4H9SA

Complex structure 6 of daxx/h3.3(sub7)/h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
TVALREIRRYQKSTELLIRKLPFQRLVREICQDFKTDLRWQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9sA00
3AZKC 4ZBJC 3X1TD 4G91C 3LZ0C 5BNVB 3KWQD 4J8VB 1P3PC 3W96C 5GXQC 3R45A 4R8PB 4E45A 1N1JB 3V9RA 5DNMA 1P3ID 3WKJC 1P3FB 5B2IA 4ZUXD 3W97D 3WTPD 3C1BD 4YM6C 5AV5B 3AZJB 5GSUD 2FJ7A 1P3LB 1P3OB 5DNNB 4HGAB 4WU8A 1P3BB 5BS7C 3VH6A 5B40D 3B0CW 1KU5A 5B0ZC 5B2ID 3REKB 3REHD 1P3KC 4AWLB 3RELB 3X1TB 4Z2MH 1M1AC 5B0YA 5B31B 2YFVA 3NQUA 5CPIA 3KWQB 2PYOA 2YFWA 5BNXA 1S32A 2F8NK 4WU8D 3TU4C 3VH5T 5GT3A 5AV9A 3B6FD 1BH8B 4CAYA 5BO0A 3W97B 3WTPB 5F99C 3C1BB 3MGPC 5GSUB 4KUDA 4G92B 1WWSA 4XZQB 5B0YD 3AZLC 4DRBA 2BYKA 3B6GC 5CPID 5CP6A 1A7WA 1H3OB 1S32D 3X1UA 3MGSD 5AV5C 5AV9D 5GT3D 4X23A 3REJC 5B40B 3V9RB 1P3OC 5B2IB 1EQZC 5DNNC 3REHB 4E44A 4HGAC 4J8XC 1P3BC 4KUDD 4XUJA 5E5AA 1P34A 1ID3A 5B1MA 3W99A 3X1SA 3UT9B 2BYMA 4WU8B 3X1UD 4JJNB 3RELC 3B6FB 5B31C 4X23D 3AYWA 3WA9A 3MNNC 5JA4A 1F66C 3LZ0A 3MGRA 4QLCA 5B0YB 3W96A 4XUJD 5E5AD 1P34D 5CPJB 1ID3D 2YFWB 5B1MD 5AVBC 3W99D 5BNXB 3UTAB 3MGSB 4WU9B 1S32B 3REIB 5AV9B 5GT3B 3UTBA 4H9NA 1ZLAC 4XZQC 3LELC 4YM6A 5AV6A 3AYWD 3WA9D 4NE6A 4EO5C 1KX4A 5JRGA 3MGRD 4QLCD 2BYKB 2NZDA 5B32A 4H9PA 3UTBD 2CV5A 1B6WA 4X23B 5B0ZA 1P3GB 5AV6D 3UT9C 1KX4D 5JRGD 4JJNC 4XUJB 4YS3C 1P3AA 3AN2A 5B1MB 1ID3B 3B0BA 4WNNB 2NZDD 2F8NB 5B32D 2CV5D 3WAAA 5F99A 3MVDB 3X1VA 2HIOA 3MGPA 4NE3A 3AYWB 3WA9B 5GT0C 1ULYA 5CPJC 3AZLA 1KX3C 1M19C 3B6GA 4WU9C 2HUEB 3MGRB 3REIC 4J8WA 2RVQC 3AV1C 5B24A 1P3AD 3AZEA 3AN2D 1BH9A 5AY8C 2AROA 4H9NB 3AZIB 3AZGC 3WAAD 5AV8C 3X1VD 2HIOD 5AV6B 1AOIC 3AZMC 1KX4B 4J8WD 3W98C 1P3GC 5B24D 3AZED 5C3IB 5B32B 1KX5A 1TZYD 2CV5B 2AROD 1F66A 2L5AA 4J8UA 4LD9A 5B2JB 3AZFC 1HQ3B 3LZ1C 1P3AB 1TAFA 3MVDC 3AN2B 1P3MB 1ZLAA 3AZNC 4WV4B 3LELA 4DRAA 1KX5D 3WAAB 5DNMD 4KHAA 3O62C 3AV2A 4J8UD 2FJ7D 4LD9D 2NQBC 3KUYA 4J8WB 4NE5A 3KXBC 1M18C 4KGCA 4Z66A 5B33C 1TZYB 2AROB 1P3IB 3C1CA 4H9QA 4ZUXB 4J8VC 3AZHA 4UUZB 2IO5B 3AFAA 1U35A 3AV2D 4R8PC 3KUYD 2PYOD 1P3FC 4KGCD 4Z66D 5G49A 3AZJC 4Z5TA 3R45B 1P3LC 1KX5B 5B2JC 3A6NA 5DNMB 5B1LA 1HQ3C 3C1CD 5CPKA 3AZHD 3AFAD 4J8UB 5FUGA 1U35D 1P3MC 2FJ7B 5CP6D 4H9RA 3MGQA 2LY8A 3LJAA 3REKC 5AVCA 4AWLC 4H9SA 3X1TC 4Z5TD 1AOIA 3A6ND 3KWQC 5B1LD 5CPKD 3AZKA 4KHAB 4CSRA 5B31G 1P3PA 2YFVB 3NQUB 5CPIB 5BT1D 1P3IC 2PYOB 5GXQA 4KGCB 4ZUXC 4Z66B 2JSSA 3WTPC 3MGQD 3X1SD 3LJAD 3C1BC 3W97C 5GSUC 5AVCD 3WKJA 4G92C 3C1CB 4CAYB 4H9QB 5BO0B 3VH6T 3AZKD 1U35B 4KUDB 5KDMA 3LZ0D 1P3PD 5B40C 5CP6B 3W96D 2CWEA 5GXQD 5B2IC 5BS7A 3REHC 1Q9CA 3X1UB 5CHLB 3WKJD 4WZSB 3A6NB 5CPKB 1P3KA 4YM6D 1M1AA 3VH5W 4WU8C 5FUGB 3B6FC 5E5AB 1P34B 5B33A 3TU4A 3W99B 3X1SB 2BYMB 5BNVA 5B0YC 4J8VA 3B0DB 5B0ZD 3B0CT 5CPIC 1P3KD 3AZKB 3KSYA 5JA4B 1M1AD 3UTAC 1S32C 4R8PA 3MGSC 3LZ0B 5AV9C 5GT3C 4QLCB 1P3PB 1F1EA 3W96B 5GXQB 5B33D 5AV5A 3TU4D 3REJA 3UTBB 3WKJB 4KUDC 1P3OA 1EQZA 5DNNA 5F99D 3VH5A 4YM6B 4J8XA 3MGPD 1P3BA 3AZLD 2F8NH 5JRGB 3X1UC 3B6GD 3B0DC 4X23C 3RELA 3TU4B 5AV5D 2NZDB 5B31A 3REJD 4H9PB 3MNNA 5B0ZB 1P3OD 1EQZD 5DNND 4XUJC 5E5AC 1P3KB 1P34C 4J8XD 1ID3C 5B1MC 3W99C 1P3BD 1BH8A 1HTAA 5AVBA 3W97A 3AYWC 3WA9C 5GSUA 3RELD 4XZQA 5B31D 2F8NG 2HUEC 3MGRC 4QLCC 3MNND 5F99B 3X1VB 2HIOB 1H3OA 3MGPB 1F66D 3AZLB 3B6GB 5B40A 3UTBC 3AZIC 5AVBD 3REHA 5B24B 3AZEB 5AV6C 1BH9B 1JFIA 3REJB 1ZLAD 4XZQD 3LELD 1KX4C 5JRGC 1EQZB 3UT9A 3VH6W 4J8XB 4JJNA 3NQJA 3B6FA 5C3IC 2NZDC 4YS3A 5B32C 2CV5C 5B32G 3MNNB 5GT0A 5CPJA 1KX3A 3UTAA 1M19A 1F66B 3MGSA 3UT9D 4WU9A 3AN2C 3REIA 1P3AC 4LD9B 4JJND 3AV1A 4YS3D 5AVBB 3WAAC 5AY8A 1TAFB 3X1VC 2HIOC 1ZLAB 3LELB 3AZGA 1B67A 5AV8A 4J8WC 5GT0D 4EO5B 5CPJD 3AZMA 1KX3D 3UTAD 1M19D 5B24C 4WU9D 4Z2MG 3REID 3AZEC 3AV2B 2RVQD 3W98A 1P3GA 1TZYC 3KUYB 3AV1D 2AROC 5AY8D 2IO5C 1JFIB 3AZGD 5AV8D 1AOID 3AZHB 4WNNA 3AZMD 3AZFA 3AFAB 3NQJB 2F8NA 3W98D 4YS3B 3LZ1A 4H9OA 3MVDA 1P3GD 1KX5C 5DNMC 1BFMA 3AZNA 5G49B 4Z5TB 4J8UC 2FJ7C 4LD9C 3O62A 5B1LB 5GT0B 1KX3B 1M19B 2NQBA 3WTPE 3AZFD 2F8ND 3AZIA 3KXBA 3AV1B 1M18A 3LZ1D 3MVDD 4H9RB 5AY8B 3MGQB 3AZND 3LJAB 5AVCB 3AZGB 3AV2C 5AV8B 1AOIB 3O62D 3KUYC 2PYOC 4ZBJB 4CSRB 3AZMB 4KGCC 4M6BA 4Z66C 2NQBD 4G91B 1N1JA 3W98B 3AZID 3KXBD 1WWIA 1P3FA 1M18D 3C1CC 3AZJA 3AZHC 1P3LA 5B2JA 3AFAC 4NFTA 1U35C 1HQ3A 4J8VD 5CP6C 1P3MA 3AZFB 4R8PD 5KDMB 4Z5TC 1R4VA 3LZ1B 4H9OB 1P3FD 3REKA 3A6NC 5CPKC 5B1LC 3AZNB 3X1TA 3AZJD 1P3LD 5B2JD 3KWQA 1HQ3D 3O62B 5BT1C 1M1AB 3MGQC 1P3MD 2NQBB 3X1SC 3LJAC 1TZYA 5AVCC 1P3IA 4H9SC 3KXBB 1M18B 4ZUXA 3WTPA 3C1BA 4UUZA 5B33B 3REKD
