4H9SE

Complex structure 6 of daxx/h3.3(sub7)/h4
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
204
structure length
199
Chain Sequence
SRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
molecule keywords Histone H3.3
molecule tags Dna binding protein/apoptosis
source organism Homo sapiens
total genus 71
structure length 199
sequence length 204
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9sE00
4H9RC 4H9SE 4H9NC 4H9PC 4H9QC 4H9OC 4HGAA 5KDMC
chains in the Genus database with same CATH superfamily
2XQ8A 3C4ZA 4TNWA 4H9RC 4PK5A 4TV8E 5LYJE 5LHGB 2BVMA 4TWFA 2KWIB 2VQET 1YW0A 5CA1E 2WZHA 4B3RT 1G8XA 2GK9A 5ABFA 2Y8DA 3LK2B 4TWDA 3FXDB 3CPZA 4A5XA 3AE2A 3HA4A 4Z91A 4HFBA 3KV6A 4U72A 3RRWA 1UX5A 1D0ZA 3CQGB 4AIUA 3AE3A 4AKGA 4YJ2E 2BS3A 3RGLA 3AE8A 5TAOA 2XAQB 3W15B 4AXPA 2X0YA 2K5BB 2L8KA 4P0BA 1EZ3A 1LRZA 4O2AE 4BA9A 4HGAA 3OKQA 2IUBA 3NWIA 2NTXA 3AE7A 2FBWA 1E2AA 4DBQA 2WM9A 5FXXA 2BKNA 3ETUA 4PK4A 5IYZE 3P8CD 3OPCA 1MNEA 2KMFA 2VKDA 2JJ9A 2KLQA 3PTRB 5FXVA 4LFAT 5ETWA 3A7MA 2XHEB 2CHNA 2XJ7A 1B7TA 3PUXF 3AAEB 2V7LA 4XAXB 4DR6T 1H7CA 2VK9A 5AQPB 3JC6D 3JAEA 3SWHA 3B13A 4YFSA 2VWAA 4X66T 2E2AA 2DI4A 2LJLA 2BG9B 3ETVA 1KNRA 3CX8B 3ZT7A 5HCJA 2LM9A 3ZSSA 3SFEA 4YTMA 4EEBA 4BJMA 3AE4A 4IE0A 4DNDA 2ZM6T 3KBTA 1UURA 5AFUL 3H37A 1T98A 1FEWA 2JMKA 4JI5T 5AQFB 3AA1B 4H9OC 4NXMT 3RIUC 1CHUA 3AEFA 3L09A 1E7PA 4Z90A 4UV8B 4I0UA 4ERRA 2XM1A 4IL9A 3C51A 4XBFB 5LBMA 4JI1T 5JRCB 2ZLYA 3LDQB 4UF0B 3I9YA 3H3MA 2BG9C 2DLRA 2XQ4A 2UUAT 3N9PA 3CX6B 2LLYA 3AEDA 5KX5E 2YEVC 4EYYR 4O2BE 4CN4A 2XSAA 2VL0A 2J1DG 4TWHA 2RP4A 4Z8XA 5AQTB 2BZBA 5FKYA 1QLBA 5JVDE 2W62A 2WU5A 3PJAA 4DR1T 4CQIA 2LSGA 3ABVA 1US7B 2J47A 4IIJE 1NWMX 3QC9A 2NTYA 4ZEYA 2VASA 2WZIA 1XMOT 3HL6A 3UULA 3HI2A 1ZKEA 2BKOA 1Y01A 3TLTA 4L9IA 4E7SA 4U7IA 5HEUA 2EHOA 4AKIA 2N1GA 3K3OA 1D1BA 2QRXA 2NW7A 3GA8A 3OYZA 2ODVA 3L3PA 4I4TE 1KNPA 2JQHA 2B1EA 1UCUA 4PFOA 5LB7B 4GYSA 1XDOA 3B57A 4A98A 4DMWA 2YDQA 3A5XA 3QNUA 4PJLA 4YTPA 4MFRA 2LRLA 4AISA 3HKBE 4IREA 3FZFB 4CXXA 5LCYA 2WAUA 3IBPA 4E7ZA 1HTJF 2WSSV 4J2CA 4WBOA 4YJ3E 5IHYA 2D2SA 4B6XA 2QGSA 4EZHA 4DR4T 2X68A 3AEAA 2IIUA 4X1IE 1FJGT 4DUYT 1WR0A 1HR0T 2F4VT 2AXDS 2LSJA 2VQFT 4QH4A 4CN6A 5J0ZA 1FMVA 4DR7T 2DNXA 4U31A 2ZM2A 4FJOA 2PFVA 4HKAA 3EI0A 5LG3A 2BBJA 3L39A 5JRCA 3AEGA 4H9PC 4PW8A 4UF0A 3MK7C 4FI5A 3E0ZA 2CRBA 2XY8B 4HN9A 1WCRA 3CX7B 3MKDA 4IGUA 2M6BA 2W63A 2LHRA 4JI3T 1T8BA 3DP7A 3OYXA 2V7JA 1T7SA 4P1NA 3VKHA 3ZLIA 4B3TT 4DR5T 4X62T 3BQIA 2JMHA 3EDVA 5JH7E 3T1YT 1WLXA 2E9XC 4ILUA 4QXHB 2RA1A 1N34T 5ABFB 2FJBA 2WP9A 5HYAA 4JI7T 2W61A 4L0RA 5LMUT 2UU9T 4QWNB 2D9DA 5AQVB 2WCAA 3EABA 4U3CA 3NRYA 2CXLA 1W9RA 1VRBA 4IT4A 3PUYF 5BR8T 2CXDA 4KMCA 3RKOA 4ILBA 1KFYA 2MBGA 4JI0T 2CXFA 3NZPA 5DJQC 5LMNT 3UQ7A 4DO0A 1LVKA 4KHZF 5JDLA 3M3ZB 4UR9A 5JTGA 4X5TA 4DUZT 2H7OA 4ZZCA 1CUNA 3AA7B 4IDOA 4DV2T 3KINB 3MJXA 3OBVE 3ONLC 4IE5A 1D1AA 1IBKT 4BAYB 1V9DA 1MMAA 3OTOT 5GONE 2LSYA 3QB5K 1N36T 5H6RB 3WAKA 2V6XA 4QX8B 4YXDA 3Q2MA 1UK5A 4WNKA 2OV9A 3RLFF 2FJAA 4GK0E 4WYVA 3UUMA 3LK3B 2DL1A 1ZV4X 3AECA 4DR2T 2K48A 3CQXC 3RYHE 4CI1B 3RH3A 2NWBA 2YU2A 3UU5A 4JEUB 3LK42 5JDMA 5L3CB 2MTQA 2WY2A 4TX5A 2ACXA 2AE9A 4JUYA 5HWXA 4O4HE 2G0UA 5JQGE 2PG8A 1M62A 2PTFA 2HN2A 2H89A 2RPAA 4QXCB 3VR9A 5C8YE 2C5IT 3ZCJA 3RQUA 2C5KT 2YOEA 1XMQT 1WFDA 5CJ5A 1UGOA 3UFGA 3UU4A 1HNXT 4GKKT 2A2FX 3JC6C 1HX1B 4HFHA 4JI4T 2UXXB 4UIGA 4GKJT 4U7YA 3CIRA 5KMGP 1NAFA 4YT0A 5EK3A 4XZCA 2V6YA 4KHPT 4O4LE 2K24A 4IDQA 3TLSA 2QVAA 5L3GB 2LOPA 2NR4A 3PU8A 2CM0A 1OWAA 3KDSE 3P50A 2CLYB 4H9QC 4NXNT 1YQ4A 4CI3B 4O4JE 5IUXA 2CCQA 3CK6A 3N9QA 2XPKA 4AI6A 3IF8B 2XUEA 2N2NA 3O4XE 4UELA 2VKOA 1DU2A 4P09A 4TUYE 3J9X1 2K3WA 4MBQA 3JAFA 1IJ6A 2EHOB 3G06A 3MXZA 2M67A 2IDOB 3PU3A 5AQIB 4X1YE 3PUVF 2CLYC 1WRDA 3NVOA 4UXNB 1HG5A 4YSZA 2KINB 2LKHA 4U2ZA 1KK7A 4IDNA 3BQKA 1XNRT 1YD8G 2LKGA 2X9WA 3F31A 4IE6A 5HXRA 5AQSB 3FXEB 5AQQB 2P9BA 5HWYA 2VB6A 3BK9A 5FP3A 4HWIB 4HWDA 4X1KE 2WDQA 1J1JA 5ADXL 3KVBA 2WDVA 3RKGA 4KBMB 4BJNA 5L4EA 4QX7B 1SHZC 3PUZF 1JNRA 5CFBA 4N78D 2X9YA 4PFPA 3H3AA 2CE7A 2LE8A 3RHWA 3RQWA 1YKHB 3I9WA 1UUSA 4WW0A 3HKDE 5F8PA 3RC3A 2DCFA 5LP6E 4HFVA 3NBXX 1OEDE 4GIWA 4CXYA 3L8RA 2LHNA 2MAWA 2D0TA 3P4RA 2XASB 