4H9SC

Complex structure 6 of daxx/h3.3(sub7)/h4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 25
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9sC00
5B0YB 3WA9B 5B0ZD 1KX4D 3WTPD 1S32B 4WU9B 1S32A 2NZDD 3LELC 1KX4C 1KX5A 3KWQB 2FJ7C 2AROA 3MNNB 5B2ID 5B31D 1P3KB 1TZYD 2AROC 4ZUXD 1P3OC 1P3LB 4KUDC 5CPKC 1P3PC 1WWIA 1KX4B 4XUJC 2HUEC 2CV5B 2NQBC 3KXBD 4WU8B 5FUGA 1M19D 5B1MD 1H3OB 5AV5B 5GXQB 3AZJC 3AFAD 2BYMA 1P34C 1M18C 4EO5C 3UTAA 2F8NA 5DNNB 1HQ3D 3AZHA 4WV4B 2PYOD 4YS3C 4DRAA 5B1LC 3MGSC 3LZ0C 1ZLAA 3REHA 3RELD 3W97D 4WU9A 3AZGB 5AV6A 1N1JB 5B0ZB 2CV5A 1BH9B 4Z5TB 3UT9D 4KGCB 4J8XB 5AVCB 4YM6C 5AVBB 2NZDB 3NQUB 3MGPB 1ZLAB 3NQUA 4JJND 5CPIA 1KX3C 1TZYB 4ZUXB 4H9OB 3C1BD 2PYOB 5B2IB 4Z66C 4CSRB 2HIOC 3MNNA 4Z66D 3C1BC 2HIOA 1M18A 3MVDD 4YM6D 4YS3A 1TAFB 3X1VB 3VH6T 3LZ1A 3W96A 1BH8B 3TU4C 5GXQC 3AZJB 3X1UA 3X1TA 1BH9A 4NFTA 4KGCC 4KGCA 3AV2B 3VH6A 1P3AB 3AZEC 1KX5B 2L5AA 4J8UB 4R8PA 1JFIB 5B2JC 4LD9B 3R45B 3AFAB 3MGSD 5B1LD 4HGAB 4YS3B 4QLCD 5B32B 3REIB 3MVDB 3B6FC 5DNND 3AZMB 3WKJA 5AV9A 1P34D 5KDMA 4KUDB 3AZGD 3AZJD 5B1MC 1KX3B 1TAFA 4E45A 3X1VA 1M19C 3VH5A 3C1CB 3AZHC 4J8VC 5BNXA 4LD9D 5AVCD 3KXBC 5E5AA 3AV2A 1P3AA 3TU4A 5F99D 4J8XC 4XUJD 3AZID 1B67A 4X23A 5DNMA 1F66D 1R4VA 1P3BD 1P3OD 1TZYC 4ZUXC 5B2IC 5B2JA 3AZFA 2FJ7D 3TU4B 3WKJB 5B40D 3LELD 3MGRA 5BO0B 3B6FA 3WTPA 3WTPC 5B0ZC 1H3OA 1P3IA 3O62D 3AZNB 1KX5D 5B31G 3AZGC 4ZBJC 5B31B 1P3KD 1AOIA 3UTAB 5B31A 5DNNC 3X1UC 5G49B 5B32D 3REID 1P3PB 4QLCC 3W98D 3LJAD 3REJA 3A6ND 5GSUA 1P3MD 3B0DB 3WAAD 3AZED 3MGQD 4G91C 1F1EA 1EQZD 5B24C 5GXQD 4G92B 5AV8A 4XZQC 1P3PA 3MGPA 4AWLB 1ID3D 1P3LA 3MGRC 4XUJB 1ULYA 5B0YC 3AN2A 1P3LC 1P3GA 3AN2B 2AROB 3W97B 5BS7C 5GT0C 5JRGD 4H9PB 1M1AA 4JJNC 2CWEA 3KWQC 1A7WA 3X1SC 2YFWA 3WA9A 4CAYB 1KU5A 4Z5TD 3LELB 3B0BA 2F8NK 5B2IA 3AZFC 3W99D 3X1SD 5CPJA 5B24B 3O62B 3AZND 3LZ0A 3C1BB 5JRGC 4JJNB 4H9PA 3LZ0B 5AV5D 5AV8C 5AVBA 5CPKA 4X23C 4NE3A 3AZLA 5B33C 1HQ3C 5B0YD 3AZMA 1P3IC 1AOIB 5B33A 3AV1D 3A6NB 3X1UB 2BYKB 3LJAB 5GT3A 3KUYA 5BT1D 4H9QB 1B6WA 4UUZA 4XZQD 1M18D 1KX3A 4YM6A 5AV8B 1EQZB 4J8UD 3MGQB 1P3FD 2F8NH 5E5AB 3X1TB 2NQBD 3A6NC 3LJAC 5AY8C 5C3IC 3MGSA 5CPKB 4H9SA 5AY8B 3R45A 5C3IB 3REHC 5G49A 2NZDA 5CHLB 1M18B 1P34B 4KUDD 1P3KC 2AROD 5E5AC 1BFMA 3O62C 5AV9D 4CSRA 3UTBA 4DRBA 4WU8C 3AZKC 1U35C 5CP6A 1N1JA 4H9RA 3AYWC 3WTPB 3X1VD 1M1AB 4WU8A 4H9RB 3AYWD 3X1SB 5B40C 3AZIB 3AZKD 1U35D 5F99B 3W99B 5AV9C 3VH6W 5F99A 5B0ZA 1P3OB 3REKB 5BNVA 1F66C 1P3BB 5AY8A 1F66A 5B1MA 3REHD 3RELA 3MGRB 2IO5B 3AFAA 3AZIC 5B40B 4H9NA 4KHAA 4J8XD 3X1TC 2CV5D 4WNNB 2RVQC 3W96C 4LD9C 1TZYA 4ZUXA 4J8VD 4R8PD 3AZKB 1HQ3A 1U35B 4G92C 3AZHD 3WA9C 4J8UC 5GSUC 3B6GB 5B1MB 1S32D 3REKD 5BT1C 4J8WC 5CP6C 4Z66A 3VH5T 3WKJC 5CPIC 1BH8A 2F8NG 3RELB 4NE5A 3LZ1D 3LJAA 5KDMB 5BO0A 3AZNC 5AVCA 3UT9B 4KGCD 3AV2C 1P3AC 3TU4D 3KWQA 4H9OA 2PYOA 3B6GA 5GT0A 4QLCB 1ZLAD 5GT3B 3KUYB 3C1CC 4QLCA 5GT0B 5AV6D 3UTAC 5CPJC 4ZBJB 4Z2MG 4KHAB 3UTAD 5AV6C 4J8WA 3MGRD 3C1CD 1ZLAC 3AZLC 1ID3C 5JRGA 3W98B 1Q9CA 5AVBC 5CP6B 4YM6B 5FUGB 3AZHB 3NQJB 5B24D 3AV2D 4J8VB 1P3AD 3MNND 2YFVA 3KXBA 4CAYA 3AZEB 3AZIA 2YFVB 3W97C 3AZGA 3AZJA 3MVDA 3AZNA 3LZ0D 4YS3D 3W98C 3W98A 2HUEB 4JJNA 5CPID 5B32C 3REIC 3AV1B 3B6FB 3X1UD 1HTAA 3WAAA 2FJ7A 3KXBB 2F8ND 3AZMD 3MGQA 3REKC 3AFAC 4WZSB 1KX4A 5GXQA 1KX5C 5DNMD 4G91B 5B1LA 4XZQA 4NE6A 4H9QA 4UUZB 3MGPC 4WU9D 4R8PC 3O62A 3W96D 4J8UA 3UTBC 2RVQD 1P3KA 3X1TD 2CV5C 2NQBB 2NQBA 3AZLB 4HGAC 5AV6B 1P3BC 3A6NA 3MGSB 2HIOB 5BS7A 5DNMB 3NQJA 5F99C 2NZDC 3UTBD 5AVCC 3X1VC 1M19A 4H9SC 4M6BA 1WWSA 1ID3B 4WU9C 1M19B 3MGPD 1P3OA 4WU8D 5DNMC 4LD9A 3V9RB 3AN2D 5E5AD 3AZMC 4Z66B 1P3GD 3AZEA 4XUJA 5CPIB 3B6FD 2LY8A 5AY8D 3W97A 3UTBB 1P3BA 1F66B 4EO5B 4Z5TA 5B2JD 4R8PB 1JFIA 3B0CW 2F8NB 1P3FA 4E44A 3UT9A 1P3FC 3WAAB 1P34A 4WNNA 3MNNC 5GSUB 3LELA 3W96B 3AZFB 5JA4B 5B1LB 5AVBD 1M1AD 3REJD 3C1BA 3AZLD 3AV1C 3MVDC 1P3ID 1AOIC 5B33D 3AV1A 1EQZA 4X23D 2HIOD 5B2JB 5CPJD 5AV8D 5AV5C 3VH5W 5BNXB 3B6GC 1KX3D 5GT3C 3KUYC 3REHB 3W99C 3WTPE 3AZFD 4AWLC 1P3MA 4Z5TC 1P3MB 5B40A 3UT9C 2YFWB 3KWQD 5GT3D 3KUYD 2BYMB 3B6GD 4Z2MH 5GT0D 3KSYA 3RELC 3LZ1C 5CPJB 2PYOC 1P3LD 1P3GB 2BYKA 5DNNA 4J8XA 5AV9B 1AOID 5B32G 2FJ7B 3WKJD 3X1SA 4J8VA 5CP6D 3REJC 1M1AC 4H9NB 5B32A 3C1CA 4J8WD 3REIA 3AYWB 1S32C 5AV5A 4XZQB 3LZ1B 5JA4A 3AYWA 2JSSA 5JRGB 1EQZC 5GSUD 3MGQC 3REKA 3AZKA 1U35A 3WA9D 4KUDA 5B24A 3WAAC 1P3FB 1P3MC 3B0DC 3V9RA 3W99A 1P3IB 3REJB 2IO5C 3B0CT 1P3PD 5CPKD 1ID3A 5BNVB 1HQ3B 4J8WB 1P3GC 5B33B 4X23B 3AN2C 5B0YA 5B31C