chains in the Genus database with same CATH superfamily
3AZKC 4ZBJC 3X1TD 4G91C 3LZ0C 5BNVB 3KWQD 4J8VB 1P3PC 2Y2HA 3W96C 5GXQC 3R45A 4R8PB 4E45A 1N1JB 3V9RA 5DNMA 1P3ID 3WKJC 2G5HC 5B2IA 1P3FB 2Y2QA 2Y2OA 4ZUXD 3WTPD 3C1BD 3W97D 4YM6C 5AV5B 3AZJB 5GSUD 2FJ7A 1P3LB 1P3OB 5DNNB 4HGAB 4WU8A 1Z2CB 1P3BB 5BS7C 3VH6A 5B40D 2W8SA 3B0CW 1KU5A 5B0ZC 5B2ID 3REKB 3REHD 1P3KC 4AWLB 3RELB 3X1TB 4Z2MH 1M1AC 5B0YA 5B31B 2YFVA 3NQUA 5CPIA 3KWQB 2PYOA 3EG5B 2YFWA 5BNXA 3A1KA 1S32A 2F8NK 4WU8D 3TU4C 3VH5T 5GT3A 5AV9A 3B6FD 1BH8B 4CAYA 5BO0A 3W97B 3WTPB 5F99C 3C1BB 3MGPC 5GSUB 4KUDA 4G92B 1WWSA 4XZQB 5B0YD 3AZLC 4DRBA 2BYKA 3B6GC 5CPID 5CP6A 1A7WA 1H3OB 1S32D 3X1UA 3H0LC 3MGSD 5AV5C 5AV9D 5GT3D 4X23A 3REJC 5B40B 3V9RB 1P3OC 5B2IB 1EQZC 5DNNC 3REHB 4E44A 4HGAC 4J8XC 1P3BC 4KUDD 4XUJA 5E5AA 1P34A 1ID3A 5B1MA 3W99A 3X1SA 3EPJA 2BYMA 2XD1A 4WU8B 3UT9B 3X1UD 4JJNB 3RELC 3B6FB 5B31C 4X23D 3AYWA 3WA9A 3MNNC 5JA4A 1F66C 3LZ0A 3MGRA 4QLCA 5B0YB 3W96A 4XUJD 5E5AD 1P34D 3H0RC 5CPJB 5BNXB 2YFWB 5B1MD 3W99D 5AVBC 3UTAB 3MGSB 4WU9B 1S32B 2DF4C 3REIB 5AV9B 5GT3B 3UTBA 4H9NA 1ZLAC 4XZQC 3LELC 4YM6A 5AV6A 3AYWD 3WA9D 4NE6A 4EO5C 2BG1A 1KX4A 5JRGA 3MGRD 4QLCD 2BYKB 2NZDA 5B32A 4H9PA 3UTBD 2CV5A 1B6WA 4X23B 5B0ZA 1P3GB 5AV6D 3UT9C 1KX4D 5JRGD 4JJNC 4XUJB 4YS3C 1P3AA 3AN2A 5B1MB 1ID3B 3B0BA 4WNNB 2NZDD 2F8NB 5B32D 2CV5D 2ZY3A 3WAAA 5F99A 3MVDB 3X1VA 3AL0C 2HIOA 3MGPA 4NE3A 3AYWB 3WA9B 5GT0C 1ULYA 5CPJC 3AZLA 1KX3C 1M19C 3B6GA 4WU9C 2HUEB 3MGRB 3REIC 4J8WA 2RVQC 2Y2KA 3AV1C 5B24A 1P3AD 3AZEA 3AN2D 1BH9A 5AY8C 2AROA 4H9NB 2ZM5A 3AZIB 3AZGC 3WAAD 2XD5A 5AV8C 2HIOD 5AV6B 3X1VD 1AOIC 3AZMC 1KX4B 4J8WD 3W98C 1P3GC 5B24D 3AZED 5C3IB 5B32B 1KX5A 1TZYD 2CV5B 2AROD 1F66A 2L5AA 4J8UA 4LD9A 5B2JB 3AZFC 1HQ3B 3EPKA 3LZ1C 1P3AB 1TAFA 3MVDC 3AN2B 1P3MB 1ZLAA 3AZNC 4WV4B 3LELA 4DRAA 1KX5D 3WAAB 5DNMD 4KHAA 3O62C 3AV2A 4J8UD 2FJ7D 4LD9D 2NQBC 3KUYA 4J8WB 4NE5A 3P5JB 3KXBC 1M18C 4KGCA 4Z66A 5B33C 1TZYB 2AROB 1P3IB 3C1CA 4H9QA 4ZUXB 4J8VC 3AZHA 4UUZB 2IO5B 3AFAA 1U35A 3AV2D 4R8PC 3KUYD 2PYOD 1P3FC 4KGCD 4Z66D 5G49A 3AZJC 4Z5TA 3R45B 1P3LC 1KX5B 5B2JC 3A6NA 5DNMB 5B1LA 1HQ3C 3C1CD 5CPKA 3AZHD 3AFAD 4J8UB 5FUGA 1U35D 1P3MC 2FJ7B 5CP6D 4H9RA 3MGQA 4DQYB 2LY8A 3LJAA 3FDDA 3REKC 5AVCA 4AWLC 4H9SA 3X1TC 4Z5TD 1AOIA 3A6ND 3KWQC 5B1LD 5CPKD 3AZKA 4KHAB 4CSRA 5B31G 1P3PA 2YFVB 3NQUB 5CPIB 5BT1D 1P3IC 2J8PA 2PYOB 5GXQA 4KGCB 4ZUXC 4Z66B 2JSSA 3WTPC 3MGQD 3X1SD 3LJAD 3C1BC 3W97C 5GSUC 5AVCD 3WKJA 4G92C 3C1CB 4CAYB 4H9QB 5BO0B 3VH6T 3AZKD 1U35B 4KUDB 5KDMA 3LZ0D 1P3PD 5B40C 5CP6B 3W96D 2CWEA 5GXQD 5B2IC 5BS7A 3REHC 1Q9CA 3X1UB 2Y2GA 5CHLB 3WKJD 1ID3D 4WZSB 3A6NB 5CPKB 1P3KA 4YM6D 1M1AA 3VH5W 4WU8C 5FUGB 3B6FC 5E5AB 1P34B 5B33A 3TU4A 3W99B 3X1SB 2BYMB 5BNVA 5B0YC 4J8VA 3B0DB 5B0ZD 3B0CT 5CPIC 1P3KD 1W2EA 3AZKB 2UWXA 3KSYA 5JA4B 1M1AD 3UTAC 1S32C 4R8PA 3MGSC 3LZ0B 5AV9C 5GT3C 4QLCB 4UPKA 1P3PB 1F1EA 3W96B 5GXQB 5B33D 5AV5A 3TU4D 3REJA 2JCHA 3UTBB 3WKJB 4KUDC 1P3OA 1EQZA 5DNNA 5F99D 3A1IA 3VH5A 4YM6B 4J8XA 3MGPD 1P3BA 3KFUG 3AZLD 2F8NH 2Y2MA 5JRGB 3X1UC 3B6GD 3B0DC 4X23C 3H0MC 2G5IC 3RELA 3TU4B 5AV5D 2NZDB 5B31A 3REJD 4H9PB 3MNNA 5B0ZB 1P3OD 1EQZD 5DNND 4XUJC 5E5AC 1P3KB 1P34C 4J8XD 1ID3C 5B1MC 3W99C 1P3BD 1BH8A 1HTAA 5AVBA 3W97A 3AYWC 3WA9C 5GSUA 3RELD 4XZQA 5B31D 2F8NG 2HUEC 2VQRA 3MGRC 4QLCC 3MNND 5F99B 3X1VB 2HIOB 1H3OA 3MGPB 1F66D 3AZLB 2F2AC 2Y2IA 3B6GB 5B40A 3UTBC 3AZIC 5AVBD 3REHA 5B24B 3AZEB 5AV6C 1BH9B 1JFIA 3REJB 1ZLAD 4XZQD 3LELD 1KX4C 5JRGC 1EQZB 3UT9A 3VH6W 4J8XB 1PZRA 3NQJA 4JJNA 3B6FA 5C3IC 2NZDC 4YS3A 5B32C 2CV5C 2DQNC 5B32G 3MNNB 5GT0A 5CPJA 1KX3A 3UTAA 1M19A 1F66B 3MGSA 3UT9D 4WU9A 3AN2C 3REIA 1P3AC 4LD9B 4JJND 3AV1A 4YS3D 5AVBB 3WAAC 5AY8A 1TAFB 3X1VC 2HIOC 1ZLAB 3LELB 3AZGA 1B67A 5AV8A 4J8WC 5GT0D 4EO5B 5CPJD 3AZMA 1KX3D 3UTAD 1M19D 5B24C 4WU9D 4Z2MG 3REID 3AZEC 3AV2B 2RVQD 3W98A 1P3GA 1TZYC 3KUYB 3AV1D 2AROC 5AY8D 2IO5C 1JFIB 3AZGD 5AV8D 1AOID 3AZHB 4WNNA 3AZMD 3AZFA 3F6TA 3AFAB 3NQJB 2F8NA 3W98D 4YS3B 3LZ1A 4H9OA 3MVDA 1P3GD 1KX5C 3EPLA 5DNMC 1BFMA 3AZNA 5G49B 4Z5TB 4J8UC 2FJ7C 4LD9C 3O62A 2ZY5A 5B1LB 5GT0B 2ZY4A 1KX3B 1M19B 2NQBA 3WTPE 3AZFD 2F8ND 3AZIA 3KXBA 3AV1B 1M18A 3LZ1D 3MVDD 4H9RB 5AY8B 3MGQB 3AZND 3LJAB 4WJ3C 2Y2PA 5AVCB 3AZGB 2FFFB 3AV2C 5AV8B 1AOIB 3O62D 3KUYC 2PYOC 4ZBJB 4CSRB 3AZMB 4KGCC 4M6BA 4Z66C 2NQBD 4G91B 1N1JA 3W98B 3AZID 3KXBD 1WWIA 1P3FA 1T3UA 1M18D 3C1CC 3AZJA 3AZHC 1P3LA 5B2JA 3AFAC 4NFTA 1U35C 1HQ3A 2Y2NA 3IP4C 4J8VD 5CP6C 1P3MA 3AZFB 4R8PD 5KDMB 3EPHA 4Z5TC 1R4VA 2Y2LA 4H9OB 3LZ1B 1P3FD 3REKA 3A6NC 5CPKC 5B1LC 3AZNB 3X1TA 3AZJD 2ZY2A 1P3LD 5B2JD 3KWQA 1HQ3D 2Y2JA 3O62B 5BT1C 1M1AB 3MGQC 1P3MD 2NQBB 3X1SC 3LJAC 1TZYA 2RIQA 5AVCC 1P3IA 4H9SC 2JE5A 3KXBB 1M18B 4ZUXA 3WTPA 3C1BA 4UUZA 5B33B 3REKD
