4H9SE

Complex structure 6 of daxx/h3.3(sub7)/h4
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
204
structure length
199
Chain Sequence
SRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 71
structure length 199
sequence length 204
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9sE00
4H9QC 4HGAA 5KDMC 4H9OC 4H9PC 4H9NC 4H9RC 4H9SE
chains in the Genus database with same CATH superfamily
4L9IA 3FXDB 1T8BA 3LJCA 3KV4A 3UFEA 3UT5E 1I6ZA 1ZOYA 4PJMA 4YY3T 4BJMA 4XZCA 2CM0A 4UF0B 3EHZA 1T72A 3ZLIA 1HX1B 5C8YE 1WCRA 3TLVA 1J5ET 1MIWA 2RPAA 3JADA 3K3QC 2WZHA 3ZJ2A 4DV0T 3CMLA 4NPPA 3PURA 4OX9T 2LOSA 4NXNT 5IWAT 2E9XC 2Q9QD 4XBFB 4JV5T 3AEEA 3FBZA 3N9MA 4K0UA 2W4XA 3ZYMA 5FXXA 2CRBA 5L4HA 2LM2A 1IBKT 3CK6A 2WWVA 4EYYR 3I1AA 4AKHA 3VHLA 3IHRA 3ZEFB 2B76A 4DIDB 4J2CA 2X67A 3RYIE 2V1DB 2YINA 2JQ9A 5FP3A 4UIGA 4JI1T 4TN7B 1BR0A 3VKGA 2D0TA 2V6YB 4FI5A 2XSAA 3RIFA 2XQ5A 1ZEEA 4DVDA 4U7YA 5LHGB 2LJLA 2V26A 1E7PA 4HEAA 4L5GA 3L3PA 3AE8A 4KI0F 1S35A 4PFOA 2WY2A 3F31A 2V7LA 3AXJB 1AJ3A 1UX4A 4U3CA 4H63H 5J1GA 4ILUA 2M6IA 1YQ3A 4HFDA 4PK5A 4TNWA 3OYXA 4DMWA 3LK2B 4ZS3A 2XAGB 4IL4A 1WR6A 5DQVA 3I9YA 5ABFB 5HXRA 2V7KA 2V6YA 4C90A 5M4YA 4HFCA 4E7SA 4QX7B 2MBGA 4KHPT 2D9DA 3EABA 5H6RB 5C2TA 2K48A 3IEEA 4YTPA 4X1YE 2UU9T 2E5LT 1X9BA 3F57A 4P0AA 5F8PA 3HKEE 4OYJA 2EHOC 2MAWA 3AEGA 3PUAA 4HWDA 4IGUA 1G73A 3NKZA 4ZI2C 2VKOA 4PW8A 2YOEA 3PUSA 2K3WA 1MMAA 3K3NA 2OA5A 2IAKA 3UU4A 2KNDA 1IBMT 4KP3C 1WYCA 5ETWA 2LSGA 4GKJT 4DR1T 2K24A 3CKDA 4IREA 2K9AA 3P4SA 5AQJB 2OLTA 2YKSA 4EZ4A 5LGNB 5LJNA 4X66T 2L9QA 4TWDA 5JQGE 3ETUA 2XQ7A 2KLQA 3DTOA 5JTGA 2E9XB 5AQLB 3R6NA 3LG7A 3VRAA 2RP4A 3U3IA 3ZN0B 5LBQB 3O9XA 2XAHB 5LA6E 5HEHA 1D1BA 1VRBA 5HCMA 3HKDE 3SFDA 4M1PA 1WYBA 2WCAA 3ZSTA 2C0SA 3AVRA 4EEBA 2H89A 2M67A 2WWUA 2WB5A 4LF4T 3RQUA 2JIWA 2WMOA 