chains in the Genus database with same CATH superfamily
5B0YB 2Y2IA 3WA9B 5B0ZD 1KX4D 1W2EA 3WTPD 1S32B 4WU9B 1S32A 2NZDD 3LELC 1KX4C 1KX5A 3KWQB 2FJ7C 2AROA 3MNNB 5B2ID 5B31D 1P3KB 1TZYD 2AROC 4ZUXD 1P3OC 1P3LB 4KUDC 5CPKC 1P3PC 1WWIA 1KX4B 4XUJC 2HUEC 2CV5B 2NQBC 3KXBD 4WU8B 5FUGA 1M19D 5B1MD 1H3OB 5AV5B 5GXQB 3AZJC 3AFAD 2BYMA 1P34C 1M18C 4EO5C 3UTAA 2F8NA 5DNNB 1HQ3D 3AZHA 4WV4B 2PYOD 4YS3C 4DRAA 5B1LC 3MGSC 3EG5B 3LZ0C 1ZLAA 3REHA 3RELD 3W97D 4WU9A 3AZGB 5AV6A 1N1JB 5B0ZB 2CV5A 1BH9B 4Z5TB 3UT9D 4KGCB 4J8XB 2Y2QA 2JE5A 5AVCB 4YM6C 5AVBB 2NZDB 3NQUB 3MGPB 1ZLAB 3NQUA 4JJND 5CPIA 3A1IA 1KX3C 1TZYB 4ZUXB 4H9OB 3C1BD 2PYOB 5B2IB 4Z66C 4CSRB 2HIOC 3MNNA 4Z66D 3C1BC 2Y2OA 2HIOA 1M18A 3MVDD 4YM6D 4YS3A 1TAFB 3X1VB 3VH6T 3LZ1A 3W96A 1BH8B 3TU4C 5GXQC 3AZJB 3X1UA 3X1TA 1BH9A 4NFTA 4KGCC 4KGCA 3AV2B 3VH6A 1P3AB 3AZEC 1KX5B 2L5AA 4J8UB 4R8PA 1JFIB 5B2JC 4LD9B 3R45B 3AFAB 3MGSD 5B1LD 4HGAB 2VQRA 4YS3B 4QLCD 5B32B 3REIB 3MVDB 3B6FC 5DNND 3AZMB 3WKJA 5AV9A 1P34D 5KDMA 4KUDB 3AZGD 3AZJD 5B1MC 2JCHA 1KX3B 1TAFA 4E45A 3X1VA 1M19C 3VH5A 3C1CB 3AZHC 4J8VC 5BNXA 4LD9D 2G5HC 5AVCD 3KXBC 5E5AA 3AV2A 1P3AA 3TU4A 5F99D 4J8XC 4XUJD 3EPLA 3AZID 1B67A 4X23A 5DNMA 1F66D 1R4VA 1P3BD 1P3OD 1TZYC 4ZUXC 5B2IC 5B2JA 3AZFA 2Y2NA 2FJ7D 3TU4B 3WKJB 5B40D 3LELD 2BG1A 3MGRA 5BO0B 3B6FA 3WTPA 3WTPC 5B0ZC 1H3OA 1P3IA 3O62D 3AZNB 1KX5D 5B31G 3AZGC 4ZBJC 5B31B 1P3KD 1AOIA 3UTAB 5B31A 5DNNC 3X1UC 5G49B 5B32D 3REID 1P3PB 4QLCC 2DQNC 2Y2MA 3W98D 3LJAD 3REJA 3A6ND 5GSUA 1P3MD 3B0DB 3WAAD 3KFUG 3AZED 3MGQD 4G91C 1F1EA 2DF4C 1EQZD 2XD5A 5B24C 5GXQD 4G92B 2Y2KA 5AV8A 4XZQC 1P3PA 3MGPA 4AWLB 1ID3D 2RIQA 1P3LA 3MGRC 4XUJB 1ULYA 5B0YC 3AN2A 1P3LC 2ZM5A 1P3GA 3AN2B 2AROB 3W97B 5BS7C 5GT0C 5JRGD 4H9PB 1M1AA 4JJNC 4WJ3C 2ZY4A 2CWEA 3KWQC 1A7WA 3X1SC 2YFWA 3WA9A 4CAYB 1KU5A 4Z5TD 3LELB 3B0BA 2F8NK 5B2IA 3AZFC 3W99D 3X1SD 5CPJA 5B24B 3O62B 3AZND 3LZ0A 3C1BB 5JRGC 4JJNB 4H9PA 3LZ0B 5AV5D 5AV8C 5AVBA 5CPKA 4X23C 4NE3A 3AZLA 5B33C 1HQ3C 5B0YD 3AZMA 1P3IC 1AOIB 5B33A 3AV1D 3A6NB 3X1UB 2BYKB 3LJAB 5GT3A 3KUYA 5BT1D 4H9QB 4XZQD 1B6WA 4UUZA 1M18D 1KX3A 4YM6A 5AV8B 1EQZB 4J8UD 3MGQB 1P3FD 2F8NH 5E5AB 3X1TB 2NQBD 3A6NC 3LJAC 5AY8C 5C3IC 3MGSA 5CPKB 4H9SA 5AY8B 5C3IB 3R45A 3REHC 5G49A 2NZDA 5CHLB 1M18B 1P34B 4KUDD 1P3KC 2AROD 5E5AC 1BFMA 3O62C 5AV9D 4CSRA 3UTBA 4DRBA 4WU8C 3AZKC 1U35C 5CP6A 1N1JA 4H9RA 3AYWC 3WTPB 3A1KA 3H0LC 3X1VD 1M1AB 4WU8A 4H9RB 3AYWD 3X1SB 5B40C 3AZIB 3AZKD 1U35D 5F99B 3W99B 5AV9C 3VH6W 5F99A 5B0ZA 1P3OB 3REKB 5BNVA 1F66C 1P3BB 5AY8A 1F66A 5B1MA 3REHD 3RELA 3MGRB 2IO5B 3AFAA 3AZIC 5B40B 4H9NA 4KHAA 4J8XD 3X1TC 2CV5D 4WNNB 2RVQC 3W96C 4LD9C 1TZYA 4ZUXA 4J8VD 4R8PD 3AZKB 1HQ3A 1U35B 4G92C 3AZHD 3WA9C 4J8UC 5GSUC 3B6GB 5B1MB 1S32D 2ZY3A 3REKD 5BT1C 4J8WC 2J8PA 5CP6C 4Z66A 3VH5T 3WKJC 5CPIC 1BH8A 2F8NG 3RELB 4NE5A 3LZ1D 3LJAA 5KDMB 5BO0A 3AZNC 5AVCA 3UT9B 4KGCD 4DQYB 3AV2C 1P3AC 3TU4D 3H0MC 3AL0C 3KWQA 4H9OA 2PYOA 3B6GA 5GT0A 4QLCB 1ZLAD 5GT3B 3KUYB 3C1CC 4QLCA 5GT0B 5AV6D 3UTAC 5CPJC 4ZBJB 4Z2MG 4KHAB 3UTAD 5AV6C 4J8WA 3MGRD 3C1CD 1ZLAC 3AZLC 1ID3C 5JRGA 3W98B 1Q9CA 1Z2CB 5AVBC 5CP6B 4YM6B 5FUGB 3AZHB 3NQJB 5B24D 3AV2D 4J8VB 1P3AD 3MNND 2YFVA 3KXBA 4CAYA 3AZEB 3AZIA 2YFVB 2FFFB 3W97C 3AZGA 3AZJA 3MVDA 3AZNA 3LZ0D 3P5JB 4YS3D 3W98C 3W98A 2HUEB 4JJNA 5CPID 5B32C 3REIC 3AV1B 3B6FB 3X1UD 1HTAA 3WAAA 2FJ7A 3KXBB 2F8ND 3AZMD 3MGQA 3REKC 3AFAC 2Y2PA 4WZSB 1KX4A 5GXQA 1KX5C 5DNMD 4G91B 5B1LA 4XZQA 4NE6A 4H9QA 4UUZB 3MGPC 4WU9D 4R8PC 2F2AC 3O62A 3W96D 4J8UA 3UTBC 2RVQD 1P3KA 3X1TD 4UPKA 2CV5C 2NQBB 2NQBA 3AZLB 4HGAC 5AV6B 1P3BC 3A6NA 3MGSB 2HIOB 5BS7A 5DNMB 3NQJA 5F99C 2NZDC 3UTBD 2Y2JA 5AVCC 3X1VC 1M19A 4H9SC 4M6BA 1WWSA 1ID3B 4WU9C 2Y2LA 1M19B 3MGPD 1P3OA 4WU8D 5DNMC 4LD9A 3V9RB 3AN2D 5E5AD 3AZMC 3EPHA 4Z66B 1P3GD 3AZEA 4XUJA 3FDDA 5CPIB 3B6FD 3H0RC 2XD1A 2LY8A 5AY8D 3W97A 3UTBB 1P3BA 1F66B 4EO5B 2ZY5A 4Z5TA 5B2JD 4R8PB 3B0CW 1JFIA 2F8NB 1P3FA 4E44A 3UT9A 1P3FC 3WAAB 1P34A 4WNNA 3MNNC 5GSUB 3LELA 3W96B 3AZFB 5JA4B 2W8SA 5B1LB 5AVBD 1M1AD 3REJD 3C1BA 3AZLD 3AV1C 3MVDC 1P3ID 1AOIC 2Y2GA 5B33D 3AV1A 2ZY2A 1EQZA 4X23D 2HIOD 5B2JB 1PZRA 5CPJD 5AV8D 5AV5C 3VH5W 5BNXB 3B6GC 3EPKA 1KX3D 5GT3C 3KUYC 3REHB 2Y2HA 3W99C 3WTPE 3AZFD 4AWLC 1P3MA 3IP4C 3EPJA 4Z5TC 1T3UA 5B40A 1P3MB 3UT9C 2YFWB 3KWQD 5GT3D 3KUYD 2BYMB 3B6GD 4Z2MH 5GT0D 3KSYA 3RELC 3LZ1C 2UWXA 5CPJB 2PYOC 1P3LD 1P3GB 2BYKA 5DNNA 4J8XA 5AV9B 1AOID 5B32G 2FJ7B 3WKJD 3X1SA 4J8VA 5CP6D 3REJC 1M1AC 4H9NB 5B32A 3C1CA 4J8WD 3REIA 3F6TA 3AYWB 1S32C 5AV5A 4XZQB 3LZ1B 5JA4A 3AYWA 2JSSA 5JRGB 1EQZC 5GSUD 3MGQC 3REKA 3AZKA 1U35A 3WA9D 4KUDA 5B24A 3WAAC 1P3FB 1P3MC 3B0DC 3V9RA 3W99A 1P3IB 3REJB 2IO5C 3B0CT 1P3PD 5CPKD 1ID3A 5BNVB 1HQ3B 4J8WB 2G5IC 1P3GC 5B33B 4X23B 3AN2C 5B0YA 5B31C
