4H9RB

Complex structure 5 of daxx(e225a)/h3.3(sub5,g90a)/h4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
molecule tags Dna binding protein/apoptosis
source organism Homo sapiens
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
total genus 26
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9rB00
3MGSB 4J8UC 3NQJA 5CPIC 3AN2A 1P34B 2HUEC 3X1TD 1P3LD 4LD9D 5CP6A 5JRGA 3AZLD 5B2JA 4JJNC 1M18A 4CAYA 3B0DC 3REID 5B1LD 3NQJB 1P34A 5BNXB 3MGSC 4J8UB 1TZYD 5B2JC 1F1EA 1M19C 2HIOA 3AZND 5DNNB 4WU9A 3W96A 3LJAC 3C1BA 3B6GC 5E5AA 5B31A 2RVQD 3AFAA 5B2ID 4UUZA 5CPKC 2PYOB 3REJA 5B2IA 3WAAC 1P3AC 1M19D 3MGPB 3A6NB 2AROC 5E5AB 5AV8B 5AV9B 3X1UC 3LZ1B 4XZQB 5JA4A 2F8NA 2HIOD 5F99C 5CPJC 3B6GD 3REJD 5AVBD 4KGCB 2NZDB 1P3MA 3AZKB 5B31D 3AV1A 3KSYA 4H9NA 4YM6B 3AYWA 1P3PB 3WA9A 4DRAA 5B1MA 4LD9A 3MGRA 4KGCA 2NZDA 4J8XD 5B1MC 1M18C 1TZYA 3REHB 3AZIB 1JFIB 3X1SA 3AN2C 4Z2MH 3MGPA 4WNNB 1HQ3A 3MGRB 4G91B 1P3LA 1P3BD 4Z66A 3WTPA 3REHA 3AZIA 1U35D 1P3MD 2F8NB 3WKJB 3KWQA 3AZGB 4YM6A 4XZQC 5B2IC 3C1BB 5AV5A 4R8PD 4X23B 3X1UB 5CPKA 1P3PA 5AV8C 5AV9C 3MVDB 1ID3A 5GT0C 4WV4B 5BNVA 4H9PA 2PYOA 3AV2D 3LJAA 3MGQB 1TZYB 4CSRA 4EO5B 2AROD 3VH6T 3X1UD 3KUYB 3C1BD 3A6NA 1EQZD 2HIOC 5B1LB 5F99D 5CPJD 3V9RB 4DRBA 3UTBD 3B6FA 5AY8C 3TU4A 3AZLB 3LZ0A 3W99B 1P3FB 5B0YA 5DNNC 1P3MB 1P34D 3AZFD 3NQUA 5B2JB 3WTPE 3MNNA 4YS3D 4H9SC 3B0CW 3W97C 3AZLA 1M18D 4H9RB 5B0YB 2CWEA 1KX5D 4J8UA 3B0CT 1KX4D 3AN2D 3AZMD 2HUEB 4XUJD 3UTAD 1P34C 2BYKA 3RELD 5GXQA 1P3BC 4Z2MG 3REKB 1U35C 4YS3C 4J8VD 3W98C 3V9RA 3B6FB 3LZ0C 3AZKD 1KX4B 5AVCB 5JRGC 5CP6C 4AWLC 4KUDB 3TU4C 5BS7C 4KUDC 5B32C 2CV5B 1KX4C 4XZQD 1P3IA 1P3KA 1P3OC 4R8PC 3VH6A 1N1JB 1ZLAC 4YS3B 1B6WA 3UTAC 4WU8D 4NFTA 1F66B 2CV5D 5GT0A 1P3FD 2CV5A 5B33A 1S32D 5G49A 4WU8A 5AVCD 3TU4D 3UTBC 4J8WA 1AOIB 1P3OD 3LELC 3AYWB 1M1AA 3REKA 3VH5W 3X1VA 5DNND 3AZFC 4E44A 1P3LC 4KUDA 4JJND 1P3FC 3W99C 5BO0A 5AV5D 4R8PA 3REIC 3AZEA 1BH9A 3X1VC 5BT1D 5AY8B 3REIB 5AV8A 5GXQD 5AV9A 5GT3A 4XZQA 1P3LB 5DNMA 3KUYC 5KDMA 5AV6A 3AZHD 3X1TB 4EO5C 1KX3C 1F66D 2NQBD 3WKJD 3AZHA 3AZKA 1P3BA 3AYWC 2F8NK 1AOIC 4CAYB 4Z66C 3WTPC 4X23C 3UTBB 1P3GD 3WA9B 5BT1C 5B40D 3X1SD 5AV5B 4X23A 4G92C 3AZFA 1P3IC 1P3KC 4AWLB 3W97A 4J8XA 3MGQA 5DNNA 3WKJC 1ZLAB 1M1AD 3RELB 3AYWD 1P3OB 5B32B 5B31B 2CV5C 2YFWA 3REJC 3AN2B 4ZUXD 3TU4B 5B40C 3AV2A 1S32B 3LZ0B 1BFMA 3B6FC 3KWQB 1M18B 3W98B 1U35B 4WU8B 2F8ND 3LELD 1P3BB 3C1CD 4J8WB 5BS7A 4WU9C 4H9OA 1M19A 3X1UA 5B24B 3MVDA 3KWQD 3MGSA 3W99D 2PYOD 1P3AA 3REHD 3AZID 4CSRB 3W97B 5BO0B 5F99B 5CPJB 4J8VB 3AFAC 3AZEB 1Q9CA 3RELA 2AROB 3UTAA 4XUJA 1P3MC 4HGAC 2NQBC 4WU9D 3AZNA 2L5AA 1P3AB 5DNMB 4ZBJB 1KX4A 3AZLC 1KX5A 4KGCD 4Z66D 3WTPD 2PYOC 2NZDD 4H9SA 3X1SB 5B1LC 3WA9D 3X1SC 3LZ1D 4YS3A 3AZJB 2BYMA 1TZYC 5B2JD 4ZBJC 2NQBB 5GT0B 5AVBA 2F8NH 3MVDC 3MGRD 3C1BC 5G49B 3B6GA 5B2IB 1R4VA 5GSUA 3AZJA 5F99A 2RVQC 5CPJA 1EQZB 4KHAA 3AV1D 4NE6A 4JJNB 3AZNB 3O62A 1P3AD 3MGPD 4WU9B 3MVDD 1P3PD 3WAAA 3KWQC 2YFVA 4H9QB 3REHC 3W96C 3AZIC 5B1MB 3AV1C 3REJB 2F8NG 5B31C 3AFAD 3RELC 5AVBC 5E5AD 3LZ1A 3AZKC 5JRGD 5CP6D 5GSUD 1HQ3B 4KGCC 1B67A 2NZDC 5B0ZC 4G92B 3WA9C 3O62B 3LZ1C 3O62C 5B1MD 4E45A 5B1LA 3WAAB 1HQ3C 5JRGB 5CPKB 3X1TA 2YFVB 4H9QA 5GSUC 5AVBB 3LJAB 1N1JA 4LD9C 3AV1B 5AV8D 5AV9D 5GT3C 3AZFB 4JJNA 3KXBB 4QLCA 3MGSD 2FJ7A 3X1VD 3UT9D 1JFIA 5GXQB 3B0DB 5AY8D 3AZNC 1BH8A 5B31G 3AZJD 3W96D 5B32A 3C1CA 3LELA 1KX3D 1F66C 5AVCA 1EQZC 3MGQD 3AV2B 1S32A 1H3OA 5CPIB 2JSSA 1TAFB 4ZUXA 4R8PB 4X23D 2IO5B 3AZGA 1P3GC 4M6BA 3REIA 5B0ZD 1KX5C 1P3ID 1P3KD 5B24A 4NE3A 3AZJC 4Z5TD 1KU5A 5CPIA 5BNXA 5B33B 3W97D 4XUJC 2NQBA 3REKC 5AV6D 5FUGA 1M1AC 4WZSB 4J8VA 5B40A 1AOIA 5DNMC 3KUYA 3AZMC 4HGAB 4KHAB 3C1CB 5B0YC 3AZMA 4KUDD 3B0BA 2LY8A 3AFAB 3AZEC 4J8VC 4UUZB 4J8XB 3W98D 1F66A 3W99A 4J8XC 1H3OB 4Z5TA 3REKD 4ZUXB 5GT3D 1P3OA 3NQUB 3MNNB 2BYMB 5B24C 5C3IC 3MNND 3AZMB 4QLCC 2FJ7C 1ULYA 3VH5T 1ZLAD 5JA4B 4J8WC 5B0YD 3UT9C 1ID3C 4WU8C 2HIOB 5B33C 3VH6W 5FUGB 3UTBA 1S32C 5B40B 3A6ND 3MGQC 2BYKB 1EQZA 5AY8A 4QLCD 2FJ7D 3R45A 5KDMB 5AV6B 5GT0D 3KXBD 1P3FA 1ZLAA 3AZHB 1TAFA 1ID3D 3AV2C 4Z5TB 3AZGC 1P3GA 1P3IB 4Z5TC 1P3KB 3KUYD 2YFWB 5AV5C 3AZHC 1WWIA 4NE5A 5GXQC 5AV6C 4G91C 3WTPB 4Z66B 3MGRC 3WKJA 4J8UD 3W98A 5CPID 5DNMD 1BH9B 1WWSA 3KXBC 4H9NB 3X1TC 1KX3B 5GT3B 1AOID 3AZED 3AZGD 4LD9B 5B32G 1ID3B 3UT9B 3VH5A 3X1VB 3KXBA 4H9PB 1P3PC 4QLCB 5GSUB 2FJ7B 5C3IB 1A7WA 4YM6C 1KX3A 5B24D 3MNNC 5B0ZA 4ZUXC 1BH8B 4WNNA 4J8WD 3UT9A 3LELB 5B33D 3LJAD 3LZ0D 3C1CC 1HTAA 5E5AC 3A6NC 3MGPC 5B0ZB 5CPKD 3B6FD 5B32D 4YM6D 5CHLB 3WAAD 1M1AB 2AROA 3UTAB 4XUJB 5BNVB 4H9RA 3B6GB 3O62D 3R45B 1U35A 1KX5B 3W96B 1HQ3D 5CP6B 5AVCC 4H9OB 1P3GB 1M19B 2IO5C