chains in the Genus database with same CATH topology
3AZKC 4ZBJC 3X1TD 4G91C 3LZ0C 5BNVB 3KWQD 4J8VB 1P3PC 2Y2HA 3W96C 5GXQC 3R45A 4R8PB 4E45A 1N1JB 3V9RA 5DNMA 1P3ID 3WKJC 2G5HC 5B2IA 1P3FB 2Y2QA 2Y2OA 4ZUXD 3WTPD 3C1BD 3W97D 4YM6C 5AV5B 3AZJB 5GSUD 2FJ7A 1P3LB 1P3OB 5DNNB 4HGAB 4WU8A 1Z2CB 1P3BB 5BS7C 3VH6A 5B40D 2W8SA 3B0CW 1KU5A 5B0ZC 5B2ID 3REKB 3REHD 1P3KC 4AWLB 3RELB 3X1TB 4Z2MH 1M1AC 5B0YA 5B31B 2YFVA 3NQUA 5CPIA 3KWQB 2PYOA 3EG5B 2YFWA 5BNXA 3A1KA 1S32A 2F8NK 4WU8D 3TU4C 3VH5T 5GT3A 5AV9A 3B6FD 1BH8B 4CAYA 5BO0A 3W97B 3WTPB 5F99C 3C1BB 3MGPC 5GSUB 4KUDA 4G92B 1WWSA 4XZQB 5B0YD 3AZLC 4DRBA 2BYKA 3B6GC 5CPID 5CP6A 1A7WA 1H3OB 1S32D 3X1UA 3H0LC 3MGSD 5AV5C 5AV9D 5GT3D 4X23A 3REJC 5B40B 3V9RB 1P3OC 5B2IB 1EQZC 5DNNC 3REHB 4E44A 4HGAC 4J8XC 1P3BC 4KUDD 4XUJA 5E5AA 1P34A 1ID3A 5B1MA 3W99A 3X1SA 3EPJA 2BYMA 2XD1A 4WU8B 3UT9B 3X1UD 4JJNB 3RELC 3B6FB 5B31C 4X23D 3AYWA 3WA9A 3MNNC 5JA4A 1F66C 3LZ0A 3MGRA 4QLCA 5B0YB 3W96A 4XUJD 5E5AD 1P34D 3H0RC 5CPJB 5BNXB 2YFWB 5B1MD 3W99D 5AVBC 3UTAB 3MGSB 4WU9B 1S32B 2DF4C 3REIB 5AV9B 5GT3B 3UTBA 4H9NA 1ZLAC 4XZQC 3LELC 4YM6A 5AV6A 3AYWD 3WA9D 4NE6A 4EO5C 2BG1A 1KX4A 5JRGA 3MGRD 4QLCD 2BYKB 2NZDA 5B32A 4H9PA 3UTBD 2CV5A 1B6WA 4X23B 5B0ZA 1P3GB 5AV6D 3UT9C 1KX4D 5JRGD 4JJNC 4XUJB 4YS3C 1P3AA 3AN2A 5B1MB 1ID3B 3B0BA 4WNNB 2NZDD 2F8NB 5B32D 2CV5D 2ZY3A 3WAAA 5F99A 3MVDB 3X1VA 3AL0C 2HIOA 3MGPA 4NE3A 3AYWB 3WA9B 5GT0C 1ULYA 5CPJC 3AZLA 1KX3C 1M19C 3B6GA 4WU9C 2HUEB 3MGRB 3REIC 4J8WA 2RVQC 2Y2KA 3AV1C 5B24A 1P3AD 3AZEA 3AN2D 1BH9A 5AY8C 2AROA 4H9NB 2ZM5A 3AZIB 3AZGC 3WAAD 2XD5A 5AV8C 2HIOD 5AV6B 3X1VD 1AOIC 3AZMC 1KX4B 4J8WD 3W98C 1P3GC 5B24D 3AZED 5C3IB 5B32B 1KX5A 1TZYD 2CV5B 2AROD 1F66A 2L5AA 4J8UA 4LD9A 5B2JB 3AZFC 1HQ3B 3EPKA 3LZ1C 1P3AB 1TAFA 3MVDC 3AN2B 1P3MB 1ZLAA 3AZNC 4WV4B 3LELA 4DRAA 1KX5D 3WAAB 5DNMD 4KHAA 3O62C 3AV2A 4J8UD 2FJ7D 4LD9D 2NQBC 3KUYA 4J8WB 4NE5A 3P5JB 3KXBC 1M18C 4KGCA 4Z66A 5B33C 1TZYB 2AROB 1P3IB 3C1CA 4H9QA 4ZUXB 4J8VC 3AZHA 4UUZB 2IO5B 3AFAA 1U35A 3AV2D 4R8PC 3KUYD 2PYOD 1P3FC 4KGCD 4Z66D 5G49A 3AZJC 4Z5TA 3R45B 1P3LC 1KX5B 5B2JC 3A6NA 5DNMB 5B1LA 1HQ3C 3C1CD 5CPKA 3AZHD 3AFAD 4J8UB 5FUGA 1U35D 1P3MC 2FJ7B 5CP6D 4H9RA 3MGQA 4DQYB 2LY8A 3LJAA 3FDDA 3REKC 5AVCA 4AWLC 4H9SA 3X1TC 4Z5TD 1AOIA 3A6ND 3KWQC 5B1LD 5CPKD 3AZKA 4KHAB 4CSRA 5B31G 1P3PA 2YFVB 3NQUB 5CPIB 5BT1D 1P3IC 2J8PA 2PYOB 5GXQA 4KGCB 4ZUXC 4Z66B 2JSSA 3WTPC 3MGQD 3X1SD 3LJAD 3C1BC 3W97C 5GSUC 5AVCD 3WKJA 4G92C 3C1CB 4CAYB 4H9QB 5BO0B 3VH6T 3AZKD 1U35B 4KUDB 5KDMA 3LZ0D 1P3PD 5B40C 5CP6B 3W96D 2CWEA 5GXQD 5B2IC 5BS7A 3REHC 1Q9CA 3X1UB 2Y2GA 5CHLB 3WKJD 1ID3D 4WZSB 3A6NB 5CPKB 1P3KA 4YM6D 1M1AA 3VH5W 4WU8C 5FUGB 3B6FC 5E5AB 1P34B 5B33A 3TU4A 3W99B 3X1SB 2BYMB 5BNVA 5B0YC 4J8VA 3B0DB 5B0ZD 3B0CT 5CPIC 1P3KD 1W2EA 3AZKB 2UWXA 3KSYA 5JA4B 1M1AD 3UTAC 1S32C 4R8PA 3MGSC 3LZ0B 5AV9C 5GT3C 4QLCB 4UPKA 1P3PB 1F1EA 3W96B 5GXQB 5B33D 5AV5A 3TU4D 3REJA 2JCHA 3UTBB 3WKJB 4KUDC 1P3OA 1EQZA 5DNNA 5F99D 3A1IA 3VH5A 4YM6B 4J8XA 3MGPD 1P3BA 3KFUG 3AZLD 2F8NH 2Y2MA 5JRGB 3X1UC 3B6GD 3B0DC 4X23C 3H0MC 2G5IC 3RELA 3TU4B 5AV5D 2NZDB 5B31A 3REJD 4H9PB 3MNNA 5B0ZB 1P3OD 1EQZD 5DNND 4XUJC 5E5AC 1P3KB 1P34C 4J8XD 1ID3C 5B1MC 3W99C 1P3BD 1BH8A 1HTAA 5AVBA 3W97A 3AYWC 3WA9C 5GSUA 3RELD 4XZQA 5B31D 2F8NG 2HUEC 2VQRA 3MGRC 4QLCC 3MNND 5F99B 3X1VB 2HIOB 1H3OA 3MGPB 1F66D 3AZLB 2F2AC 2Y2IA 3B6GB 5B40A 3UTBC 3AZIC 5AVBD 3REHA 5B24B 3AZEB 5AV6C 1BH9B 1JFIA 3REJB 1ZLAD 4XZQD 3LELD 1KX4C 5JRGC 1EQZB 3UT9A 3VH6W 4J8XB 1PZRA 3NQJA 4JJNA 3B6FA 5C3IC 2NZDC 4YS3A 5B32C 2CV5C 2DQNC 5B32G 3MNNB 5GT0A 5CPJA 1KX3A 3UTAA 1M19A 1F66B 3MGSA 3UT9D 4WU9A 3AN2C 3REIA 1P3AC 4LD9B 4JJND 3AV1A 4YS3D 5AVBB 3WAAC 5AY8A 1TAFB 3X1VC 2HIOC 1ZLAB 3LELB 3AZGA 1B67A 5AV8A 4J8WC 5GT0D 4EO5B 