3B5MA 2ODUA 2JIWA 4KP3C 3U78A 3U3IA 1G73A 1KNZA 3AE5A 2B76A 1D0XA 4JEHB 5KXJA 5HXSA 3K3NA 2XQAA 2XM2A 4YTNA 1T72A 2DWGA 2V7IA 4EOZB 3PDYA 4JYAT 4ANJA 4ZS2A 4UVCB 5JDQA 4EV6A 1ZP0A 2V1DB 1HG2A 2BVLA 4AKLA 4G63A 3K1SA 5L2LA 2X9XA 2EHOD 1J5WA 4TZ4C 4HFCA 2W4XA 3RYCE 4NUUA 1NEKA 2HHHT 5FY1A 4HWCA 5AQJB 4DVDA 2YDRA 3AXJA 3V5SA 3N9LA 4B3MT 2Y6XA 3QK6A 4EIWA 2X9HA 4LFBT 3ZYKA 4GK5E 4JI8T 4AKRB 2H88A 1X79A 3EVYA 2XQ7A 3UFEA 2MPKA 2V7MA 3ZN0B 2FJEA 4ZOLE 5CA0E 5CGMA 5LBQB 1GQEA 1QSDA 3GWHA 4LF5T 2W66A 2XTLA 4ZI3D 4CI2B 3EAMA 4DV1T 3PUSA 2MOZA 5FNVE 3TLWA 1W09A 4C90A 2LEHA 4PJMA 2E5VA 3PUQA 2L3LA 1OXZA 5JREA 1XDPA 2YK0A 1JNZA 4NPPA 3GMIA 4QH1A 4LF7T 3D0TA 3ONJA 3M65A 3LSVA 1HNZT 3R6NA 1MNDA 4JBWF 3TKLB 5LOVE 5FL0A 3OVUA 3FHNA 1SE7A 3IHRA 3RC8A 4HFIA 1L0VA 4HWHA 5FY0A 3KVAA 3PUGA 4OYKA 5F3JA 3UU6A 5JDNA 4ZS3A 2CEAA 4EB6E 1N33T 4DV0T 1S94A 2V6YB 4AQFA 2Q9QB 4DMVA 2UXCT 4ZI2D 2IAKA 2MYSA 5FL1A 5HEJA 4O4IE 2CBJA 5ABHA 4EYUA 3EHZA 3LFMA 4JV5T 3AVRA 3HKEE 2JQ9A 4CXWA 5HEHA 3UUBA 3T8OA 3BQLA 3EDUA 1MMGA 3N9MA 3PUWF 4A97A 1KEYA 1ZOYA 4UVAB 2Y48B 3RIAA 2YKSA 2LSKA 3I0QA 3ZCIA 3QUJA 5E0OA 3FZLB 4H9SE 4EZ4A 2QA7A 2V5CA 2PJQA 1HNWT 3KV9A 4TNVA 5FMNA 4YHHT 3ZMZB 3FZKB 1S35A 5IWAT 5J2TE 4ISTA 2XAGB 2WS3A 3PE0A 2XQ6A 4QHOA 1R8IA 5AQMB 2VVSA 3R84B 3ZT6A 4HTEA 4LF8T 5HCMA 2V7KA 5HAXA 2N9DA 4DV7T 2SPCA 1OEDB 3VU7H 4PJNA 4OFZA 5LHIB 2YU1A 4DV4T 2BDEA 5EK4A 5C2TA 3SFDA 3O1IA 2NP9A 2W2UA 3RI5A 1QUUA 3FZHB 3AE6A 1MMNA 5HEGA 3A8YC 1FIOA 2X0HA 3ZC0A 4ZZBA 5HXCA 2KSRA 5ABGA 2KWHA 3N9NA 1LVFA 3P4WA 3KV4A 4DV3T 4ILCA 2CPTA 1M7KA 5AQRB 3Q5DA 5EZYE 4DBRA 4IDPA 3AEBA 4JI2T 4AKHA 1W0BA 2CWYA 4PAGA 4HFDA 2ZM8A 3IEEA 4LF9T 3SS1A 2ES0A 3AA0B 4O8SA 2BBHA 1HFAA 5HXEA 1Z8UA 2Q9QA 2HN1A 2Q9QD 1MIYA 2H3RA 3T1HT 3K3QC 3UUXB 5LXTE 2LT3A 2YINA 4AQYT 3I0OA 3P4SA 3ZT5A 5A1LA 3OJAA 3C98B 4UV9B 1FMWA 3VRBA 1BR4A 5AQGB 4LF6T 2M6IA 4OYJA 3C64A 3HKCE 2CWOA 5L3FB 1X9BA 3LG7A 4EGWA 4ILAA 4KX6A 5JR9A 3RRCA 2D0UA 1BR1A 2A3DA 3P4QA 3F2EA 3ZJ1A 3J7Yq 5AQOB 3CWZB 3Q5XA 5J2UE 3X1DA 3UU8A 4K0UA 3LBXB 5FVLA 3N9OA 2W0GA 4AQGA 3AAAB 3FBLA 2NW9A 4K0KT 5L47A 5LJMA 3PUAA 2CMRA 3AXJB 4YHJA 2WWVA 2J62A 3PJAJ 4LFCT 4V1Av 3SRZA 4EEDA 3JCFA 5DQWA 4F8HA 4LMLA 5FY7A 2FJDA 2OA5A 1U4QA 1OEDA 2VVNA 2Z6EA 3O1HA 2UUCT 4COFA 4M1PA 2ZMAA 4I55E 1SA0E 2XQYA 4DR3T 2EHOC 3RF1A 5F5WA 2X67A 3N2GE 3ZPOA 3FZMB 1D0YA 2WB5A 5FVKA 2WMOA 4YSYA 1UX4A 5L4HA 2ACZA 2CHOA 1BR0A 4HWFA 2I6HA 1J5ET 3AB3B 3N2OA 2UUBT 4X65T 1KF6A 5KDMC 4TV9E 5AQUB 2XQ3A 3N2KE 2I59A 2C5JA 2LSIA 3ESLA 3TLUA 5L3EB 2A72A 3ZSTA 4DIDB 4L5GA 4QH5A 2X51A 4MLKA 4PK6A 2JQQA 1D1CA 4MHCA 2VL8A 5HEOA 4YY3T 1IAPA 2WQYA 4B3ST 4YSXA 3Q9DA 1ZEEA 3QB5A 4U2YA 4YLHA 1I6ZA 4OHFA 1VCTA 3PV0F 3AA6B 3RX6A 2CBIA 4ZI3C 4LMJA 3VKGA 5EK2A 3AEEA 4H63V 3CVRA 2XAHB 3MA9A 2PBIA 5L3DB 5J1GA 1XZYA 4NIQA 1O3XA 3ZEFB 3AE9A 2DWKA 5LA6E 3V5UA 2UXNB 5FXWA 4F6RC 2J4GA 1WYCA 1VOMA 1NENA 2CA5A 2LRKA 3LBXA 4I50E 1I94T 4EXTA 3GN5B 2WDRA 1HS7A 2XQ9A 3S4UA 1WR6A 4C91A 2OLTA 4HEAA 4OK0A 3DJBA 2HH7A 2W67A 4EAHA 3P4PA 2KNDA 3AVSA 2H7VC 2LM2A 4I43B 3KBUA 2UXBT 4AQFC 4ZI2C 3E08A 3NRXA 4IHJE 4GYRA 2KZ7B 3RYIE 5FXZA 3ONXA 4H63H 2BS4A 1HCIA 5JDGA 2NW8A 3RIUA 3ZMSB 5DQVA 3CKDA 2W00A 3N5LA 3VR8A 3C4XA 3ZKRA 4PNIA 3UU3A 3NZQA 3E22E 3IA3A 5LGNB 3LJCA 4X20E 2YDSA 3KFWX 4IDZA 3WI3A 1HX8A 2UXDT 3F57A 5HXHA 2BG9A 1IBLT 1E1HB 5LNKA 3ANWB 2QYWA 4UVBB 2A9UA 2L9QA 1XWMA 4IE4A 1IBMT 1LKXA 4ADZA 2DHRA 3UTKA 1W0AA 4U74A 3Q5WA 2XZEA 2X66A 3C4WA 4PJJA 2BS2A 2JQKA 2XAFB 1VCSA 2D5UA 2E9XB 3I1AA 3ZYLA 5AQKB 3UQ4A 1HF8A 3RIFA 3PURA 1AJ3A 3AE1A 2KXPB 4JLEA 2K9AA 2IC6A 4Q25A 5LGUB 4NUVA 4DV6T 2V8SV 4MALA 3ZYMA 4WZXA 5FYMA 2HPLA 4JI6T 2BG9E 3VHLA 3ZC1A 2WBLA 3RPUA 5JDHA 2FUPA 3ZMUB 1SUMB 2V5DA 3CMLA 2X0LB 1YKEB 4IE7A 4ISSA 3MZKB 3KV5A 4A56A 1IJ5A 3HR0A 3GN5A 4ASKA 3O1JA 1IZNB 4IL4A 2LOSA 5BMVE 1Z0PA 1XNQT 3ZMVB 5JR9B 5L3BB 3JADA 4OX9T 5LGTB 2WWUA 4P0AA 1ZHCA 1YQ3A 4CZZB 1Y64B 2NOXA 2IHR1 2V26A 5H6QB 5DABA 2Q9QC 3AAIA 5JDFA 1U5PA 2E8IA 4ZI7E 3NKZA 3SOLA 5LG4A 4X64T 5AQLB 3DTOA 1MIWA 3VRAA 2JRKA 4TN7B 5CB4E 2VKJA 4QKNA 4DV5T 3UT5E 3ZN1B 2VKHA 2WU2A 3CQCB 2VURA 4KUMB 2HPJA 3FB2A 3QOFA 5C3JA 5JR9C 2YN6A 2ZM0A 2IMLA 4U33A 2WMNA 3FBZA 4G2AA 2XQ5A 3ANWA 4ZHQE 3ZMTB 4GOUA 1WYBA 3ZJ2A 3K8PC 2KT9A 3Q5EA 2R6GF 4KI0F 5LJNA 3O9XA 2E5LT 4LMKA 1MIVA 2JPFA 3TLVA 2E9XA 3MACA 5AQHB 2E9XD 5M4YA 4QXBB 4LF4T 1N32T 2I0MA 4WBNE 3WAJA 2XAJB 4CN1A 4HFEA 2C0SA 1OEDC 3EUHA 2IW5B 2XSBA 4H9NC 1YXRA 4ZXLA 1BR2A 2BKPA 5LHHB 5ABEA 3RYFE 3UUNA 4HE8A 4UEMA 3C50A 5AQNB 2IC9A 3P7IA 1MMDA