chains in the Genus database with same CATH superfamily
2JE5A 3MGSB 4J8UC 3NQJA 5CPIC 3AN2A 1P34B 2HUEC 3X1TD 1P3LD 2ZM5A 5CP6A 5JRGA 3AZLD 5B2JA 2Y2IA 4JJNC 1M18A 4LD9D 4CAYA 3B0DC 3REID 5B1LD 3NQJB 1P34A 5BNXB 3MGSC 4J8UB 1TZYD 5B2JC 1F1EA 1M19C 2HIOA 3AZND 5DNNB 4WU9A 4DQYB 3W96A 3LJAC 3C1BA 3B6GC 5E5AA 5B31A 2RVQD 3AFAA 5B2ID 4UUZA 5CPKC 2PYOB 3REJA 5B2IA 3EG5B 3WAAC 1P3AC 1M19D 3MGPB 3A6NB 2AROC 5E5AB 5AV8B 2Y2JA 5AV9B 3X1UC 3LZ1B 4XZQB 5JA4A 2F8NA 2HIOD 5F99C 5CPJC 2W8SA 3B6GD 3REJD 5AVBD 4KGCB 2NZDB 1P3MA 3AZKB 5B31D 3AV1A 3KSYA 4H9NA 4YM6B 3AYWA 1P3PB 3WA9A 4DRAA 5B1MA 4LD9A 3MGRA 4KGCA 2NZDA 4J8XD 5B1MC 1M18C 1TZYA 3REHB 3AZIB 1JFIB 3EPJA 3X1SA 1T3UA 3AN2C 4Z2MH 3MGPA 4WNNB 1HQ3A 3MGRB 4G91B 1P3LA 1P3BD 4Z66A 3WTPA 3REHA 3AZIA 1U35D 1P3MD 2F8NB 3WKJB 3KWQA 3AZGB 3EPKA 4YM6A 4XZQC 3F6TA 5B2IC 3C1BB 5AV5A 4R8PD 4X23B 3X1UB 5CPKA 1P3PA 5AV8C 5AV9C 3MVDB 1ID3A 5GT0C 4WV4B 5BNVA 4H9PA 2PYOA 3AV2D 3LJAA 3MGQB 1TZYB 4CSRA 4EO5B 2AROD 3VH6T 3X1UD 3KUYB 2Y2GA 3C1BD 3KFUG 3A6NA 1EQZD 2HIOC 2Y2KA 5B1LB 5F99D 3V9RB 4DRBA 5CPJD 3UTBD 3B6FA 5AY8C 3TU4A 3AZLB 3LZ0A 3W99B 1P3FB 5B0YA 5DNNC 1P3MB 1P34D 3AZFD 3NQUA 5B2JB 3WTPE 3MNNA 4YS3D 3IP4C 4H9SC 3B0CW 3W97C 3AZLA 1M18D 4H9RB 5B0YB 2CWEA 1KX5D 4J8UA 3B0CT 1KX4D 3AN2D 3AZMD 2HUEB 4XUJD 3UTAD 1P34C 2BYKA 3RELD 5GXQA 1P3BC 2Y2NA 4Z2MG 3REKB 1U35C 4YS3C 4J8VD 3W98C 3V9RA 3B6FB 3LZ0C 3AZKD 1KX4B 5AVCB 5JRGC 5CP6C 4AWLC 4KUDB 3TU4C 3EPHA 5BS7C 4KUDC 5B32C 2CV5B 1KX4C 4XZQD 1P3IA 1P3KA 1P3OC 4R8PC 3VH6A 1N1JB 1ZLAC 4YS3B 1B6WA 3UTAC 4WU8D 4NFTA 1F66B 2CV5D 5GT0A 1P3FD 2CV5A 5B33A 1S32D 5G49A 4WU8A 5AVCD 3TU4D 3UTBC 4J8WA 3H0LC 1AOIB 1P3OD 3LELC 3AYWB 1M1AA 3REKA 3VH5W 3X1VA 5DNND 3AZFC 4E44A 1P3LC 4KUDA 4JJND 1P3FC 2G5IC 3W99C 5BO0A 5AV5D 4R8PA 3REIC 3AZEA 1BH9A 3X1VC 5BT1D 5AY8B 3REIB 5AV8A 5GXQD 5AV9A 5GT3A 4XZQA 1P3LB 5DNMA 3KUYC 5KDMA 5AV6A 3AZHD 3X1TB 4EO5C 1KX3C 1F66D 2NQBD 3WKJD 3AZHA 3AZKA 1P3BA 3AYWC 2F8NK 1AOIC 4CAYB 4Z66C 3WTPC 4X23C 3UTBB 1P3GD 3WA9B 5BT1C 5B40D 3X1SD 5AV5B 4X23A 4G92C 3AZFA 1P3IC 1P3KC 4AWLB 3W97A 4J8XA 3MGQA 5DNNA 3WKJC 1ZLAB 1M1AD 3RELB 3AYWD 1P3OB 5B32B 5B31B 2CV5C 3H0MC 2YFWA 3REJC 3AN2B 4ZUXD 3TU4B 5B40C 3AV2A 1S32B 3LZ0B 1BFMA 3B6FC 3KWQB 1M18B 3W98B 1U35B 4WU8B 2DQNC 2F8ND 3LELD 1P3BB 3C1CD 4J8WB 5BS7A 4WU9C 4H9OA 3H0RC 1M19A 3X1UA 5B24B 3MVDA 3KWQD 3MGSA 3W99D 2PYOD 1P3AA 3REHD 3AZID 4CSRB 3W97B 5BO0B 3P5JB 4WJ3C 2F2AC 5F99B 5CPJB 4J8VB 3AFAC 3AZEB 1Q9CA 3RELA 2AROB 3UTAA 2G5HC 4XUJA 1P3MC 4HGAC 2NQBC 4WU9D 3AZNA 3A1KA 2L5AA 1P3AB 5DNMB 4ZBJB 2J8PA 1KX4A 3AZLC 1KX5A 4KGCD 4Z66D 3WTPD 2PYOC 2NZDD 4H9SA 3X1SB 5B1LC 3WA9D 3X1SC 3LZ1D 4YS3A 3AZJB 2BYMA 1TZYC 5B2JD 4ZBJC 2NQBB 5GT0B 5AVBA 2F8NH 3MVDC 2FFFB 3MGRD 3C1BC 5G49B 3B6GA 5B2IB 1R4VA 5GSUA 1W2EA 3AZJA 5F99A 2RVQC 5CPJA 1EQZB 4KHAA 3AV1D 4NE6A 4JJNB 3AZNB 3O62A 1P3AD 3MGPD 4WU9B 3MVDD 1P3PD 3WAAA 3KWQC 2YFVA 4H9QB 3REHC 3W96C 3AZIC 5B1MB 3AV1C 3REJB 3FDDA 2F8NG 5B31C 3AFAD 3RELC 5AVBC 5E5AD 3LZ1A 3AZKC 5JRGD 5CP6D 5GSUD 1HQ3B 4KGCC 1B67A 2NZDC 5B0ZC 4G92B 3A1IA 3WA9C 3O62B 3LZ1C 2Y2LA 3O62C 5B1MD 4E45A 5B1LA 1Z2CB 3WAAB 1HQ3C 5JRGB 5CPKB 3X1TA 2YFVB 4H9QA 5GSUC 5AVBB 2ZY2A 3LJAB 1N1JA 2Y2MA 4LD9C 3AV1B 5AV8D 5AV9D 3EPLA 5GT3C 3AZFB 4JJNA 3KXBB 2VQRA 4QLCA 3MGSD 2FJ7A 3X1VD 3UT9D 1JFIA 5GXQB 3B0DB 5AY8D 3AZNC 1BH8A 5B31G 3AZJD 3W96D 5B32A 3C1CA 3LELA 1KX3D 1F66C 5AVCA 1EQZC 3MGQD 3AV2B 1S32A 1H3OA 2XD5A 5CPIB 2JSSA 1TAFB 4ZUXA 4R8PB 4X23D 2IO5B 3AZGA 1P3GC 4M6BA 3REIA 2ZY3A 5B0ZD 1KX5C 1P3ID 1P3KD 2DF4C 4NE3A 5B24A 3AZJC 4Z5TD 1KU5A 5CPIA 5BNXA 5B33B 3W97D 4XUJC 2NQBA 3REKC 5AV6D 5FUGA 1M1AC 4WZSB 4J8VA 5B40A 1AOIA 5DNMC 3KUYA 2Y2PA 3AZMC 2UWXA 4HGAB 4KHAB 3C1CB 5B0YC 3AZMA 4KUDD 3B0BA 2LY8A 3AFAB 3AZEC 4J8VC 4UUZB 4J8XB 3W98D 1F66A 2ZY4A 3W99A 4J8XC 1H3OB 4Z5TA 3REKD 4ZUXB 5GT3D 1P3OA 3NQUB 3MNNB 2BYMB 2JCHA 5B24C 5C3IC 3MNND 3AZMB 4QLCC 2FJ7C 1ULYA 4UPKA 3VH5T 1ZLAD 5JA4B 4J8WC 5B0YD 3UT9C 1ID3C 4WU8C 2HIOB 5B33C 3VH6W 5FUGB 3UTBA 1S32C 5B40B 3A6ND 3MGQC 2BYKB 1EQZA 5AY8A 4QLCD 2FJ7D 1PZRA 3R45A 5KDMB 