5CPJD 3AZMA 1KX3D 3UTAD 1M19D 5B24C 4WU9D 4Z2MG 3REID 3AZEC 3AV2B 2RVQD 3W98A 1P3GA 1TZYC 3KUYB 3AV1D 2AROC 5AY8D 2IO5C 1JFIB 3AZGD 5AV8D 1AOID 3AZHB 4WNNA 3AZMD 3AZFA 3F6TA 3AFAB 3NQJB 2F8NA 3W98D 4YS3B 3LZ1A 4H9OA 3MVDA 1P3GD 1KX5C 3EPLA 5DNMC 1BFMA 3AZNA 5G49B 4Z5TB 4J8UC 2FJ7C 4LD9C 3O62A 2ZY5A 5B1LB 5GT0B 2ZY4A 1KX3B 1M19B 2NQBA 3WTPE 3AZFD 2F8ND 3AZIA 3KXBA 3AV1B 1M18A 3LZ1D 3MVDD 4H9RB 5AY8B 3MGQB 3AZND 3LJAB 4WJ3C 2Y2PA 5AVCB 3AZGB 2FFFB 3AV2C 5AV8B 1AOIB 3O62D 3KUYC 2PYOC 4ZBJB 4CSRB 3AZMB 4KGCC 4M6BA 4Z66C 2NQBD 4G91B 1N1JA 3W98B 3AZID 3KXBD 1WWIA 1P3FA 1T3UA 1M18D 3C1CC 3AZJA 3AZHC 1P3LA 5B2JA 3AFAC 4NFTA 1U35C 1HQ3A 2Y2NA 3IP4C 4J8VD 5CP6C 1P3MA 3AZFB 4R8PD 5KDMB 3EPHA 4Z5TC 1R4VA 2Y2LA 4H9OB 3LZ1B 1P3FD 3REKA 3A6NC 5CPKC 5B1LC 3AZNB 3X1TA 3AZJD 2ZY2A 1P3LD 5B2JD 3KWQA 1HQ3D 2Y2JA 3O62B 5BT1C 1M1AB 3MGQC 1P3MD 2NQBB 3X1SC 3LJAC 1TZYA 2RIQA 5AVCC 1P3IA 4H9SC 2JE5A 3KXBB 1M18B 4ZUXA 3WTPA 3C1BA 4UUZA 5B33B 3REKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK C;  4ZBJ C;  3X1T D;  4G91 C;  3LZ0 C;  5BNV B;  3KWQ D;  4J8V B;  1P3P C;  3W96 C;  5GXQ C;  3R45 A;  4R8P B;  4E45 A;  1N1J B;  3V9R A;  5DNM A;  1P3I D;  3WKJ C;  1P3F B;  5B2I A;  4ZUX D;  3W97 D;  3WTP D;  3C1B D;  4YM6 C;  5AV5 B;  3AZJ B;  5GSU D;  2FJ7 A;  1P3L B;  1P3O B;  5DNN B;  4HGA B;  4WU8 A;  1P3B B;  5BS7 C;  3VH6 A;  5B40 D;  3B0C W;  1KU5 A;  5B0Z C;  5B2I D;  3REK B;  3REH D;  1P3K C;  4AWL B;  3REL B;  3X1T B;  4Z2M H;  1M1A C;  5B0Y A;  5B31 B;  2YFV A;  3NQU A;  5CPI A;  3KWQ B;  2PYO A;  2YFW A;  5BNX A;  1S32 A;  2F8N K;  4WU8 D;  3TU4 C;  3VH5 T;  5GT3 A;  5AV9 A;  3B6F D;  1BH8 B;  4CAY A;  5BO0 A;  3W97 B;  3WTP B;  5F99 C;  3C1B B;  3MGP C;  5GSU B;  4KUD A;  4G92 B;  1WWS A;  4XZQ B;  5B0Y D;  3AZL C;  4DRB A;  2BYK A;  3B6G C;  5CPI D;  5CP6 A;  1A7W A;  1H3O B;  1S32 D;  3X1U A;  3MGS D;  5AV5 C;  5AV9 D;  5GT3 D;  4X23 A;  3REJ C;  5B40 B;  3V9R B;  1P3O C;  5B2I B;  1EQZ C;  5DNN C;  3REH B;  4E44 A;  4HGA C;  4J8X C;  1P3B C;  4KUD D;  4XUJ A;  5E5A A;  1P34 A;  1ID3 A;  5B1M A;  3W99 A;  3X1S A;  3UT9 B;  2BYM A;  4WU8 B;  3X1U D;  4JJN B;  3REL C;  3B6F B;  5B31 C;  4X23 D;  3AYW A;  3WA9 A;  3MNN C;  5JA4 A;  1F66 C;  3LZ0 A;  3MGR A;  4QLC A;  5B0Y B;  3W96 A;  4XUJ D;  5E5A D;  1P34 D;  5CPJ B;  1ID3 D;  2YFW B;  5B1M D;  5AVB C;  3W99 D;  5BNX B;  3UTA B;  3MGS B;  4WU9 B;  1S32 B;  3REI B;  5AV9 B;  5GT3 B;  3UTB A;  4H9N A;  1ZLA C;  4XZQ C;  3LEL C;  4YM6 A;  5AV6 A;  3AYW D;  3WA9 D;  4NE6 A;  4EO5 C;  1KX4 A;  5JRG A;  3MGR D;  4QLC D;  2BYK B;  2NZD A;  5B32 A;  4H9P A;  3UTB D;  2CV5 A;  1B6W A;  4X23 B;  5B0Z A;  1P3G B;  5AV6 D;  3UT9 C;  1KX4 D;  5JRG D;  4JJN C;  4XUJ B;  4YS3 C;  1P3A A;  3AN2 A;  5B1M B;  1ID3 B;  3B0B A;  4WNN B;  2NZD D;  2F8N B;  5B32 D;  2CV5 D;  3WAA A;  5F99 A;  3MVD B;  3X1V A;  2HIO A;  3MGP A;  4NE3 A;  3AYW B;  3WA9 B;  5GT0 C;  1ULY A;  5CPJ C;  3AZL A;  1KX3 C;  1M19 C;  3B6G A;  4WU9 C;  2HUE B;  3MGR B;  3REI C;  4J8W A;  2RVQ C;  3AV1 C;  5B24 A;  1P3A D;  3AZE A;  3AN2 D;  1BH9 A;  5AY8 C;  2ARO A;  4H9N B;  3AZI B;  3AZG C;  3WAA D;  5AV8 C;  3X1V D;  2HIO D;  5AV6 B;  1AOI C;  3AZM C;  1KX4 B;  4J8W D;  3W98 C;  1P3G C;  5B24 D;  3AZE D;  5C3I B;  5B32 B;  1KX5 A;  1TZY D;  2CV5 B;  2ARO D;  1F66 A;  2L5A A;  4J8U A;  4LD9 A;  5B2J B;  3AZF C;  1HQ3 B;  3LZ1 C;  1P3A B;  1TAF A;  3MVD C;  3AN2 B;  1P3M B;  1ZLA A;  3AZN C;  4WV4 B;  3LEL A;  4DRA A;  1KX5 D;  3WAA B;  5DNM D;  4KHA A;  3O62 C;  3AV2 A;  4J8U D;  2FJ7 D;  4LD9 D;  2NQB C;  3KUY A;  4J8W B;  4NE5 A;  3KXB C;  1M18 C;  4KGC A;  4Z66 A;  5B33 C;  1TZY B;  2ARO B;  1P3I B;  3C1C A;  4H9Q A;  4ZUX B;  4J8V C;  3AZH A;  4UUZ B;  2IO5 B;  3AFA A;  1U35 A;  3AV2 D;  4R8P C;  3KUY D;  2PYO D;  1P3F C;  4KGC D;  4Z66 D;  5G49 A;  3AZJ C;  4Z5T A;  3R45 B;  1P3L C;  1KX5 B;  5B2J C;  3A6N A;  5DNM B;  5B1L A;  1HQ3 C;  3C1C D;  5CPK A;  3AZH D;  3AFA D;  4J8U B;  5FUG A;  1U35 D;  1P3M C;  2FJ7 B;  5CP6 D;  4H9R A;  3MGQ A;  2LY8 A;  3LJA A;  3REK C;  5AVC A;  4AWL C;  4H9S A;  3X1T C;  4Z5T D;  1AOI A;  3A6N D;  3KWQ C;  5B1L D;  5CPK D;  3AZK A;  4KHA B;  4CSR A;  5B31 G;  1P3P A;  2YFV B;  3NQU B;  5CPI B;  5BT1 D;  1P3I C;  2PYO B;  5GXQ A;  4KGC B;  4ZUX C;  4Z66 B;  2JSS A;  3WTP C;  