chains in the Genus database with same CATH topology
3NRYA 3AB3B 3C4ZA 3N2OA 2CXLA 4AKRB 1X79A 4H9RC 3EVYA 4PK5A 3UFEA 4TV8E 1VRBA 3ZN0B 2V7MA 5KDMC 5LYJE 5LHGB 2BVMA 4TV9E 3N2KE 2KWIB 2I59A 2C5JA 2LSIA 3ESLA 4ZOLE 5CA0E 5L3EB 2CXDA 4KMCA 5LBQB 3RKOA 1YW0A 5CA1E 2A72A 2MBGA 1G8XA 2GK9A 2CXFA 3NZPA 4L5GA 1QSDA 5DJQC 2X51A 4MLKA 4PK6A 2JQQA 3GWHA 1D1CA 2Y8DA 4MHCA 2VL8A 4DO0A 1LVKA 3LK2B 5JDLA 3FXDB 3CPZA 1IAPA 2XTLA 3Q9DA 4ZI3D 4CI2B 1ZEEA 3HA4A 3PUSA 2MOZA 4YLHA 5FNVE 4OHFA 2H7OA 3KV6A 4C90A 2LEHA 1CUNA 3AA7B 4U72A 3AA6B 3RX6A 4PJMA 3RRWA 1UX5A 4ZI3C 3PUQA 3KINB 1D0ZA 2L3LA 1OXZA 3CQGB 5EK2A 5JREA 3VKGA 2YK0A 3MJXA 3OBVE 4H63V 4IE5A 1D1AA 3GMIA 4AKGA 4YJ2E 3CVRA 4BAYB 1V9DA 1MMAA 2XAHB 3D0TA 2LSYA 5GONE 3M65A 2XAQB 2PBIA 3MA9A 5TAOA 5L3DB 5J1GA 3W15B 4AXPA 5H6RB 2K5BB 2L8KA 4P0BA 3WAKA 1EZ3A 1LRZA 1O3XA 4O2AE 3R6NA 4BA9A 3ZEFB 4HGAA 4QX8B 3Q2MA 3OKQA 1MNDA 2DWKA 4WNKA 5LA6E 2NTXA 3TKLB 3V5UA 2UXNB 5LOVE 4DBQA 3FHNA 5FXWA 3IHRA 4GK0E 4F6RC 3UUMA 2WM9A 3LK3B 5FXXA 1WYCA 3ETUA 4PK4A 1VOMA 3RC8A 5IYZE 3P8CD 1ZV4X 2CA5A 2K48A 1MNEA 2KMFA 3CQXC 3RYHE 3LBXA 4I50E 2VKDA 2JJ9A 4EXTA 4CI1B 5FY0A 3KVAA 3PUGA 4OYKA 2NWBA 2KLQA 2YU2A 3RH3A 3PTRB 3GN5B 5FXVA 5F3JA 5JDNA 5ETWA 4JEUB 1HS7A 3LK42 5JDMA 2XHEB 4ZS3A 3S4UA 5L3CB 2CEAA 1WR6A 2MTQA 4TX5A 4C91A 4EB6E 1B7TA 2ACXA 4HEAA 4OK0A 1S94A 3DJBA 4AQFA 2Q9QB 4JUYA 4DMVA 3AAEB 5HWXA 2V7LA 4O4HE 2G0UA 2HH7A 4XAXB 5JQGE 4ZI2D 2PG8A 2IAKA 2MYSA 4EAHA 2KNDA 4O4IE 3AVSA 2H7VC 1H7CA 4QXCB 2VK9A 5C8YE 4EYUA 3JC6D 4I43B 3KBUA 2C5IT 4AQFC 3ZCJA 3SWHA 3LFMA 3B13A 3E08A 4YFSA 2VWAA 4ZI2C 3AVRA 2C5KT 3NRXA 4IHJE 4GYRA 3HKEE 2DI4A 2LJLA 4CXWA 2KZ7B 2A2FX 3JC6C 3ETVA 3RYIE 3CX8B 3T8OA 5FXZA 3BQLA 3ONXA 2UXXB 2LM9A 4H63H 4UIGA 1HCIA 5JDGA 5KMGP 1NAFA 2NW8A 3EDUA 4BJMA 1MMGA 1BR0A 3N9MA 3ZMSB 5DQVA 4IE0A 3CKDA 5EK3A 2W00A 3N5LA 4XZCA 4DNDA 3KBTA 4O4LE 2K24A 3C4XA 5AFUL 3H37A 4UVAB 4PNIA 2Y48B 3NZQA 3E22E 1T98A 1FEWA 5L3GB 2JMKA 5LGNB 2LSKA 3I0QA 3LJCA 2LOPA 3AA1B 3PU8A 3ZCIA 4H9OC 2CM0A 4X20E 3QUJA 5E0OA 1OWAA 3KFWX 4IDZA 4H9SE 3WI3A 1HX8A 4EZ4A 3KDSE 2QA7A 3L09A 3F57A 5HXHA 2CLYB 4H9QC 4UV8B 4ERRA 1E1HB 3C51A 5LNKA 2PJQA 3ANWB 4XBFB 4CI3B 5LBMA 4O4JE 3KV9A 2CCQA 5JRCB 4UVBB 5FMNA 3N9QA 2ZLYA 3ZMZB 1S35A 4AI6A 2L9QA 5J2TE 3IF8B 4IE4A 4UF0B 3I9YA 2DLRA 4ISTA 1LKXA 4ADZA 2XUEA 2DHRA 3N9PA 2XAGB 3UTKA 3CX6B 2N2NA 3PE0A 3O4XE 4UELA 4QHOA 4U74A 5KX5E 3Q5WA 2X66A 2YEVC 3C4WA 4O2BE 4EYYR 4PJJA 3R84B 2VKOA 4HTEA 4P09A 4TUYE 2XAFB 3J9X1 2V7KA 4MBQA 5HAXA 2J1DG 2N9DA 2D5UA 2E9XB 3I1AA 2RP4A 1IJ6A 2SPCA 2EHOB 3VU7H 3MXZA 4OFZA 4PJNA 3ZYLA 2M67A 5LHIB 1HF8A 4Z8XA 3PU3A 3PURA 2BZBA 2YU1A 1AJ3A 2BDEA 4X1YE 2KXPB 5JVDE 5EK4A 2CLYC 2W62A 1WRDA 3O1IA 1HG5A 2NP9A 4JLEA 2K9AA 2IC6A 4UXNB 1QUUA 5LGUB 4NUVA 4MALA 3ZYMA 2KINB 5FYMA 4CQIA 1MMNA 2LSGA 1KK7A 1FIOA 1US7B 3ZYKA 4IIJE 1NWMX 3QC9A 3ZC0A 2HPLA 2NTYA 3BQKA 2VASA 5HXCA 3VHLA 3HL6A 3UULA 2KWHA 3N9NA 3HI2A 1LVFA 1ZKEA 2WBLA 3ZC1A 4L9IA 3KV4A 3RPUA 5JDHA 4E7SA 3ZMUB 1YD8G 3CMLA 2X9WA 2EHOA 4AKIA 2N1GA 3K3OA 2X0LB 1D1BA 1YKEB 5EZYE 4DBRA 2NW7A 3F31A 4IE6A 4IE7A 4ISSA 4AKHA 3GA8A 3MZKB 3OYZA 3FXEB 5HXRA 2CWYA 4PAGA 2ODVA 3L3PA 2ZM8A 3IEEA 3KV5A 4A56A 1IJ5A 3HR0A 3GN5A 4ASKA 3SS1A 2P9BA 3O1JA 5HWYA 1IZNB 2ES0A 2VB6A 3AA0B 2LOSA 3BK9A 2B1EA 4I4TE 4O8SA 5FP3A 5BMVE 1UCUA 1Z0PA 1HFAA 4PFOA 3ZMVB 5HXEA 5JR9B 4GYSA 3B57A 2Q9QA 5L3BB 4DMWA 4X1KE 2Q9QD 3A5XA 5ADXL 4PJLA 3KVBA 4MFRA 5LGTB 1MIYA 2WWUA 2H3RA 1ZHCA 4P0AA 3HKBE 4CZZB 3K3QC 1Y64B 3UUXB 2NOXA 2V26A 5H6QB 2YINA 2LT3A 5LXTE 5DABA 2Q9QC 3AAIA 3I0OA 5JDFA 1U5PA 5A1LA 4KBMB 2E8IA 3OJAA 4BJNA 4ZI7E 3C98B 4QX7B 4UV9B 1SHZC 3SOLA 4CXXA 5LCYA 5LG4A 1FMWA 2WAUA 3DTOA 3IBPA 4N78D 1BR4A 4E7ZA 1MIWA 1HTJF 2X9YA 4PFPA 2JRKA 2WSSV 3H3AA 2CE7A 4J2CA 4OYJA 4TN7B 2LE8A 5CB4E 3C64A 3HKCE 2CWOA 5L3FB 4WBOA 3LG7A 1YKHB 2VKJA 3I9WA 4YJ3E 4WW0A 5JR9A 3HKDE 3RRCA 5IHYA 4QKNA 5F8PA 2DCFA 3RC3A 4HFVA 5LP6E 