5AV6B 5GT0D 3KXBD 1P3FA 1ZLAA 3AZHB 1TAFA 1ID3D 3AV2C 4Z5TB 3AZGC 1P3GA 1P3IB 4Z5TC 1P3KB 3KUYD 2YFWB 5AV5C 3AZHC 1WWIA 4NE5A 5GXQC 5AV6C 4G91C 3WTPB 4Z66B 3MGRC 3WKJA 4J8UD 3W98A 5CPID 5DNMD 1BH9B 1WWSA 3KXBC 4H9NB 3X1TC 1KX3B 5GT3B 1AOID 3AZED 2BG1A 3AZGD 4LD9B 2Y2OA 5B32G 1ID3B 3UT9B 3VH5A 3X1VB 3KXBA 4H9PB 1P3PC 4QLCB 5GSUB 2FJ7B 5C3IB 1A7WA 4YM6C 1KX3A 5B24D 3MNNC 3AL0C 5B0ZA 2Y2HA 4ZUXC 1BH8B 4WNNA 4J8WD 2ZY5A 3UT9A 3LELB 5B33D 3LJAD 3LZ0D 3C1CC 1HTAA 5E5AC 3A6NC 3MGPC 5B0ZB 5CPKD 3B6FD 5B32D 4YM6D 5CHLB 3WAAD 1M1AB 2AROA 3UTAB 4XUJB 5BNVB 4H9RA 2RIQA 3B6GB 3O62D 3R45B 1U35A 2Y2QA 1KX5B 2XD1A 3W96B 1HQ3D 5CP6B 5AVCC 4H9OB 1P3GB 1M19B 2IO5C
chains in the Genus database with same CATH topology
2JE5A 3MGSB 4J8UC 3NQJA 5CPIC 3AN2A 1P34B 2HUEC 3X1TD 1P3LD 2ZM5A 5CP6A 5JRGA 3AZLD 5B2JA 2Y2IA 4JJNC 1M18A 4LD9D 4CAYA 3B0DC 3REID 5B1LD 3NQJB 1P34A 5BNXB 3MGSC 4J8UB 1TZYD 5B2JC 1F1EA 1M19C 2HIOA 3AZND 5DNNB 4WU9A 4DQYB 3W96A 3LJAC 3C1BA 3B6GC 5E5AA 5B31A 2RVQD 3AFAA 5B2ID 4UUZA 5CPKC 2PYOB 3REJA 5B2IA 3EG5B 3WAAC 1P3AC 1M19D 3MGPB 3A6NB 2AROC 5E5AB 5AV8B 2Y2JA 5AV9B 3X1UC 3LZ1B 4XZQB 5JA4A 2F8NA 2HIOD 5F99C 5CPJC 2W8SA 3B6GD 3REJD 5AVBD 4KGCB 2NZDB 1P3MA 3AZKB 5B31D 3AV1A 3KSYA 4H9NA 4YM6B 3AYWA 1P3PB 3WA9A 4DRAA 5B1MA 4LD9A 3MGRA 4KGCA 2NZDA 4J8XD 5B1MC 1M18C 1TZYA 3REHB 3AZIB 1JFIB 3EPJA 3X1SA 1T3UA 3AN2C 4Z2MH 3MGPA 4WNNB 1HQ3A 3MGRB 4G91B 1P3LA 1P3BD 4Z66A 3WTPA 3REHA 3AZIA 1U35D 1P3MD 2F8NB 3WKJB 3KWQA 3AZGB 3EPKA 4YM6A 4XZQC 3F6TA 5B2IC 3C1BB 5AV5A 4R8PD 4X23B 3X1UB 5CPKA 1P3PA 5AV8C 5AV9C 3MVDB 1ID3A 5GT0C 4WV4B 5BNVA 4H9PA 2PYOA 3AV2D 3LJAA 3MGQB 1TZYB 4CSRA 4EO5B 2AROD 3VH6T 3X1UD 3KUYB 2Y2GA 3C1BD 3KFUG 3A6NA 1EQZD 2HIOC 2Y2KA 5B1LB 5F99D 3V9RB 4DRBA 5CPJD 3UTBD 3B6FA 5AY8C 3TU4A 3AZLB 3LZ0A 3W99B 1P3FB 5B0YA 5DNNC 1P3MB 1P34D 3AZFD 3NQUA 5B2JB 3WTPE 3MNNA 4YS3D 3IP4C 4H9SC 3B0CW 3W97C 3AZLA 1M18D 4H9RB 5B0YB 2CWEA 1KX5D 4J8UA 3B0CT 1KX4D 3AN2D 3AZMD 2HUEB 4XUJD 3UTAD 1P34C 2BYKA 3RELD 5GXQA 1P3BC 2Y2NA 4Z2MG 3REKB 1U35C 4YS3C 4J8VD 3W98C 3V9RA 3B6FB 3LZ0C 3AZKD 1KX4B 5AVCB 5JRGC 5CP6C 4AWLC 4KUDB 3TU4C 3EPHA 5BS7C 4KUDC 5B32C 2CV5B 1KX4C 4XZQD 1P3IA 1P3KA 1P3OC 4R8PC 3VH6A 1N1JB 1ZLAC 4YS3B 1B6WA 3UTAC 4WU8D 4NFTA 1F66B 2CV5D 5GT0A 1P3FD 2CV5A 5B33A 1S32D 5G49A 4WU8A 5AVCD 3TU4D 3UTBC 4J8WA 3H0LC 1AOIB 1P3OD 3LELC 3AYWB 1M1AA 3REKA 3VH5W 3X1VA 5DNND 3AZFC 4E44A 1P3LC 4KUDA 4JJND 1P3FC 2G5IC 3W99C 5BO0A 5AV5D 4R8PA 3REIC 3AZEA 1BH9A 3X1VC 5BT1D 5AY8B 3REIB 5AV8A 5GXQD 5AV9A 5GT3A 4XZQA 1P3LB 5DNMA 3KUYC 5KDMA 5AV6A 3AZHD 3X1TB 4EO5C 1KX3C 1F66D 2NQBD 3WKJD 3AZHA 3AZKA 1P3BA 3AYWC 2F8NK 1AOIC 4CAYB 4Z66C 3WTPC 4X23C 3UTBB 1P3GD 3WA9B 5BT1C 5B40D 3X1SD 5AV5B 4X23A 4G92C 3AZFA 1P3IC 1P3KC 4AWLB 3W97A 4J8XA 3MGQA 5DNNA 3WKJC 1ZLAB 1M1AD 3RELB 3AYWD 1P3OB 5B32B 5B31B 2CV5C 3H0MC 2YFWA 3REJC 3AN2B 4ZUXD 3TU4B 5B40C 3AV2A 1S32B 3LZ0B 1BFMA 3B6FC 3KWQB 1M18B 3W98B 1U35B 4WU8B 2DQNC 2F8ND 3LELD 1P3BB 3C1CD 4J8WB 5BS7A 4WU9C 4H9OA 3H0RC 1M19A 3X1UA 5B24B 3MVDA 3KWQD 3MGSA 3W99D 2PYOD 1P3AA 3REHD 3AZID 4CSRB 3W97B 5BO0B 3P5JB 4WJ3C 2F2AC 5F99B 5CPJB 4J8VB 3AFAC 3AZEB 1Q9CA 3RELA 2AROB 3UTAA 2G5HC 4XUJA 1P3MC 4HGAC 2NQBC 4WU9D 3AZNA 3A1KA 2L5AA 1P3AB 5DNMB 4ZBJB 2J8PA 1KX4A 3AZLC 1KX5A 4KGCD 4Z66D 3WTPD 2PYOC 2NZDD 4H9SA 3X1SB 5B1LC 3WA9D 3X1SC 3LZ1D 4YS3A 3AZJB 2BYMA 1TZYC 5B2JD 4ZBJC 2NQBB 5GT0B 5AVBA 2F8NH 3MVDC 2FFFB 3MGRD 3C1BC 5G49B 3B6GA 5B2IB 1R4VA 5GSUA 1W2EA 3AZJA 5F99A 2RVQC 5CPJA 1EQZB 4KHAA 3AV1D 4NE6A 4JJNB 3AZNB 3O62A 1P3AD 3MGPD 4WU9B 3MVDD 1P3PD 3WAAA 3KWQC 2YFVA 4H9QB 3REHC 3W96C 3AZIC 5B1MB 3AV1C 3REJB 3FDDA 2F8NG 5B31C 3AFAD 3RELC 5AVBC 5E5AD 3LZ1A 3AZKC 5JRGD 5CP6D 5GSUD 1HQ3B 4KGCC 1B67A 2NZDC 5B0ZC 4G92B 3A1IA 3WA9C 3O62B 3LZ1C 2Y2LA 3O62C 5B1MD 4E45A 5B1LA 1Z2CB 3WAAB 1HQ3C 5JRGB 5CPKB 3X1TA 2YFVB 4H9QA 5GSUC 5AVBB 2ZY2A 3LJAB 1N1JA 2Y2MA 4LD9C 3AV1B 5AV8D 5AV9D 3EPLA 5GT3C 3AZFB 4JJNA 3KXBB 2VQRA 4QLCA 3MGSD 2FJ7A 3X1VD 3UT9D 1JFIA 5GXQB 3B0DB 5AY8D 3AZNC 1BH8A 5B31G 3AZJD 3W96D 5B32A 3C1CA 3LELA 1KX3D 1F66C 5AVCA 1EQZC 3MGQD 3AV2B 1S32A 1H3OA 2XD5A 5CPIB 2JSSA 1TAFB 4ZUXA 4R8PB 4X23D 2IO5B 3AZGA 1P3GC 4M6BA 3REIA 2ZY3A 5B0ZD 1KX5C 1P3ID 1P3KD 2DF4C 4NE3A 5B24A 3AZJC 4Z5TD 1KU5A 5CPIA 5BNXA 5B33B 3W97D 4XUJC 2NQBA 3REKC 5AV6D 5FUGA 1M1AC 4WZSB 4J8VA 5B40A 1AOIA 5DNMC 3KUYA 2Y2PA 3AZMC 2UWXA 4HGAB 4KHAB 