3MGQ D;  3X1S D;  3LJA D;  3C1B C;  3W97 C;  5GSU C;  5AVC D;  3WKJ A;  4G92 C;  3C1C B;  4CAY B;  4H9Q B;  5BO0 B;  3VH6 T;  3AZK D;  1U35 B;  4KUD B;  5KDM A;  3LZ0 D;  1P3P D;  5B40 C;  5CP6 B;  3W96 D;  2CWE A;  5GXQ D;  5B2I C;  5BS7 A;  3REH C;  1Q9C A;  3X1U B;  5CHL B;  3WKJ D;  4WZS B;  3A6N B;  5CPK B;  1P3K A;  4YM6 D;  1M1A A;  3VH5 W;  4WU8 C;  5FUG B;  3B6F C;  5E5A B;  1P34 B;  5B33 A;  3TU4 A;  3W99 B;  3X1S B;  2BYM B;  5BNV A;  5B0Y C;  4J8V A;  3B0D B;  5B0Z D;  3B0C T;  5CPI C;  1P3K D;  3AZK B;  3KSY A;  5JA4 B;  1M1A D;  3UTA C;  1S32 C;  4R8P A;  3MGS C;  3LZ0 B;  5AV9 C;  5GT3 C;  4QLC B;  1P3P B;  1F1E A;  3W96 B;  5GXQ B;  5B33 D;  5AV5 A;  3TU4 D;  3REJ A;  3UTB B;  3WKJ B;  4KUD C;  1P3O A;  1EQZ A;  5DNN A;  5F99 D;  3VH5 A;  4YM6 B;  4J8X A;  3MGP D;  1P3B A;  3AZL D;  2F8N H;  5JRG B;  3X1U C;  3B6G D;  3B0D C;  4X23 C;  3REL A;  3TU4 B;  5AV5 D;  2NZD B;  5B31 A;  3REJ D;  4H9P B;  3MNN A;  5B0Z B;  1P3O D;  1EQZ D;  5DNN D;  4XUJ C;  5E5A C;  1P3K B;  1P34 C;  4J8X D;  1ID3 C;  5B1M C;  3W99 C;  1P3B D;  1BH8 A;  1HTA A;  5AVB A;  3W97 A;  3AYW C;  3WA9 C;  5GSU A;  3REL D;  4XZQ A;  5B31 D;  2F8N G;  2HUE C;  3MGR C;  4QLC C;  3MNN D;  5F99 B;  3X1V B;  2HIO B;  1H3O A;  3MGP B;  1F66 D;  3AZL B;  3B6G B;  5B40 A;  3UTB C;  3AZI C;  5AVB D;  3REH A;  5B24 B;  3AZE B;  5AV6 C;  1BH9 B;  1JFI A;  3REJ B;  1ZLA D;  4XZQ D;  3LEL D;  1KX4 C;  5JRG C;  1EQZ B;  3UT9 A;  3VH6 W;  4J8X B;  4JJN A;  3NQJ A;  3B6F A;  5C3I C;  2NZD C;  4YS3 A;  5B32 C;  2CV5 C;  5B32 G;  3MNN B;  5GT0 A;  5CPJ A;  1KX3 A;  3UTA A;  1M19 A;  1F66 B;  3MGS A;  3UT9 D;  4WU9 A;  3AN2 C;  3REI A;  1P3A C;  4LD9 B;  4JJN D;  3AV1 A;  4YS3 D;  5AVB B;  3WAA C;  5AY8 A;  1TAF B;  3X1V C;  2HIO C;  1ZLA B;  3LEL B;  3AZG A;  1B67 A;  5AV8 A;  4J8W C;  5GT0 D;  4EO5 B;  5CPJ D;  3AZM A;  1KX3 D;  3UTA D;  1M19 D;  5B24 C;  4WU9 D;  4Z2M G;  3REI D;  3AZE C;  3AV2 B;  2RVQ D;  3W98 A;  1P3G A;  1TZY C;  3KUY B;  3AV1 D;  2ARO C;  5AY8 D;  2IO5 C;  1JFI B;  3AZG D;  5AV8 D;  1AOI D;  3AZH B;  4WNN A;  3AZM D;  3AZF A;  3AFA B;  3NQJ B;  2F8N A;  3W98 D;  4YS3 B;  3LZ1 A;  4H9O A;  3MVD A;  1P3G D;  1KX5 C;  5DNM C;  1BFM A;  3AZN A;  5G49 B;  4Z5T B;  4J8U C;  2FJ7 C;  4LD9 C;  3O62 A;  5B1L B;  5GT0 B;  1KX3 B;  1M19 B;  2NQB A;  3WTP E;  3AZF D;  2F8N D;  3AZI A;  3KXB A;  3AV1 B;  1M18 A;  3LZ1 D;  3MVD D;  4H9R B;  5AY8 B;  3MGQ B;  3AZN D;  3LJA B;  5AVC B;  3AZG B;  3AV2 C;  5AV8 B;  1AOI B;  3O62 D;  3KUY C;  2PYO C;  4ZBJ B;  4CSR B;  3AZM B;  4KGC C;  4M6B A;  4Z66 C;  2NQB D;  4G91 B;  1N1J A;  3W98 B;  3AZI D;  3KXB D;  1WWI A;  1P3F A;  1M18 D;  3C1C C;  3AZJ A;  3AZH C;  1P3L A;  5B2J A;  3AFA C;  4NFT A;  1U35 C;  1HQ3 A;  4J8V D;  5CP6 C;  1P3M A;  3AZF B;  4R8P D;  5KDM B;  4Z5T C;  1R4V A;  3LZ1 B;  4H9O B;  1P3F D;  3REK A;  3A6N C;  5CPK C;  5B1L C;  3AZN B;  3X1T A;  3AZJ D;  1P3L D;  5B2J D;  3KWQ A;  1HQ3 D;  3O62 B;  5BT1 C;  1M1A B;  3MGQ C;  1P3M D;  2NQB B;  3X1S C;  3LJA C;  1TZY A;  5AVC C;  1P3I A;  4H9S C;  3KXB B;  1M18 B;  4ZUX A;  3WTP A;  3C1B A;  4UUZ A;  5B33 B;  3REK D; 
#chains in the Genus database with same CATH topology
 3AZK C;  4ZBJ C;  3X1T D;  4G91 C;  3LZ0 C;  5BNV B;  3KWQ D;  4J8V B;  1P3P C;  2Y2H A;  3W96 C;  5GXQ C;  3R45 A;  4R8P B;  4E45 A;  1N1J B;  3V9R A;  5DNM A;  1P3I D;  3WKJ C;  2G5H C;  5B2I A;  1P3F B;  2Y2Q A;  2Y2O A;  4ZUX D;  3WTP D;  3C1B D;  3W97 D;  4YM6 C;  5AV5 B;  3AZJ B;  5GSU D;  2FJ7 A;  1P3L B;  1P3O B;  5DNN B;  4HGA B;  4WU8 A;  1Z2C B;  1P3B B;  5BS7 C;  3VH6 A;  5B40 D;  2W8S A;  3B0C W;  1KU5 A;  5B0Z C;  5B2I D;  3REK B;  3REH D;  1P3K C;  4AWL B;  3REL B;  3X1T B;  4Z2M H;  1M1A C;  5B0Y A;  5B31 B;  2YFV A;  3NQU A;  5CPI A;  3KWQ B;  2PYO A;  3EG5 B;  2YFW A;  5BNX A;  3A1K A;  1S32 A;  2F8N K;  4WU8 D;  3TU4 C;  3VH5 T;  5GT3 A;  5AV9 A;  3B6F D;  1BH8 B;  4CAY A;  5BO0 A;  3W97 B;  3WTP B;  5F99 C;  3C1B B;  3MGP C;  5GSU B;  4KUD A;  4G92 B;  1WWS A;  4XZQ B;  5B0Y D;  3AZL C;  4DRB A;  2BYK A;  3B6G C;  5CPI D;  5CP6 A;  1A7W A;  1H3O B;  1S32 D;  3X1U A;  3H0L C;  3MGS D;  5AV5 C;  5AV9 D;  5GT3 D;  4X23 A;  3REJ C;  5B40 B;  3V9R B;  1P3O C;  5B2I B;  1EQZ C;  5DNN C;  3REH B;  4E44 A;  4HGA C;  4J8X C;  1P3B C;  