4GK0E 1IJ5A 4QH4A 5FXVA 5JREA 2H7OA 3EI0A 2CLYC 4KX6A 3P8CD 2XM2A 3NZPA 1N33T 4EEDA 3QOFA 1KNRA 4ISSA 4PNIA 4CN6A 5J2UE 3E08A 1H7CA 4U2ZA 5JDLA 4HN9A 4JLEA 2PFVA 3FZHB 4EXTA 2I59A 4DO0A 3GWHA 3CX6B 5JVDE 3AE3A 2WU5A 2LRLA 4O8SA 5F3JA 2BKNA 1Z0PA 1J5WA 2Q9QB 5AQVB 2F4VT 3KBUA 3ANWA 2YU1A 4IDOA 3UU5A 5HYAA 5IHYA 2J4GA 3RX6A 2JMHA 3MJXA 4IE5A 3HI2A 5HWYA 4I55E 4IDNA 4IDQA 4AKRB 2FUPA 4P1NA 2ZMAA 2QRXA 2W0GA 3C4ZA 3JC6D 3N9QA 4UV9B 4YFSA 4YT0A 3O4XE 4ZI2D 2NW7A 2DLRA 1XMQT 1M62A 2VQET 2LKGA 2CBJA 3OVUA 2PJQA 2CCQA 3H3MA 3RYFE 3ZT5A 1HCIA 5LMUT 2HN2A 3GA8A 4C91A 2NWBA 1E1HB 2CWOA 2L3LA 4I4TE 3WAJA 4LF9T 4AXPA 3Q5XA 1HS7A 4DUZT 5ADXL 4PJLA 4TWHA 5BMVE 2X9XA 4A97A 3B5MA 3LBXA 4LF5T 1BR2A 2LEHA 2PBIA 4ZZBA 3MZKB 4CXWA 5FNVE 2JQKA 3F2EA 4HKAA 4QXCB 3KFWX 3L09A 4EYUA 2VWAA 2BG9C 3I9WA 3M3ZB 1BR4A 1Y01A 5FKYA 2HPJA 1L0VA 3RRCA 2IIUA 4I43B 5HEUA 3ZJ1A 1U4QA 2VKHA 2NR4A 3LK42 3BQLA 4IE4A 2JQQA 2NTXA 2PTFA 2A2FX 3CIRA 4UF0A 3RKGA 3A5XA 3ABVA 3AEDA 3ONJA 2K5BB 3AE4A 2V7MA 2E2AA 3JC6C 3N9OA 2XUEA 4UXNB 5HXHA 4HWHA 1NEKA 5FL1A 2H3RA 2XHEB 2IHR1 3CWZB 3LBXB 2E5VA 3B13A 2P9BA 1LVFA 3OJAA 5TAOA 3O1HA 4MFRA 5IUXA 3HKBE 1QLBA 5C3JA 2VURA 2VK9A 2Y48B 4H9OC 4JEUB 5L3EB 4IL9A 2OV9A 4ZOLE 4DNDA 1G8XA 5JRCA 3KBTA 4YSXA 1D0YA 3KVAA 1GQEA 4OHFA 2R6GF 3CQGB 3H37A 2V5DA 1UGOA 4ILAA 1HG2A 2JPFA 3LSVA 3OYZA 5LB7B 4AKIA 5LXTE 2I0MA 4AIUA 2DL1A 1JNRA 4UVAB 5LOVE 4IDZA 2X0HA 3WAKA 5FXWA 2YN6A 2FJAA 4CN1A 1N36T 2VASA 2W61A 3CVRA 3LK3B 5HAXA 2QA7A 3AAIA 2Q9QA 3PDYA 3T8OA 1HNZT 3ESLA 1VCSA 3KV9A 3UU3A 3RH3A 3ZT6A 5JRCB 3ONXA 4JI4T 1D0XA 1S94A 3BQIA 5JR9A 3ZMSB 4ISTA 4EGWA 2UUCT 2LSIA 3BQKA 3KV6A 2CWYA 3TLWA 1OEDE 3SS1A 2JRKA 4JI0T 4ZI7E 3MACA 4ADZA 2WDRA 3RPUA 3RYHE 3Q5EA 2VKJA 3UQ7A 4U2YA 4JI7T 5AQIB 4UEMA 3V5UA 4COFA 4EZHA 3J7Yq 3OTOT 3NZQA 2HH7A 3DJBA 2HHHT 2BG9A 