chains in the Genus database with same CATH topology
5B0YB 2Y2IA 3WA9B 5B0ZD 1KX4D 1W2EA 3WTPD 1S32B 4WU9B 1S32A 2NZDD 3LELC 1KX4C 1KX5A 3KWQB 2FJ7C 2AROA 3MNNB 5B2ID 5B31D 1P3KB 1TZYD 2AROC 4ZUXD 1P3OC 1P3LB 4KUDC 5CPKC 1P3PC 1WWIA 1KX4B 4XUJC 2HUEC 2CV5B 2NQBC 3KXBD 4WU8B 5FUGA 1M19D 5B1MD 1H3OB 5AV5B 5GXQB 3AZJC 3AFAD 2BYMA 1P34C 1M18C 4EO5C 3UTAA 2F8NA 5DNNB 1HQ3D 3AZHA 4WV4B 2PYOD 4YS3C 4DRAA 5B1LC 3MGSC 3EG5B 3LZ0C 1ZLAA 3REHA 3RELD 3W97D 4WU9A 3AZGB 5AV6A 1N1JB 5B0ZB 2CV5A 1BH9B 4Z5TB 3UT9D 4KGCB 4J8XB 2Y2QA 2JE5A 5AVCB 4YM6C 5AVBB 2NZDB 3NQUB 3MGPB 1ZLAB 3NQUA 4JJND 5CPIA 3A1IA 1KX3C 1TZYB 4ZUXB 4H9OB 3C1BD 2PYOB 5B2IB 4Z66C 4CSRB 2HIOC 3MNNA 4Z66D 3C1BC 2Y2OA 2HIOA 1M18A 3MVDD 4YM6D 4YS3A 1TAFB 3X1VB 3VH6T 3LZ1A 3W96A 1BH8B 3TU4C 5GXQC 3AZJB 3X1UA 3X1TA 1BH9A 4NFTA 4KGCC 4KGCA 3AV2B 3VH6A 1P3AB 3AZEC 1KX5B 2L5AA 4J8UB 4R8PA 1JFIB 5B2JC 4LD9B 3R45B 3AFAB 3MGSD 5B1LD 4HGAB 2VQRA 4YS3B 4QLCD 5B32B 3REIB 3MVDB 3B6FC 5DNND 3AZMB 3WKJA 5AV9A 1P34D 5KDMA 4KUDB 3AZGD 3AZJD 5B1MC 2JCHA 1KX3B 1TAFA 4E45A 3X1VA 1M19C 3VH5A 3C1CB 3AZHC 4J8VC 5BNXA 4LD9D 2G5HC 5AVCD 3KXBC 5E5AA 3AV2A 1P3AA 3TU4A 5F99D 4J8XC 4XUJD 3EPLA 3AZID 1B67A 4X23A 5DNMA 1F66D 1R4VA 1P3BD 1P3OD 1TZYC 4ZUXC 5B2IC 5B2JA 3AZFA 2Y2NA 2FJ7D 3TU4B 3WKJB 5B40D 3LELD 2BG1A 3MGRA 5BO0B 3B6FA 3WTPA 3WTPC 5B0ZC 1H3OA 1P3IA 3O62D 3AZNB 1KX5D 5B31G 3AZGC 4ZBJC 5B31B 1P3KD 1AOIA 3UTAB 5B31A 5DNNC 3X1UC 5G49B 5B32D 3REID 1P3PB 4QLCC 2DQNC 2Y2MA 3W98D 3LJAD 3REJA 3A6ND 5GSUA 1P3MD 3B0DB 3WAAD 3KFUG 3AZED 3MGQD 4G91C 1F1EA 2DF4C 1EQZD 2XD5A 5B24C 5GXQD 4G92B 2Y2KA 5AV8A 4XZQC 1P3PA 3MGPA 4AWLB 1ID3D 2RIQA 1P3LA 3MGRC 4XUJB 1ULYA 5B0YC 3AN2A 1P3LC 2ZM5A 1P3GA 3AN2B 2AROB 3W97B 5BS7C 5GT0C 5JRGD 4H9PB 1M1AA 4JJNC 4WJ3C 2ZY4A 2CWEA 3KWQC 1A7WA 3X1SC 2YFWA 3WA9A 4CAYB 1KU5A 4Z5TD 3LELB 3B0BA 2F8NK 5B2IA 3AZFC 3W99D 3X1SD 5CPJA 5B24B 3O62B 3AZND 3LZ0A 3C1BB 5JRGC 4JJNB 4H9PA 3LZ0B 5AV5D 5AV8C 5AVBA 5CPKA 4X23C 4NE3A 3AZLA 5B33C 1HQ3C 5B0YD 3AZMA 1P3IC 1AOIB 5B33A 3AV1D 3A6NB 3X1UB 2BYKB 3LJAB 5GT3A 3KUYA 5BT1D 4H9QB 4XZQD 1B6WA 4UUZA 1M18D 1KX3A 4YM6A 5AV8B 1EQZB 4J8UD 3MGQB 1P3FD 2F8NH 5E5AB 3X1TB 2NQBD 3A6NC 3LJAC 5AY8C 5C3IC 3MGSA 5CPKB 4H9SA 5AY8B 5C3IB 3R45A 3REHC 5G49A 2NZDA 5CHLB 1M18B 1P34B 4KUDD 1P3KC 2AROD 5E5AC 1BFMA 3O62C 5AV9D 4CSRA 3UTBA 4DRBA 4WU8C 3AZKC 1U35C 5CP6A 1N1JA 4H9RA 3AYWC 3WTPB 3A1KA 3H0LC 3X1VD 1M1AB 4WU8A 4H9RB 3AYWD 3X1SB 5B40C 3AZIB 3AZKD 1U35D 5F99B 3W99B 5AV9C 3VH6W 5F99A 5B0ZA 1P3OB 3REKB 5BNVA 1F66C 1P3BB 5AY8A 1F66A 5B1MA 3REHD 3RELA 3MGRB 2IO5B 3AFAA 3AZIC 5B40B 4H9NA 4KHAA 4J8XD 3X1TC 2CV5D 4WNNB 2RVQC 3W96C 4LD9C 1TZYA 4ZUXA 4J8VD 4R8PD 3AZKB 1HQ3A 1U35B 4G92C 3AZHD 3WA9C 4J8UC 5GSUC 3B6GB 5B1MB 1S32D 2ZY3A 3REKD 5BT1C 4J8WC 2J8PA 5CP6C 4Z66A 3VH5T 3WKJC 5CPIC 1BH8A 2F8NG 3RELB 4NE5A 3LZ1D 3LJAA 5KDMB 5BO0A 3AZNC 5AVCA 3UT9B 4KGCD 4DQYB 3AV2C 1P3AC 3TU4D 3H0MC 3AL0C 3KWQA 4H9OA 2PYOA 3B6GA 5GT0A 4QLCB 1ZLAD 5GT3B 3KUYB 3C1CC 4QLCA 5GT0B 5AV6D 3UTAC 5CPJC 4ZBJB 4Z2MG 4KHAB 3UTAD 5AV6C 4J8WA 3MGRD 3C1CD 1ZLAC 3AZLC 1ID3C 5JRGA 3W98B 1Q9CA 1Z2CB 5AVBC 5CP6B 4YM6B 5FUGB 3AZHB 3NQJB 5B24D 3AV2D 4J8VB 1P3AD 3MNND 2YFVA 3KXBA 4CAYA 3AZEB 3AZIA 2YFVB 2FFFB 3W97C 3AZGA 3AZJA 3MVDA 3AZNA 3LZ0D 3P5JB 4YS3D 3W98C 3W98A 2HUEB 4JJNA 5CPID 5B32C 3REIC 3AV1B 3B6FB 3X1UD 1HTAA 3WAAA 2FJ7A 3KXBB 2F8ND 3AZMD 3MGQA 3REKC 3AFAC 2Y2PA 4WZSB 1KX4A 5GXQA 1KX5C 5DNMD 4G91B 5B1LA 4XZQA 4NE6A 4H9QA 4UUZB 3MGPC 4WU9D 4R8PC 2F2AC 3O62A 3W96D 4J8UA 3UTBC 2RVQD 1P3KA 3X1TD 4UPKA 2CV5C 2NQBB 2NQBA 3AZLB 4HGAC 5AV6B 1P3BC 3A6NA 3MGSB 2HIOB 5BS7A 5DNMB 3NQJA 5F99C 2NZDC 3UTBD 2Y2JA 5AVCC 3X1VC 1M19A 4H9SC 4M6BA 1WWSA 1ID3B 4WU9C 2Y2LA 1M19B 3MGPD 1P3OA 4WU8D 5DNMC 4LD9A 3V9RB 3AN2D 5E5AD 3AZMC 3EPHA 4Z66B 1P3GD 3AZEA 