4H9SE

Complex structure 6 of daxx/h3.3(sub7)/h4
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
204
structure length
199
Chain Sequence
b'SRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 71
structure length 199
sequence length 204
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9sE00
4H9NC 4H9RC 4H9QC 4H9SE 4H9PC 4HGAA 5KDMC 4H9OC
chains in the Genus database with same CATH superfamily
3T1HT 1S35A 3RRWA 3EHZA 3TLUA 3FZHB 4P0AA 2Y48B 2XAJB 4YHJA 4IT4A 2E5LT 2J62A 5EK4A 3PUQA 2M67A 1W0AA 3FBLA 2LHRA 3P4SA 2VVSA 2AXDS 5L3DB 1E2AA 2QVAA 2LLYA 2XAHB 1Y01A 2C5KT 4J2CA 5JR9B 3WAJA 3ZYMA 5JDFA 4V1Av 4ZI2D 1N33T 3W15B 3TLVA 1VCSA 5JVDE 2IHR1 2RA1A 3VKGA 4UELA 2N9DA 5J2UE 4B3ST 3FZMB 4AQGA 3JC6D 2X67A 4PJLA 1D1BA 3ZMZB 3LG7A 2WWVA 3K3QC 4FI5A 3UU5A 4NUVA 4DR4T 2YU1A 3G06A 1T8BA 5C2TA 3GA8A 2JPFA 3OTOT 3MK7C 4EV6A 3L8RA 5L3BB 5LGTB 4AQFC 2PBIA 4BJNA 5H6QB 1NAFA 2CA5A 2BKPA 5HXCA 4HFVA 1QSDA 2WDQA 2ACXA 2CLYB 1N32T 5AQMB 5LHHB 5CJ5A 3QB5K 1HG2A 4BJMA 3PUYF 3RIFA 2K48A 3RYIE 1VRBA 2W0GA 2AE9A 2V6YB 3OVUA 2W61A 3ZMSB 2KWIB 2Q9QC 4X64T 4P1NA 3IF8B 5TAOA 2YOEA 3ZT7A 4L9IA 2X9XA 4OX9T 4AKIA 4MHCA 4U2YA 5LOVE 3LK3B 4IDQA 5LGUB 4KX6A 3N9OA 4U2ZA 3Q5EA 5AQIB 2V7KA 4QH4A 1AJ3A 2V6YA 4XZCA 2LEHA 2DWGA 5AQSB 5EZYE 3ZJ1A 1U4QA 4ZI3D 5HEUA 4CN6A 2RPAA 3RIAA 2BG9B 3QOFA 1M62A 3RLFF 4UVCB 4CXWA 3P4PA 2L9QA 4AISA 2HHHT 4WNKA 3LBXB 1OWAA 5KMGP 3DTOA 3C4ZA 1WR6A 3VRBA 1XWMA 4X5TA 2HPJA 4X66T 3VHLA 4IDPA 4LF7T 3TLTA 2QA7A 4EYUA 5AFUL 5AQUB 1IBMT 2WQYA 3LBXA 2J4GA 2FJBA 2CXLA 4PJJA 2PJQA 4TWDA 2VQET 1N34T 2YDQA 5FMNA 3PUWF 3PUVF 4E7SA 3MACA 2YK0A 5ABFB 2MPKA 4O8SA 3VR9A 1J1JA 1WR0A 3CK6A 3SS1A 4UF0B 2YN6A 4IIJE 2X68A 5JH7E 4MBQA 2V6XA 3AAIA 4JEUB 1IJ5A 3FZLB 5HXEA 4PK5A 1UK5A 2NW7A 4CN1A 4K0KT 4AQFA 3AE7A 5ABFA 3D0TA 4CQIA 5E0OA 5JDQA 3UFGA 2Q9QB 3N5LA 2YU2A 4DIDB 2UUCT 2NW9A 3I9WA 4UF0A 4TN7B 3SRZA 2WDRA 2UUBT 3AA6B 2CMRA 2E5VA 2VKDA 4DMVA 3Q2MA 2JMHA 2UXXB 4MFRA 2WAUA 2Q9QA 5ABEA 2UXNB 1LVFA 4OHFA 5C8YE 3UUBA 3H37A 2XPKA 1XNQT 3J9X1 2CXFA 1QLBA 3PUSA 2WM9A 2E9XC 2MAWA 4GYRA 2NTYA 5CFBA 2BZBA 2KWHA 2KSRA 2LHNA 3C4XA 3QB5A 3I9YA 3ANWB 3RQUA 4QXBB 4TV9E 2LM2A 4C91A 4IL4A 1B7TA 3GN5A 3TLWA 3T1YT 2K9AA 5FP3A 1FEWA 1X9BA 3KINB 2A3DA 3P4QA 3AAEB 3KFWX 5JQGE 4ANJA 2CXDA 4AIUA 5GONE 4XBFB 2LSIA 2XQ4A 4U7IA 4U7YA 1SHZC 4UXNB 5FL0A 2Y8DA 5L47A 2W66A 4ZOLE 1KNPA 3ANWA 5F3JA 3IBPA 5KXJA 3RGLA 2MOZA 3LSVA 3WI3A 2M6IA 3ZCIA 2CWYA 3F2EA 4HFIA 4JI3T 2YDRA 4EAHA 3VU7H 5JDLA 5AQTB 3EABA 1ZHCA 3K3NA 1NWMX 4H9PC 1D0ZA 2WU5A 3RRCA 4AI6A 1OEDB 1ZKEA 3JC6C 1ZOYA 4JEHB 1VCTA 2CHOA 3JAEA 3FXEB 4YJ3E 4I43B 4QKNA 3GWHA 3UQ7A 4LFCT 1BR2A 4ZZBA 3A8YC 3TKLB 4DMWA 4DV0T 2IW5B 2KZ7B 3UTKA 1N36T 4EEDA 2XQ9A 5F8PA 5LBQB 4ADZA 3NWIA 1U5PA 5JDMA 3L09A 3VR8A 2W67A 2XUEA 5IUXA 5LG3A 4PJMA 2XQ5A 1W0BA 4QX8B 4WYVA 3O4XE 3Q5DA 2K3WA 5LB7B 3K8PC 4DO0A 5LG4A 3CX7B 4I50E 4HEAA 3CIRA 5FVLA 2MBGA 3Q9DA 5HXSA 5HWXA 4HTEA 2KXPB 3N9MA 4U33A 2E9XA 2LSJA 2XHEB 4Z90A 3M65A 2FJDA 3UU6A 4HWFA 3PUAA 2VURA 4IE6A 4LF4T 4HGAA 1I6ZA 3AXJB 5FY1A 1IBKT 3LK2B 3O1JA 3ZMUB 1UGOA 2WP9A 4P09A 3CX6B 3B5MA 3AECA 4HFHA 4IE7A 4LFBT 1GQEA 3PURA 4ZI3C 2D2SA 2WZIA 4O2AE 4OYJA 2D9DA 3C98B 5JDGA 2Z6EA 3N9NA 4B3MT 2N2NA 2E2AA 2CE7A 5LHGB 2XQ8A 4HFCA 4UV9B 3KBUA 3AXJA 4ILBA 4ZXLA 2EHOC 2X9YA 3ONXA 2XTLA 1WFDA 5L2LA 2CWOA 3HKCE 3N9QA 3S4UA 3UU8A 5FL1A 3CQXC 2ES0A 3NRXA 4DV6T 2NOXA 4AQYT 2V7LA 5CA0E 1ZV4X 5DJQC 4KI0F 5JTGA 4DV4T 5FY7A 3HKEE 3B57A 4L0RA 2ZM6T 1DU2A 1EZ3A 2W63A 2XQAA 3OPCA 4O2BE 1MMDA 5BMVE 4N78D 1NENA 2JQ9A 4EZHA 5HEHA 4LF9T 5AQQB 3JADA 3ZSTA 4O4JE 3AE8A 4TX5A 1M7KA 2XZEA 2ACZA 2CHNA 4DR2T 1KK7A 3WAKA 2FUPA 4HKAA 2IIUA 4B3RT 2WMOA 3NBXX 4TUYE 4A56A 3PTRB 5AQGB 3MKDA 3CQGB 3KV5A 4L5GA 2WB5A 2IUBA 2LSYA 3RIUC 4LF6T 3U78A 4P0BA 4EXTA 3ZKRA 1V9DA 3ZSSA 5HXRA 5L3GB 3O9XA 1D1AA 2V7IA 1SUMB 3ONJA 3AAAB 4ZS3A 5J0ZA 4EB6E 3N2OA 1Z8UA 2JQQA 5DQWA 5LBMA 2FJEA 2QYWA 4X1IE 2EHOB 2C0SA 4IE5A 3OBVE 1XDPA 4YTPA 4DR6T 3E0ZA 3J7Yq 3RHWA 2V7JA 5LP6E 5LXTE 1S94A 4DUZT 3H3MA 1HR0T 1MIWA 4NUUA 2Y6XA 2IAKA 2UXDT 4YLHA 4E7ZA 4AKHA 4DR1T 1L0VA 3PU3A 2W00A 4AKGA 2EHOA 3AA7B 3V5UA 4LFAT 3QC9A 3HKBE 5AQLB 4PJNA 5FKYA 3ZMVB 5HAXA 4NPPA 4UV8B 4YT0A 3BK9A 