4KUD D;  4XUJ A;  5E5A A;  1P34 A;  1ID3 A;  5B1M A;  3W99 A;  3X1S A;  3EPJ A;  2BYM A;  2XD1 A;  4WU8 B;  3UT9 B;  3X1U D;  4JJN B;  3REL C;  3B6F B;  5B31 C;  4X23 D;  3AYW A;  3WA9 A;  3MNN C;  5JA4 A;  1F66 C;  3LZ0 A;  3MGR A;  4QLC A;  5B0Y B;  3W96 A;  4XUJ D;  5E5A D;  1P34 D;  3H0R C;  5CPJ B;  5BNX B;  2YFW B;  5B1M D;  3W99 D;  5AVB C;  3UTA B;  3MGS B;  4WU9 B;  1S32 B;  2DF4 C;  3REI B;  5AV9 B;  5GT3 B;  3UTB A;  4H9N A;  1ZLA C;  4XZQ C;  3LEL C;  4YM6 A;  5AV6 A;  3AYW D;  3WA9 D;  4NE6 A;  4EO5 C;  2BG1 A;  1KX4 A;  5JRG A;  3MGR D;  4QLC D;  2BYK B;  2NZD A;  5B32 A;  4H9P A;  3UTB D;  2CV5 A;  1B6W A;  4X23 B;  5B0Z A;  1P3G B;  5AV6 D;  3UT9 C;  1KX4 D;  5JRG D;  4JJN C;  4XUJ B;  4YS3 C;  1P3A A;  3AN2 A;  5B1M B;  1ID3 B;  3B0B A;  4WNN B;  2NZD D;  2F8N B;  5B32 D;  2CV5 D;  2ZY3 A;  3WAA A;  5F99 A;  3MVD B;  3X1V A;  3AL0 C;  2HIO A;  3MGP A;  4NE3 A;  3AYW B;  3WA9 B;  5GT0 C;  1ULY A;  5CPJ C;  3AZL A;  1KX3 C;  1M19 C;  3B6G A;  4WU9 C;  2HUE B;  3MGR B;  3REI C;  4J8W A;  2RVQ C;  2Y2K A;  3AV1 C;  5B24 A;  1P3A D;  3AZE A;  3AN2 D;  1BH9 A;  5AY8 C;  2ARO A;  4H9N B;  2ZM5 A;  3AZI B;  3AZG C;  3WAA D;  2XD5 A;  5AV8 C;  2HIO D;  5AV6 B;  3X1V D;  1AOI C;  3AZM C;  1KX4 B;  4J8W D;  3W98 C;  1P3G C;  5B24 D;  3AZE D;  5C3I B;  5B32 B;  1KX5 A;  1TZY D;  2CV5 B;  2ARO D;  1F66 A;  2L5A A;  4J8U A;  4LD9 A;  5B2J B;  3AZF C;  1HQ3 B;  3EPK A;  3LZ1 C;  1P3A B;  1TAF A;  3MVD C;  3AN2 B;  1P3M B;  1ZLA A;  3AZN C;  4WV4 B;  3LEL A;  4DRA A;  1KX5 D;  3WAA B;  5DNM D;  4KHA A;  3O62 C;  3AV2 A;  4J8U D;  2FJ7 D;  4LD9 D;  2NQB C;  3KUY A;  4J8W B;  4NE5 A;  3P5J B;  3KXB C;  1M18 C;  4KGC A;  4Z66 A;  5B33 C;  1TZY B;  2ARO B;  1P3I B;  3C1C A;  4H9Q A;  4ZUX B;  4J8V C;  3AZH A;  4UUZ B;  2IO5 B;  3AFA A;  1U35 A;  3AV2 D;  4R8P C;  3KUY D;  2PYO D;  1P3F C;  4KGC D;  4Z66 D;  5G49 A;  3AZJ C;  4Z5T A;  3R45 B;  1P3L C;  1KX5 B;  5B2J C;  3A6N A;  5DNM B;  5B1L A;  1HQ3 C;  3C1C D;  5CPK A;  3AZH D;  3AFA D;  4J8U B;  5FUG A;  1U35 D;  1P3M C;  2FJ7 B;  5CP6 D;  4H9R A;  3MGQ A;  4DQY B;  2LY8 A;  3LJA A;  3FDD A;  3REK C;  5AVC A;  4AWL C;  4H9S A;  3X1T C;  4Z5T D;  1AOI A;  3A6N D;  3KWQ C;  5B1L D;  5CPK D;  3AZK A;  4KHA B;  4CSR A;  5B31 G;  1P3P A;  2YFV B;  3NQU B;  5CPI B;  5BT1 D;  1P3I C;  2J8P A;  2PYO B;  5GXQ A;  4KGC B;  4ZUX C;  4Z66 B;  2JSS A;  3WTP C;  3MGQ D;  3X1S D;  3LJA D;  3C1B C;  3W97 C;  5GSU C;  5AVC D;  3WKJ A;  4G92 C;  3C1C B;  4CAY B;  4H9Q B;  5BO0 B;  3VH6 T;  3AZK D;  1U35 B;  4KUD B;  5KDM A;  3LZ0 D;  1P3P D;  5B40 C;  5CP6 B;  3W96 D;  2CWE A;  5GXQ D;  5B2I C;  5BS7 A;  3REH C;  1Q9C A;  3X1U B;  2Y2G A;  5CHL B;  3WKJ D;  1ID3 D;  4WZS B;  3A6N B;  5CPK B;  1P3K A;  4YM6 D;  1M1A A;  3VH5 W;  4WU8 C;  5FUG B;  3B6F C;  5E5A B;  1P34 B;  5B33 A;  3TU4 A;  3W99 B;  3X1S B;  2BYM B;  5BNV A;  5B0Y C;  4J8V A;  3B0D B;  5B0Z D;  3B0C T;  5CPI C;  1P3K D;  1W2E A;  3AZK B;  2UWX A;  3KSY A;  5JA4 B;  1M1A D;  3UTA C;  1S32 C;  4R8P A;  3MGS C;  3LZ0 B;  5AV9 C;  5GT3 C;  4QLC B;  4UPK A;  1P3P B;  1F1E A;  3W96 B;  5GXQ B;  5B33 D;  5AV5 A;  3TU4 D;  3REJ A;  2JCH A;  3UTB B;  3WKJ B;  4KUD C;  1P3O A;  1EQZ A;  5DNN A;  5F99 D;  3A1I A;  3VH5 A;  4YM6 B;  4J8X A;  3MGP D;  1P3B A;  3KFU G;  3AZL D;  2F8N H;  2Y2M A;  5JRG B;  3X1U C;  3B6G D;  3B0D C;  4X23 C;  3H0M C;  2G5I C;  3REL A;  3TU4 B;  5AV5 D;  2NZD B;  5B31 A;  3REJ D;  4H9P B;  3MNN A;  5B0Z B;  1P3O D;  1EQZ D;  5DNN D;  4XUJ C;  5E5A C;  1P3K B;  1P34 C;  4J8X D;  1ID3 C;  5B1M C;  3W99 C;  1P3B D;  1BH8 A;  1HTA A;  5AVB A;  3W97 A;  3AYW C;  3WA9 C;  5GSU A;  3REL D;  4XZQ A;  5B31 D;  2F8N G;  2HUE C;  2VQR A;  3MGR C;  4QLC C;  3MNN D;  5F99 B;  3X1V B;  2HIO B;  1H3O A;  3MGP B;  1F66 D;  3AZL B;  2F2A C;  2Y2I A;  3B6G B;  5B40 A;  3UTB C;  3AZI C;  5AVB D;  3REH A;  5B24 B;  3AZE B;  5AV6 C;  1BH9 B;  1JFI A;  3REJ B;  1ZLA D;  4XZQ D;  3LEL D;  1KX4 C;  5JRG C;  1EQZ B;  3UT9 A;  3VH6 W;  4J8X B;  1PZR A;  3NQJ A;  4JJN A;  3B6F A;  5C3I C;  2NZD C;  4YS3 A;  5B32 C;  2CV5 C;  2DQN C;  5B32 G;  3MNN B;  5GT0 A;  5CPJ A;  1KX3 A;  3UTA A;  1M19 A;  1F66 B;  3MGS A;  3UT9 D;  4WU9 A;  3AN2 C;  3REI A;  1P3A C;  4LD9 B;  4JJN D;  3AV1 A;  4YS3 D;  5AVB B;  3WAA C;  5AY8 