3C1CB 5B0YC 3AZMA 4KUDD 3B0BA 2LY8A 3AFAB 3AZEC 4J8VC 4UUZB 4J8XB 3W98D 1F66A 2ZY4A 3W99A 4J8XC 1H3OB 4Z5TA 3REKD 4ZUXB 5GT3D 1P3OA 3NQUB 3MNNB 2BYMB 2JCHA 5B24C 5C3IC 3MNND 3AZMB 4QLCC 2FJ7C 1ULYA 4UPKA 3VH5T 1ZLAD 5JA4B 4J8WC 5B0YD 3UT9C 1ID3C 4WU8C 2HIOB 5B33C 3VH6W 5FUGB 3UTBA 1S32C 5B40B 3A6ND 3MGQC 2BYKB 1EQZA 5AY8A 4QLCD 2FJ7D 1PZRA 3R45A 5KDMB 5AV6B 5GT0D 3KXBD 1P3FA 1ZLAA 3AZHB 1TAFA 1ID3D 3AV2C 4Z5TB 3AZGC 1P3GA 1P3IB 4Z5TC 1P3KB 3KUYD 2YFWB 5AV5C 3AZHC 1WWIA 4NE5A 5GXQC 5AV6C 4G91C 3WTPB 4Z66B 3MGRC 3WKJA 4J8UD 3W98A 5CPID 5DNMD 1BH9B 1WWSA 3KXBC 4H9NB 3X1TC 1KX3B 5GT3B 1AOID 3AZED 2BG1A 3AZGD 4LD9B 2Y2OA 5B32G 1ID3B 3UT9B 3VH5A 3X1VB 3KXBA 4H9PB 1P3PC 4QLCB 5GSUB 2FJ7B 5C3IB 1A7WA 4YM6C 1KX3A 5B24D 3MNNC 3AL0C 5B0ZA 2Y2HA 4ZUXC 1BH8B 4WNNA 4J8WD 2ZY5A 3UT9A 3LELB 5B33D 3LJAD 3LZ0D 3C1CC 1HTAA 5E5AC 3A6NC 3MGPC 5B0ZB 5CPKD 3B6FD 5B32D 4YM6D 5CHLB 3WAAD 1M1AB 2AROA 3UTAB 4XUJB 5BNVB 4H9RA 2RIQA 3B6GB 3O62D 3R45B 1U35A 2Y2QA 1KX5B 2XD1A 3W96B 1HQ3D 5CP6B 5AVCC 4H9OB 1P3GB 1M19B 2IO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGS B;  4J8U C;  3NQJ A;  5CPI C;  3AN2 A;  1P34 B;  2HUE C;  3X1T D;  1P3L D;  4LD9 D;  5CP6 A;  5JRG A;  3AZL D;  5B2J A;  4JJN C;  1M18 A;  4CAY A;  3B0D C;  3REI D;  5B1L D;  3NQJ B;  1P34 A;  5BNX B;  3MGS C;  4J8U B;  1TZY D;  5B2J C;  1F1E A;  1M19 C;  2HIO A;  3AZN D;  5DNN B;  4WU9 A;  3W96 A;  3LJA C;  3C1B A;  3B6G C;  5E5A A;  5B31 A;  2RVQ D;  3AFA A;  5B2I D;  4UUZ A;  5CPK C;  2PYO B;  3REJ A;  5B2I A;  3WAA C;  1P3A C;  1M19 D;  3MGP B;  3A6N B;  2ARO C;  5E5A B;  5AV8 B;  5AV9 B;  3X1U C;  3LZ1 B;  4XZQ B;  5JA4 A;  2F8N A;  2HIO D;  5F99 C;  5CPJ C;  3B6G D;  3REJ D;  5AVB D;  4KGC B;  2NZD B;  1P3M A;  3AZK B;  5B31 D;  3AV1 A;  3KSY A;  4H9N A;  4YM6 B;  3AYW A;  1P3P B;  3WA9 A;  4DRA A;  5B1M A;  4LD9 A;  3MGR A;  4KGC A;  2NZD A;  4J8X D;  5B1M C;  1M18 C;  1TZY A;  3REH B;  3AZI B;  1JFI B;  3X1S A;  3AN2 C;  4Z2M H;  3MGP A;  4WNN B;  1HQ3 A;  3MGR B;  4G91 B;  1P3L A;  1P3B D;  4Z66 A;  3WTP A;  3REH A;  3AZI A;  1U35 D;  1P3M D;  2F8N B;  3WKJ B;  3KWQ A;  3AZG B;  4YM6 A;  4XZQ C;  5B2I C;  3C1B B;  5AV5 A;  4R8P D;  4X23 B;  3X1U B;  5CPK A;  1P3P A;  5AV8 C;  5AV9 C;  3MVD B;  1ID3 A;  5GT0 C;  4WV4 B;  5BNV A;  4H9P A;  2PYO A;  3AV2 D;  3LJA A;  3MGQ B;  1TZY B;  4CSR A;  4EO5 B;  2ARO D;  3VH6 T;  3X1U D;  3KUY B;  3C1B D;  3A6N A;  1EQZ D;  2HIO C;  5B1L B;  5F99 D;  5CPJ D;  3V9R B;  4DRB A;  3UTB D;  3B6F A;  5AY8 C;  3TU4 A;  3AZL B;  3LZ0 A;  3W99 B;  1P3F B;  5B0Y A;  5DNN C;  1P3M B;  1P34 D;  3AZF D;  3NQU A;  5B2J B;  3WTP E;  3MNN A;  4YS3 D;  4H9S C;  3B0C W;  3W97 C;  3AZL A;  1M18 D;  4H9R B;  5B0Y B;  2CWE A;  1KX5 D;  4J8U A;  3B0C T;  1KX4 D;  3AN2 D;  3AZM D;  2HUE B;  4XUJ D;  3UTA D;  1P34 C;  2BYK A;  3REL D;  5GXQ A;  1P3B C;  4Z2M G;  3REK B;  1U35 C;  4YS3 C;  4J8V D;  3W98 C;  3V9R A;  3B6F B;  3LZ0 C;  3AZK D;  1KX4 B;  5AVC B;  5JRG C;  5CP6 C;  4AWL C;  4KUD B;  3TU4 C;  5BS7 C;  4KUD C;  5B32 C;  2CV5 B;  1KX4 C;  4XZQ D;  1P3I A;  1P3K A;  1P3O C;  4R8P C;  3VH6 A;  1N1J B;  1ZLA C;  4YS3 B;  1B6W A;  3UTA C;  4WU8 D;  4NFT A;  1F66 B;  2CV5 D;  5GT0 A;  1P3F D;  2CV5 A;  5B33 A;  1S32 D;  5G49 A;  4WU8 A;  5AVC D;  3TU4 D;  3UTB C;  4J8W A;  1AOI B;  1P3O D;  3LEL C;  3AYW B;  1M1A A;  3REK A;  3VH5 W;  3X1V A;  5DNN D;  3AZF C;  4E44 A;  1P3L C;  4KUD A;  4JJN D;  1P3F C;  3W99 C;  5BO0 A;  5AV5 D;  4R8P A;  3REI C;  3AZE A;  1BH9 A;  3X1V C;  5BT1 D;  5AY8 B;  3REI B;  5AV8 A;  5GXQ D;  5AV9 A;  5GT3 A;  4XZQ A;  1P3L B;  5DNM A;  3KUY C;  5KDM A;  5AV6 A;  3AZH D;  3X1T B;  4EO5 C;  1KX3 C;  1F66 D;  2NQB D;  3WKJ D;  3AZH A;  3AZK A;  1P3B A;  3AYW C;  2F8N K;  1AOI C;  4CAY B;  4Z66 C;  3WTP C;  4X23 C;  3UTB B;  1P3G D;  3WA9 B;  5BT1 C;  5B40 D;  3X1S D;  5AV5 B;  4X23 A;  4G92 C;  3AZF A;  1P3I C;  1P3K C;  4AWL B;  3W97 A;  4J8X A;  3MGQ A;  5DNN A;  3WKJ C;  1ZLA B;  1M1A D;  3REL B;  3AYW D;  1P3O B;  5B32 B;  5B31 B;  2CV5 C;  2YFW A;  3REJ C;  3AN2 B;  4ZUX D;  3TU4 B;  5B40 C;  3AV2 A;  1S32 B;  3LZ0 B;  1BFM A;  3B6F C;  3KWQ B;  1M18 B;  3W98 B;  1U35 B;  4WU8 B;  2F8N D;  3LEL D;  1P3B B;  3C1C D;  4J8W B;  5BS7 A;  4WU9 C;  4H9O A;  1M19 A;  3X1U A;  5B24 B;  3MVD A;  3KWQ D;  3MGS A;  3W99 D;  2PYO