3AE2A 3V5SA 3P7IA 2JIWA 3AEFA 4IGUA 4DV5T 3RQWA 2I0MA 4K0UA 4PFOA 3UULA 2VKOA 3E22E 4WW0A 3MJXA 2BBJA 2G0UA 3OKQA 3CKDA 4HWCA 3F31A 3JAFA 4IE4A 2BS4A 2ZMAA 3ZEFB 1KFYA 4JI1T 4H9OC 2H88A 4H9QC 3ZJ2A 3PU8A 5HEGA 4HWIB 5AQKB 1E7PA 5L3EB 3N2GE 3QNUA 1CUNA 3ESLA 4ZS2A 4OFZA 2NWBA 5H6RB 5FXVA 2CBIA 3KVBA 2XSBA 5JDNA 3IHRA 4WBNE 2N1GA 5LMUT 3FHNA 3SFEA 3UU3A 3QK6A 2LSKA 3ZYKA 2P9BA 3NZPA 3P4WA 3BQLA 2I59A 2M6BA 4I0UA 1WYCA 3RKGA 3LJCA 4U31A 2XM1A 3UT5E 3R6NA 3BQIA 2H7VC 4YFSA 5L4HA 4TNVA 4EEBA 3DP7A 3ZN0B 2V7MA 1UX4A 3RIUA 4B3TT 5KDMC 3KV9A 4TWFA 3NRYA 2V26A 3EVYA 1VOMA 3KBTA 5ETWA 3ZPOA 2WSSV 4JI0T 4X65T 4X1YE 1D0XA 3ZCJA 1BR0A 3GN5B 2BBHA 3PUXF 3AEBA 2Q9QD 4KHPT 5AQJB 1HS7A 1YQ3A 5ABGA 4DNDA 4U72A 4O4IE 3U3IA 4JLEA 2H89A 3K3OA 1WRDA 2BS3A 4UR9A 1JNZA 4YSZA 2V1DB 3CWZB 4IDNA 4JV5T 4QXCB 3ZT6A 2CEAA 2CBJA 2VWAA 5HCJA 4HE8A 4KHZF 5C3JA 4JI5T 4M1PA 1G8XA 2PTFA 4DV3T 2F4VT 5L3CB 2A9UA 4JUYA 4CXYA 3PJAA 1HNZT 2LRKA 3AE3A 5AQVB 4JI6T 4ZI2C 2I6HA 5FXXA 2D5UA 3L39A 4GKJT 3L3PA 2J1DG 2VL0A 4Z8XA 4NXNT 3PJAJ 3ZMTB 1D1CA 5CB4E 4H63H 4PFPA 2ZM8A 2DWKA 2XJ7A 4WBOA 5J2TE 1Z0PA 4COFA 1HX1B 4U3CA 2NTXA 3C51A 4YHHT 3HI2A 1J5WA 1IJ6A 1YKEB 5L4EA 3ZC0A 3C50A 5JR9C 4GYSA 3ABVA 4G63A 2ZM2A 1D0YA 2D0TA 3FBZA 2HH7A 2K24A 2XQ3A 3RC3A 2JQHA 2FJAA 2YKSA 2FBWA 3N9LA 1X79A 3RKOA 2K5BB 2H3RA 2L8KA 3RH3A 2E8IA 4JI4T 2WS3A 5FXZA 4CN4A 1UURA 5HEJA 3PUZF 2E9XB 1QUUA 4QX7B 2B76A 5L3FB 1G73A 2X9HA 4ILCA 4ZI7E 4LMJA 1NEKA 3AB3B 3FXDB 2XSAA 3AVRA 3RPUA 2IMLA 1LKXA 4FJOA 4B6XA 3RF1A 2BVMA 4JI8T 5HXHA 3RYCE 1ZEEA 2BKOA 3AE5A 2CRBA 2YEVC 3CQCB 1BR4A 3ETUA 4CI2B 1HTJF 2NW8A 2WZHA 1IAPA 1Y64B 3EDUA 4H9SE 4IDOA 4I4TE 2X0HA 1T7SA 3EAMA 4YSYA 5KX5E 1UX5A 2ODVA 4DV7T 3ZN1B 2WMNA 5LJNA 4DV1T 1ZP0A 4HFDA 5AQPB 4DV2T 1MIYA 2JJ9A 4Z91A 1UCUA 3ZYLA 3VKHA 4DBQA 2UU9T 4H9NC 1MNDA 2YDSA 3KDSE 5F5WA 4UVAB 2X66A 4H9RC 4YJ2E 3CMLA 2XY8B 3B13A 3E08A 4TWHA 1HNXT 5EK3A 2XAGB 2BG9C 1I94T 2BG9E 4UIGA 4X62T 3DJBA 3RC8A 4NXMT 1IZNB 3LFMA 3SFDA 2QGSA 1HFAA 4U74A 3MXZA 4DR5T 4GIWA 5JR9A 4DUYT 2LM9A 5LNKA 4LMLA 2VQFT 3RYHE 4EYYR 5IYZE 1YKHB 5FVKA 1FJGT 4QWNB 2V5CA 2UUAT 2W62A 2UXBT 4A98A 1XMOT 3EDVA 4NIQA 4QHOA 1LVKA 2JRKA 4ZEYA 3ZC1A 4ZZCA 4HFEA 2X0LB 4GOUA 1UUSA 5LGNB 2KMFA 3BQKA 4YSXA 2A2FX 3UFEA 4DR3T 3M3ZB 4ISTA 5HEOA 4IL9A 3CPZA 1CHUA 2J47A 5LCYA 1XZYA 2LJLA 4EIWA 3TLSA 3GMIA 4GK0E 5FNVE 3AE9A 5ABHA 2IDOB 2XASB 3NKZA 5CA1E 3MA9A 2OA5A 4DR7T 1IBLT 2LSGA 4CI1B 1HF8A 5AQRB 5LYJE 3ETVA 3HL6A 1SE7A 2LKHA 4LMKA 2HN1A 3NZQA 4HWDA 3HKDE 2OV9A 3OYXA 3IA3A 5JREA 3UQ4A 1YXRA 3EI0A 2W2UA 1XMQT 5M4YA 4A5XA 2LT3A 5JRCB 4EGWA 3SWHA 3P4RA 4A97A 4BA9A 4ISSA 4CZZB 3CX8B 4YXDA 1J5ET 2XAFB 2EHOD 1W9RA 1MMAA 3SOLA 1YQ4A 3PDYA 4AKRB 2BVLA 3UUNA 1WLXA 3PE0A 2BG9A 5J1GA 3KV4A 4LF5T 3PUGA 5JRCA 3Q5WA 3QUJA 1SA0E 2BKNA 2KT9A 3I0QA 4G2AA 3P8CD 3X1DA 5HCMA 5LHIB 5FY0A 3T8OA 5EK2A 2VKJA 3AEAA 2MYSA 2GK9A 5IHYA 4O4HE 3A7MA 3RI5A 2C5IT 1LRZA 2JMKA 2VASA 5AQHB 2NP9A 3O1HA 4MALA 2WWUA 4PW8A 2DCFA 4TNWA 4ERRA 2XM2A 2WU2A 4ASKA 2IC9A 1KNRA 3RYFE 4BAYB 4F8HA 3NVOA 3AVSA 5DABA 3R84B 1XNRT 3K1SA 2QRXA 2PG8A 1US7B 5LA6E 3A5XA 2VK9A 2SPCA 2LE8A 3AEEA 4LF8T 2DLRA 1MMGA 2C5JA 4IE0A 4H63V 1OEDC 2ZLYA 3Q5XA 1OEDE 3KV6A 4PK4A 4QXHB 4PK6A 5BR8T 2R6GF 3KVAA 2XQ7A 2VL8A 3O1IA 3ZLIA 1MMNA 2NR4A 3F57A 4KUMB 5AQFB 3CVRA 5AQOB 2A72A 2DI4A 2V8SV 4KMCA 3C4WA 3P50A 1YD8G 3HR0A 1HNWT 1T98A 4KBMB 1MNEA 3AEGA 2L3LA 2MTQA 2X9WA 4TV8E 3N9PA 3H3AA 1FMWA 2CCQA 3LK42 1HX8A 1WYBA 1MIVA 1FMVA 3ZT5A 4YTNA 2DL1A 4IDZA 2WCAA 3AE1A 4EZ4A 4KP3C 2DNXA 2XQ6A 3RX6A 2IC6A 3C64A 3EUHA 5FYMA 1T72A 4MLKA 1OXZA 3AA1B 2VVNA 3MZKB 5CGMA 4YY3T 4OK0A 5ADXL 3AE6A 3UUMA 2BS2A 4JYAT 5LMNT 4IHJE 5HYAA 2WY2A 5HWYA 4OYKA 3UU4A 4ILAA 4YTMA 2LRLA 2VKHA 4F6RC 5IWAT 4X1KE 1FIOA 1KNZA 3AA0B 3I0OA 1HCIA 1W09A 2KINB 4PAGA 4JBWF 4CXXA 2HPLA 2VB6A 2V5DA 4QH1A 4UVBB 1KF6A 2YINA 2DHRA 3FZKB 1E1HB 1KEYA 1WCRA 2ZM0A 2RP4A 2X51A 2ODUA 2WDVA 2X0YA 4PNIA 3UUXB 3FB2A 4HN9A 2LOPA 4HWHA 4UEMA 3I1AA 2KNDA 3N2KE 2B1EA 2CPTA 4TZ4C 4DVDA 1HG5A 5DQVA 2PFVA 3PV0F 1YW0A 2XQYA 2CM0A 1OEDA 4CI3B 3IEEA 2UXCT 3JCFA 3HA4A 4AKLA 3AEDA 2W4XA 4GK5E 2LKGA 4DBRA 1XDOA 2WBLA 1BR1A 5FXWA 3LDQB 4JI2T 4O4LE 4QH5A 5JDHA 1O3XA 2HN2A 3AE4A 2JQKA 3FZFB 4XAXB 4JI7T 4EOZB 2LOSA 4X20E 2BDEA 4GKKT 3OYZA 4I55E 2D0UA 1H7CA 4AXPA 3OJAA 1JNRA 2E9XD 4ILUA 4Q25A 5LJMA 4C90A 4HFBA 3VRAA 2H7OA 2CLYC 3ONLC 4ZHQE 4IREA 5AQNB 2OLTA 4WZXA 2XAQB 2KLQA 1R8IA 5A1LA