2IUBA 4HGAA 2BKPA 3PJAJ 3AE5A 2D5UA 4GYSA 4H9NC 4Q25A 2VVNA 1JNZA 3QB5K 5AQFB 4LF6T 3AE7A 2EHOA 2BVLA 3GMIA 4HFHA 1MMNA 3PU8A 2VL8A 3U78A 5FVKA 2IC9A 2YK0A 4NIQA 4X65T 2PG8A 3ZCJA 3C98B 1W0AA 1MMGA 3O1IA 3ZPOA 5AQTB 3AE1A 5ABHA 1US7B 2KSRA 3VR9A 4F8HA 5JDGA 4NXMT 4H9PC 2WDVA 4MHCA 5JDQA 4KBMB 2XQYA 1Z8UA 4UV8B 4JI3T 4DR4T 2D2SA 5L2LA 3ZMTB 4CI1B 2J1DG 4IDPA 4KUMB 5DABA 2XPKA 2XZEA 4YTNA 5EK2A 2N1GA 5EK4A 3T1YT 4Z91A 1MNEA 1LKXA 2DWGA 2QGSA 4YXDA 2CMRA 3UQ4A 1T7SA 3TLTA 4JYAT 2X0LB 3UU6A 1U5PA 4U31A 4HFBA 2XM1A 4MALA 1XNRT 1MIVA 3L8RA 1KF6A 2AXDS 2CHNA 2LSJA 3KDSE 4KHZF 1OWAA 2XSBA 4GIWA 3RIUC 2XAJB 4DR5T 5GONE 3ZYKA 5LHIB 3RKOA 2WS3A 2ZM0A 4DMVA 2BS3A 5FL0A 5HXEA 2NW9A 3RIAA 4DV4T 4DR6T 5JR9C 1V9DA 3O1JA 3UULA 2EHOD 3PUZF 2BZBA 4ANJA 2XASB 1HNXT 3OBVE 2W00A 4EV6A 2BKOA 4GK5E 5A1LA 4U72A 2N9DA 3P50A 2KWHA 4V1Av 1IBLT 1YD8G 3ZC0A 5L4EA 1YW0A 4JI2T 4HWFA 3CX8B 3GN5A 3MXZA 1UUSA 2CPTA 4HFVA 5LGTB 2ES0A 2WZIA 3RI5A 2L8KA 3NRXA 4UVCB 5LCYA 4HFEA 5AFUL 3PE0A 5CFBA 4X62T 4X64T 4DR3T 2JJ9A 1QUUA 2XQ8A 3AE6A 5L47A 4LFAT 2V7IA 2BG9E 4AI6A 1YKHB 2LHNA 2XQ9A 1SHZC 1KEYA 3HL6A 3PUWF 4DUYT 3TKLB 1FMVA 3CQXC 4YLHA 5CA1E 3AA6B 4X1IE 5AQMB 3V5SA 1B7TA 3I0QA 3UFGA 4XAXB 4YJ2E 5L3GB 5FY7A 3FB2A 1NAFA 2UUBT 1OEDA 4O4LE 1LVKA 2CEAA 2W66A 4TV9E 5AQRB 4BA9A 4Z8XA 4EOZB 5DJQC 3A8YC 2J62A 2C5KT 4WNKA 5HEGA 2CHOA 2WQYA 3NBXX 3C4WA 1MNDA 5HEJA 5JDMA 5JDNA 4FJOA 5FYMA 1DU2A 4NUUA 1BR1A 2UUAT 3SWHA 4AKLA 2ODVA 1W09A 2XQAA 2Y8DA 3WI3A 2X9YA 5CJ5A 5J0ZA 2LE8A 4H9RC 3FZMB 3RF1A 2KMFA 2A72A 2LSYA 4TZ4C 4A98A 2UXDT 4TUYE 3JAFA 3VR8A 4F6RC 1SE7A 1WR0A 4YSYA 1SUMB 1WFDA 3ANWB 3MKDA 4O2AE 5L3CB 2BBJA 2CXLA 2JQHA 4N78D 4YHHT 4U74A 1HX8A 3N9NA 2X66A 3J9X1 1YKEB 3N9LA 2VB6A 3Q2MA 3RRWA 4CI2B 5HCJA 3UUBA 4AISA 1W0BA 2B1EA 2NTYA 4GOUA 2KINB 3EVYA 3K8PC 4ILBA 1CUNA 1D0ZA 