A;  1TAF B;  3X1V C;  2HIO C;  1ZLA B;  3LEL B;  3AZG A;  1B67 A;  5AV8 A;  4J8W C;  5GT0 D;  4EO5 B;  5CPJ D;  3AZM A;  1KX3 D;  3UTA D;  1M19 D;  5B24 C;  4WU9 D;  4Z2M G;  3REI D;  3AZE C;  3AV2 B;  2RVQ D;  3W98 A;  1P3G A;  1TZY C;  3KUY B;  3AV1 D;  2ARO C;  5AY8 D;  2IO5 C;  1JFI B;  3AZG D;  5AV8 D;  1AOI D;  3AZH B;  4WNN A;  3AZM D;  3AZF A;  3F6T A;  3AFA B;  3NQJ B;  2F8N A;  3W98 D;  4YS3 B;  3LZ1 A;  4H9O A;  3MVD A;  1P3G D;  1KX5 C;  3EPL A;  5DNM C;  1BFM A;  3AZN A;  5G49 B;  4Z5T B;  4J8U C;  2FJ7 C;  4LD9 C;  3O62 A;  2ZY5 A;  5B1L B;  5GT0 B;  2ZY4 A;  1KX3 B;  1M19 B;  2NQB A;  3WTP E;  3AZF D;  2F8N D;  3AZI A;  3KXB A;  3AV1 B;  1M18 A;  3LZ1 D;  3MVD D;  4H9R B;  5AY8 B;  3MGQ B;  3AZN D;  3LJA B;  4WJ3 C;  2Y2P A;  5AVC B;  3AZG B;  2FFF B;  3AV2 C;  5AV8 B;  1AOI B;  3O62 D;  3KUY C;  2PYO C;  4ZBJ B;  4CSR B;  3AZM B;  4KGC C;  4M6B A;  4Z66 C;  2NQB D;  4G91 B;  1N1J A;  3W98 B;  3AZI D;  3KXB D;  1WWI A;  1P3F A;  1T3U A;  1M18 D;  3C1C C;  3AZJ A;  3AZH C;  1P3L A;  5B2J A;  3AFA C;  4NFT A;  1U35 C;  1HQ3 A;  2Y2N A;  3IP4 C;  4J8V D;  5CP6 C;  1P3M A;  3AZF B;  4R8P D;  5KDM B;  3EPH A;  4Z5T C;  1R4V A;  2Y2L A;  4H9O B;  3LZ1 B;  1P3F D;  3REK A;  3A6N C;  5CPK C;  5B1L C;  3AZN B;  3X1T A;  3AZJ D;  2ZY2 A;  1P3L D;  5B2J D;  3KWQ A;  1HQ3 D;  2Y2J A;  3O62 B;  5BT1 C;  1M1A B;  3MGQ C;  1P3M D;  2NQB B;  3X1S C;  3LJA C;  1TZY A;  2RIQ A;  5AVC C;  1P3I A;  4H9S C;  2JE5 A;  3KXB B;  1M18 B;  4ZUX A;  3WTP A;  3C1B A;  4UUZ A;  5B33 B;  3REK D; 
#chains in the Genus database with same CATH homology
 3AZK C;  4ZBJ C;  3X1T D;  4G91 C;  3LZ0 C;  5BNV B;  3KWQ D;  4J8V B;  1P3P C;  2Y2H A;  3W96 C;  5GXQ C;  3R45 A;  4R8P B;  4E45 A;  1N1J B;  3V9R A;  5DNM A;  1P3I D;  3WKJ C;  2G5H C;  5B2I A;  1P3F B;  2Y2Q A;  2Y2O A;  4ZUX D;  3WTP D;  3C1B D;  3W97 D;  4YM6 C;  5AV5 B;  3AZJ B;  5GSU D;  2FJ7 A;  1P3L B;  1P3O B;  5DNN B;  4HGA B;  4WU8 A;  1Z2C B;  1P3B B;  5BS7 C;  3VH6 A;  5B40 D;  2W8S A;  3B0C W;  1KU5 A;  5B0Z C;  5B2I D;  3REK B;  3REH D;  1P3K C;  4AWL B;  3REL B;  3X1T B;  4Z2M H;  1M1A C;  5B0Y A;  5B31 B;  2YFV A;  3NQU A;  5CPI A;  3KWQ B;  2PYO A;  3EG5 B;  2YFW A;  5BNX A;  3A1K A;  1S32 A;  2F8N K;  4WU8 D;  3TU4 C;  3VH5 T;  5GT3 A;  5AV9 A;  3B6F D;  1BH8 B;  4CAY A;  5BO0 A;  3W97 B;  3WTP B;  5F99 C;  3C1B B;  3MGP C;  5GSU B;  4KUD A;  4G92 B;  1WWS A;  4XZQ B;  5B0Y D;  3AZL C;  4DRB A;  2BYK A;  3B6G C;  5CPI D;  5CP6 A;  1A7W A;  1H3O B;  1S32 D;  3X1U A;  3H0L C;  3MGS D;  5AV5 C;  5AV9 D;  5GT3 D;  4X23 A;  3REJ C;  5B40 B;  3V9R B;  1P3O C;  5B2I B;  1EQZ C;  5DNN C;  3REH B;  4E44 A;  4HGA C;  4J8X C;  1P3B C;  4KUD D;  4XUJ A;  5E5A A;  1P34 A;  1ID3 A;  5B1M A;  3W99 A;  3X1S A;  3EPJ A;  2BYM A;  2XD1 A;  4WU8 B;  3UT9 B;  3X1U D;  4JJN B;  3REL C;  3B6F B;  5B31 C;  4X23 D;  3AYW A;  3WA9 A;  3MNN C;  5JA4 A;  1F66 C;  3LZ0 A;  3MGR A;  4QLC A;  5B0Y B;  3W96 A;  4XUJ D;  5E5A D;  1P34 D;  3H0R C;  5CPJ B;  5BNX B;  2YFW B;  5B1M D;  3W99 D;  5AVB C;  3UTA B;  3MGS B;  4WU9 B;  1S32 B;  2DF4 C;  3REI B;  5AV9 B;  5GT3 B;  3UTB A;  4H9N A;  1ZLA C;  4XZQ C;  3LEL C;  4YM6 A;  5AV6 A;  3AYW D;  3WA9 D;  4NE6 A;  4EO5 C;  2BG1 A;  1KX4 A;  5JRG A;  3MGR D;  4QLC D;  2BYK B;  2NZD A;  5B32 A;  4H9P A;  3UTB D;  2CV5 A;  1B6W A;  4X23 B;  5B0Z A;  1P3G B;  5AV6 D;  3UT9 C;  1KX4 D;  5JRG D;  4JJN C;  4XUJ B;  4YS3 C;  1P3A A;  3AN2 A;  5B1M B;  1ID3 B;  3B0B A;  4WNN B;  2NZD D;  2F8N B;  5B32 D;  2CV5 D;  2ZY3 A;  3WAA A;  5F99 A;  3MVD B;  3X1V A;  3AL0 C;  2HIO A;  3MGP A;  4NE3 A;  3AYW B;  3WA9 B;  5GT0 C;  1ULY A;  5CPJ C;  3AZL A;  1KX3 C;  1M19 C;  3B6G A;  4WU9 C;  2HUE B;  3MGR B;  3REI C;  4J8W A;  2RVQ C;  2Y2K A;  3AV1 C;  5B24 A;  1P3A D;  3AZE A;  3AN2 D;  1BH9 A;  5AY8 C;  2ARO A;  4H9N B;  2ZM5 A;  3AZI B;  3AZG C;  3WAA D;  2XD5 A;  5AV8 C;  2HIO D;  5AV6 B;  3X1V D;  1AOI C;  3AZM C;  1KX4 B;  4J8W D;  3W98 C;  1P3G C;  5B24 D;  3AZE D;  5C3I B;  5B32 B;  1KX5 A;  1TZY D;  2CV5 B;  2ARO D;  1F66 A;  2L5A A;  4J8U A;  4LD9 A;  5B2J B;  3AZF C;  1HQ3 B;  3EPK A;  3LZ1 C;  1P3A B;  1TAF A;  3MVD C;  3AN2 B;  1P3M B;  1ZLA A;  3AZN C;  4WV4 B;  3LEL A;  4DRA A;  1KX5 D;  3WAA B;  5DNM D;  4KHA A;  3O62 C;  3AV2 A;  4J8U D;  