chains in the Genus database with same CATH topology
4EAHA 4ISTA 3VU7H 5JDLA 1ZHCA 3CPZA 4WBNE 2N1GA 3FHNA 3QK6A 3K3NA 2LSKA 1S35A 5LCYA 3RRWA 3ZYKA 4P0AA 1NWMX 2P9BA 3NZPA 3BQLA 2Y48B 4H9PC 1D0ZA 2XAJB 2LJLA 4EIWA 4YHJA 3GMIA 4GK0E 2I59A 5FNVE 3RRCA 5EK4A 3PUQA 2M67A 4AI6A 3FBLA 1WYCA 3JC6C 1ZKEA 3LJCA 3UT5E 2LHRA 3R6NA 2XASB 4JEHB 3BQIA 2H7VC 4YFSA 5L3DB 5CA1E 3MA9A 2OA5A 3FXEB 2XAHB 3DP7A 3ZN0B 2V7MA 1UX4A 4YJ3E 2C5KT 4I43B 5KDMC 2LSGA 4J2CA 3KV9A 4CI1B 4QKNA 1HF8A 5JR9B 5LYJE 3GWHA 3NRYA 3WAJA 3ZYMA 3ETVA 2V26A 3EVYA 3HL6A 5JDFA 1BR2A 1VOMA 3KBTA 4V1Av 5ETWA 3TKLB 4DMWA 3ZPOA 4ZI2D 2WSSV 3W15B 3NZQA 4X1YE 1D0XA 3HKDE 3ZCJA 1BR0A 3GN5B 5JVDE 3OYXA 2IW5B 2KZ7B 2RA1A 3VKGA 5JREA 4UELA 2Q9QD 2N9DA 5J2UE 3UTKA 4AQGA 1HS7A 5M4YA 3JC6D 5F8PA 2LT3A 5JRCB 2X67A 5LBQB 4ADZA 4PJLA 1U5PA 1D1BA 3SWHA 5JDMA 3L09A 3ZMZB 4BA9A 4DNDA 4ISSA 4U72A 4CZZB 3CX8B 2XUEA 3LG7A 2XAFB 4O4IE 4PJMA 4QX8B 3U3IA 2EHOD 1MMAA 3K3QC 3SOLA 4JLEA 3PDYA 4FI5A 4AKRB 3O4XE 4NUVA 2BVLA 3UUNA 3K8PC 4DO0A 3K3OA 1WRDA 5LG4A 1WLXA 3CX7B 3PE0A 4I50E 2YU1A 4HEAA 2V1DB 2MBGA 3Q9DA 3GA8A 3CWZB 2JPFA 5J1GA 3KV4A 5HXSA 4QXCB 5HWXA 3MK7C 3PUGA 4HTEA 5JRCA 3Q5WA 2KXPB 3QUJA 2CEAA 1SA0E 2VWAA 5L3BB 5LGTB 4AQFC 3N9MA 4HE8A 2E9XA 2LSJA 2XHEB 2KT9A 3I0QA 3M65A 2PBIA 4G2AA 3P8CD 4M1PA 4BJNA 5H6QB 5LHIB 1NAFA 1G8XA 2CA5A 5FY0A 3T8OA 5EK2A 3PUAA 2VKJA 5L3CB 2MYSA 2GK9A 4JUYA 5HXCA 4HFVA 5IHYA 4CXYA 4O4HE 1QSDA 4IE6A 4HGAA 2C5IT 5FY1A 1LRZA 2ACXA 2JMKA 2VASA 2CLYB 3LK2B 2NP9A 3O1HA 3O1JA 4MALA 2WWUA 4PW8A 2DCFA 4ERRA 4ZI2C 5LHHB 3ZMUB 1HG2A 4BJMA 5FXXA 4P09A 3CX6B 4ASKA 2D5UA 2IC9A 2K48A 3RYIE 3L3PA 1VRBA 4IE7A 2J1DG 2W0GA 3RYFE 3PURA 4ZI3C 4BAYB 2D2SA 3AVSA 2W61A 4O2AE 3ZMSB 4OYJA 2KWIB 5DABA 2Q9QC 4Z8XA 3R84B 3C98B 3IF8B 5TAOA 3ZMTB 5JDGA 4L9IA 2X9XA 1D1CA 2PG8A 2Z6EA 1US7B 3N9NA 5LA6E 2N2NA 5CB4E 4H63H 3A5XA 2ZM8A 2CE7A 2DWKA 2VK9A 4PFPA 5LHGB 2SPCA 2LE8A 4WBOA 2DLRA 4UV9B 5J2TE 3KBUA 1Z0PA 1MMGA 2C5JA 4IE0A 4H63V 2ZLYA 4MHCA 3Q5XA 3KV6A 4PK4A 5LOVE 3LK3B 2EHOC 2NTXA 3C51A 4QXHB 4PK6A 5LGUB 2X9YA 3N9OA 3HI2A 3ONXA 2XTLA 2V7KA 1IJ6A 1YKEB 3KVAA 5L2LA 2CWOA 3HKCE 3ZC0A 2VL8A 3O1IA 3ZLIA 1AJ3A 3C50A 3N9QA 3S4UA 5JR9C 4GYSA 4G63A 1MMNA 4XZCA 3CQXC 2ES0A 3NRXA 2ZM2A 2LEHA 1D0YA 2D0TA 2DWGA 2NOXA 3F57A 3FBZA 2HH7A 2K24A 5EZYE 3ZJ1A 4KUMB 1U4QA 3RC3A 4ZI3D 3CVRA 3N9LA 1X79A 2A72A 2DI4A 4KMCA 3C4WA 3RKOA 2K5BB 2H3RA 2V7LA 5CA0E 1ZV4X 2L8KA 5DJQC 1YD8G 4UVCB 3HR0A 4CXWA 3RH3A 2E8IA 1T98A 2L9QA 5FY7A 5FXZA 4WNKA 3LBXB 1OWAA 5KMGP 3DTOA 3HKEE 3C4ZA 2E9XB 1WR6A 3B57A 4L0RA 1QUUA 4AKIA 4QX7B 4KBMB 1MNEA 1EZ3A 2W63A 2L3LA 5L3FB 2MTQA 2X9WA 4TV8E 1G73A 2X9HA 2HPJA 3N9PA 3H3AA 4O2BE 4ZI7E 1MMDA 5BMVE 4N78D 3VHLA 1FMWA 2CCQA 3LK42 1HX8A 3AB3B 1WYBA 1MIVA 4EZHA 3FXDB 1FMVA 2QA7A 4EYUA 5AFUL 4IDZA 4EZ4A 4O4JE 3AVRA 4TX5A 3RPUA 4KP3C 3LBXA 1LKXA 2DNXA 2CXLA 4PJJA 4FJOA 2PJQA 4B6XA 2BVMA 1KK7A 3RX6A 5FMNA 3WAKA 5HXHA 2IC6A 3C64A 3EUHA 3RYCE 1ZEEA 4HKAA 5FYMA 4E7SA 2WMOA 4MLKA 3NBXX 3MACA 1OXZA 4TUYE 2YK0A 3AA1B 3MZKB 4A56A 2YEVC 3PTRB 4O8SA 3CQCB 4OK0A 5ADXL 1BR4A 3ETUA 3UUMA 4CI2B 3MKDA 3CQGB 4IHJE 3SS1A 3KV5A 4L5GA 1HTJF 4UF0B 5HYAA 2NW8A 4IIJE 2LSYA 2X68A 5JH7E 4MBQA 1IAPA 1Y64B 3EDUA 3AAIA 4H9SE 5HWYA 4OYKA 4JEUB 3U78A 1IJ5A 4P0BA 5HXEA 4PK5A 4I4TE 2NW7A 4EXTA 1V9DA 2VKHA 4AQFA 5KX5E 5HXRA 1UX5A 2ODVA 4F6RC 5L3GB 3ZN1B 3D0TA 2WMNA 4CQIA 1D1AA 5E0OA 5LJNA 3O9XA 2V7IA 4X1KE 5JDQA 1FIOA 1KNZA 2Q9QB 3AAAB 3AA0B 1MIYA 3I0OA 3N5LA 4ZS3A 1HCIA 2JJ9A 2YU2A 2KINB 4PAGA 4CXXA 2NW9A 3I9WA 2HPLA 4EB6E 2VB6A 1UCUA 3N2OA 4UF0A 3ZYLA 2JQQA 4TN7B 5DQWA 5LBMA 3SRZA 4UVBB 3VKHA 4DBQA 2YINA 2DHRA 3AA6B 4H9NC 4X1IE 2EHOB 2C0SA 1MNDA 1E1HB 2CMRA 3KDSE 4IE5A 3OBVE 2VKDA 2ZM0A 4DMVA 3Q2MA 2RP4A 2X51A 2ODUA 4PNIA 3UUXB 3FB2A 4HN9A 3E0ZA 4UVAB 2JMHA 2UXXB 2X66A 4MFRA 2LOPA 4UEMA 3J7Yq 3I1AA 2WAUA 2KNDA 4H9RC 2Q9QA 2V7JA 3N2KE 2B1EA 3CMLA 4YJ2E 5LP6E 5LXTE 2UXNB 1S94A 3B13A 3E08A 1MIWA 1LVFA 4OHFA 4NUUA 2Y6XA 5C8YE 2IAKA 4TZ4C 4DVDA 1HG5A 5EK3A 4YLHA 