4XUJA 3FDDA 5CPIB 3B6FD 3H0RC 2XD1A 2LY8A 5AY8D 3W97A 3UTBB 1P3BA 1F66B 4EO5B 2ZY5A 4Z5TA 5B2JD 4R8PB 3B0CW 1JFIA 2F8NB 1P3FA 4E44A 3UT9A 1P3FC 3WAAB 1P34A 4WNNA 3MNNC 5GSUB 3LELA 3W96B 3AZFB 5JA4B 2W8SA 5B1LB 5AVBD 1M1AD 3REJD 3C1BA 3AZLD 3AV1C 3MVDC 1P3ID 1AOIC 2Y2GA 5B33D 3AV1A 2ZY2A 1EQZA 4X23D 2HIOD 5B2JB 1PZRA 5CPJD 5AV8D 5AV5C 3VH5W 5BNXB 3B6GC 3EPKA 1KX3D 5GT3C 3KUYC 3REHB 2Y2HA 3W99C 3WTPE 3AZFD 4AWLC 1P3MA 3IP4C 3EPJA 4Z5TC 1T3UA 5B40A 1P3MB 3UT9C 2YFWB 3KWQD 5GT3D 3KUYD 2BYMB 3B6GD 4Z2MH 5GT0D 3KSYA 3RELC 3LZ1C 2UWXA 5CPJB 2PYOC 1P3LD 1P3GB 2BYKA 5DNNA 4J8XA 5AV9B 1AOID 5B32G 2FJ7B 3WKJD 3X1SA 4J8VA 5CP6D 3REJC 1M1AC 4H9NB 5B32A 3C1CA 4J8WD 3REIA 3F6TA 3AYWB 1S32C 5AV5A 4XZQB 3LZ1B 5JA4A 3AYWA 2JSSA 5JRGB 1EQZC 5GSUD 3MGQC 3REKA 3AZKA 1U35A 3WA9D 4KUDA 5B24A 3WAAC 1P3FB 1P3MC 3B0DC 3V9RA 3W99A 1P3IB 3REJB 2IO5C 3B0CT 1P3PD 5CPKD 1ID3A 5BNVB 1HQ3B 4J8WB 2G5IC 1P3GC 5B33B 4X23B 3AN2C 5B0YA 5B31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y B;  3WA9 B;  5B0Z D;  1KX4 D;  3WTP D;  1S32 B;  4WU9 B;  1S32 A;  2NZD D;  3LEL C;  1KX4 C;  1KX5 A;  3KWQ B;  2FJ7 C;  2ARO A;  3MNN B;  5B2I D;  5B31 D;  1P3K B;  1TZY D;  2ARO C;  4ZUX D;  1P3O C;  1P3L B;  4KUD C;  5CPK C;  1P3P C;  1WWI A;  1KX4 B;  4XUJ C;  2HUE C;  2CV5 B;  2NQB C;  3KXB D;  4WU8 B;  5FUG A;  1M19 D;  5B1M D;  1H3O B;  5AV5 B;  5GXQ B;  3AZJ C;  3AFA D;  2BYM A;  1P34 C;  1M18 C;  4EO5 C;  3UTA A;  2F8N A;  5DNN B;  1HQ3 D;  3AZH A;  4WV4 B;  2PYO D;  4YS3 C;  4DRA A;  5B1L C;  3MGS C;  3LZ0 C;  1ZLA A;  3REH A;  3REL D;  3W97 D;  4WU9 A;  3AZG B;  5AV6 A;  1N1J B;  5B0Z B;  2CV5 A;  1BH9 B;  4Z5T B;  3UT9 D;  4KGC B;  4J8X B;  5AVC B;  4YM6 C;  5AVB B;  2NZD B;  3NQU B;  3MGP B;  1ZLA B;  3NQU A;  4JJN D;  5CPI A;  1KX3 C;  1TZY B;  4ZUX B;  4H9O B;  3C1B D;  2PYO B;  5B2I B;  4Z66 C;  4CSR B;  2HIO C;  3MNN A;  4Z66 D;  3C1B C;  2HIO A;  1M18 A;  3MVD D;  4YM6 D;  4YS3 A;  1TAF B;  3X1V B;  3VH6 T;  3LZ1 A;  3W96 A;  1BH8 B;  3TU4 C;  5GXQ C;  3AZJ B;  3X1U A;  3X1T A;  1BH9 A;  4NFT A;  4KGC C;  4KGC A;  3AV2 B;  3VH6 A;  1P3A B;  3AZE C;  1KX5 B;  2L5A A;  4J8U B;  4R8P A;  1JFI B;  5B2J C;  4LD9 B;  3R45 B;  3AFA B;  3MGS D;  5B1L D;  4HGA B;  4YS3 B;  4QLC D;  5B32 B;  3REI B;  3MVD B;  3B6F C;  5DNN D;  3AZM B;  3WKJ A;  5AV9 A;  1P34 D;  5KDM A;  4KUD B;  3AZG D;  3AZJ D;  5B1M C;  1KX3 B;  1TAF A;  4E45 A;  3X1V A;  1M19 C;  3VH5 A;  3C1C B;  3AZH C;  4J8V C;  5BNX A;  4LD9 D;  5AVC D;  3KXB C;  5E5A A;  3AV2 A;  1P3A A;  3TU4 A;  5F99 D;  4J8X C;  4XUJ D;  3AZI D;  1B67 A;  4X23 A;  5DNM A;  1F66 D;  1R4V A;  1P3B D;  1P3O D;  1TZY C;  4ZUX C;  5B2I C;  5B2J A;  3AZF A;  2FJ7 D;  3TU4 B;  3WKJ B;  5B40 D;  3LEL D;  3MGR A;  5BO0 B;  3B6F A;  3WTP A;  3WTP C;  5B0Z C;  1H3O A;  1P3I A;  3O62 D;  3AZN B;  1KX5 D;  5B31 G;  3AZG C;  4ZBJ C;  5B31 B;  1P3K D;  1AOI A;  3UTA B;  5B31 A;  5DNN C;  3X1U C;  5G49 B;  5B32 D;  3REI D;  1P3P B;  4QLC C;  3W98 D;  3LJA D;  3REJ A;  3A6N D;  5GSU A;  1P3M D;  3B0D B;  3WAA D;  3AZE D;  3MGQ D;  4G91 C;  1F1E A;  1EQZ D;  5B24 C;  5GXQ D;  4G92 B;  5AV8 A;  4XZQ C;  1P3P A;  3MGP A;  4AWL B;  1ID3 D;  1P3L A;  3MGR C;  4XUJ B;  1ULY A;  5B0Y C;  3AN2 A;  1P3L C;  1P3G A;  3AN2 B;  2ARO B;  3W97 B;  5BS7 C;  5GT0 C;  5JRG D;  4H9P B;  1M1A A;  4JJN C;  2CWE A;  3KWQ C;  1A7W A;  3X1S C;  2YFW A;  3WA9 A;  4CAY B;  1KU5 A;  4Z5T D;  3LEL B;  3B0B A;  2F8N K;  5B2I A;  3AZF C;  3W99 D;  3X1S D;  5CPJ A;  5B24 B;  3O62 B;  3AZN D;  3LZ0 A;  3C1B B;  5JRG C;  4JJN B;  4H9P A;  3LZ0 B;  5AV5 D;  5AV8 C;  5AVB A;  5CPK A;  4X23 C;  4NE3 A;  3AZL A;  5B33 C;  1HQ3 C;  5B0Y D;  3AZM A;  1P3I C;  1AOI B;  5B33 A;  3AV1 D;  3A6N B;  3X1U B;  2BYK B;  3LJA B;  5GT3 A;  3KUY A;  5BT1 D;  4H9Q B;  1B6W A;  4UUZ A;  4XZQ D;  1M18 D;  1KX3 A;  4YM6 A;  5AV8 B;  1EQZ B;  4J8U D;  3MGQ B;  1P3F D;  2F8N H;  5E5A B;  3X1T B;  2NQB D;  3A6N C;  3LJA C;  5AY8 C;  5C3I C;  3MGS A;  5CPK B;  4H9S A;  5AY8 B;  3R45 A;  5C3I B;  3REH C;  5G49 A;  2NZD A;  5CHL B;  1M18 B;  1P34 B;  4KUD D;  1P3K C;  2ARO D;  5E5A C;  1BFM A;  3O62 C;  5AV9 D;  4CSR A;  3UTB A;  4DRB A;  4WU8 C;  3AZK C;  1U35 C;  5CP6 A;  1N1J A;  4H9R A;  3AYW C;  3WTP B;  3X1V D;  1M1A B;  4WU8 A;  4H9R B;  3AYW D;  3X1S B;  5B40 C;  