D;  1P3A A;  3REH D;  3AZI D;  4CSR B;  3W97 B;  5BO0 B;  5F99 B;  5CPJ B;  4J8V B;  3AFA C;  3AZE B;  1Q9C A;  3REL A;  2ARO B;  3UTA A;  4XUJ A;  1P3M C;  4HGA C;  2NQB C;  4WU9 D;  3AZN A;  2L5A A;  1P3A B;  5DNM B;  4ZBJ B;  1KX4 A;  3AZL C;  1KX5 A;  4KGC D;  4Z66 D;  3WTP D;  2PYO C;  2NZD D;  4H9S A;  3X1S B;  5B1L C;  3WA9 D;  3X1S C;  3LZ1 D;  4YS3 A;  3AZJ B;  2BYM A;  1TZY C;  5B2J D;  4ZBJ C;  2NQB B;  5GT0 B;  5AVB A;  2F8N H;  3MVD C;  3MGR D;  3C1B C;  5G49 B;  3B6G A;  5B2I B;  1R4V A;  5GSU A;  3AZJ A;  5F99 A;  2RVQ C;  5CPJ A;  1EQZ B;  4KHA A;  3AV1 D;  4NE6 A;  4JJN B;  3AZN B;  3O62 A;  1P3A D;  3MGP D;  4WU9 B;  3MVD D;  1P3P D;  3WAA A;  3KWQ C;  2YFV A;  4H9Q B;  3REH C;  3W96 C;  3AZI C;  5B1M B;  3AV1 C;  3REJ B;  2F8N G;  5B31 C;  3AFA D;  3REL C;  5AVB C;  5E5A D;  3LZ1 A;  3AZK C;  5JRG D;  5CP6 D;  5GSU D;  1HQ3 B;  4KGC C;  1B67 A;  2NZD C;  5B0Z C;  4G92 B;  3WA9 C;  3O62 B;  3LZ1 C;  3O62 C;  5B1M D;  4E45 A;  5B1L A;  3WAA B;  1HQ3 C;  5JRG B;  5CPK B;  3X1T A;  2YFV B;  4H9Q A;  5GSU C;  5AVB B;  3LJA B;  1N1J A;  4LD9 C;  3AV1 B;  5AV8 D;  5AV9 D;  5GT3 C;  3AZF B;  4JJN A;  3KXB B;  4QLC A;  3MGS D;  2FJ7 A;  3X1V D;  3UT9 D;  1JFI A;  5GXQ B;  3B0D B;  5AY8 D;  3AZN C;  1BH8 A;  5B31 G;  3AZJ D;  3W96 D;  5B32 A;  3C1C A;  3LEL A;  1KX3 D;  1F66 C;  5AVC A;  1EQZ C;  3MGQ D;  3AV2 B;  1S32 A;  1H3O A;  5CPI B;  2JSS A;  1TAF B;  4ZUX A;  4R8P B;  4X23 D;  2IO5 B;  3AZG A;  1P3G C;  4M6B A;  3REI A;  5B0Z D;  1KX5 C;  1P3I D;  1P3K D;  5B24 A;  4NE3 A;  3AZJ C;  4Z5T D;  1KU5 A;  5CPI A;  5BNX A;  5B33 B;  3W97 D;  4XUJ C;  2NQB A;  3REK C;  5AV6 D;  5FUG A;  1M1A C;  4WZS B;  4J8V A;  5B40 A;  1AOI A;  5DNM C;  3KUY A;  3AZM C;  4HGA B;  4KHA B;  3C1C B;  5B0Y C;  3AZM A;  4KUD D;  3B0B A;  2LY8 A;  3AFA B;  3AZE C;  4J8V C;  4UUZ B;  4J8X B;  3W98 D;  1F66 A;  3W99 A;  4J8X C;  1H3O B;  4Z5T A;  3REK D;  4ZUX B;  5GT3 D;  1P3O A;  3NQU B;  3MNN B;  2BYM B;  5B24 C;  5C3I C;  3MNN D;  3AZM B;  4QLC C;  2FJ7 C;  1ULY A;  3VH5 T;  1ZLA D;  5JA4 B;  4J8W C;  5B0Y D;  3UT9 C;  1ID3 C;  4WU8 C;  2HIO B;  5B33 C;  3VH6 W;  5FUG B;  3UTB A;  1S32 C;  5B40 B;  3A6N D;  3MGQ C;  2BYK B;  1EQZ A;  5AY8 A;  4QLC D;  2FJ7 D;  3R45 A;  5KDM B;  5AV6 B;  5GT0 D;  3KXB D;  1P3F A;  1ZLA A;  3AZH B;  1TAF A;  1ID3 D;  3AV2 C;  4Z5T B;  3AZG C;  1P3G A;  1P3I B;  4Z5T C;  1P3K B;  3KUY D;  2YFW B;  5AV5 C;  3AZH C;  1WWI A;  4NE5 A;  5GXQ C;  5AV6 C;  4G91 C;  3WTP B;  4Z66 B;  3MGR C;  3WKJ A;  4J8U D;  3W98 A;  5CPI D;  5DNM D;  1BH9 B;  1WWS A;  3KXB C;  4H9N B;  3X1T C;  1KX3 B;  5GT3 B;  1AOI D;  3AZE D;  3AZG D;  4LD9 B;  5B32 G;  1ID3 B;  3UT9 B;  3VH5 A;  3X1V B;  3KXB A;  4H9P B;  1P3P C;  4QLC B;  5GSU B;  2FJ7 B;  5C3I B;  1A7W A;  4YM6 C;  1KX3 A;  5B24 D;  3MNN C;  5B0Z A;  4ZUX C;  1BH8 B;  4WNN A;  4J8W D;  3UT9 A;  3LEL B;  5B33 D;  3LJA D;  3LZ0 D;  3C1C C;  1HTA A;  5E5A C;  3A6N C;  3MGP C;  5B0Z B;  5CPK D;  3B6F D;  5B32 D;  4YM6 D;  5CHL B;  3WAA D;  1M1A B;  2ARO A;  3UTA B;  4XUJ B;  5BNV B;  4H9R A;  3B6G B;  3O62 D;  3R45 B;  1U35 A;  1KX5 B;  3W96 B;  1HQ3 D;  5CP6 B;  5AVC C;  4H9O B;  1P3G B;  1M19 B;  2IO5 C; 
#chains in the Genus database with same CATH topology
 2JE5 A;  3MGS B;  4J8U C;  3NQJ A;  5CPI C;  3AN2 A;  1P34 B;  2HUE C;  3X1T D;  1P3L D;  2ZM5 A;  5CP6 A;  5JRG A;  3AZL D;  5B2J A;  2Y2I A;  4JJN C;  1M18 A;  4LD9 D;  4CAY A;  3B0D C;  3REI D;  5B1L D;  3NQJ B;  1P34 A;  5BNX B;  3MGS C;  4J8U B;  1TZY D;  5B2J C;  1F1E A;  1M19 C;  2HIO A;  3AZN D;  5DNN B;  4WU9 A;  4DQY B;  3W96 A;  3LJA C;  3C1B A;  3B6G C;  5E5A A;  5B31 A;  2RVQ D;  3AFA A;  5B2I D;  4UUZ A;  5CPK C;  2PYO B;  3REJ A;  5B2I A;  3EG5 B;  3WAA C;  1P3A C;  1M19 D;  3MGP B;  3A6N B;  2ARO C;  5E5A B;  5AV8 B;  2Y2J A;  5AV9 B;  3X1U C;  3LZ1 B;  4XZQ B;  5JA4 A;  2F8N A;  2HIO D;  5F99 C;  5CPJ C;  2W8S A;  3B6G D;  3REJ D;  5AVB D;  4KGC B;  2NZD B;  1P3M A;  3AZK B;  5B31 D;  3AV1 A;  3KSY A;  4H9N A;  4YM6 B;  3AYW A;  1P3P B;  3WA9 A;  4DRA A;  5B1M A;  4LD9 A;  3MGR A;  4KGC A;  2NZD A;  4J8X D;  5B1M C;  1M18 C;  1TZY A;  3REH B;  3AZI B;  1JFI B;  3EPJ A;  3X1S A;  1T3U A;  3AN2 C;  4Z2M H;  3MGP A;  4WNN B;  1HQ3 A;  3MGR B;  4G91 B;  1P3L A;  1P3B D;  4Z66 A;  3WTP A;  3REH