2XAGB 5DQVA 4E7ZA 2PFVA 4AKHA 1YW0A 2XQYA 3PU3A 2CM0A 4CI3B 3H37A 4UIGA 3IEEA 2W00A 4AKGA 3DJBA 3J9X1 3HA4A 2EHOA 3AA7B 4AKLA 2CXFA 3V5UA 3PUSA 3QC9A 2WM9A 3RC8A 2E9XC 1IZNB 4GK5E 3LFMA 2QGSA 3HKBE 4PJNA 1HFAA 2NTYA 4GYRA 4U74A 3MXZA 3ZMVB 2BZBA 4GIWA 2KWHA 5JR9A 4DBRA 5HAXA 2LHNA 3C4XA 4UV8B 2LM9A 3BK9A 5LNKA 3V5SA 2WBLA 3I9YA 3RYHE 1BR1A 3P7IA 5FXWA 4EYYR 4IGUA 5IYZE 1YKHB 3ANWB 4QXBB 4TV9E 4K0UA 4PFOA 4O4LE 4C91A 5JDHA 3UULA 4QWNB 1O3XA 2VKOA 1B7TA 2W62A 3E22E 3GN5A 4WW0A 2K9AA 5FP3A 1FEWA 3MJXA 4XAXB 3KINB 2G0UA 2A3DA 3OKQA 4EOZB 2LOSA 3CKDA 3EDVA 3AAEB 3KFWX 4QHOA 2BDEA 3F31A 4IE4A 4X20E 1LVKA 4ANJA 2CXDA 2JRKA 5JQGE 2ZMAA 3ZEFB 5GONE 4XBFB 2LSIA 3OYZA 4I55E 3ZC1A 1SHZC 2D0UA 1H7CA 4UXNB 4AXPA 3OJAA 2E9XD 4ILUA 2X0LB 2Y8DA 4H9OC 4GOUA 4ZOLE 4H9QC 4C90A 3ANWA 3ZJ2A 3PU8A 5LJMA 5LGNB 5F3JA 2KMFA 3IBPA 2MOZA 2H7OA 2CLYC 5L3EB 3WI3A 3N2GE 3ZCIA 2CWYA 1CUNA 3ESLA 4ZS2A 4ZHQE 4OFZA 2NWBA 3F2EA 3BQKA 5FXVA 5H6RB 3KVBA 5JDNA 2A2FX 2XAQB 3IHRA 2KLQA 3UFEA 5A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N C;  4H9R C;  4H9Q C;  4H9S E;  4H9P C;  4HGA A;  5KDM C;  4H9O C; 
#chains in the Genus database with same CATH topology
 3T1H T;  1S35 A;  3RRW A;  3EHZ A;  3TLU A;  3FZH B;  4P0A A;  2Y48 B;  2XAJ B;  4YHJ A;  4IT4 A;  2E5L T;  2J62 A;  5EK4 A;  3PUQ A;  2M67 A;  1W0A A;  3FBL A;  2LHR A;  3P4S A;  2VVS A;  2AXD S;  5L3D B;  1E2A A;  2QVA A;  2LLY A;  2XAH B;  1Y01 A;  2C5K T;  4J2C A;  5JR9 B;  3WAJ A;  3ZYM A;  5JDF A;  4V1A v;  4ZI2 D;  1N33 T;  3W15 B;  3TLV A;  1VCS A;  5JVD E;  2IHR 1;  2RA1 A;  3VKG A;  4UEL A;  2N9D A;  5J2U E;  4B3S T;  3FZM B;  4AQG A;  3JC6 D;  2X67 A;  4PJL A;  1D1B A;  3ZMZ B;  3LG7 A;  2WWV A;  3K3Q C;  4FI5 A;  3UU5 A;  4NUV A;  4DR4 T;  2YU1 A;  3G06 A;  1T8B A;  5C2T A;  3GA8 A;  2JPF A;  3OTO T;  3MK7 C;  4EV6 A;  3L8R A;  5L3B B;  5LGT B;  4AQF C;  2PBI A;  4BJN A;  5H6Q B;  1NAF A;  2CA5 A;  2BKP A;  5HXC A;  4HFV A;  1QSD A;  2WDQ A;  2ACX A;  2CLY B;  1N32 T;  5AQM B;  5LHH B;  5CJ5 A;  3QB5 K;  1HG2 A;  4BJM A;  3PUY F;  3RIF A;  2K48 A;  3RYI E;  1VRB A;  2W0G A;  2AE9 A;  2V6Y B;  3OVU A;  2W61 A;  3ZMS B;  2KWI B;  2Q9Q C;  4X64 T;  4P1N A;  3IF8 B;  5TAO A;  2YOE A;  3ZT7 A;  4L9I A;  2X9X A;  4OX9 T;  4AKI A;  4MHC A;  4U2Y A;  5LOV E;  3LK3 B;  4IDQ A;  5LGU B;  4KX6 A;  3N9O A;  4U2Z A;  3Q5E A;  5AQI B;  2V7K A;  4QH4 A;  1AJ3 A;  2V6Y A;  4XZC A;  2LEH A;  2DWG A;  5AQS B;  5EZY E;  3ZJ1 A;  1U4Q A;  4ZI3 D;  5HEU A;  4CN6 A;  2RPA A;  3RIA A;  2BG9 B;  3QOF A;  1M62 A;  3RLF F;  4UVC B;  4CXW A;  3P4P A;  2L9Q A;  4AIS A;  2HHH T;  4WNK A;  3LBX B;  1OWA A;  5KMG P;  3DTO A;  3C4Z A;  1WR6 A;  3VRB A;  1XWM A;  4X5T A;  2HPJ A;  4X66 T;  3VHL A;  4IDP A;  4LF7 T;  3TLT A;  2QA7 A;  4EYU A;  5AFU L;  5AQU B;  1IBM T;  2WQY A;  3LBX A;  2J4G A;  2FJB A;  2CXL A;  4PJJ A;  2PJQ A;  4TWD A;  2VQE T;  1N34 T;  2YDQ A;  5FMN A;  3PUW F;  3PUV F;  4E7S A;  3MAC A;  2YK0 A;  5ABF B;  2MPK A;  4O8S A;  3VR9 A;  1J1J A;  1WR0 A;  3CK6 A;  3SS1 A;  4UF0 B;  2YN6 A;  4IIJ E;  2X68 A;  5JH7 E;  4MBQ A;  2V6X A;  3AAI A;  4JEU B;  1IJ5 A;  3FZL B;  5HXE A;  4PK5 A;  1UK5 A;  2NW7 A;  4CN1 A;  4K0K T;  4AQF A;  3AE7 A;  5ABF A;  3D0T A;  4CQI A;  5E0O A;  5JDQ A;  3UFG A;  2Q9Q B;  3N5L A;  2YU2 A;  4DID B;  2UUC T;  2NW9 A;  3I9W A;  4UF0 A;  4TN7 B;  3SRZ A;  2WDR A;  2UUB T;  3AA6 B;  2CMR A;  2E5V A;  2VKD A;  4DMV A;  3Q2M A;  2JMH A;  2UXX B;  4MFR A;  2WAU A;  2Q9Q A;  5ABE A;  2UXN B;  1LVF A;  4OHF A;  5C8Y E;  3UUB A;  3H37 A;  2XPK A;  1XNQ T;  3J9X 1;  2CXF A;  1QLB A;  3PUS A;  2WM9 A;  2E9X C;  2MAW A;  4GYR A;  2NTY A;  5CFB A;  2BZB A;  2KWH A;  2KSR A;  2LHN A;  3C4X A;  3QB5 A;  3I9Y A;  3ANW B;  3RQU A;  4QXB B;  4TV9 E;  2LM2 A;  4C91 A;  4IL4 A;  1B7T A;  3GN5 A;  3TLW A;  3T1Y T;  2K9A A;  5FP3 A;  1FEW A;  1X9B A;  3KIN B;  2A3D A;  3P4Q A;  3AAE B;  3KFW X;  5JQG E;  4ANJ A;  2CXD A;  4AIU A;  5GON E;  4XBF B;  2LSI A;  2XQ4 A;  4U7I A;  4U7Y A;  1SHZ C;  4UXN B;  5FL0 A;  2Y8D A;  5L47 A;  2W66 A;  4ZOL E;  1KNP A;  3ANW A;  5F3J A;  3IBP A;  5KXJ A;  3RGL A;  2MOZ A;  3LSV A;  3WI3 A;  2M6I