2D0UA 2D2SA 3NBXX 4B6XA 1BR1A 2QGSA 3UT5E 3ZN1B 2VKHA 2A3DA 3CQCB 4GIWA 4EZHA 3F2EA 2X68A 4CXYA 3ZJ1A 3J7Yq 4KUMB 4X1IE 2HPJA 3CWZB 3FB2A 3Q5XA 5J2UE 2LHNA 2D0TA 5JR9C 2XASB 2ZM0A 2ODUA 4KP3C 3U78A 4K0UA 3U3IA 3LBXB 2LSJA 1G73A 2WMNA 3FBZA 1KNZA 3N9OA 1D0XA 1FMVA 4JEHB 2DNXA 4G2AA 2W0GA 3ANWA 2ZM2A 4FJOA 2PFVA 4ZHQE 4HKAA 5HXSA 3K3NA 3ZMTB 5JRCA 4GOUA 4AQGA 4H9PC 3AAAB 1WYBA 3ZJ2A 2DWGA 4PW8A 2V7IA 4EOZB 3K8PC 2KT9A 3FBLA 2NW9A 3PDYA 4UF0A 3MK7C 4ANJA 5LJMA 5LJNA 3O9XA 3PUAA 2CMRA 4ZS2A 4FI5A 4YHJA 3E0ZA 4UVCB 4HN9A 5JDQA 1MIVA 4V1Av 2V1DB 2JPFA 1HG2A 3CX7B 3MKDA 3SRZA 2BVLA 4IGUA 4AKLA 5DQWA 2W63A 5FY7A 4G63A 2LHRA 2E9XA 2OA5A 5L2LA 3MACA 2X9XA 1U4QA 2E9XD 3DP7A 2Z6EA 3O1HA 3OYXA 5M4YA 2EHOD 4QXBB 4TZ4C 2V7JA 4M1PA 3VKHA 3ZLIA 2ZMAA 4I55E 1SA0E 3RYCE 4WBNE 3BQIA 4NUUA 2JMHA 3EDVA 5JH7E 3WAJA 1WLXA 2E9XC 2XAJB 2XQYA 5FY1A 2C0SA 4ILUA 2EHOC 4QXHB 3EUHA 2IW5B 4DVDA 2RA1A 4H9NC 1BR2A 3V5SA 2X67A 3N2GE 3ZPOA 3N9LA 5HYAA 5LHHB 3RYFE 2Y6XA 1D0YA 3QK6A 4EIWA 2W61A 2WMOA 4L0RA 3UUNA 1UX4A 4HE8A 3C50A 4UEMA 4QWNB 2X9HA 2IC9A 3P7IA 4GK5E 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R C;  4H9S E;  4H9N C;  4H9P C;  4H9Q C;  4H9O C;  4HGA A;  5KDM C; 
#chains in the Genus database with same CATH topology
 2XQ8 A;  3C4Z A;  4TNW A;  4H9R C;  4PK5 A;  4TV8 E;  5LYJ E;  5LHG B;  2BVM A;  4TWF A;  2KWI B;  2VQE T;  1YW0 A;  5CA1 E;  2WZH A;  4B3R T;  1G8X A;  2GK9 A;  5ABF A;  2Y8D A;  3LK2 B;  4TWD A;  3FXD B;  3CPZ A;  4A5X A;  3AE2 A;  3HA4 A;  4Z91 A;  4HFB A;  3KV6 A;  4U72 A;  3RRW A;  1UX5 A;  1D0Z A;  3CQG B;  4AIU A;  3AE3 A;  4AKG A;  4YJ2 E;  2BS3 A;  3RGL A;  3AE8 A;  5TAO A;  2XAQ B;  3W15 B;  4AXP A;  2X0Y A;  2K5B B;  2L8K A;  4P0B A;  1EZ3 A;  1LRZ A;  4O2A E;  4BA9 A;  4HGA A;  3OKQ A;  2IUB A;  3NWI A;  2NTX A;  3AE7 A;  2FBW A;  1E2A A;  4DBQ A;  2WM9 A;  5FXX A;  2BKN A;  3ETU A;  4PK4 A;  5IYZ E;  3P8C D;  3OPC A;  1MNE A;  2KMF A;  2VKD A;  2JJ9 A;  2KLQ A;  3PTR B;  5FXV A;  4LFA T;  5ETW A;  3A7M A;  2XHE B;  2CHN A;  2XJ7 A;  1B7T A;  3PUX F;  3AAE B;  2V7L A;  4XAX B;  4DR6 T;  1H7C A;  2VK9 A;  5AQP B;  3JC6 D;  3JAE A;  3SWH A;  3B13 A;  4YFS A;  2VWA A;  4X66 T;  2E2A A;  2DI4 A;  2LJL A;  2BG9 B;  3ETV A;  1KNR A;  3CX8 B;  3ZT7 A;  5HCJ A;  2LM9 A;  3ZSS A;  3SFE A;  4YTM A;  4EEB A;  4BJM A;  3AE4 A;  4IE0 A;  4DND A;  2ZM6 T;  3KBT A;  1UUR A;  5AFU L;  3H37 A;  1T98 A;  1FEW A;  2JMK A;  4JI5 T;  5AQF B;  3AA1 B;  4H9O C;  4NXM T;  3RIU C;  1CHU A;  3AEF A;  3L09 A;  1E7P A;  4Z90 A;  4UV8 B;  4I0U A;  4ERR A;  2XM1 A;  4IL9 A;  3C51 A;  4XBF B;  5LBM A;  4JI1 T;  5JRC B;  2ZLY A;  3LDQ B;  4UF0 B;  3I9Y A;  3H3M A;  2BG9 C;  2DLR A;  2XQ4 A;  2UUA T;  3N9P A;  3CX6 B;  2LLY A;  3AED A;  5KX5 E;  2YEV C;  4EYY R;  4O2B E;  4CN4 A;  2XSA A;  2VL0 A;  2J1D G;  4TWH A;  2RP4 A;  4Z8X A;  5AQT B;  2BZB A;  5FKY A;  1QLB A;  5JVD E;  2W62 A;  2WU5 A;  3PJA A;  4DR1 T;  4CQI A;  2LSG A;  3ABV A;  1US7 B;  2J47 A;  4IIJ E;  1NWM X;  3QC9 A;  2NTY A;  4ZEY A;  2VAS A;  2WZI A;  1XMO T;  3HL6 A;  3UUL A;  3HI2 A;  1ZKE A;  2BKO A;  1Y01 A;  3TLT A;  4L9I A;  4E7S A;  4U7I A;  5HEU A;  2EHO A;  4AKI A;  2N1G A;  3K3O A;  1D1B A;  2QRX A;  2NW7 A;  3GA8 A;  3OYZ A;  2ODV A;  3L3P A;  4I4T E;  1KNP A;  2JQH A;  2B1E A;  1UCU A;  4PFO A;  5LB7 B;  4GYS A;  1XDO A;  3B57 A;  4A98 A;  4DMW A;  2YDQ A;  3A5X A;  3QNU A;  4PJL A;  4YTP A;  4MFR A;  2LRL A;  4AIS A;  3HKB E;  4IRE A;  3FZF B;  4CXX A;  5LCY A;  2WAU A;  3IBP A;  4E7Z A;  1HTJ F;  2WSS V;  4J2C A;  4WBO A;  4YJ3 E;  5IHY A;  2D2S A;  4B6X A;  2QGS A;  4EZH A;  4DR4 T;  2X68 A;  3AEA A;  2IIU A;  4X1I E;  1FJG T;  4DUY T;  1WR0 A;  1HR0 T;  2F4V T;  2AXD S;  2LSJ A;  2VQF T;  4QH4 A;  4CN6 A;  5J0Z A;  1FMV A;  4DR7 T;  2DNX A;  4U31 A;  2ZM2 A;  4FJO A;  2PFV A;  4HKA A;  3EI0 A;  5LG3 A;  2BBJ A;  3L39 A;  5JRC A;  3AEG A;  4H9P C;  4PW8 A;  4UF0 A;  3MK7 C;  4FI5 A;  3E0Z A;  2CRB A;  2XY8 B;  4HN9 A;  1WCR A;  3CX7 B;  3MKD A;  4IGU A;  2M6B A;  2W63 A;  2LHR A;  4JI3 T;  1T8B A;  3DP7 A;  3OYX A;  2V7J A;  1T7S A;  4P1N A;  3VKH A;  3ZLI A;  4B3T T;  4DR5 T;  4X62 T;  3BQI A;  2JMH A;  