A;  3AZI A;  1U35 D;  1P3M D;  2F8N B;  3WKJ B;  3KWQ A;  3AZG B;  3EPK A;  4YM6 A;  4XZQ C;  3F6T A;  5B2I C;  3C1B B;  5AV5 A;  4R8P D;  4X23 B;  3X1U B;  5CPK A;  1P3P A;  5AV8 C;  5AV9 C;  3MVD B;  1ID3 A;  5GT0 C;  4WV4 B;  5BNV A;  4H9P A;  2PYO A;  3AV2 D;  3LJA A;  3MGQ B;  1TZY B;  4CSR A;  4EO5 B;  2ARO D;  3VH6 T;  3X1U D;  3KUY B;  2Y2G A;  3C1B D;  3KFU G;  3A6N A;  1EQZ D;  2HIO C;  2Y2K A;  5B1L B;  5F99 D;  3V9R B;  4DRB A;  5CPJ D;  3UTB D;  3B6F A;  5AY8 C;  3TU4 A;  3AZL B;  3LZ0 A;  3W99 B;  1P3F B;  5B0Y A;  5DNN C;  1P3M B;  1P34 D;  3AZF D;  3NQU A;  5B2J B;  3WTP E;  3MNN A;  4YS3 D;  3IP4 C;  4H9S C;  3B0C W;  3W97 C;  3AZL A;  1M18 D;  4H9R B;  5B0Y B;  2CWE A;  1KX5 D;  4J8U A;  3B0C T;  1KX4 D;  3AN2 D;  3AZM D;  2HUE B;  4XUJ D;  3UTA D;  1P34 C;  2BYK A;  3REL D;  5GXQ A;  1P3B C;  2Y2N A;  4Z2M G;  3REK B;  1U35 C;  4YS3 C;  4J8V D;  3W98 C;  3V9R A;  3B6F B;  3LZ0 C;  3AZK D;  1KX4 B;  5AVC B;  5JRG C;  5CP6 C;  4AWL C;  4KUD B;  3TU4 C;  3EPH A;  5BS7 C;  4KUD C;  5B32 C;  2CV5 B;  1KX4 C;  4XZQ D;  1P3I A;  1P3K A;  1P3O C;  4R8P C;  3VH6 A;  1N1J B;  1ZLA C;  4YS3 B;  1B6W A;  3UTA C;  4WU8 D;  4NFT A;  1F66 B;  2CV5 D;  5GT0 A;  1P3F D;  2CV5 A;  5B33 A;  1S32 D;  5G49 A;  4WU8 A;  5AVC D;  3TU4 D;  3UTB C;  4J8W A;  3H0L C;  1AOI B;  1P3O D;  3LEL C;  3AYW B;  1M1A A;  3REK A;  3VH5 W;  3X1V A;  5DNN D;  3AZF C;  4E44 A;  1P3L C;  4KUD A;  4JJN D;  1P3F C;  2G5I C;  3W99 C;  5BO0 A;  5AV5 D;  4R8P A;  3REI C;  3AZE A;  1BH9 A;  3X1V C;  5BT1 D;  5AY8 B;  3REI B;  5AV8 A;  5GXQ D;  5AV9 A;  5GT3 A;  4XZQ A;  1P3L B;  5DNM A;  3KUY C;  5KDM A;  5AV6 A;  3AZH D;  3X1T B;  4EO5 C;  1KX3 C;  1F66 D;  2NQB D;  3WKJ D;  3AZH A;  3AZK A;  1P3B A;  3AYW C;  2F8N K;  1AOI C;  4CAY B;  4Z66 C;  3WTP C;  4X23 C;  3UTB B;  1P3G D;  3WA9 B;  5BT1 C;  5B40 D;  3X1S D;  5AV5 B;  4X23 A;  4G92 C;  3AZF A;  1P3I C;  1P3K C;  4AWL B;  3W97 A;  4J8X A;  3MGQ A;  5DNN A;  3WKJ C;  1ZLA B;  1M1A D;  3REL B;  3AYW D;  1P3O B;  5B32 B;  5B31 B;  2CV5 C;  3H0M C;  2YFW A;  3REJ C;  3AN2 B;  4ZUX D;  3TU4 B;  5B40 C;  3AV2 A;  1S32 B;  3LZ0 B;  1BFM A;  3B6F C;  3KWQ B;  1M18 B;  3W98 B;  1U35 B;  4WU8 B;  2DQN C;  2F8N D;  3LEL D;  1P3B B;  3C1C D;  4J8W B;  5BS7 A;  4WU9 C;  4H9O A;  3H0R C;  1M19 A;  3X1U A;  5B24 B;  3MVD A;  3KWQ D;  3MGS A;  3W99 D;  2PYO D;  1P3A A;  3REH D;  3AZI D;  4CSR B;  3W97 B;  5BO0 B;  3P5J B;  4WJ3 C;  2F2A C;  5F99 B;  5CPJ B;  4J8V B;  3AFA C;  3AZE B;  1Q9C A;  3REL A;  2ARO B;  3UTA A;  2G5H C;  4XUJ A;  1P3M C;  4HGA C;  2NQB C;  4WU9 D;  3AZN A;  3A1K A;  2L5A A;  1P3A B;  5DNM B;  4ZBJ B;  2J8P A;  1KX4 A;  3AZL C;  1KX5 A;  4KGC D;  4Z66 D;  3WTP D;  2PYO C;  2NZD D;  4H9S A;  3X1S B;  5B1L C;  3WA9 D;  3X1S C;  3LZ1 D;  4YS3 A;  3AZJ B;  2BYM A;  1TZY C;  5B2J D;  4ZBJ C;  2NQB B;  5GT0 B;  5AVB A;  2F8N H;  3MVD C;  2FFF B;  3MGR D;  3C1B C;  5G49 B;  3B6G A;  5B2I B;  1R4V A;  5GSU A;  1W2E A;  3AZJ A;  5F99 A;  2RVQ C;  5CPJ A;  1EQZ B;  4KHA A;  3AV1 D;  4NE6 A;  4JJN B;  3AZN B;  3O62 A;  1P3A D;  3MGP D;  4WU9 B;  3MVD D;  1P3P D;  3WAA A;  3KWQ C;  2YFV A;  4H9Q B;  3REH C;  3W96 C;  3AZI C;  5B1M B;  3AV1 C;  3REJ B;  3FDD A;  2F8N G;  5B31 C;  3AFA D;  3REL C;  5AVB C;  5E5A D;  3LZ1 A;  3AZK C;  5JRG D;  5CP6 D;  5GSU D;  1HQ3 B;  4KGC C;  1B67 A;  2NZD C;  5B0Z C;  4G92 B;  3A1I A;  3WA9 C;  3O62 B;  3LZ1 C;  2Y2L A;  3O62 C;  5B1M D;  4E45 A;  5B1L A;  1Z2C B;  3WAA B;  1HQ3 C;  5JRG B;  5CPK B;  3X1T A;  2YFV B;  4H9Q A;  5GSU C;  5AVB B;  2ZY2 A;  3LJA B;  1N1J A;  2Y2M A;  4LD9 C;  3AV1 B;  5AV8 D;  5AV9 D;  3EPL A;  5GT3 C;  3AZF B;  4JJN A;  3KXB B;  2VQR A;  4QLC A;  3MGS D;  2FJ7 A;  3X1V D;  3UT9 D;  1JFI A;  5GXQ B;  3B0D B;  5AY8 D;  3AZN C;  1BH8 A;  5B31 G;  3AZJ D;  3W96 D;  5B32 A;  3C1C A;  3LEL A;  1KX3 D;  1F66 C;  5AVC A;  1EQZ C;  3MGQ D;  3AV2 B;  1S32 A;  1H3O A;  2XD5 A;  5CPI B;  2JSS A;  1TAF B;  4ZUX A;  4R8P B;  4X23 D;  2IO5 B;  3AZG A;  1P3G C;  4M6B A;  3REI A;  2ZY3 A;  5B0Z D;  1KX5 C;  1P3I D;  1P3K D;  2DF4 C;  4NE3 A;  5B24 A;  3AZJ C;  4Z5T D;  1KU5 A;  5CPI A;  5BNX A;  5B33 B;  3W97 D;  4XUJ C;  2NQB A;  3REK C;  5AV6 D;  5FUG A;  1M1A C;  4WZS B;  4J8V A;  5B40 A;  1AOI A;  5DNM C;  3KUY A;  2Y2P A;  3AZM C;  2UWX