A;  3ZCI A;  2CWY A;  3F2E A;  4HFI A;  4JI3 T;  2YDR A;  4EAH A;  3VU7 H;  5JDL A;  5AQT B;  3EAB A;  1ZHC A;  3K3N A;  1NWM X;  4H9P C;  1D0Z A;  2WU5 A;  3RRC A;  4AI6 A;  1OED B;  1ZKE A;  3JC6 C;  1ZOY A;  4JEH B;  1VCT A;  2CHO A;  3JAE A;  3FXE B;  4YJ3 E;  4I43 B;  4QKN A;  3GWH A;  3UQ7 A;  4LFC T;  1BR2 A;  4ZZB A;  3A8Y C;  3TKL B;  4DMW A;  4DV0 T;  2IW5 B;  2KZ7 B;  3UTK A;  1N36 T;  4EED A;  2XQ9 A;  5F8P A;  5LBQ B;  4ADZ A;  3NWI A;  1U5P A;  5JDM A;  3L09 A;  3VR8 A;  2W67 A;  2XUE A;  5IUX A;  5LG3 A;  4PJM A;  2XQ5 A;  1W0B A;  4QX8 B;  4WYV A;  3O4X E;  3Q5D A;  2K3W A;  5LB7 B;  3K8P C;  4DO0 A;  5LG4 A;  3CX7 B;  4I50 E;  4HEA A;  3CIR A;  5FVL A;  2MBG A;  3Q9D A;  5HXS A;  5HWX A;  4HTE A;  2KXP B;  3N9M A;  4U33 A;  2E9X A;  2LSJ A;  2XHE B;  4Z90 A;  3M65 A;  2FJD A;  3UU6 A;  4HWF A;  3PUA A;  2VUR A;  4IE6 A;  4LF4 T;  4HGA A;  1I6Z A;  3AXJ B;  5FY1 A;  1IBK T;  3LK2 B;  3O1J A;  3ZMU B;  1UGO A;  2WP9 A;  4P09 A;  3CX6 B;  3B5M A;  3AEC A;  4HFH A;  4IE7 A;  4LFB T;  1GQE A;  3PUR A;  4ZI3 C;  2D2S A;  2WZI A;  4O2A E;  4OYJ A;  2D9D A;  3C98 B;  5JDG A;  2Z6E A;  3N9N A;  4B3M T;  2N2N A;  2E2A A;  2CE7 A;  5LHG B;  2XQ8 A;  4HFC A;  4UV9 B;  3KBU A;  3AXJ A;  4ILB A;  4ZXL A;  2EHO C;  2X9Y A;  3ONX A;  2XTL A;  1WFD A;  5L2L A;  2CWO A;  3HKC E;  3N9Q A;  3S4U A;  3UU8 A;  5FL1 A;  3CQX C;  2ES0 A;  3NRX A;  4DV6 T;  2NOX A;  4AQY T;  2V7L A;  5CA0 E;  1ZV4 X;  5DJQ C;  4KI0 F;  5JTG A;  4DV4 T;  5FY7 A;  3HKE E;  3B57 A;  4L0R A;  2ZM6 T;  1DU2 A;  1EZ3 A;  2W63 A;  2XQA A;  3OPC A;  4O2B E;  1MMD A;  5BMV E;  4N78 D;  1NEN A;  2JQ9 A;  4EZH A;  5HEH A;  4LF9 T;  5AQQ B;  3JAD A;  3ZST A;  4O4J E;  3AE8 A;  4TX5 A;  1M7K A;  2XZE A;  2ACZ A;  2CHN A;  4DR2 T;  1KK7 A;  3WAK A;  2FUP A;  4HKA A;  2IIU A;  4B3R T;  2WMO A;  3NBX X;  4TUY E;  4A56 A;  3PTR B;  5AQG B;  3MKD A;  3CQG B;  3KV5 A;  4L5G A;  2WB5 A;  2IUB A;  2LSY A;  3RIU C;  4LF6 T;  3U78 A;  4P0B A;  4EXT A;  3ZKR A;  1V9D A;  3ZSS A;  5HXR A;  5L3G B;  3O9X A;  1D1A A;  2V7I A;  1SUM B;  3ONJ A;  3AAA B;  4ZS3 A;  5J0Z A;  4EB6 E;  3N2O A;  1Z8U A;  2JQQ A;  5DQW A;  5LBM A;  2FJE A;  2QYW A;  4X1I E;  2EHO B;  2C0S A;  4IE5 A;  3OBV E;  1XDP A;  4YTP A;  4DR6 T;  3E0Z A;  3J7Y q;  3RHW A;  2V7J A;  5LP6 E;  5LXT E;  1S94 A;  4DUZ T;  3H3M A;  1HR0 T;  1MIW A;  4NUU A;  2Y6X A;  2IAK A;  2UXD T;  4YLH A;  4E7Z A;  4AKH A;  4DR1 T;  1L0V A;  3PU3 A;  2W00 A;  4AKG A;  2EHO A;  3AA7 B;  3V5U A;  4LFA T;  3QC9 A;  3HKB E;  5AQL B;  4PJN A;  5FKY A;  3ZMV B;  5HAX A;  4NPP A;  4UV8 B;  4YT0 A;  3BK9 A;  3AE2 A;  3V5S A;  3P7I A;  2JIW A;  3AEF A;  4IGU A;  4DV5 T;  3RQW A;  2I0M A;  4K0U A;  4PFO A;  3UUL A;  2VKO A;  3E22 E;  4WW0 A;  3MJX A;  2BBJ A;  2G0U A;  3OKQ A;  3CKD A;  4HWC A;  3F31 A;  3JAF A;  4IE4 A;  2BS4 A;  2ZMA A;  3ZEF B;  1KFY A;  4JI1 T;  4H9O C;  2H88 A;  4H9Q C;  3ZJ2 A;  3PU8 A;  5HEG A;  4HWI B;  5AQK B;  1E7P A;  5L3E B;  3N2G E;  3QNU A;  1CUN A;  3ESL A;  4ZS2 A;  4OFZ A;  2NWB A;  5H6R B;  5FXV A;  2CBI A;  3KVB A;  2XSB A;  5JDN A;  3IHR A;  4WBN E;  2N1G A;  5LMU T;  3FHN A;  3SFE A;  3UU3 A;  3QK6 A;  2LSK A;  3ZYK A;  2P9B A;  3NZP A;  3P4W A;  3BQL A;  2I59 A;  2M6B A;  4I0U A;  1WYC A;  3RKG A;  3LJC A;  4U31 A;  2XM1 A;  3UT5 E;  3R6N A;  3BQI A;  2H7V C;  4YFS A;  5L4H A;  4TNV A;  4EEB A;  3DP7 A;  3ZN0 B;  2V7M A;  1UX4 A;  3RIU A;  4B3T T;  5KDM C;  3KV9 A;  4TWF A;  3NRY A;  2V26 A;  3EVY A;  1VOM A;  3KBT A;  5ETW A;  3ZPO A;  2WSS V;  4JI0 T;  4X65 T;  4X1Y E;  1D0X A;  3ZCJ A;  1BR0 A;  3GN5 B;  2BBH A;  3PUX F;  3AEB A;  2Q9Q D;  4KHP T;  5AQJ B;  1HS7 A;  1YQ3 A;  5ABG A;  4DND A;  4U72 A;  4O4I E;  3U3I A;  4JLE A;  2H89 A;  3K3O A;  1WRD A;  2BS3 A;  4UR9 A;  1JNZ A;  4YSZ A;  2V1D B;  3CWZ B;  4IDN A;  4JV5 T;  4QXC B;  3ZT6 A;  2CEA A;  2CBJ A;  2VWA A;  5HCJ A;  4HE8 A;  4KHZ F;  5C3J A;  4JI5 T;  4M1P A;  1G8X A;  2PTF A;  4DV3 T;  2F4V T;  5L3C B;  2A9U A;  4JUY A;  4CXY A;  3PJA A;  1HNZ T;  2LRK A;  3AE3 A;  5AQV B;  4JI6 T;  4ZI2 C;  2I6H A;  5FXX A;  2D5U A;  3L39 A;  4GKJ T;  3L3P A;  2J1D G;  2VL0 A;  