3EDV A;  5JH7 E;  3T1Y T;  1WLX A;  2E9X C;  4ILU A;  4QXH B;  2RA1 A;  1N34 T;  5ABF B;  2FJB A;  2WP9 A;  5HYA A;  4JI7 T;  2W61 A;  4L0R A;  5LMU T;  2UU9 T;  4QWN B;  2D9D A;  5AQV B;  2WCA A;  3EAB A;  4U3C A;  3NRY A;  2CXL A;  1W9R A;  1VRB A;  4IT4 A;  3PUY F;  5BR8 T;  2CXD A;  4KMC A;  3RKO A;  4ILB A;  1KFY A;  2MBG A;  4JI0 T;  2CXF A;  3NZP A;  5DJQ C;  5LMN T;  3UQ7 A;  4DO0 A;  1LVK A;  4KHZ F;  5JDL A;  3M3Z B;  4UR9 A;  5JTG A;  4X5T A;  4DUZ T;  2H7O A;  4ZZC A;  1CUN A;  3AA7 B;  4IDO A;  4DV2 T;  3KIN B;  3MJX A;  3OBV E;  3ONL C;  4IE5 A;  1D1A A;  1IBK T;  4BAY B;  1V9D A;  1MMA A;  3OTO T;  5GON E;  2LSY A;  3QB5 K;  1N36 T;  5H6R B;  3WAK A;  2V6X A;  4QX8 B;  4YXD A;  3Q2M A;  1UK5 A;  4WNK A;  2OV9 A;  3RLF F;  2FJA A;  4GK0 E;  4WYV A;  3UUM A;  3LK3 B;  2DL1 A;  1ZV4 X;  3AEC A;  4DR2 T;  2K48 A;  3CQX C;  3RYH E;  4CI1 B;  3RH3 A;  2NWB A;  2YU2 A;  3UU5 A;  4JEU B;  3LK4 2;  5JDM A;  5L3C B;  2MTQ A;  2WY2 A;  4TX5 A;  2ACX A;  2AE9 A;  4JUY A;  5HWX A;  4O4H E;  2G0U A;  5JQG E;  2PG8 A;  1M62 A;  2PTF A;  2HN2 A;  2H89 A;  2RPA A;  4QXC B;  3VR9 A;  5C8Y E;  2C5I T;  3ZCJ A;  3RQU A;  2C5K T;  2YOE A;  1XMQ T;  1WFD A;  5CJ5 A;  1UGO A;  3UFG A;  3UU4 A;  1HNX T;  4GKK T;  2A2F X;  3JC6 C;  1HX1 B;  4HFH A;  4JI4 T;  2UXX B;  4UIG A;  4GKJ T;  4U7Y A;  3CIR A;  5KMG P;  1NAF A;  4YT0 A;  5EK3 A;  4XZC A;  2V6Y A;  4KHP T;  4O4L E;  2K24 A;  4IDQ A;  3TLS A;  2QVA A;  5L3G B;  2LOP A;  2NR4 A;  3PU8 A;  2CM0 A;  1OWA A;  3KDS E;  3P50 A;  2CLY B;  4H9Q C;  4NXN T;  1YQ4 A;  4CI3 B;  4O4J E;  5IUX A;  2CCQ A;  3CK6 A;  3N9Q A;  2XPK A;  4AI6 A;  3IF8 B;  2XUE A;  2N2N A;  3O4X E;  4UEL A;  2VKO A;  1DU2 A;  4P09 A;  4TUY E;  3J9X 1;  2K3W A;  4MBQ A;  3JAF A;  1IJ6 A;  2EHO B;  3G06 A;  3MXZ A;  2M67 A;  2IDO B;  3PU3 A;  5AQI B;  4X1Y E;  3PUV F;  2CLY C;  1WRD A;  3NVO A;  4UXN B;  1HG5 A;  4YSZ A;  2KIN B;  2LKH A;  4U2Z A;  1KK7 A;  4IDN A;  3BQK A;  1XNR T;  1YD8 G;  2LKG A;  2X9W A;  3F31 A;  4IE6 A;  5HXR A;  5AQS B;  3FXE B;  5AQQ B;  2P9B A;  5HWY A;  2VB6 A;  3BK9 A;  5FP3 A;  4HWI B;  4HWD A;  4X1K E;  2WDQ A;  1J1J A;  5ADX L;  3KVB A;  2WDV A;  3RKG A;  4KBM B;  4BJN A;  5L4E A;  4QX7 B;  1SHZ C;  3PUZ F;  1JNR A;  5CFB A;  4N78 D;  2X9Y A;  4PFP A;  3H3A A;  2CE7 A;  2LE8 A;  3RHW A;  3RQW A;  1YKH B;  3I9W A;  1UUS A;  4WW0 A;  3HKD E;  5F8P A;  3RC3 A;  2DCF A;  5LP6 E;  4HFV A;  3NBX X;  1OED E;  4GIW A;  4CXY A;  3L8R A;  2LHN A;  2MAW A;  2D0T A;  3P4R A;  2XAS B;  3B5M A;  2ODU A;  2JIW A;  4KP3 C;  3U78 A;  3U3I A;  1G73 A;  1KNZ A;  3AE5 A;  2B76 A;  1D0X A;  4JEH B;  5KXJ A;  5HXS A;  3K3N A;  2XQA A;  2XM2 A;  4YTN A;  1T72 A;  2DWG A;  2V7I A;  4EOZ B;  3PDY A;  4JYA T;  4ANJ A;  4ZS2 A;  4UVC B;  5JDQ A;  4EV6 A;  1ZP0 A;  2V1D B;  1HG2 A;  2BVL A;  4AKL A;  4G63 A;  3K1S A;  5L2L A;  2X9X A;  2EHO D;  1J5W A;  4TZ4 C;  4HFC A;  2W4X A;  3RYC E;  4NUU A;  1NEK A;  2HHH T;  5FY1 A;  4HWC A;  5AQJ B;  4DVD A;  2YDR A;  3AXJ A;  3V5S A;  3N9L A;  4B3M T;  2Y6X A;  3QK6 A;  4EIW A;  2X9H A;  4LFB T;  3ZYK A;  4GK5 E;  4JI8 T;  4AKR B;  2H88 A;  1X79 A;  3EVY A;  2XQ7 A;  3UFE A;  2MPK A;  2V7M A;  3ZN0 B;  2FJE A;  4ZOL E;  5CA0 E;  5CGM A;  5LBQ B;  1GQE A;  1QSD A;  3GWH A;  4LF5 T;  2W66 A;  2XTL A;  4ZI3 D;  4CI2 B;  3EAM A;  4DV1 T;  3PUS A;  2MOZ A;  5FNV E;  3TLW A;  1W09 A;  4C90 A;  2LEH A;  4PJM A;  2E5V A;  3PUQ A;  2L3L A;  1OXZ A;  5JRE A;  1XDP A;  2YK0 A;  1JNZ A;  4NPP A;  3GMI A;  4QH1 A;  4LF7 T;  3D0T A;  3ONJ A;  3M65 A;  3LSV A;  1HNZ T;  3R6N A;  1MND A;  4JBW F;  3TKL B;  5LOV E;  5FL0 A;  3OVU A;  3FHN A;  1SE7 A;  3IHR A;  3RC8 A;  4HFI A;  1L0V A;  4HWH A;  5FY0 A;  3KVA A;  3PUG A;  4OYK A;  5F3J A;  3UU6 A;  5JDN A;  4ZS3 A;  2CEA A;  4EB6 E;  1N33 T;  4DV0 T;  1S94 A;  2V6Y B;  4AQF A;  2Q9Q B;  4DMV A;  2UXC T;  4ZI2 D;  2IAK A;  2MYS A;  5FL1 A;  5HEJ A;  4O4I E;  2CBJ A;  5ABH A;  4EYU A;  3EHZ A;  3LFM A;  4JV5 T;  3AVR A;  3HKE E;  2JQ9 A;  4CXW A;  5HEH A;  3UUB A;  3T8O A;  3BQL A;  3EDU A;  1MMG A;  3N9M A;  3PUW F;  4A97 A;  1KEY A;  1ZOY A;  4UVA B;  2Y48 B;  3RIA A;  2YKS A;  