  5F99 D;  2IO5 B;  2CV5 D;  5B1M D;  4J8V D;  3WA9 B;  4NE5 A;  4QLC C;  4AWL B;  3W98 A;  5GT3 A;  3B6F D;  3VH5 T;  1P3B C;  3O62 A;  2PYO C;  4WU8 B;  3KUY B;  1ID3 C;  1U35 D;  1KX5 D;  5B32 A;  2NQB C;  3B0D C;  1H3O A;  4XZQ B;  4Z66 D;  3WTP C;  1BH8 B;  3UTA A;  5DNM B;  5B0Z C;  3NQJ A;  3W96 C;  3X1U D;  4XUJ A;  3AV1 B;  1P3I B;  2ZM5 A;  2F8N H;  3FDD A;  1F1E A;  3MGP A;  1WWS A;  2Y2N A;  3B6G B;  3LEL D;  4J8W A;  2JE5 A;  5B2I A;  3B0C W;  5CPI C;  1P3G A;  5CPJ A;  2Y2P A;  5GT0 A;  5B2J C;  3TU4 B;  1P3B B;  5B40 C;  2PYO B;  1ID3 B;  3A1I A;  3B0D B;  2XD5 A;  4HGA C;  5CP6 B;  4WV4 B;  3AV2 A;  3WTP B;  5F99 A;  2CV5 A;  5GT3 C;  3AZN D;  2G5I C;  5B1M A;  4J8V A;  3AZG A;  3O62 C;  3A6N D;  5B32 C;  5JRG A;  3REI D;  4EO5 C;  3UTA C;  4CSR B;  4Z66 A;  3AZE D;  1P3K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...