4Z8X A;  4NXN T;  3PJA J;  3ZMT B;  1D1C A;  5CB4 E;  4H63 H;  4PFP A;  2ZM8 A;  2DWK A;  2XJ7 A;  4WBO A;  5J2T E;  1Z0P A;  4COF A;  1HX1 B;  4U3C A;  2NTX A;  3C51 A;  4YHH T;  3HI2 A;  1J5W A;  1IJ6 A;  1YKE B;  5L4E A;  3ZC0 A;  3C50 A;  5JR9 C;  4GYS A;  3ABV A;  4G63 A;  2ZM2 A;  1D0Y A;  2D0T A;  3FBZ A;  2HH7 A;  2K24 A;  2XQ3 A;  3RC3 A;  2JQH A;  2FJA A;  2YKS A;  2FBW A;  3N9L A;  1X79 A;  3RKO A;  2K5B B;  2H3R A;  2L8K A;  3RH3 A;  2E8I A;  4JI4 T;  2WS3 A;  5FXZ A;  4CN4 A;  1UUR A;  5HEJ A;  3PUZ F;  2E9X B;  1QUU A;  4QX7 B;  2B76 A;  5L3F B;  1G73 A;  2X9H A;  4ILC A;  4ZI7 E;  4LMJ A;  1NEK A;  3AB3 B;  3FXD B;  2XSA A;  3AVR A;  3RPU A;  2IML A;  1LKX A;  4FJO A;  4B6X A;  3RF1 A;  2BVM A;  4JI8 T;  5HXH A;  3RYC E;  1ZEE A;  2BKO A;  3AE5 A;  2CRB A;  2YEV C;  3CQC B;  1BR4 A;  3ETU A;  4CI2 B;  1HTJ F;  2NW8 A;  2WZH A;  1IAP A;  1Y64 B;  3EDU A;  4H9S E;  4IDO A;  4I4T E;  2X0H A;  1T7S A;  3EAM A;  4YSY A;  5KX5 E;  1UX5 A;  2ODV A;  4DV7 T;  3ZN1 B;  2WMN A;  5LJN A;  4DV1 T;  1ZP0 A;  4HFD A;  5AQP B;  4DV2 T;  1MIY A;  2JJ9 A;  4Z91 A;  1UCU A;  3ZYL A;  3VKH A;  4DBQ A;  2UU9 T;  4H9N C;  1MND A;  2YDS A;  3KDS E;  5F5W A;  4UVA B;  2X66 A;  4H9R C;  4YJ2 E;  3CML A;  2XY8 B;  3B13 A;  3E08 A;  4TWH A;  1HNX T;  5EK3 A;  2XAG B;  2BG9 C;  1I94 T;  2BG9 E;  4UIG A;  4X62 T;  3DJB A;  3RC8 A;  4NXM T;  1IZN B;  3LFM A;  3SFD A;  2QGS A;  1HFA A;  4U74 A;  3MXZ A;  4DR5 T;  4GIW A;  5JR9 A;  4DUY T;  2LM9 A;  5LNK A;  4LML A;  2VQF T;  3RYH E;  4EYY R;  5IYZ E;  1YKH B;  5FVK A;  1FJG T;  4QWN B;  2V5C A;  2UUA T;  2W62 A;  2UXB T;  4A98 A;  1XMO T;  3EDV A;  4NIQ A;  4QHO A;  1LVK A;  2JRK A;  4ZEY A;  3ZC1 A;  4ZZC A;  4HFE A;  2X0L B;  4GOU A;  1UUS A;  5LGN B;  2KMF A;  3BQK A;  4YSX A;  2A2F X;  3UFE A;  4DR3 T;  3M3Z B;  4IST A;  5HEO A;  4IL9 A;  3CPZ A;  1CHU A;  2J47 A;  5LCY A;  1XZY A;  2LJL A;  4EIW A;  3TLS A;  3GMI A;  4GK0 E;  5FNV E;  3AE9 A;  5ABH A;  2IDO B;  2XAS B;  3NKZ A;  5CA1 E;  3MA9 A;  2OA5 A;  4DR7 T;  1IBL T;  2LSG A;  4CI1 B;  1HF8 A;  5AQR B;  5LYJ E;  3ETV A;  3HL6 A;  1SE7 A;  2LKH A;  4LMK A;  2HN1 A;  3NZQ A;  4HWD A;  3HKD E;  2OV9 A;  3OYX A;  3IA3 A;  5JRE A;  3UQ4 A;  1YXR A;  3EI0 A;  2W2U A;  1XMQ T;  5M4Y A;  4A5X A;  2LT3 A;  5JRC B;  4EGW A;  3SWH A;  3P4R A;  4A97 A;  4BA9 A;  4ISS A;  4CZZ B;  3CX8 B;  4YXD A;  1J5E T;  2XAF B;  2EHO D;  1W9R A;  1MMA A;  3SOL A;  1YQ4 A;  3PDY A;  4AKR B;  2BVL A;  3UUN A;  1WLX A;  3PE0 A;  2BG9 A;  5J1G A;  3KV4 A;  4LF5 T;  3PUG A;  5JRC A;  3Q5W A;  3QUJ A;  1SA0 E;  2BKN A;  2KT9 A;  3I0Q A;  4G2A A;  3P8C D;  3X1D A;  5HCM A;  5LHI B;  5FY0 A;  3T8O A;  5EK2 A;  2VKJ A;  3AEA A;  2MYS A;  2GK9 A;  5IHY A;  4O4H E;  3A7M A;  3RI5 A;  2C5I T;  1LRZ A;  2JMK A;  2VAS A;  5AQH B;  2NP9 A;  3O1H A;  4MAL A;  2WWU A;  4PW8 A;  2DCF A;  4TNW A;  4ERR A;  2XM2 A;  2WU2 A;  4ASK A;  2IC9 A;  1KNR A;  3RYF E;  4BAY B;  4F8H A;  3NVO A;  3AVS A;  5DAB A;  3R84 B;  1XNR T;  3K1S A;  2QRX A;  2PG8 A;  1US7 B;  5LA6 E;  3A5X A;  2VK9 A;  2SPC A;  2LE8 A;  3AEE A;  4LF8 T;  2DLR A;  1MMG A;  2C5J A;  4IE0 A;  4H63 V;  1OED C;  2ZLY A;  3Q5X A;  1OED E;  3KV6 A;  4PK4 A;  4QXH B;  4PK6 A;  5BR8 T;  2R6G F;  3KVA A;  2XQ7 A;  2VL8 A;  3O1I A;  3ZLI A;  1MMN A;  2NR4 A;  3F57 A;  4KUM B;  5AQF B;  3CVR A;  5AQO B;  2A72 A;  2DI4 A;  2V8S V;  4KMC A;  3C4W A;  3P50 A;  1YD8 G;  3HR0 A;  1HNW T;  1T98 A;  4KBM B;  1MNE A;  3AEG A;  2L3L A;  2MTQ A;  2X9W A;  4TV8 E;  3N9P A;  3H3A A;  1FMW A;  2CCQ A;  3LK4 2;  1HX8 A;  1WYB A;  1MIV A;  1FMV A;  3ZT5 A;  4YTN A;  2DL1 A;  4IDZ A;  2WCA A;  3AE1 A;  4EZ4 A;  4KP3 C;  2DNX A;  2XQ6 A;  3RX6 A;  2IC6 A;  3C64 A;  3EUH A;  5FYM A;  1T72 A;  4MLK A;  1OXZ A;  3AA1 B;  2VVN A;  3MZK B;  5CGM A;  4YY3 T;  4OK0 A;  5ADX L;  3AE6 A;  3UUM A;  2BS2 A;  4JYA T;  5LMN T;  4IHJ E;  5HYA A;  2WY2 A;  5HWY A;  4OYK A;  3UU4 A;  4ILA A;  4YTM A;  2LRL A;  2VKH A;  4F6R C;  5IWA T;  4X1K E;  1FIO A;  1KNZ A;  3AA0 B;  3I0O A;  1HCI A;  1W09 A;  2KIN B;  4PAG A;  4JBW F;  4CXX A;  2HPL A;  2VB6 A;  2V5D A;  4QH1 A;  4UVB B;  1KF6 