3AA0B 4PJNA 4TX5A 2CLYB 5DQWA 3AB3B 2UXCT 3SRZA 4PAGA 3QUJA 1FEWA 2LRKA 4AQFC 5LJMA 3RC8A 5LMNT 2A3DA 2YU2A 1IZNB 1D1CA 4WZXA 3S4UA 2N2NA 3IBPA 3ZKRA 5AQSB 2SPCA 4ZI3C 4DV1T 4B3RT 2IC6A 5EK3A 4A5XA 2CXDA 2FJDA 2XAQB 3JAEA 2LT3A 3Q5WA 4CZZB 2RA1A 2DHRA 4LMJA 3SOLA 2VQFT 2CE7A 3Q5DA 5EZYE 5FMNA 2XQ6A 3RHWA 4ZEYA 2E9XA 5HWXA 4IHJE 1EZ3A 4UR9A 2BS4A 5LP6E 3FZKB 1XWMA 4I0UA 4QKNA 3ZN1B 5JH7E 4P09A 2EHOB 4PK6A 2GK9A 3IF8B 4YJ3E 3UUNA 3RC3A 2XQ4A 5L3BB 5E0OA 2UXNB 5LGUB 3CPZA 2BG9B 5LYJE 4HFIA 2W62A 4LFCT 3EDUA 5HXCA 4QWNB 2YDRA 3RQWA 3MA9A 3RGLA 4QX8B 1CHUA 4TV8E 5KMGP 4AQYT 5FY1A 1N32T 1YQ4A 4HTEA 2KWIB 3FZFB 1QSDA 2BBHA 1UCUA 3C50A 3P4RA 2LLYA 3RLFF 3ZMVB 4CXXA 2XTLA 3BK9A 4DBRA 1MMDA 2Y6XA 3CX7B 3N9PA 4DBQA 2QVAA 3R84B 4DV7T 3A7MA 2DI4A 3UTKA 4DR2T 2DWKA 4WBOA 2WMNA 4EB6E 2CXFA 2WAUA 4ZXLA 4LFBT 3KVBA 4UELA 5AQOB 1T98A 3C51A 3AA7B 4JUYA 4HE8A 1WRDA 2E9XD 2Q9QC 2V7JA 5CGMA 1MIYA 4ZZCA 4CN4A 5LG3A 2BDEA 1WLXA 4K0KT 2UXXB 3B57A 4P0BA 1HR0T 4IE7A 4JI8T 4AKGA 2X9HA 1HF8A 2KXPB 2X0YA 1Y64B 2DNXA 4B3TT 4OFZA 4CI3B 4DV3T 2W63A 5ABFA 4G2AA 2H7VC 3L39A 1W9RA 4IE0A 4QXBB 5L3DB 2E8IA 4QH5A 3PUYF 3GN5B 4OYKA 1HNWT 4QH1A 3ZMZB 3NWIA 1UX5A 4G63A 3TLSA 2VKDA 3PUXF 1XZYA 3N5LA 3G06A 4JEHB 2ZM6T 1HG5A 3FZLB 2KZ7B 3PUGA 3AA1B 3PUVF 2I6HA 2X9WA 3OPCA 4U7IA 4B3ST 5AQGB 3W15B 3ZMUB 2UXBT 2MOZA 3PU3A 2W67A 2V8SV 2XJ7A 1NWMX 1D1AA 2DCFA 3D0TA 4YHJA 4X5TA 2H88A 1UK5A 5JDFA 3C4XA 5HEOA 4MBQA 3CQCB 2V6XA 4PK4A 4BAYB 1SA0E 2J47A 3K3OA 3P4PA 4GYRA 2FJEA 3AE9A 1KNZA 3EUHA 4LMLA 3ZYLA 1IAPA 2C5JA 2NP9A 3H3AA 4O4HE 4YTMA 1UURA 3HR0A 4PJJA 2MYSA 3UU8A 4A56A 3ZSSA 2KT9A 2LSKA 3LDQB 1M7KA 4TNVA 4UVBB 3FBLA 4OK0A 4CXYA 2HN1A 3PJAA 4U33A 1X79A 4DR7T 3AEAA 2XY8B 3FHNA 1E2AA 4DV6T 4HWCA 4ZS2A 3RYCE 2IDOB 3UUMA 2WSSV 2G0UA 4AQFA 3E22E 3KV5A 3QB5A 2CBIA 3RIUA 4H63V 4WW0A 