3AZI B;  3AZK D;  1U35 D;  5F99 B;  3W99 B;  5AV9 C;  3VH6 W;  5F99 A;  5B0Z A;  1P3O B;  3REK B;  5BNV A;  1F66 C;  1P3B B;  5AY8 A;  1F66 A;  5B1M A;  3REH D;  3REL A;  3MGR B;  2IO5 B;  3AFA A;  3AZI C;  5B40 B;  4H9N A;  4KHA A;  4J8X D;  3X1T C;  2CV5 D;  4WNN B;  2RVQ C;  3W96 C;  4LD9 C;  1TZY A;  4ZUX A;  4J8V D;  4R8P D;  3AZK B;  1HQ3 A;  1U35 B;  4G92 C;  3AZH D;  3WA9 C;  4J8U C;  5GSU C;  3B6G B;  5B1M B;  1S32 D;  3REK D;  5BT1 C;  4J8W C;  5CP6 C;  4Z66 A;  3VH5 T;  3WKJ C;  5CPI C;  1BH8 A;  2F8N G;  3REL B;  4NE5 A;  3LZ1 D;  3LJA A;  5KDM B;  5BO0 A;  3AZN C;  5AVC A;  3UT9 B;  4KGC D;  3AV2 C;  1P3A C;  3TU4 D;  3KWQ A;  4H9O A;  2PYO A;  3B6G A;  5GT0 A;  4QLC B;  1ZLA D;  5GT3 B;  3KUY B;  3C1C C;  4QLC A;  5GT0 B;  5AV6 D;  3UTA C;  5CPJ C;  4ZBJ B;  4Z2M G;  4KHA B;  3UTA D;  5AV6 C;  4J8W A;  3MGR D;  3C1C D;  1ZLA C;  3AZL C;  1ID3 C;  5JRG A;  3W98 B;  1Q9C A;  5AVB C;  5CP6 B;  4YM6 B;  5FUG B;  3AZH B;  3NQJ B;  5B24 D;  3AV2 D;  4J8V B;  1P3A D;  3MNN D;  2YFV A;  3KXB A;  4CAY A;  3AZE B;  3AZI A;  2YFV B;  3W97 C;  3AZG A;  3AZJ A;  3MVD A;  3AZN A;  3LZ0 D;  4YS3 D;  3W98 C;  3W98 A;  2HUE B;  4JJN A;  5CPI D;  5B32 C;  3REI C;  3AV1 B;  3B6F B;  3X1U D;  1HTA A;  3WAA A;  2FJ7 A;  3KXB B;  2F8N D;  3AZM D;  3MGQ A;  3REK C;  3AFA C;  4WZS B;  1KX4 A;  5GXQ A;  1KX5 C;  5DNM D;  4G91 B;  5B1L A;  4XZQ A;  4NE6 A;  4H9Q A;  4UUZ B;  3MGP C;  4WU9 D;  4R8P C;  3O62 A;  3W96 D;  4J8U A;  3UTB C;  2RVQ D;  1P3K A;  3X1T D;  2CV5 C;  2NQB B;  2NQB A;  3AZL B;  4HGA C;  5AV6 B;  1P3B C;  3A6N A;  3MGS B;  2HIO B;  5BS7 A;  5DNM B;  3NQJ A;  5F99 C;  2NZD C;  3UTB D;  5AVC C;  3X1V C;  1M19 A;  4H9S C;  4M6B A;  1WWS A;  1ID3 B;  4WU9 C;  1M19 B;  3MGP D;  1P3O A;  4WU8 D;  5DNM C;  4LD9 A;  3V9R B;  3AN2 D;  5E5A D;  3AZM C;  4Z66 B;  1P3G D;  3AZE A;  4XUJ A;  5CPI B;  3B6F D;  2LY8 A;  5AY8 D;  3W97 A;  3UTB B;  1P3B A;  1F66 B;  4EO5 B;  4Z5T A;  5B2J D;  4R8P B;  1JFI A;  3B0C W;  2F8N B;  1P3F A;  4E44 A;  3UT9 A;  1P3F C;  3WAA B;  1P34 A;  4WNN A;  3MNN C;  5GSU B;  3LEL A;  3W96 B;  3AZF B;  5JA4 B;  5B1L B;  5AVB D;  1M1A D;  3REJ D;  3C1B A;  3AZL D;  3AV1 C;  3MVD C;  1P3I D;  1AOI C;  5B33 D;  3AV1 A;  1EQZ A;  4X23 D;  2HIO D;  5B2J B;  5CPJ D;  5AV8 D;  5AV5 C;  3VH5 W;  5BNX B;  3B6G C;  1KX3 D;  5GT3 C;  3KUY C;  3REH B;  3W99 C;  3WTP E;  3AZF D;  4AWL C;  1P3M A;  4Z5T C;  1P3M B;  5B40 A;  3UT9 C;  2YFW B;  3KWQ D;  5GT3 D;  3KUY D;  2BYM B;  3B6G D;  4Z2M H;  5GT0 D;  3KSY A;  3REL C;  3LZ1 C;  5CPJ B;  2PYO C;  1P3L D;  1P3G B;  2BYK A;  5DNN A;  4J8X A;  5AV9 B;  1AOI D;  5B32 G;  2FJ7 B;  3WKJ D;  3X1S A;  4J8V A;  5CP6 D;  3REJ C;  1M1A C;  4H9N B;  5B32 A;  3C1C A;  4J8W D;  3REI A;  3AYW B;  1S32 C;  5AV5 A;  4XZQ B;  3LZ1 B;  5JA4 A;  3AYW A;  2JSS A;  5JRG B;  1EQZ C;  5GSU D;  3MGQ C;  3REK A;  3AZK A;  1U35 A;  3WA9 D;  4KUD A;  5B24 A;  3WAA C;  1P3F B;  1P3M C;  3B0D C;  3V9R A;  3W99 A;  1P3I B;  3REJ B;  2IO5 C;  3B0C T;  1P3P D;  5CPK D;  1ID3 A;  5BNV B;  1HQ3 B;  4J8W B;  1P3G C;  5B33 B;  4X23 B;  3AN2 C;  5B0Y A;  5B31 C; 
#chains in the Genus database with same CATH topology
 5B0Y B;  2Y2I A;  3WA9 B;  5B0Z D;  1KX4 D;  1W2E A;  3WTP D;  1S32 B;  4WU9 B;  1S32 A;  2NZD D;  3LEL C;  1KX4 C;  1KX5 A;  3KWQ B;  2FJ7 C;  2ARO A;  3MNN B;  5B2I D;  5B31 D;  1P3K B;  1TZY D;  2ARO C;  4ZUX D;  1P3O C;  1P3L B;  4KUD C;  5CPK C;  1P3P C;  1WWI A;  1KX4 B;  4XUJ C;  2HUE C;  2CV5 B;  2NQB C;  3KXB D;  4WU8 B;  5FUG A;  1M19 D;  5B1M D;  1H3O B;  5AV5 B;  5GXQ B;  3AZJ C;  3AFA D;  2BYM A;  1P34 C;  1M18 C;  4EO5 C;  3UTA A;  2F8N A;  5DNN B;  1HQ3 D;  3AZH A;  4WV4 B;  2PYO D;  4YS3 C;  4DRA A;  5B1L C;  3MGS C;  3EG5 B;  3LZ0 C;  1ZLA A;  3REH A;  3REL D;  3W97 D;  4WU9 A;  3AZG B;  5AV6 A;  1N1J B;  5B0Z B;  2CV5 A;  1BH9 B;  4Z5T B;  3UT9 D;  4KGC B;  4J8X B;  2Y2Q A;  2JE5 A;  5AVC B;  4YM6 C;  5AVB B;  2NZD B;  3NQU B;  3MGP B;  1ZLA B;  3NQU A;  4JJN D;  5CPI A;  3A1I A;  1KX3 C;  1TZY B;  4ZUX B;  4H9O B;  3C1B D;  2PYO B;  5B2I B;  4Z66 C;  4CSR B;  2HIO C;  3MNN A;  4Z66 D;  3C1B C;  2Y2O A;  2HIO A;  1M18 A;  3MVD D;  4YM6 D;  4YS3 A;  1TAF B;  3X1V B;  3VH6 T;  3LZ1 A;  3W96 A;  1BH8 B;  3TU4 C;  5GXQ C;  3AZJ B;  3X1U A;  3X1T A;  