2LSK A;  3I0Q A;  3ZCI A;  3QUJ A;  5E0O A;  3FZL B;  4H9S E;  4EZ4 A;  2QA7 A;  2V5C A;  2PJQ A;  1HNW T;  3KV9 A;  4TNV A;  5FMN A;  4YHH T;  3ZMZ B;  3FZK B;  1S35 A;  5IWA T;  5J2T E;  4IST A;  2XAG B;  2WS3 A;  3PE0 A;  2XQ6 A;  4QHO A;  1R8I A;  5AQM B;  2VVS A;  3R84 B;  3ZT6 A;  4HTE A;  4LF8 T;  5HCM A;  2V7K A;  5HAX A;  2N9D A;  4DV7 T;  2SPC A;  1OED B;  3VU7 H;  4PJN A;  4OFZ A;  5LHI B;  2YU1 A;  4DV4 T;  2BDE A;  5EK4 A;  5C2T A;  3SFD A;  3O1I A;  2NP9 A;  2W2U A;  3RI5 A;  1QUU A;  3FZH B;  3AE6 A;  1MMN A;  5HEG A;  3A8Y C;  1FIO A;  2X0H A;  3ZC0 A;  4ZZB A;  5HXC A;  2KSR A;  5ABG A;  2KWH A;  3N9N A;  1LVF A;  3P4W A;  3KV4 A;  4DV3 T;  4ILC A;  2CPT A;  1M7K A;  5AQR B;  3Q5D A;  5EZY E;  4DBR A;  4IDP A;  3AEB A;  4JI2 T;  4AKH A;  1W0B A;  2CWY A;  4PAG A;  4HFD A;  2ZM8 A;  3IEE A;  4LF9 T;  3SS1 A;  2ES0 A;  3AA0 B;  4O8S A;  2BBH A;  1HFA A;  5HXE A;  1Z8U A;  2Q9Q A;  2HN1 A;  2Q9Q D;  1MIY A;  2H3R A;  3T1H T;  3K3Q C;  3UUX B;  5LXT E;  2LT3 A;  2YIN A;  4AQY T;  3I0O A;  3P4S A;  3ZT5 A;  5A1L A;  3OJA A;  3C98 B;  4UV9 B;  1FMW A;  3VRB A;  1BR4 A;  5AQG B;  4LF6 T;  2M6I A;  4OYJ A;  3C64 A;  3HKC E;  2CWO A;  5L3F B;  1X9B A;  3LG7 A;  4EGW A;  4ILA A;  4KX6 A;  5JR9 A;  3RRC A;  2D0U A;  1BR1 A;  2A3D A;  3P4Q A;  3F2E A;  3ZJ1 A;  3J7Y q;  5AQO B;  3CWZ B;  3Q5X A;  5J2U E;  3X1D A;  3UU8 A;  4K0U A;  3LBX B;  5FVL A;  3N9O A;  2W0G A;  4AQG A;  3AAA B;  3FBL A;  2NW9 A;  4K0K T;  5L47 A;  5LJM A;  3PUA A;  2CMR A;  3AXJ B;  4YHJ A;  2WWV A;  2J62 A;  3PJA J;  4LFC T;  4V1A v;  3SRZ A;  4EED A;  3JCF A;  5DQW A;  4F8H A;  4LML A;  5FY7 A;  2FJD A;  2OA5 A;  1U4Q A;  1OED A;  2VVN A;  2Z6E A;  3O1H A;  2UUC T;  4COF A;  4M1P A;  2ZMA A;  4I55 E;  1SA0 E;  2XQY A;  4DR3 T;  2EHO C;  3RF1 A;  5F5W A;  2X67 A;  3N2G E;  3ZPO A;  3FZM B;  1D0Y A;  2WB5 A;  5FVK A;  2WMO A;  4YSY A;  1UX4 A;  5L4H A;  2ACZ A;  2CHO A;  1BR0 A;  4HWF A;  2I6H A;  1J5E T;  3AB3 B;  3N2O A;  2UUB T;  4X65 T;  1KF6 A;  5KDM C;  4TV9 E;  5AQU B;  2XQ3 A;  3N2K E;  2I59 A;  2C5J A;  2LSI A;  3ESL A;  3TLU A;  5L3E B;  2A72 A;  3ZST A;  4DID B;  4L5G A;  4QH5 A;  2X51 A;  4MLK A;  4PK6 A;  2JQQ A;  1D1C A;  4MHC A;  2VL8 A;  5HEO A;  4YY3 T;  1IAP A;  2WQY A;  4B3S T;  4YSX A;  3Q9D A;  1ZEE A;  3QB5 A;  4U2Y A;  4YLH A;  1I6Z A;  4OHF A;  1VCT A;  3PV0 F;  3AA6 B;  3RX6 A;  2CBI A;  4ZI3 C;  4LMJ A;  3VKG A;  5EK2 A;  3AEE A;  4H63 V;  3CVR A;  2XAH B;  3MA9 A;  2PBI A;  5L3D B;  5J1G A;  1XZY A;  4NIQ A;  1O3X A;  3ZEF B;  3AE9 A;  2DWK A;  5LA6 E;  3V5U A;  2UXN B;  5FXW A;  4F6R C;  2J4G A;  1WYC A;  1VOM A;  1NEN A;  2CA5 A;  2LRK A;  3LBX A;  4I50 E;  1I94 T;  4EXT A;  3GN5 B;  2WDR A;  1HS7 A;  2XQ9 A;  3S4U A;  1WR6 A;  4C91 A;  2OLT A;  4HEA A;  4OK0 A;  3DJB A;  2HH7 A;  2W67 A;  4EAH A;  3P4P A;  2KND A;  3AVS A;  2H7V C;  2LM2 A;  4I43 B;  3KBU A;  2UXB T;  4AQF C;  4ZI2 C;  3E08 A;  3NRX A;  4IHJ E;  4GYR A;  2KZ7 B;  3RYI E;  5FXZ A;  3ONX A;  4H63 H;  2BS4 A;  1HCI A;  5JDG A;  2NW8 A;  3RIU A;  3ZMS B;  5DQV A;  3CKD A;  2W00 A;  3N5L A;  3VR8 A;  3C4X A;  3ZKR A;  4PNI A;  3UU3 A;  3NZQ A;  3E22 E;  3IA3 A;  5LGN B;  3LJC A;  4X20 E;  2YDS A;  3KFW X;  4IDZ A;  3WI3 A;  1HX8 A;  2UXD T;  3F57 A;  5HXH A;  2BG9 A;  1IBL T;  1E1H B;  5LNK A;  3ANW B;  2QYW A;  4UVB B;  2A9U A;  2L9Q A;  1XWM A;  4IE4 A;  1IBM T;  1LKX A;  4ADZ A;  2DHR A;  3UTK A;  1W0A A;  4U74 A;  3Q5W A;  2XZE A;  2X66 A;  3C4W A;  4PJJ A;  2BS2 A;  2JQK A;  2XAF B;  1VCS A;  2D5U A;  2E9X B;  3I1A A;  3ZYL A;  5AQK B;  3UQ4 A;  1HF8 A;  3RIF A;  3PUR A;  1AJ3 A;  3AE1 A;  2KXP B;  4JLE A;  2K9A A;  2IC6 A;  4Q25 A;  5LGU B;  4NUV A;  4DV6 T;  2V8S V;  4MAL A;  3ZYM A;  4WZX A;  5FYM A;  2HPL A;  4JI6 T;  2BG9 E;  3VHL A;  3ZC1 A;  2WBL A;  3RPU A;  5JDH A;  2FUP A;  3ZMU B;  1SUM B;  2V5D A;  3CML A;  2X0L B;  1YKE B;  4IE7 A;  4ISS A;  3MZK B;  3KV5 A;  4A56 A;  1IJ5 A;  3HR0 A;  3GN5 A;  4ASK A;  3O1J A;  1IZN B;  4IL4 A;  2LOS A;  5BMV E;  1Z0P A;  1XNQ T;  3ZMV B;  5JR9 B;  5L3B B;  3JAD A;  4OX9 T;  5LGT B;  2WWU A;  4P0A A;  1ZHC A;  1YQ3 A;  4CZZ B;  1Y64 B;  2NOX A;  