A;  4HGA B;  4KHA B;  3C1C B;  5B0Y C;  3AZM A;  4KUD D;  3B0B A;  2LY8 A;  3AFA B;  3AZE C;  4J8V C;  4UUZ B;  4J8X B;  3W98 D;  1F66 A;  2ZY4 A;  3W99 A;  4J8X C;  1H3O B;  4Z5T A;  3REK D;  4ZUX B;  5GT3 D;  1P3O A;  3NQU B;  3MNN B;  2BYM B;  2JCH A;  5B24 C;  5C3I C;  3MNN D;  3AZM B;  4QLC C;  2FJ7 C;  1ULY A;  4UPK A;  3VH5 T;  1ZLA D;  5JA4 B;  4J8W C;  5B0Y D;  3UT9 C;  1ID3 C;  4WU8 C;  2HIO B;  5B33 C;  3VH6 W;  5FUG B;  3UTB A;  1S32 C;  5B40 B;  3A6N D;  3MGQ C;  2BYK B;  1EQZ A;  5AY8 A;  4QLC D;  2FJ7 D;  1PZR A;  3R45 A;  5KDM B;  5AV6 B;  5GT0 D;  3KXB D;  1P3F A;  1ZLA A;  3AZH B;  1TAF A;  1ID3 D;  3AV2 C;  4Z5T B;  3AZG C;  1P3G A;  1P3I B;  4Z5T C;  1P3K B;  3KUY D;  2YFW B;  5AV5 C;  3AZH C;  1WWI A;  4NE5 A;  5GXQ C;  5AV6 C;  4G91 C;  3WTP B;  4Z66 B;  3MGR C;  3WKJ A;  4J8U D;  3W98 A;  5CPI D;  5DNM D;  1BH9 B;  1WWS A;  3KXB C;  4H9N B;  3X1T C;  1KX3 B;  5GT3 B;  1AOI D;  3AZE D;  2BG1 A;  3AZG D;  4LD9 B;  2Y2O A;  5B32 G;  1ID3 B;  3UT9 B;  3VH5 A;  3X1V B;  3KXB A;  4H9P B;  1P3P C;  4QLC B;  5GSU B;  2FJ7 B;  5C3I B;  1A7W A;  4YM6 C;  1KX3 A;  5B24 D;  3MNN C;  3AL0 C;  5B0Z A;  2Y2H A;  4ZUX C;  1BH8 B;  4WNN A;  4J8W D;  2ZY5 A;  3UT9 A;  3LEL B;  5B33 D;  3LJA D;  3LZ0 D;  3C1C C;  1HTA A;  5E5A C;  3A6N C;  3MGP C;  5B0Z B;  5CPK D;  3B6F D;  5B32 D;  4YM6 D;  5CHL B;  3WAA D;  1M1A B;  2ARO A;  3UTA B;  4XUJ B;  5BNV B;  4H9R A;  2RIQ A;  3B6G B;  3O62 D;  3R45 B;  1U35 A;  2Y2Q A;  1KX5 B;  2XD1 A;  3W96 B;  1HQ3 D;  5CP6 B;  5AVC C;  4H9O B;  1P3G B;  1M19 B;  2IO5 C; 
#chains in the Genus database with same CATH homology
 2JE5 A;  3MGS B;  4J8U C;  3NQJ A;  5CPI C;  3AN2 A;  1P34 B;  2HUE C;  3X1T D;  1P3L D;  2ZM5 A;  5CP6 A;  5JRG A;  3AZL D;  5B2J A;  2Y2I A;  4JJN C;  1M18 A;  4LD9 D;  4CAY A;  3B0D C;  3REI D;  5B1L D;  3NQJ B;  1P34 A;  5BNX B;  3MGS C;  4J8U B;  1TZY D;  5B2J C;  1F1E A;  1M19 C;  2HIO A;  3AZN D;  5DNN B;  4WU9 A;  4DQY B;  3W96 A;  3LJA C;  3C1B A;  3B6G C;  5E5A A;  5B31 A;  2RVQ D;  3AFA A;  5B2I D;  4UUZ A;  5CPK C;  2PYO B;  3REJ A;  5B2I A;  3EG5 B;  3WAA C;  1P3A C;  1M19 D;  3MGP B;  3A6N B;  2ARO C;  5E5A B;  5AV8 B;  2Y2J A;  5AV9 B;  3X1U C;  3LZ1 B;  4XZQ B;  5JA4 A;  2F8N A;  2HIO D;  5F99 C;  5CPJ C;  2W8S A;  3B6G D;  3REJ D;  5AVB D;  4KGC B;  2NZD B;  1P3M A;  3AZK B;  5B31 D;  3AV1 A;  3KSY A;  4H9N A;  4YM6 B;  3AYW A;  1P3P B;  3WA9 A;  4DRA A;  5B1M A;  4LD9 A;  3MGR A;  4KGC A;  2NZD A;  4J8X D;  5B1M C;  1M18 C;  1TZY A;  3REH B;  3AZI B;  1JFI B;  3EPJ A;  3X1S A;  1T3U A;  3AN2 C;  4Z2M H;  3MGP A;  4WNN B;  1HQ3 A;  3MGR B;  4G91 B;  1P3L A;  1P3B D;  4Z66 A;  3WTP A;  3REH A;  3AZI A;  1U35 D;  1P3M D;  2F8N B;  3WKJ B;  3KWQ A;  3AZG B;  3EPK A;  4YM6 A;  4XZQ C;  3F6T A;  5B2I C;  3C1B B;  5AV5 A;  4R8P D;  4X23 B;  3X1U B;  5CPK A;  1P3P A;  5AV8 C;  5AV9 C;  3MVD B;  1ID3 A;  5GT0 C;  4WV4 B;  5BNV A;  4H9P A;  2PYO A;  3AV2 D;  3LJA A;  3MGQ B;  1TZY B;  4CSR A;  4EO5 B;  2ARO D;  3VH6 T;  3X1U D;  3KUY B;  2Y2G A;  3C1B D;  3KFU G;  3A6N A;  1EQZ D;  2HIO C;  2Y2K A;  5B1L B;  5F99 D;  3V9R B;  4DRB A;  5CPJ D;  3UTB D;  3B6F A;  5AY8 C;  3TU4 A;  3AZL B;  3LZ0 A;  3W99 B;  1P3F B;  5B0Y A;  5DNN C;  1P3M B;  1P34 D;  3AZF D;  3NQU A;  5B2J B;  3WTP E;  3MNN A;  4YS3 D;  3IP4 C;  4H9S C;  3B0C W;  3W97 C;  3AZL A;  1M18 D;  4H9R B;  5B0Y B;  2CWE A;  1KX5 D;  4J8U A;  3B0C T;  1KX4 D;  3AN2 D;  3AZM D;  2HUE B;  4XUJ D;  3UTA D;  1P34 C;  2BYK A;  3REL D;  5GXQ A;  1P3B C;  2Y2N A;  4Z2M G;  3REK B;  1U35 C;  4YS3 C;  4J8V D;  3W98 C;  3V9R A;  3B6F B;  3LZ0 C;  3AZK D;  1KX4 B;  5AVC B;  5JRG C;  5CP6 C;  4AWL C;  4KUD B;  3TU4 C;  3EPH A;  5BS7 C;  4KUD C;  5B32 C;  2CV5 B;  1KX4 C;  4XZQ D;  1P3I A;  1P3K A;  1P3O C;  4R8P C;  3VH6 A;  1N1J B;  1ZLA C;  4YS3 B;  1B6W A;  3UTA C;  4WU8 D;  4NFT A;  1F66 B;  2CV5 D;  5GT0 A;  1P3F D;  2CV5 A;  5B33 A;  1S32 D;  5G49 A;  4WU8 A;  5AVC D;  3TU4 D;  3UTB C;  4J8W A;  3H0L C;  1AOI B;  1P3O D;  3LEL C;  3AYW B;  1M1A A;  3REK A;  3VH5 W;  3X1V A;  5DNN D;  3AZF C;  4E44 A;  1P3L C;  4KUD A;  4JJN D;  1P3F C;  2G5I C;  3W99 C;  5BO0 A;  5AV5 D;  4R8P A;  3REI C;  3AZE A;  1BH9 A;  3X1V C;  5BT1 D;  5AY8 B;  3REI B;  5AV8 A;  5GXQ D;  5AV9 A;  5GT3 A;  4XZQ A;  1P3L B;  5DNM