A;  2YIN A;  2DHR A;  3FZK B;  1E1H B;  1KEY A;  1WCR A;  2ZM0 A;  2RP4 A;  2X51 A;  2ODU A;  2WDV A;  2X0Y A;  4PNI A;  3UUX B;  3FB2 A;  4HN9 A;  2LOP A;  4HWH A;  4UEM A;  3I1A A;  2KND A;  3N2K E;  2B1E A;  2CPT A;  4TZ4 C;  4DVD A;  1HG5 A;  5DQV A;  2PFV A;  3PV0 F;  1YW0 A;  2XQY A;  2CM0 A;  1OED A;  4CI3 B;  3IEE A;  2UXC T;  3JCF A;  3HA4 A;  4AKL A;  3AED A;  2W4X A;  4GK5 E;  2LKG A;  4DBR A;  1XDO A;  2WBL A;  1BR1 A;  5FXW A;  3LDQ B;  4JI2 T;  4O4L E;  4QH5 A;  5JDH A;  1O3X A;  2HN2 A;  3AE4 A;  2JQK A;  3FZF B;  4XAX B;  4JI7 T;  4EOZ B;  2LOS A;  4X20 E;  2BDE A;  4GKK T;  3OYZ A;  4I55 E;  2D0U A;  1H7C A;  4AXP A;  3OJA A;  1JNR A;  2E9X D;  4ILU A;  4Q25 A;  5LJM A;  4C90 A;  4HFB A;  3VRA A;  2H7O A;  2CLY C;  3ONL C;  4ZHQ E;  4IRE A;  5AQN B;  2OLT A;  4WZX A;  2XAQ B;  2KLQ A;  1R8I A;  5A1L A; 
#chains in the Genus database with same CATH homology
 4EAH A;  4IST A;  3VU7 H;  5JDL A;  1ZHC A;  3CPZ A;  4WBN E;  2N1G A;  3FHN A;  3QK6 A;  3K3N A;  2LSK A;  1S35 A;  5LCY A;  3RRW A;  3ZYK A;  4P0A A;  1NWM X;  2P9B A;  3NZP A;  3BQL A;  2Y48 B;  4H9P C;  1D0Z A;  2XAJ B;  2LJL A;  4EIW A;  4YHJ A;  3GMI A;  4GK0 E;  2I59 A;  5FNV E;  3RRC A;  5EK4 A;  3PUQ A;  2M67 A;  4AI6 A;  3FBL A;  1WYC A;  3JC6 C;  1ZKE A;  3LJC A;  3UT5 E;  2LHR A;  3R6N A;  2XAS B;  4JEH B;  3BQI A;  2H7V C;  4YFS A;  5L3D B;  5CA1 E;  3MA9 A;  2OA5 A;  3FXE B;  2XAH B;  3DP7 A;  3ZN0 B;  2V7M A;  1UX4 A;  4YJ3 E;  2C5K T;  4I43 B;  5KDM C;  2LSG A;  4J2C A;  3KV9 A;  4CI1 B;  4QKN A;  1HF8 A;  5JR9 B;  5LYJ E;  3GWH A;  3NRY A;  3WAJ A;  3ZYM A;  3ETV A;  2V26 A;  3EVY A;  3HL6 A;  5JDF A;  1BR2 A;  1VOM A;  3KBT A;  4V1A v;  5ETW A;  3TKL B;  4DMW A;  3ZPO A;  4ZI2 D;  2WSS V;  3W15 B;  3NZQ A;  4X1Y E;  1D0X A;  3HKD E;  3ZCJ A;  1BR0 A;  3GN5 B;  5JVD E;  3OYX A;  2IW5 B;  2KZ7 B;  2RA1 A;  3VKG A;  5JRE A;  4UEL A;  2Q9Q D;  2N9D A;  5J2U E;  3UTK A;  4AQG A;  1HS7 A;  5M4Y A;  3JC6 D;  5F8P A;  2LT3 A;  5JRC B;  2X67 A;  5LBQ B;  4ADZ A;  4PJL A;  1U5P A;  1D1B A;  3SWH A;  5JDM A;  3L09 A;  3ZMZ B;  4BA9 A;  4DND A;  4ISS A;  4U72 A;  4CZZ B;  3CX8 B;  2XUE A;  3LG7 A;  2XAF B;  4O4I E;  4PJM A;  4QX8 B;  3U3I A;  2EHO D;  1MMA A;  3K3Q C;  3SOL A;  4JLE A;  3PDY A;  4FI5 A;  4AKR B;  3O4X E;  4NUV A;  2BVL A;  3UUN A;  3K8P C;  4DO0 A;  3K3O A;  1WRD A;  5LG4 A;  1WLX A;  3CX7 B;  3PE0 A;  4I50 E;  2YU1 A;  4HEA A;  2V1D B;  2MBG A;  3Q9D A;  3GA8 A;  3CWZ B;  2JPF A;  5J1G A;  3KV4 A;  5HXS A;  4QXC B;  5HWX A;  3MK7 C;  3PUG A;  4HTE A;  5JRC A;  3Q5W A;  2KXP B;  3QUJ A;  2CEA A;  1SA0 E;  2VWA A;  5L3B B;  5LGT B;  4AQF C;  3N9M A;  4HE8 A;  2E9X A;  2LSJ A;  2XHE B;  2KT9 A;  3I0Q A;  3M65 A;  2PBI A;  4G2A A;  3P8C D;  4M1P A;  4BJN A;  5H6Q B;  5LHI B;  1NAF A;  1G8X A;  2CA5 A;  5FY0 A;  3T8O A;  5EK2 A;  3PUA A;  2VKJ A;  5L3C B;  2MYS A;  2GK9 A;  4JUY A;  5HXC A;  4HFV A;  5IHY A;  4CXY A;  4O4H E;  1QSD A;  4IE6 A;  4HGA A;  2C5I T;  5FY1 A;  1LRZ A;  2ACX A;  2JMK A;  2VAS A;  2CLY B;  3LK2 B;  2NP9 A;  3O1H A;  3O1J A;  4MAL A;  2WWU A;  4PW8 A;  2DCF A;  4ERR A;  4ZI2 C;  5LHH B;  3ZMU B;  1HG2 A;  4BJM A;  5FXX A;  4P09 A;  3CX6 B;  4ASK A;  2D5U A;  2IC9 A;  2K48 A;  3RYI E;  3L3P A;  1VRB A;  4IE7 A;  2J1D G;  2W0G A;  3RYF E;  3PUR A;  4ZI3 C;  4BAY B;  2D2S A;  3AVS A;  2W61 A;  4O2A E;  3ZMS B;  4OYJ A;  2KWI B;  5DAB A;  2Q9Q C;  4Z8X A;  3R84 B;  3C98 B;  3IF8 B;  5TAO A;  3ZMT B;  5JDG A;  4L9I A;  2X9X A;  1D1C A;  2PG8 A;  2Z6E A;  1US7 B;  3N9N A;  5LA6 E;  2N2N A;  5CB4 E;  4H63 H;  3A5X A;  2ZM8 A;  2CE7 A;  2DWK A;  2VK9 A;  4PFP A;  5LHG B;  2SPC A;  2LE8 A;  4WBO A;  2DLR A;  4UV9 B;  5J2T E;  3KBU A;  1Z0P A;  1MMG A;  2C5J A;  4IE0 A;  4H63 V;  2ZLY A;  4MHC A;  3Q5X A;  3KV6 A;  4PK4 A;  5LOV E;  3LK3 B;  2EHO C;  2NTX A;  3C51 A;  4QXH B;  4PK6 A;  5LGU B;  2X9Y A;  3N9O A;  3HI2 A;  3ONX A;  2XTL A;  2V7K A;  1IJ6 A;  1YKE B;  3KVA A;  5L2L A;  2CWO A;  3HKC E;  3ZC0 A;  2VL8 A;  3O1I A;  3ZLI A;  1AJ3 A;  3C50 A;  3N9Q A;  3S4U A;  5JR9 C;  4GYS A;  4G63 A;  1MMN A;  4XZC A;  3CQX C;  2ES0 A;  3NRX A;  2ZM2 A;  