2IHR 1;  2V26 A;  5H6Q B;  5DAB A;  2Q9Q C;  3AAI A;  5JDF A;  1U5P A;  2E8I A;  4ZI7 E;  3NKZ A;  3SOL A;  5LG4 A;  4X64 T;  5AQL B;  3DTO A;  1MIW A;  3VRA A;  2JRK A;  4TN7 B;  5CB4 E;  2VKJ A;  4QKN A;  4DV5 T;  3UT5 E;  3ZN1 B;  2VKH A;  2WU2 A;  3CQC B;  2VUR A;  4KUM B;  2HPJ A;  3FB2 A;  3QOF A;  5C3J A;  5JR9 C;  2YN6 A;  2ZM0 A;  2IML A;  4U33 A;  2WMN A;  3FBZ A;  4G2A A;  2XQ5 A;  3ANW A;  4ZHQ E;  3ZMT B;  4GOU A;  1WYB A;  3ZJ2 A;  3K8P C;  2KT9 A;  3Q5E A;  2R6G F;  4KI0 F;  5LJN A;  3O9X A;  2E5L T;  4LMK A;  1MIV A;  2JPF A;  3TLV A;  2E9X A;  3MAC A;  5AQH B;  2E9X D;  5M4Y A;  4QXB B;  4LF4 T;  1N32 T;  2I0M A;  4WBN E;  3WAJ A;  2XAJ B;  4CN1 A;  4HFE A;  2C0S A;  1OED C;  3EUH A;  2IW5 B;  2XSB A;  4H9N C;  1YXR A;  4ZXL A;  1BR2 A;  2BKP A;  5LHH B;  5ABE A;  3RYF E;  3UUN A;  4HE8 A;  4UEM A;  3C50 A;  5AQN B;  2IC9 A;  3P7I A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3NRY A;  3AB3 B;  3C4Z A;  3N2O A;  2CXL A;  4AKR B;  1X79 A;  4H9R C;  3EVY A;  4PK5 A;  3UFE A;  4TV8 E;  1VRB A;  3ZN0 B;  2V7M A;  5KDM C;  5LYJ E;  5LHG B;  2BVM A;  4TV9 E;  3N2K E;  2KWI B;  2I59 A;  2C5J A;  2LSI A;  3ESL A;  4ZOL E;  5CA0 E;  5L3E B;  2CXD A;  4KMC A;  5LBQ B;  3RKO A;  1YW0 A;  5CA1 E;  2A72 A;  2MBG A;  1G8X A;  2GK9 A;  2CXF A;  3NZP A;  4L5G A;  1QSD A;  5DJQ C;  2X51 A;  4MLK A;  4PK6 A;  2JQQ A;  3GWH A;  1D1C A;  2Y8D A;  4MHC A;  2VL8 A;  4DO0 A;  1LVK A;  3LK2 B;  5JDL A;  3FXD B;  3CPZ A;  1IAP A;  2XTL A;  3Q9D A;  4ZI3 D;  4CI2 B;  1ZEE A;  3HA4 A;  3PUS A;  2MOZ A;  4YLH A;  5FNV E;  4OHF A;  2H7O A;  3KV6 A;  4C90 A;  2LEH A;  1CUN A;  3AA7 B;  4U72 A;  3AA6 B;  3RX6 A;  4PJM A;  3RRW A;  1UX5 A;  4ZI3 C;  3PUQ A;  3KIN B;  1D0Z A;  2L3L A;  1OXZ A;  3CQG B;  5EK2 A;  5JRE A;  3VKG A;  2YK0 A;  3MJX A;  3OBV E;  4H63 V;  4IE5 A;  1D1A A;  3GMI A;  4AKG A;  4YJ2 E;  3CVR A;  4BAY B;  1V9D A;  1MMA A;  2XAH B;  3D0T A;  2LSY A;  5GON E;  3M65 A;  2XAQ B;  2PBI A;  3MA9 A;  5TAO A;  5L3D B;  5J1G A;  3W15 B;  4AXP A;  5H6R B;  2K5B B;  2L8K A;  4P0B A;  3WAK A;  1EZ3 A;  1LRZ A;  1O3X A;  4O2A E;  3R6N A;  4BA9 A;  3ZEF B;  4HGA A;  4QX8 B;  3Q2M A;  3OKQ A;  1MND A;  2DWK A;  4WNK A;  5LA6 E;  2NTX A;  3TKL B;  3V5U A;  2UXN B;  5LOV E;  4DBQ A;  3FHN A;  5FXW A;  3IHR A;  4GK0 E;  4F6R C;  3UUM A;  2WM9 A;  3LK3 B;  5FXX A;  1WYC A;  3ETU A;  4PK4 A;  1VOM A;  3RC8 A;  5IYZ E;  3P8C D;  1ZV4 X;  2CA5 A;  2K48 A;  1MNE A;  2KMF A;  3CQX C;  3RYH E;  3LBX A;  4I50 E;  2VKD A;  2JJ9 A;  4EXT A;  4CI1 B;  5FY0 A;  3KVA A;  3PUG A;  4OYK A;  2NWB A;  2KLQ A;  2YU2 A;  3RH3 A;  3PTR B;  3GN5 B;  5FXV A;  5F3J A;  5JDN A;  5ETW A;  4JEU B;  1HS7 A;  3LK4 2;  5JDM A;  2XHE B;  4ZS3 A;  3S4U A;  5L3C B;  2CEA A;  1WR6 A;  2MTQ A;  4TX5 A;  4C91 A;  4EB6 E;  1B7T A;  2ACX A;  4HEA A;  4OK0 A;  1S94 A;  3DJB A;  4AQF A;  2Q9Q B;  4JUY A;  4DMV A;  3AAE B;  5HWX A;  2V7L A;  4O4H E;  2G0U A;  2HH7 A;  4XAX B;  5JQG E;  4ZI2 D;  2PG8 A;  2IAK A;  2MYS A;  4EAH A;  2KND A;  4O4I E;  3AVS A;  2H7V C;  1H7C A;  4QXC B;  2VK9 A;  5C8Y E;  4EYU A;  3JC6 D;  4I43 B;  3KBU A;  2C5I T;  4AQF C;  3ZCJ A;  3SWH A;  3LFM A;  3B13 A;  3E08 A;  4YFS A;  2VWA A;  4ZI2 C;  3AVR A;  2C5K T;  3NRX A;  4IHJ E;  4GYR A;  3HKE E;  2DI4 A;  2LJL A;  4CXW A;  2KZ7 B;  2A2F X;  3JC6 C;  3ETV A;  3RYI E;  3CX8 B;  3T8O A;  5FXZ A;  3BQL A;  3ONX A;  2UXX B;  2LM9 A;  4H63 H;  4UIG A;  1HCI A;  5JDG A;  5KMG P;  1NAF A;  2NW8 A;  3EDU A;  4BJM A;  1MMG A;  1BR0 A;  3N9M A;  3ZMS B;  5DQV A;  4IE0 A;  3CKD A;  5EK3 A;  2W00 A;  3N5L A;  4XZC A;  4DND A;  3KBT A;  4O4L E;  2K24 A;  3C4X A;  5AFU L;  3H37 A;  4UVA B;  4PNI A;  2Y48 B;  3NZQ A;  3E22 E;  1T98 A;  1FEW A;  5L3G B;  2JMK A;  5LGN B;  2LSK A;  3I0Q A;  3LJC A;  2LOP A;  3AA1 B;  3PU8 A;  3ZCI A;  4H9O C;  2CM0 A;  4X20 E;  3QUJ A;  5E0O A;  1OWA A;  3KFW X;  4IDZ A;  4H9S E;  3WI3 A;  1HX8 A;  4EZ4 A;  3KDS E;  2QA7 A;  3L09 A;  3F57 A;  5HXH A;  2CLY B;  4H9Q C;  4UV8 B;  4ERR A;  1E1H B;  3C51 A;  5LNK A;  2PJQ A;  3ANW B;  4XBF B;  4CI3 B;  5LBM A;  4O4J E;  3KV9 A;  2CCQ A;  5JRC B;  4UVB B;  5FMN A;  3N9Q A;  2ZLY A;  3ZMZ B;  1S35 A;  4AI6 A;  2L9Q A;  5J2T E;  3IF8 B;  4IE4 A;  4UF0 B;  3I9Y A;  2DLR A;  4IST A;  1LKX A;  4ADZ A;  2XUE A;  2DHR A;  3N9P A;  2XAG B;  3UTK A;  3CX6 B;  2N2N A;  3PE0 A;  3O4X E;  4UEL A;  4QHO A;  4U74 A;  5KX5 E;  3Q5W A;  2X66 A;  2YEV C;  3C4W A;  4O2B E;  4EYY R;  4PJJ A;  3R84 B;  2VKO A;  4HTE A;  4P09 A;  4TUY E;  2XAF B;  3J9X 1;  2V7K A;  4MBQ A;  5HAX A;  2J1D G;  2N9D A;  2D5U A;  2E9X B;  3I1A A;  2RP4 A;  1IJ6 A;  2SPC A;  2EHO B;  3VU7 H;  3MXZ A;  4OFZ A;  4PJN A;  3ZYL A;  2M67 A;  5LHI B;  1HF8 A;  4Z8X A;  3PU3 A;  3PUR A;  2BZB A;  2YU1 A;  1AJ3 A;  2BDE A;  4X1Y E;  2KXP B;  5JVD E;  5EK4 A;  2CLY C;  2W62 A;  1WRD A;  3O1I A;  1HG5 A;  2NP9 A;  4JLE A;  2K9A A;  2IC6 A;  4UXN B;  1QUU A;  5LGU B;  4NUV A;  4MAL A;  3ZYM A;  2KIN B;  5FYM A;  4CQI A;  1MMN A;  2LSG A;  1KK7 A;  1FIO A;  1US7 B;  3ZYK A;  4IIJ E;  1NWM X;  3QC9 A;  3ZC0 A;  2HPL A;  2NTY A;  3BQK A;  2VAS A;  5HXC A;  3VHL A;  3HL6 A;  3UUL A;  2KWH A;  3N9N A;  3HI2 A;  1LVF A;  1ZKE A;  2WBL A;  3ZC1 A;  4L9I A;  3KV4 A;  3RPU A;  5JDH A;  4E7S A;  3ZMU B;  1YD8 G;  3CML A;  2X9W A;  2EHO A;  4AKI A;  2N1G A;  3K3O A;  2X0L B;  1D1B A;  1YKE B;  5EZY E;  4DBR A;  2NW7 A;  3F31 A;  4IE6 A;  4IE7 A;  4ISS A;  4AKH A;  3GA8 A;  3MZK B;  3OYZ A;  3FXE B;  5HXR A;  2CWY A;  4PAG A;  2ODV A;  3L3P A;  2ZM8 A;  3IEE A;  3KV5 A;  4A56 A;  1IJ5 A;  3HR0 A;  3GN5 A;  4ASK A;  3SS1 A;  2P9B A;  3O1J A;  5HWY A;  1IZN B;  2ES0 A;  2VB6 A;  3AA0 B;  2LOS A;  3BK9 A;  2B1E A;  4I4T E;  4O8S A;  5FP3 A;  5BMV E;  1UCU A;  1Z0P A;  1HFA A;  4PFO A;  3ZMV B;  5HXE A;  5JR9 B;  4GYS A;  3B57 A;  2Q9Q A;  5L3B B;  4DMW A;  4X1K E;  2Q9Q D;  3A5X A;  5ADX L;  4PJL A;  3KVB A;  4MFR A;  5LGT B;  1MIY A;  2WWU A;  2H3R A;  1ZHC A;  4P0A A;  3HKB E;  4CZZ B;  3K3Q C;  1Y64 B;  3UUX B;  2NOX A;  2V26 A;  5H6Q B;  2YIN A;  2LT3 A;  5LXT E;  5DAB A;  2Q9Q C;  3AAI A;  3I0O A;  5JDF A;  1U5P A;  5A1L A;  4KBM B;  2E8I A;  3OJA A;  4BJN A;  4ZI7 E;  3C98 B;  4QX7 B;  4UV9 B;  1SHZ C;  3SOL A;  4CXX A;  5LCY A;  5LG4 A;  1FMW A;  2WAU A;  3DTO A;  3IBP A;  4N78 D;  1BR4 A;  4E7Z A;  1MIW A;  1HTJ F;  2X9Y A;  4PFP A;  2JRK A;  2WSS V;  3H3A A;  2CE7 A;  4J2C A;  4OYJ A;  4TN7 B;  2LE8 A;  5CB4 E;  3C64 A;  3HKC E;  2CWO A;  5L3F B;  4WBO A;  3LG7 A;  1YKH B;  2VKJ A;  3I9W A;  4YJ3 E;  4WW0 A;  5JR9 A;  3HKD E;  3RRC A;  5IHY A;  4QKN A;  5F8P A;  2DCF A;  3RC3 A;  4HFV A;  5LP6 E;  2D0U A;  2D2S A;  3NBX X;  4B6X A;  1BR1 A;  2QGS A;  3UT5 E;  3ZN1 B;  2VKH A;  2A3D A;  3CQC B;  4GIW A;  4EZH A;  3F2E A;  2X68 A;  4CXY A;  3ZJ1 A;  3J7Y q;  4KUM B;  4X1I E;  2HPJ A;  3CWZ B;  3FB2 A;  3Q5X A;  5J2U E;  2LHN A;  2D0T A;  5JR9 C;  2XAS B;  2ZM0 A;  2ODU A;  4KP3 C;  3U78 A;  4K0U A;  3U3I A;  3LBX B;  2LSJ A;  1G73 A;  2WMN A;  3FBZ A;  1KNZ A;  3N9O A;  1D0X A;  1FMV A;  4JEH B;  2DNX A;  4G2A A;  2W0G A;  3ANW A;  2ZM2 A;  4FJO A;  2PFV A;  4ZHQ E;  4HKA A;  5HXS A;  3K3N A;  3ZMT B;  5JRC A;  4GOU A;  4AQG A;  4H9P C;  3AAA B;  1WYB A;  3ZJ2 A;  2DWG A;  4PW8 A;  2V7I A;  4EOZ B;  3K8P C;  2KT9 A;  3FBL A;  2NW9 A;  3PDY A;  4UF0 A;  3MK7 C;  4ANJ A;  5LJM A;  5LJN A;  3O9X A;  3PUA A;  2CMR A;  4ZS2 A;  4FI5 A;  4YHJ A;  3E0Z A;  4UVC B;  4HN9 A;  5JDQ A;  1MIV A;  4V1A v;  2V1D B;  2JPF A;  1HG2 A;  3CX7 B;  3MKD A;  3SRZ A;  2BVL A;  4IGU A;  4AKL A;  5DQW A;  2W63 A;  5FY7 A;  4G63 A;  2LHR A;  2E9X A;  2OA5 A;  5L2L A;  3MAC A;  2X9X A;  1U4Q A;  2E9X D;  3DP7 A;  2Z6E A;  3O1H A;  3OYX A;  5M4Y A;  2EHO D;  4QXB B;  4TZ4 C;  2V7J A;  4M1P A;  3VKH A;  3ZLI A;  2ZMA A;  4I55 E;  1SA0 E;  3RYC E;  4WBN E;  3BQI A;  4NUU A;  2JMH A;  3EDV A;  5JH7 E;  3WAJ A;  1WLX A;  2E9X C;  2XAJ B;  2XQY A;  5FY1 A;  2C0S A;  4ILU A;  2EHO C;  4QXH B;  3EUH A;  2IW5 B;  4DVD A;  2RA1 A;  4H9N C;  1BR2 A;  3V5S A;  2X67 A;  3N2G E;  3ZPO A;  3N9L A;  5HYA A;  5LHH B;  3RYF E;  2Y6X A;  1D0Y A;  3QK6 A;  4EIW A;  2W61 A;  2WMO A;  4L0R A;  3UUN A;  1UX4 A;  4HE8 A;  3C50 A;  4UEM A;  4QWN B;  2X9H A;  2IC9 A;  3P7I A;  4GK5 E;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...