1BH9 A;  4NFT A;  4KGC C;  4KGC A;  3AV2 B;  3VH6 A;  1P3A B;  3AZE C;  1KX5 B;  2L5A A;  4J8U B;  4R8P A;  1JFI B;  5B2J C;  4LD9 B;  3R45 B;  3AFA B;  3MGS D;  5B1L D;  4HGA B;  2VQR A;  4YS3 B;  4QLC D;  5B32 B;  3REI B;  3MVD B;  3B6F C;  5DNN D;  3AZM B;  3WKJ A;  5AV9 A;  1P34 D;  5KDM A;  4KUD B;  3AZG D;  3AZJ D;  5B1M C;  2JCH A;  1KX3 B;  1TAF A;  4E45 A;  3X1V A;  1M19 C;  3VH5 A;  3C1C B;  3AZH C;  4J8V C;  5BNX A;  4LD9 D;  2G5H C;  5AVC D;  3KXB C;  5E5A A;  3AV2 A;  1P3A A;  3TU4 A;  5F99 D;  4J8X C;  4XUJ D;  3EPL A;  3AZI D;  1B67 A;  4X23 A;  5DNM A;  1F66 D;  1R4V A;  1P3B D;  1P3O D;  1TZY C;  4ZUX C;  5B2I C;  5B2J A;  3AZF A;  2Y2N A;  2FJ7 D;  3TU4 B;  3WKJ B;  5B40 D;  3LEL D;  2BG1 A;  3MGR A;  5BO0 B;  3B6F A;  3WTP A;  3WTP C;  5B0Z C;  1H3O A;  1P3I A;  3O62 D;  3AZN B;  1KX5 D;  5B31 G;  3AZG C;  4ZBJ C;  5B31 B;  1P3K D;  1AOI A;  3UTA B;  5B31 A;  5DNN C;  3X1U C;  5G49 B;  5B32 D;  3REI D;  1P3P B;  4QLC C;  2DQN C;  2Y2M A;  3W98 D;  3LJA D;  3REJ A;  3A6N D;  5GSU A;  1P3M D;  3B0D B;  3WAA D;  3KFU G;  3AZE D;  3MGQ D;  4G91 C;  1F1E A;  2DF4 C;  1EQZ D;  2XD5 A;  5B24 C;  5GXQ D;  4G92 B;  2Y2K A;  5AV8 A;  4XZQ C;  1P3P A;  3MGP A;  4AWL B;  1ID3 D;  2RIQ A;  1P3L A;  3MGR C;  4XUJ B;  1ULY A;  5B0Y C;  3AN2 A;  1P3L C;  2ZM5 A;  1P3G A;  3AN2 B;  2ARO B;  3W97 B;  5BS7 C;  5GT0 C;  5JRG D;  4H9P B;  1M1A A;  4JJN C;  4WJ3 C;  2ZY4 A;  2CWE A;  3KWQ C;  1A7W A;  3X1S C;  2YFW A;  3WA9 A;  4CAY B;  1KU5 A;  4Z5T D;  3LEL B;  3B0B A;  2F8N K;  5B2I A;  3AZF C;  3W99 D;  3X1S D;  5CPJ A;  5B24 B;  3O62 B;  3AZN D;  3LZ0 A;  3C1B B;  5JRG C;  4JJN B;  4H9P A;  3LZ0 B;  5AV5 D;  5AV8 C;  5AVB A;  5CPK A;  4X23 C;  4NE3 A;  3AZL A;  5B33 C;  1HQ3 C;  5B0Y D;  3AZM A;  1P3I C;  1AOI B;  5B33 A;  3AV1 D;  3A6N B;  3X1U B;  2BYK B;  3LJA B;  5GT3 A;  3KUY A;  5BT1 D;  4H9Q B;  4XZQ D;  1B6W A;  4UUZ A;  1M18 D;  1KX3 A;  4YM6 A;  5AV8 B;  1EQZ B;  4J8U D;  3MGQ B;  1P3F D;  2F8N H;  5E5A B;  3X1T B;  2NQB D;  3A6N C;  3LJA C;  5AY8 C;  5C3I C;  3MGS A;  5CPK B;  4H9S A;  5AY8 B;  5C3I B;  3R45 A;  3REH C;  5G49 A;  2NZD A;  5CHL B;  1M18 B;  1P34 B;  4KUD D;  1P3K C;  2ARO D;  5E5A C;  1BFM A;  3O62 C;  5AV9 D;  4CSR A;  3UTB A;  4DRB A;  4WU8 C;  3AZK C;  1U35 C;  5CP6 A;  1N1J A;  4H9R A;  3AYW C;  3WTP B;  3A1K A;  3H0L C;  3X1V D;  1M1A B;  4WU8 A;  4H9R B;  3AYW D;  3X1S B;  5B40 C;  3AZI B;  3AZK D;  1U35 D;  5F99 B;  3W99 B;  5AV9 C;  3VH6 W;  5F99 A;  5B0Z A;  1P3O B;  3REK B;  5BNV A;  1F66 C;  1P3B B;  5AY8 A;  1F66 A;  5B1M A;  3REH D;  3REL A;  3MGR B;  2IO5 B;  3AFA A;  3AZI C;  5B40 B;  4H9N A;  4KHA A;  4J8X D;  3X1T C;  2CV5 D;  4WNN B;  2RVQ C;  3W96 C;  4LD9 C;  1TZY A;  4ZUX A;  4J8V D;  4R8P D;  3AZK B;  1HQ3 A;  1U35 B;  4G92 C;  3AZH D;  3WA9 C;  4J8U C;  5GSU C;  3B6G B;  5B1M B;  1S32 D;  2ZY3 A;  3REK D;  5BT1 C;  4J8W C;  2J8P A;  5CP6 C;  4Z66 A;  3VH5 T;  3WKJ C;  5CPI C;  1BH8 A;  2F8N G;  3REL B;  4NE5 A;  3LZ1 D;  3LJA A;  5KDM B;  5BO0 A;  3AZN C;  5AVC A;  3UT9 B;  4KGC D;  4DQY B;  3AV2 C;  1P3A C;  3TU4 D;  3H0M C;  3AL0 C;  3KWQ A;  4H9O A;  2PYO A;  3B6G A;  5GT0 A;  4QLC B;  1ZLA D;  5GT3 B;  3KUY B;  3C1C C;  4QLC A;  5GT0 B;  5AV6 D;  3UTA C;  5CPJ C;  4ZBJ B;  4Z2M G;  4KHA B;  3UTA D;  5AV6 C;  4J8W A;  3MGR D;  3C1C D;  1ZLA C;  3AZL C;  1ID3 C;  5JRG A;  3W98 B;  1Q9C A;  1Z2C B;  5AVB C;  5CP6 B;  4YM6 B;  5FUG B;  3AZH B;  3NQJ B;  5B24 D;  3AV2 D;  4J8V B;  1P3A D;  3MNN D;  2YFV A;  3KXB A;  4CAY A;  3AZE B;  3AZI A;  2YFV B;  2FFF B;  3W97 C;  3AZG A;  3AZJ A;  3MVD A;  3AZN A;  3LZ0 D;  3P5J B;  4YS3 D;  3W98 C;  3W98 A;  2HUE B;  4JJN A;  5CPI D;  5B32 C;  3REI C;  3AV1 B;  3B6F B;  3X1U D;  1HTA A;  3WAA A;  2FJ7 A;  3KXB B;  2F8N D;  3AZM D;  3MGQ A;  3REK C;  3AFA C;  2Y2P A;  4WZS B;  1KX4 A;  5GXQ A;  1KX5 C;  5DNM D;  4G91 B;  5B1L A;  4XZQ A;  4NE6 A;  4H9Q A;  4UUZ B;  3MGP C;  4WU9 D;  4R8P C;  2F2A C;  3O62 A;  3W96 D;  4J8U A;  3UTB C;  2RVQ D;  1P3K A;  3X1T D;  4UPK A;  2CV5 C;  2NQB B;  2NQB A;  3AZL B;  4HGA C;  5AV6 B;  1P3B C;  3A6N A;  3MGS B;  2HIO B;  5BS7 A;  5DNM B;  3NQJ A;  5F99 C;  2NZD C;  3UTB D;  2Y2J A;  5AVC C;  3X1V C;  1M19 A;  4H9S C;  4M6B A;  1WWS A;  1ID3 B;  4WU9 C;  2Y2L A;  1M19 B;  