2FJ7 D;  4LD9 D;  2NQB C;  3KUY A;  4J8W B;  4NE5 A;  3P5J B;  3KXB C;  1M18 C;  4KGC A;  4Z66 A;  5B33 C;  1TZY B;  2ARO B;  1P3I B;  3C1C A;  4H9Q A;  4ZUX B;  4J8V C;  3AZH A;  4UUZ B;  2IO5 B;  3AFA A;  1U35 A;  3AV2 D;  4R8P C;  3KUY D;  2PYO D;  1P3F C;  4KGC D;  4Z66 D;  5G49 A;  3AZJ C;  4Z5T A;  3R45 B;  1P3L C;  1KX5 B;  5B2J C;  3A6N A;  5DNM B;  5B1L A;  1HQ3 C;  3C1C D;  5CPK A;  3AZH D;  3AFA D;  4J8U B;  5FUG A;  1U35 D;  1P3M C;  2FJ7 B;  5CP6 D;  4H9R A;  3MGQ A;  4DQY B;  2LY8 A;  3LJA A;  3FDD A;  3REK C;  5AVC A;  4AWL C;  4H9S A;  3X1T C;  4Z5T D;  1AOI A;  3A6N D;  3KWQ C;  5B1L D;  5CPK D;  3AZK A;  4KHA B;  4CSR A;  5B31 G;  1P3P A;  2YFV B;  3NQU B;  5CPI B;  5BT1 D;  1P3I C;  2J8P A;  2PYO B;  5GXQ A;  4KGC B;  4ZUX C;  4Z66 B;  2JSS A;  3WTP C;  3MGQ D;  3X1S D;  3LJA D;  3C1B C;  3W97 C;  5GSU C;  5AVC D;  3WKJ A;  4G92 C;  3C1C B;  4CAY B;  4H9Q B;  5BO0 B;  3VH6 T;  3AZK D;  1U35 B;  4KUD B;  5KDM A;  3LZ0 D;  1P3P D;  5B40 C;  5CP6 B;  3W96 D;  2CWE A;  5GXQ D;  5B2I C;  5BS7 A;  3REH C;  1Q9C A;  3X1U B;  2Y2G A;  5CHL B;  3WKJ D;  1ID3 D;  4WZS B;  3A6N B;  5CPK B;  1P3K A;  4YM6 D;  1M1A A;  3VH5 W;  4WU8 C;  5FUG B;  3B6F C;  5E5A B;  1P34 B;  5B33 A;  3TU4 A;  3W99 B;  3X1S B;  2BYM B;  5BNV A;  5B0Y C;  4J8V A;  3B0D B;  5B0Z D;  3B0C T;  5CPI C;  1P3K D;  1W2E A;  3AZK B;  2UWX A;  3KSY A;  5JA4 B;  1M1A D;  3UTA C;  1S32 C;  4R8P A;  3MGS C;  3LZ0 B;  5AV9 C;  5GT3 C;  4QLC B;  4UPK A;  1P3P B;  1F1E A;  3W96 B;  5GXQ B;  5B33 D;  5AV5 A;  3TU4 D;  3REJ A;  2JCH A;  3UTB B;  3WKJ B;  4KUD C;  1P3O A;  1EQZ A;  5DNN A;  5F99 D;  3A1I A;  3VH5 A;  4YM6 B;  4J8X A;  3MGP D;  1P3B A;  3KFU G;  3AZL D;  2F8N H;  2Y2M A;  5JRG B;  3X1U C;  3B6G D;  3B0D C;  4X23 C;  3H0M C;  2G5I C;  3REL A;  3TU4 B;  5AV5 D;  2NZD B;  5B31 A;  3REJ D;  4H9P B;  3MNN A;  5B0Z B;  1P3O D;  1EQZ D;  5DNN D;  4XUJ C;  5E5A C;  1P3K B;  1P34 C;  4J8X D;  1ID3 C;  5B1M C;  3W99 C;  1P3B D;  1BH8 A;  1HTA A;  5AVB A;  3W97 A;  3AYW C;  3WA9 C;  5GSU A;  3REL D;  4XZQ A;  5B31 D;  2F8N G;  2HUE C;  2VQR A;  3MGR C;  4QLC C;  3MNN D;  5F99 B;  3X1V B;  2HIO B;  1H3O A;  3MGP B;  1F66 D;  3AZL B;  2F2A C;  2Y2I A;  3B6G B;  5B40 A;  3UTB C;  3AZI C;  5AVB D;  3REH A;  5B24 B;  3AZE B;  5AV6 C;  1BH9 B;  1JFI A;  3REJ B;  1ZLA D;  4XZQ D;  3LEL D;  1KX4 C;  5JRG C;  1EQZ B;  3UT9 A;  3VH6 W;  4J8X B;  1PZR A;  3NQJ A;  4JJN A;  3B6F A;  5C3I C;  2NZD C;  4YS3 A;  5B32 C;  2CV5 C;  2DQN C;  5B32 G;  3MNN B;  5GT0 A;  5CPJ A;  1KX3 A;  3UTA A;  1M19 A;  1F66 B;  3MGS A;  3UT9 D;  4WU9 A;  3AN2 C;  3REI A;  1P3A C;  4LD9 B;  4JJN D;  3AV1 A;  4YS3 D;  5AVB B;  3WAA C;  5AY8 A;  1TAF B;  3X1V C;  2HIO C;  1ZLA B;  3LEL B;  3AZG A;  1B67 A;  5AV8 A;  4J8W C;  5GT0 D;  4EO5 B;  5CPJ D;  3AZM A;  1KX3 D;  3UTA D;  1M19 D;  5B24 C;  4WU9 D;  4Z2M G;  3REI D;  3AZE C;  3AV2 B;  2RVQ D;  3W98 A;  1P3G A;  1TZY C;  3KUY B;  3AV1 D;  2ARO C;  5AY8 D;  2IO5 C;  1JFI B;  3AZG D;  5AV8 D;  1AOI D;  3AZH B;  4WNN A;  3AZM D;  3AZF A;  3F6T A;  3AFA B;  3NQJ B;  2F8N A;  3W98 D;  4YS3 B;  3LZ1 A;  4H9O A;  3MVD A;  1P3G D;  1KX5 C;  3EPL A;  5DNM C;  1BFM A;  3AZN A;  5G49 B;  4Z5T B;  4J8U C;  2FJ7 C;  4LD9 C;  3O62 A;  2ZY5 A;  5B1L B;  5GT0 B;  2ZY4 A;  1KX3 B;  1M19 B;  2NQB A;  3WTP E;  3AZF D;  2F8N D;  3AZI A;  3KXB A;  3AV1 B;  1M18 A;  3LZ1 D;  3MVD D;  4H9R B;  5AY8 B;  3MGQ B;  3AZN D;  3LJA B;  4WJ3 C;  2Y2P A;  5AVC B;  3AZG B;  2FFF B;  3AV2 C;  5AV8 B;  1AOI B;  3O62 D;  3KUY C;  2PYO C;  4ZBJ B;  4CSR B;  3AZM B;  4KGC C;  4M6B A;  4Z66 C;  2NQB D;  4G91 B;  1N1J A;  3W98 B;  3AZI D;  3KXB D;  1WWI A;  1P3F A;  1T3U A;  1M18 D;  3C1C C;  3AZJ A;  3AZH C;  1P3L A;  5B2J A;  3AFA C;  4NFT A;  1U35 C;  1HQ3 A;  2Y2N A;  3IP4 C;  4J8V D;  5CP6 C;  1P3M A;  3AZF B;  4R8P D;  5KDM B;  3EPH A;  4Z5T C;  1R4V A;  2Y2L A;  4H9O B;  3LZ1 B;  1P3F D;  3REK A;  3A6N C;  5CPK C;  5B1L C;  3AZN B;  3X1T A;  3AZJ D;  2ZY2 A;  1P3L D;  5B2J D;  3KWQ A;  1HQ3 D;  2Y2J A;  3O62 B;  5BT1 C;  1M1A B;  3MGQ C;  1P3M D;  2NQB B;  3X1S C;  3LJA C;  1TZY A;  2RIQ A;  5AVC C;  1P3I A;  4H9S C;  2JE5 A;  3KXB B;  1M18 B;  4ZUX A;  3WTP A;  3C1B A;  4UUZ A;  5B33 B;  3REK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...