A;  3KUY C;  5KDM A;  5AV6 A;  3AZH D;  3X1T B;  4EO5 C;  1KX3 C;  1F66 D;  2NQB D;  3WKJ D;  3AZH A;  3AZK A;  1P3B A;  3AYW C;  2F8N K;  1AOI C;  4CAY B;  4Z66 C;  3WTP C;  4X23 C;  3UTB B;  1P3G D;  3WA9 B;  5BT1 C;  5B40 D;  3X1S D;  5AV5 B;  4X23 A;  4G92 C;  3AZF A;  1P3I C;  1P3K C;  4AWL B;  3W97 A;  4J8X A;  3MGQ A;  5DNN A;  3WKJ C;  1ZLA B;  1M1A D;  3REL B;  3AYW D;  1P3O B;  5B32 B;  5B31 B;  2CV5 C;  3H0M C;  2YFW A;  3REJ C;  3AN2 B;  4ZUX D;  3TU4 B;  5B40 C;  3AV2 A;  1S32 B;  3LZ0 B;  1BFM A;  3B6F C;  3KWQ B;  1M18 B;  3W98 B;  1U35 B;  4WU8 B;  2DQN C;  2F8N D;  3LEL D;  1P3B B;  3C1C D;  4J8W B;  5BS7 A;  4WU9 C;  4H9O A;  3H0R C;  1M19 A;  3X1U A;  5B24 B;  3MVD A;  3KWQ D;  3MGS A;  3W99 D;  2PYO D;  1P3A A;  3REH D;  3AZI D;  4CSR B;  3W97 B;  5BO0 B;  3P5J B;  4WJ3 C;  2F2A C;  5F99 B;  5CPJ B;  4J8V B;  3AFA C;  3AZE B;  1Q9C A;  3REL A;  2ARO B;  3UTA A;  2G5H C;  4XUJ A;  1P3M C;  4HGA C;  2NQB C;  4WU9 D;  3AZN A;  3A1K A;  2L5A A;  1P3A B;  5DNM B;  4ZBJ B;  2J8P A;  1KX4 A;  3AZL C;  1KX5 A;  4KGC D;  4Z66 D;  3WTP D;  2PYO C;  2NZD D;  4H9S A;  3X1S B;  5B1L C;  3WA9 D;  3X1S C;  3LZ1 D;  4YS3 A;  3AZJ B;  2BYM A;  1TZY C;  5B2J D;  4ZBJ C;  2NQB B;  5GT0 B;  5AVB A;  2F8N H;  3MVD C;  2FFF B;  3MGR D;  3C1B C;  5G49 B;  3B6G A;  5B2I B;  1R4V A;  5GSU A;  1W2E A;  3AZJ A;  5F99 A;  2RVQ C;  5CPJ A;  1EQZ B;  4KHA A;  3AV1 D;  4NE6 A;  4JJN B;  3AZN B;  3O62 A;  1P3A D;  3MGP D;  4WU9 B;  3MVD D;  1P3P D;  3WAA A;  3KWQ C;  2YFV A;  4H9Q B;  3REH C;  3W96 C;  3AZI C;  5B1M B;  3AV1 C;  3REJ B;  3FDD A;  2F8N G;  5B31 C;  3AFA D;  3REL C;  5AVB C;  5E5A D;  3LZ1 A;  3AZK C;  5JRG D;  5CP6 D;  5GSU D;  1HQ3 B;  4KGC C;  1B67 A;  2NZD C;  5B0Z C;  4G92 B;  3A1I A;  3WA9 C;  3O62 B;  3LZ1 C;  2Y2L A;  3O62 C;  5B1M D;  4E45 A;  5B1L A;  1Z2C B;  3WAA B;  1HQ3 C;  5JRG B;  5CPK B;  3X1T A;  2YFV B;  4H9Q A;  5GSU C;  5AVB B;  2ZY2 A;  3LJA B;  1N1J A;  2Y2M A;  4LD9 C;  3AV1 B;  5AV8 D;  5AV9 D;  3EPL A;  5GT3 C;  3AZF B;  4JJN A;  3KXB B;  2VQR A;  4QLC A;  3MGS D;  2FJ7 A;  3X1V D;  3UT9 D;  1JFI A;  5GXQ B;  3B0D B;  5AY8 D;  3AZN C;  1BH8 A;  5B31 G;  3AZJ D;  3W96 D;  5B32 A;  3C1C A;  3LEL A;  1KX3 D;  1F66 C;  5AVC A;  1EQZ C;  3MGQ D;  3AV2 B;  1S32 A;  1H3O A;  2XD5 A;  5CPI B;  2JSS A;  1TAF B;  4ZUX A;  4R8P B;  4X23 D;  2IO5 B;  3AZG A;  1P3G C;  4M6B A;  3REI A;  2ZY3 A;  5B0Z D;  1KX5 C;  1P3I D;  1P3K D;  2DF4 C;  4NE3 A;  5B24 A;  3AZJ C;  4Z5T D;  1KU5 A;  5CPI A;  5BNX A;  5B33 B;  3W97 D;  4XUJ C;  2NQB A;  3REK C;  5AV6 D;  5FUG A;  1M1A C;  4WZS B;  4J8V A;  5B40 A;  1AOI A;  5DNM C;  3KUY A;  2Y2P A;  3AZM C;  2UWX A;  4HGA B;  4KHA B;  3C1C B;  5B0Y C;  3AZM A;  4KUD D;  3B0B A;  2LY8 A;  3AFA B;  3AZE C;  4J8V C;  4UUZ B;  4J8X B;  3W98 D;  1F66 A;  2ZY4 A;  3W99 A;  4J8X C;  1H3O B;  4Z5T A;  3REK D;  4ZUX B;  5GT3 D;  1P3O A;  3NQU B;  3MNN B;  2BYM B;  2JCH A;  5B24 C;  5C3I C;  3MNN D;  3AZM B;  4QLC C;  2FJ7 C;  1ULY A;  4UPK A;  3VH5 T;  1ZLA D;  5JA4 B;  4J8W C;  5B0Y D;  3UT9 C;  1ID3 C;  4WU8 C;  2HIO B;  5B33 C;  3VH6 W;  5FUG B;  3UTB A;  1S32 C;  5B40 B;  3A6N D;  3MGQ C;  2BYK B;  1EQZ A;  5AY8 A;  4QLC D;  2FJ7 D;  1PZR A;  3R45 A;  5KDM B;  5AV6 B;  5GT0 D;  3KXB D;  1P3F A;  1ZLA A;  3AZH B;  1TAF A;  1ID3 D;  3AV2 C;  4Z5T B;  3AZG C;  1P3G A;  1P3I B;  4Z5T C;  1P3K B;  3KUY D;  2YFW B;  5AV5 C;  3AZH C;  1WWI A;  4NE5 A;  5GXQ C;  5AV6 C;  4G91 C;  3WTP B;  4Z66 B;  3MGR C;  3WKJ A;  4J8U D;  3W98 A;  5CPI D;  5DNM D;  1BH9 B;  1WWS A;  3KXB C;  4H9N B;  3X1T C;  1KX3 B;  5GT3 B;  1AOI D;  3AZE D;  2BG1 A;  3AZG D;  4LD9 B;  2Y2O A;  5B32 G;  1ID3 B;  3UT9 B;  3VH5 A;  3X1V B;  3KXB A;  4H9P B;  1P3P C;  4QLC B;  5GSU B;  2FJ7 B;  5C3I B;  1A7W A;  4YM6 C;  1KX3 A;  5B24 D;  3MNN C;  3AL0 C;  5B0Z A;  2Y2H A;  4ZUX C;  1BH8 B;  4WNN A;  4J8W D;  2ZY5 A;  3UT9 A;  3LEL B;  5B33 D;  3LJA D;  3LZ0 D;  3C1C C;  1HTA A;  5E5A C;  3A6N C;  3MGP C;  5B0Z B;  5CPK D;  3B6F D;  5B32 D;  4YM6 D;  5CHL B;  3WAA D;  1M1A B;  2ARO A;  3UTA B;  4XUJ B;  5BNV B;  4H9R A;  2RIQ A;  3B6G B;  3O62 D;  3R45 B;  1U35 A;  2Y2Q A;  1KX5 B;  2XD1 A;  3W96 B;  1HQ3 D;  5CP6 B;  5AVC C;  4H9O B;  1P3G B;  1M19 B;  2IO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...