3MGP D;  1P3O A;  4WU8 D;  5DNM C;  4LD9 A;  3V9R B;  3AN2 D;  5E5A D;  3AZM C;  3EPH A;  4Z66 B;  1P3G D;  3AZE A;  4XUJ A;  3FDD A;  5CPI B;  3B6F D;  3H0R C;  2XD1 A;  2LY8 A;  5AY8 D;  3W97 A;  3UTB B;  1P3B A;  1F66 B;  4EO5 B;  2ZY5 A;  4Z5T A;  5B2J D;  4R8P B;  3B0C W;  1JFI A;  2F8N B;  1P3F A;  4E44 A;  3UT9 A;  1P3F C;  3WAA B;  1P34 A;  4WNN A;  3MNN C;  5GSU B;  3LEL A;  3W96 B;  3AZF B;  5JA4 B;  2W8S A;  5B1L B;  5AVB D;  1M1A D;  3REJ D;  3C1B A;  3AZL D;  3AV1 C;  3MVD C;  1P3I D;  1AOI C;  2Y2G A;  5B33 D;  3AV1 A;  2ZY2 A;  1EQZ A;  4X23 D;  2HIO D;  5B2J B;  1PZR A;  5CPJ D;  5AV8 D;  5AV5 C;  3VH5 W;  5BNX B;  3B6G C;  3EPK A;  1KX3 D;  5GT3 C;  3KUY C;  3REH B;  2Y2H A;  3W99 C;  3WTP E;  3AZF D;  4AWL C;  1P3M A;  3IP4 C;  3EPJ A;  4Z5T C;  1T3U A;  5B40 A;  1P3M B;  3UT9 C;  2YFW B;  3KWQ D;  5GT3 D;  3KUY D;  2BYM B;  3B6G D;  4Z2M H;  5GT0 D;  3KSY A;  3REL C;  3LZ1 C;  2UWX A;  5CPJ B;  2PYO C;  1P3L D;  1P3G B;  2BYK A;  5DNN A;  4J8X A;  5AV9 B;  1AOI D;  5B32 G;  2FJ7 B;  3WKJ D;  3X1S A;  4J8V A;  5CP6 D;  3REJ C;  1M1A C;  4H9N B;  5B32 A;  3C1C A;  4J8W D;  3REI A;  3F6T A;  3AYW B;  1S32 C;  5AV5 A;  4XZQ B;  3LZ1 B;  5JA4 A;  3AYW A;  2JSS A;  5JRG B;  1EQZ C;  5GSU D;  3MGQ C;  3REK A;  3AZK A;  1U35 A;  3WA9 D;  4KUD A;  5B24 A;  3WAA C;  1P3F B;  1P3M C;  3B0D C;  3V9R A;  3W99 A;  1P3I B;  3REJ B;  2IO5 C;  3B0C T;  1P3P D;  5CPK D;  1ID3 A;  5BNV B;  1HQ3 B;  4J8W B;  2G5I C;  1P3G C;  5B33 B;  4X23 B;  3AN2 C;  5B0Y A;  5B31 C; 
#chains in the Genus database with same CATH homology
 5B0Y B;  2Y2I A;  3WA9 B;  5B0Z D;  1KX4 D;  1W2E A;  3WTP D;  1S32 B;  4WU9 B;  1S32 A;  2NZD D;  3LEL C;  1KX4 C;  1KX5 A;  3KWQ B;  2FJ7 C;  2ARO A;  3MNN B;  5B2I D;  5B31 D;  1P3K B;  1TZY D;  2ARO C;  4ZUX D;  1P3O C;  1P3L B;  4KUD C;  5CPK C;  1P3P C;  1WWI A;  1KX4 B;  4XUJ C;  2HUE C;  2CV5 B;  2NQB C;  3KXB D;  4WU8 B;  5FUG A;  1M19 D;  5B1M D;  1H3O B;  5AV5 B;  5GXQ B;  3AZJ C;  3AFA D;  2BYM A;  1P34 C;  1M18 C;  4EO5 C;  3UTA A;  2F8N A;  5DNN B;  1HQ3 D;  3AZH A;  4WV4 B;  2PYO D;  4YS3 C;  4DRA A;  5B1L C;  3MGS C;  3EG5 B;  3LZ0 C;  1ZLA A;  3REH A;  3REL D;  3W97 D;  4WU9 A;  3AZG B;  5AV6 A;  1N1J B;  5B0Z B;  2CV5 A;  1BH9 B;  4Z5T B;  3UT9 D;  4KGC B;  4J8X B;  2Y2Q A;  2JE5 A;  5AVC B;  4YM6 C;  5AVB B;  2NZD B;  3NQU B;  3MGP B;  1ZLA B;  3NQU A;  4JJN D;  5CPI A;  3A1I A;  1KX3 C;  1TZY B;  4ZUX B;  4H9O B;  3C1B D;  2PYO B;  5B2I B;  4Z66 C;  4CSR B;  2HIO C;  3MNN A;  4Z66 D;  3C1B C;  2Y2O A;  2HIO A;  1M18 A;  3MVD D;  4YM6 D;  4YS3 A;  1TAF B;  3X1V B;  3VH6 T;  3LZ1 A;  3W96 A;  1BH8 B;  3TU4 C;  5GXQ C;  3AZJ B;  3X1U A;  3X1T A;  1BH9 A;  4NFT A;  4KGC C;  4KGC A;  3AV2 B;  3VH6 A;  1P3A B;  3AZE C;  1KX5 B;  2L5A A;  4J8U B;  4R8P A;  1JFI B;  5B2J C;  4LD9 B;  3R45 B;  3AFA B;  3MGS D;  5B1L D;  4HGA B;  2VQR A;  4YS3 B;  4QLC D;  5B32 B;  3REI B;  3MVD B;  3B6F C;  5DNN D;  3AZM B;  3WKJ A;  5AV9 A;  1P34 D;  5KDM A;  4KUD B;  3AZG D;  3AZJ D;  5B1M C;  2JCH A;  1KX3 B;  1TAF A;  4E45 A;  3X1V A;  1M19 C;  3VH5 A;  3C1C B;  3AZH C;  4J8V C;  5BNX A;  4LD9 D;  2G5H C;  5AVC D;  3KXB C;  5E5A A;  3AV2 A;  1P3A A;  3TU4 A;  5F99 D;  4J8X C;  4XUJ D;  3EPL A;  3AZI D;  1B67 A;  4X23 A;  5DNM A;  1F66 D;  1R4V A;  1P3B D;  1P3O D;  1TZY C;  4ZUX C;  5B2I C;  5B2J A;  3AZF A;  2Y2N A;  2FJ7 D;  3TU4 B;  3WKJ B;  5B40 D;  3LEL D;  2BG1 A;  3MGR A;  5BO0 B;  3B6F A;  3WTP A;  3WTP C;  5B0Z C;  1H3O A;  1P3I A;  3O62 D;  3AZN B;  1KX5 D;  5B31 G;  3AZG C;  4ZBJ C;  5B31 B;  1P3K D;  1AOI A;  3UTA B;  5B31 A;  5DNN C;  3X1U C;  5G49 B;  5B32 D;  3REI D;  1P3P B;  4QLC C;  2DQN C;  2Y2M A;  3W98 D;  3LJA D;  3REJ A;  3A6N D;  5GSU A;  1P3M D;  3B0D B;  3WAA D;  3KFU G;  3AZE D;  3MGQ D;  4G91 C;  1F1E A;  2DF4 C;  1EQZ D;  2XD5 A;  5B24 C;  5GXQ D;  4G92 B;  2Y2K A;  5AV8 A;  4XZQ C;  1P3P A;  3MGP A;  4AWL B;  1ID3 D;  2RIQ A;  1P3L A;  3MGR C;  4XUJ B;  1ULY A;  5B0Y C;  3AN2 A;  1P3L C;  2ZM5 A;  1P3G A;  3AN2 B;  2ARO B;  3W97 B;  5BS7 C;  5GT0 C;  5JRG D;  4H9P B;  1M1A A;  4JJN C;  4WJ3 C;  2ZY4 A;  2CWE A;  3KWQ C;  1A7W A;  3X1S C;  2YFW A;  3WA9 A;  4CAY B;  1KU5 A;  4Z5T D;  3LEL B;  3B0B A;  2F8N K;  5B2I A;  3AZF C;  3W99 D;  3X1S D;  5CPJ A;  5B24 B;  3O62 B;  3AZN D;  3LZ0 A;  3C1B B;  5JRG C;  4JJN B;  4H9P A;  3LZ0 B;  5AV5 D;  5AV8 C;  5AVB A;  5CPK A;  4X23 C;  4NE3 A;  3AZL A;  5B33 C;  1HQ3 C;  5B0Y D;  3AZM A;  1P3I C;  1AOI B;  5B33 A;  3AV1 D;  3A6N B;  3X1U B;  2BYK B;  3LJA B;  5GT3 A;  3KUY A;  5BT1 D;  4H9Q B;  4XZQ D;  1B6W A;  4UUZ A;  1M18 D;  1KX3 A;  4YM6 A;  5AV8 B;  1EQZ B;  4J8U D;  3MGQ B;  1P3F D;  2F8N H;  5E5A B;  3X1T B;  2NQB D;  3A6N C;  3LJA C;  5AY8 C;  5C3I C;  3MGS A;  5CPK B;  4H9S A;  5AY8 B;  5C3I B;  3R45 A;  3REH C;  5G49 A;  2NZD A;  5CHL B;  1M18 B;  1P34 B;  4KUD D;  1P3K C;  2ARO D;  5E5A C;  1BFM A;  3O62 C;  5AV9 D;  4CSR A;  3UTB A;  4DRB A;  4WU8 C;  3AZK C;  1U35 C;  5CP6 A;  1N1J A;  4H9R A;  3AYW C;  3WTP B;  3A1K A;  3H0L C;  3X1V D;  1M1A B;  4WU8 A;  4H9R B;  3AYW D;  3X1S B;  5B40 C;  3AZI B;  3AZK D;  1U35 D;  5F99 B;  3W99 B;  5AV9 C;  3VH6 W;  5F99 A;  5B0Z A;  1P3O B;  3REK B;  5BNV A;  1F66 C;  1P3B B;  5AY8 A;  1F66 A;  5B1M A;  3REH D;  3REL A;  3MGR B;  2IO5 B;  3AFA A;  3AZI C;  5B40 B;  4H9N A;  4KHA A;  4J8X D;  3X1T C;  2CV5 D;  4WNN B;  2RVQ C;  3W96 C;  4LD9 C;  1TZY A;  4ZUX A;  4J8V D;  4R8P D;  3AZK B;  1HQ3 A;  1U35 B;  4G92 C;  3AZH D;  3WA9 C;  4J8U C;  5GSU C;  3B6G B;  5B1M B;  1S32 D;  2ZY3 A;  3REK D;  5BT1 C;  4J8W C;  2J8P A;  5CP6 C;  4Z66 A;  3VH5 T;  3WKJ C;  5CPI C;  1BH8 A;  2F8N G;  3REL B;  4NE5 A;  3LZ1 D;  3LJA A;  5KDM B;  5BO0 A;  3AZN C;  5AVC A;  3UT9 B;  4KGC D;  4DQY B;  3AV2 C;  1P3A C;  3TU4 D;  3H0M C;  3AL0 C;  3KWQ A;  4H9O A;  2PYO A;  3B6G A;  5GT0 A;  4QLC B;  1ZLA D;  5GT3 B;  3KUY B;  3C1C C;  4QLC A;  5GT0 B;  5AV6 D;  3UTA C;  5CPJ C;  4ZBJ B;  4Z2M G;  4KHA B;  3UTA D;  5AV6 C;  4J8W A;  3MGR D;  3C1C D;  1ZLA C;  3AZL C;  1ID3 C;  5JRG A;  3W98 B;  1Q9C A;  1Z2C B;  5AVB C;  5CP6 B;  4YM6 B;  5FUG B;  3AZH B;  3NQJ B;  5B24 D;  3AV2 D;  4J8V B;  1P3A D;  3MNN D;  2YFV A;  3KXB A;  4CAY A;  3AZE B;  3AZI A;  2YFV B;  2FFF B;  3W97 C;  3AZG A;  3AZJ A;  3MVD A;  3AZN A;  3LZ0 D;  3P5J B;  4YS3 D;  3W98 C;  3W98 A;  2HUE B;  4JJN A;  5CPI D;  5B32 C;  3REI C;  3AV1 B;  3B6F B;  3X1U D;  1HTA A;  3WAA A;  2FJ7 A;  3KXB B;  2F8N D;  3AZM D;  3MGQ A;  3REK C;  3AFA C;  2Y2P A;  4WZS B;  1KX4 A;  5GXQ A;  1KX5 C;  5DNM D;  4G91 B;  5B1L A;  4XZQ A;  4NE6 A;  4H9Q A;  4UUZ B;  3MGP C;  4WU9 D;  4R8P C;  2F2A C;  3O62 A;  3W96 D;  4J8U A;  3UTB C;  2RVQ D;  1P3K A;  3X1T D;  4UPK A;  2CV5 C;  2NQB B;  2NQB A;  3AZL B;  4HGA C;  5AV6 B;  1P3B C;  3A6N A;  3MGS B;  2HIO B;  5BS7 A;  5DNM B;  3NQJ A;  5F99 C;  2NZD C;  3UTB D;  2Y2J A;  5AVC C;  3X1V C;  1M19 A;  4H9S C;  4M6B A;  1WWS A;  1ID3 B;  4WU9 C;  2Y2L A;  1M19 B;  3MGP D;  1P3O A;  4WU8 D;  5DNM C;  4LD9 A;  3V9R B;  3AN2 D;  5E5A D;  3AZM C;  3EPH A;  4Z66 B;  1P3G D;  3AZE A;  4XUJ A;  3FDD A;  5CPI B;  3B6F D;  3H0R C;  2XD1 A;  2LY8 A;  5AY8 D;  3W97 A;  3UTB B;  1P3B A;  1F66 B;  4EO5 B;  2ZY5 A;  4Z5T A;  5B2J D;  4R8P B;  3B0C W;  1JFI A;  2F8N B;  1P3F A;  4E44 A;  3UT9 A;  1P3F C;  3WAA B;  1P34 A;  4WNN A;  3MNN C;  5GSU B;  3LEL A;  3W96 B;  3AZF B;  5JA4 B;  2W8S A;  5B1L B;  5AVB D;  1M1A D;  3REJ D;  3C1B A;  3AZL D;  3AV1 C;  3MVD C;  1P3I D;  1AOI C;  2Y2G A;  5B33 D;  3AV1 A;  2ZY2 A;  1EQZ A;  4X23 D;  2HIO D;  5B2J B;  1PZR A;  5CPJ D;  5AV8 D;  5AV5 C;  3VH5 W;  5BNX B;  3B6G C;  3EPK A;  1KX3 D;  5GT3 C;  3KUY C;  3REH B;  2Y2H A;  3W99 C;  3WTP E;  3AZF D;  4AWL C;  1P3M A;  3IP4 C;  3EPJ A;  4Z5T C;  1T3U A;  5B40 A;  1P3M B;  3UT9 C;  2YFW B;  3KWQ D;  5GT3 D;  3KUY D;  2BYM B;  3B6G D;  4Z2M H;  5GT0 D;  3KSY A;  3REL C;  3LZ1 C;  2UWX A;  5CPJ B;  2PYO C;  1P3L D;  1P3G B;  2BYK A;  5DNN A;  4J8X A;  5AV9 B;  1AOI D;  5B32 G;  2FJ7 B;  3WKJ D;  3X1S A;  4J8V A;  5CP6 D;  3REJ C;  1M1A C;  4H9N B;  5B32 A;  3C1C A;  4J8W D;  3REI A;  3F6T A;  3AYW B;  1S32 C;  5AV5 A;  4XZQ B;  3LZ1 B;  5JA4 A;  3AYW A;  2JSS A;  5JRG B;  1EQZ C;  5GSU D;  3MGQ C;  3REK A;  3AZK A;  1U35 A;  3WA9 D;  4KUD A;  5B24 A;  3WAA C;  1P3F B;  1P3M C;  3B0D C;  3V9R A;  3W99 A;  1P3I B;  3REJ B;  2IO5 C;  3B0C T;  1P3P D;  5CPK D;  1ID3 A;  5BNV B;  1HQ3 B;  4J8W B;  2G5I C;  1P3G C;  5B33 B;  4X23 B;  3AN2 C;  5B0Y A;  5B31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...