2LEH A;  1D0Y A;  2D0T A;  2DWG A;  2NOX A;  3F57 A;  3FBZ A;  2HH7 A;  2K24 A;  5EZY E;  3ZJ1 A;  4KUM B;  1U4Q A;  3RC3 A;  4ZI3 D;  3CVR A;  3N9L A;  1X79 A;  2A72 A;  2DI4 A;  4KMC A;  3C4W A;  3RKO A;  2K5B B;  2H3R A;  2V7L A;  5CA0 E;  1ZV4 X;  2L8K A;  5DJQ C;  1YD8 G;  4UVC B;  3HR0 A;  4CXW A;  3RH3 A;  2E8I A;  1T98 A;  2L9Q A;  5FY7 A;  5FXZ A;  4WNK A;  3LBX B;  1OWA A;  5KMG P;  3DTO A;  3HKE E;  3C4Z A;  2E9X B;  1WR6 A;  3B57 A;  4L0R A;  1QUU A;  4AKI A;  4QX7 B;  4KBM B;  1MNE A;  1EZ3 A;  2W63 A;  2L3L A;  5L3F B;  2MTQ A;  2X9W A;  4TV8 E;  1G73 A;  2X9H A;  2HPJ A;  3N9P A;  3H3A A;  4O2B E;  4ZI7 E;  1MMD A;  5BMV E;  4N78 D;  3VHL A;  1FMW A;  2CCQ A;  3LK4 2;  1HX8 A;  3AB3 B;  1WYB A;  1MIV A;  4EZH A;  3FXD B;  1FMV A;  2QA7 A;  4EYU A;  5AFU L;  4IDZ A;  4EZ4 A;  4O4J E;  3AVR A;  4TX5 A;  3RPU A;  4KP3 C;  3LBX A;  1LKX A;  2DNX A;  2CXL A;  4PJJ A;  4FJO A;  2PJQ A;  4B6X A;  2BVM A;  1KK7 A;  3RX6 A;  5FMN A;  3WAK A;  5HXH A;  2IC6 A;  3C64 A;  3EUH A;  3RYC E;  1ZEE A;  4HKA A;  5FYM A;  4E7S A;  2WMO A;  4MLK A;  3NBX X;  3MAC A;  1OXZ A;  4TUY E;  2YK0 A;  3AA1 B;  3MZK B;  4A56 A;  2YEV C;  3PTR B;  4O8S A;  3CQC B;  4OK0 A;  5ADX L;  1BR4 A;  3ETU A;  3UUM A;  4CI2 B;  3MKD A;  3CQG B;  4IHJ E;  3SS1 A;  3KV5 A;  4L5G A;  1HTJ F;  4UF0 B;  5HYA A;  2NW8 A;  4IIJ E;  2LSY A;  2X68 A;  5JH7 E;  4MBQ A;  1IAP A;  1Y64 B;  3EDU A;  3AAI A;  4H9S E;  5HWY A;  4OYK A;  4JEU B;  3U78 A;  1IJ5 A;  4P0B A;  5HXE A;  4PK5 A;  4I4T E;  2NW7 A;  4EXT A;  1V9D A;  2VKH A;  4AQF A;  5KX5 E;  5HXR A;  1UX5 A;  2ODV A;  4F6R C;  5L3G B;  3ZN1 B;  3D0T A;  2WMN A;  4CQI A;  1D1A A;  5E0O A;  5LJN A;  3O9X A;  2V7I A;  4X1K E;  5JDQ A;  1FIO A;  1KNZ A;  2Q9Q B;  3AAA B;  3AA0 B;  1MIY A;  3I0O A;  3N5L A;  4ZS3 A;  1HCI A;  2JJ9 A;  2YU2 A;  2KIN B;  4PAG A;  4CXX A;  2NW9 A;  3I9W A;  2HPL A;  4EB6 E;  2VB6 A;  1UCU A;  3N2O A;  4UF0 A;  3ZYL A;  2JQQ A;  4TN7 B;  5DQW A;  5LBM A;  3SRZ A;  4UVB B;  3VKH A;  4DBQ A;  2YIN A;  2DHR A;  3AA6 B;  4H9N C;  4X1I E;  2EHO B;  2C0S A;  1MND A;  1E1H B;  2CMR A;  3KDS E;  4IE5 A;  3OBV E;  2VKD A;  2ZM0 A;  4DMV A;  3Q2M A;  2RP4 A;  2X51 A;  2ODU A;  4PNI A;  3UUX B;  3FB2 A;  4HN9 A;  3E0Z A;  4UVA B;  2JMH A;  2UXX B;  2X66 A;  4MFR A;  2LOP A;  4UEM A;  3J7Y q;  3I1A A;  2WAU A;  2KND A;  4H9R C;  2Q9Q A;  2V7J A;  3N2K E;  2B1E A;  3CML A;  4YJ2 E;  5LP6 E;  5LXT E;  2UXN B;  1S94 A;  3B13 A;  3E08 A;  1MIW A;  1LVF A;  4OHF A;  4NUU A;  2Y6X A;  5C8Y E;  2IAK A;  4TZ4 C;  4DVD A;  1HG5 A;  5EK3 A;  4YLH A;  2XAG B;  5DQV A;  4E7Z A;  2PFV A;  4AKH A;  1YW0 A;  2XQY A;  3PU3 A;  2CM0 A;  4CI3 B;  3H37 A;  4UIG A;  3IEE A;  2W00 A;  4AKG A;  3DJB A;  3J9X 1;  3HA4 A;  2EHO A;  3AA7 B;  4AKL A;  2CXF A;  3V5U A;  3PUS A;  3QC9 A;  2WM9 A;  3RC8 A;  2E9X C;  1IZN B;  4GK5 E;  3LFM A;  2QGS A;  3HKB E;  4PJN A;  1HFA A;  2NTY A;  4GYR A;  4U74 A;  3MXZ A;  3ZMV B;  2BZB A;  4GIW A;  2KWH A;  5JR9 A;  4DBR A;  5HAX A;  2LHN A;  3C4X A;  4UV8 B;  2LM9 A;  3BK9 A;  5LNK A;  3V5S A;  2WBL A;  3I9Y A;  3RYH E;  1BR1 A;  3P7I A;  5FXW A;  4EYY R;  4IGU A;  5IYZ E;  1YKH B;  3ANW B;  4QXB B;  4TV9 E;  4K0U A;  4PFO A;  4O4L E;  4C91 A;  5JDH A;  3UUL A;  4QWN B;  1O3X A;  2VKO A;  1B7T A;  2W62 A;  3E22 E;  3GN5 A;  4WW0 A;  2K9A A;  5FP3 A;  1FEW A;  3MJX A;  4XAX B;  3KIN B;  2G0U A;  2A3D A;  3OKQ A;  4EOZ B;  2LOS A;  3CKD A;  3EDV A;  3AAE B;  3KFW X;  4QHO A;  2BDE A;  3F31 A;  4IE4 A;  4X20 E;  1LVK A;  4ANJ A;  2CXD A;  2JRK A;  5JQG E;  2ZMA A;  3ZEF B;  5GON E;  4XBF B;  2LSI A;  3OYZ A;  4I55 E;  3ZC1 A;  1SHZ C;  2D0U A;  1H7C A;  4UXN B;  4AXP A;  3OJA A;  2E9X D;  4ILU A;  2X0L B;  2Y8D A;  4H9O C;  4GOU A;  4ZOL E;  4H9Q C;  4C90 A;  3ANW A;  3ZJ2 A;  3PU8 A;  5LJM A;  5LGN B;  5F3J A;  2KMF A;  3IBP A;  2MOZ A;  2H7O A;  2CLY C;  5L3E B;  3WI3 A;  3N2G E;  3ZCI A;  2CWY A;  1CUN A;  3ESL A;  4ZS2 A;  4ZHQ E;  4OFZ A;  2NWB A;  3F2E A;  3BQK A;  5FXV A;  5H6R B;  3KVB A;  5JDN A;  2A2F X;  2XAQ B;  3IHR A;  2KLQ A;  3UFE A;  5A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...