4JI6T 2LKHA 4TWFA 3HA4A 5FVLA 2VL0A 1ZKEA 2WBLA 2NOXA 3QC9A 2M6BA 3AECA 5CA0E 3AEBA 2D0UA 3AE2A 2W2UA 3ZC1A 5AQPB 3PUQA 2BS2A 3AVSA 1NENA 1I94T 5F5WA 4EAHA 2ACZA 4AQGA 3ZCIA 3N2KE 4IIJE 3P4QA 1KK7A 1J1JA 2NW8A 1FMWA 1OXZA 1HTJF 4H9SE 5FY0A 2WP9A 5FXZA 5ABEA 2MPKA 2ZLYA 2HPLA 4I50E 2ZM8A 3JCFA 5AQKB 4QXHB 5AQNB 4B3MT 1R8IA 2YDQA 2IW5B 2ACXA 4CQIA 2ZM2A 2YEVC 5AQQB 2BVMA 4JI5T 5BR8T 1YXRA 4ASKA 3VU7H 1XNQT 3SFEA 4O4JE 3X1DA 5KX5E 4X20E 1VCTA 5ABGA 1HFAA 2Z6EA 5LBMA 5KXJA 3EDVA 4WYVA 5LNKA 4LF7T 5IYZE 5H6QB 5LHHB 2FJBA 3PTRB 1XDOA 2V5CA 4MLKA 3EAMA 3ETVA 3KINB 1FIOA 1XDPA 3AAAB 4IT4A 1KNPA 2XAFB 3M65A 4Z90A 4LF8T 3VKHA 3P4WA 4O4IE 2X68A 4X1KE 2IMLA 3N2GE 5JR9B 3ONLC 5L3FB 3Q9DA 4IE6A 3K1SA 4ILCA 4NUVA 4O2BE 1OEDB 3UUXB 2ODUA 5HXSA 1O3XA 2FBWA 4B6XA 3T1HT 3E0ZA 3I0OA 4DV5T 2MTQA 4EIWA 3AXJA 5J2TE 5JDHA 1ZHCA 2LM9A 2WM9A 1ZV4X 1VOMA 2WDQA 5AQHB 1LRZA 2AE9A 4JBWF 4KMCA 3TLUA 5LG4A 3IA3A 4WBNE 1N34T 4GKKT 1FJGT 3VRBA 3FXEB 4DV2T 1KFYA 4QHOA 3PV0F 3DP7A 4ZHQE 1ZP0A 2WU2A 2XQ3A 2VVSA 3P7IA 4H9QC 4L0RA 3ZT7A 4ERRA 3QK6A 4YSZA 4ZI3D 2CA5A 2JMKA 3LFMA 2C5IT 2LOPA 3C64A 1XMOT 3NVOA 3AAEB 4BJNA 3N2OA 3OKQA 4PFPA 1OEDC 5CB4E 3MK7C 5AQUB 2QYWA 3NRYA 3AEFA 2LHRA 2X51A 3QNUA 4HWIB 4LMKA 2A9UA 2YDSA 1IJ6A 5KDMC 3HKCE 4E7ZA
chains in the Genus database with same CATH topology
4L9IA 3FXDB 3LJCA 3KV4A 3UFEA 3UT5E 4PJMA 4BJMA 4XZCA 2CM0A 4UF0B 3ZLIA 5C8YE 1MIWA 3K3QC 3ZJ2A 3CMLA 3PURA 2LOSA 2E9XC 2Q9QD 3N9MA 3FBZA 4K0UA 3ZYMA 5FXXA 4AKHA 4EYYR 3I1AA 3VHLA 3IHRA 3ZEFB 4J2CA 2X67A 3RYIE 2V1DB 2YINA 5FP3A 4UIGA 4TN7B 1BR0A 3VKGA 2D0TA 4FI5A 1ZEEA 4DVDA 5LHGB 2LJLA 2V26A 4HEAA 4L5GA 4PFOA 3L3PA 1S35A 3F31A 2V7LA 1UX4A 4H63H 5J1GA 4ILUA 4DMWA 4PK5A 3OYXA 3LK2B 4ZS3A 2XAGB 1WR6A 5DQVA 3I9YA 5HXRA 2V7KA 4C90A 5M4YA 4E7SA 4QX7B 2MBGA 5H6RB 2K48A 3IEEA 4X1YE 3F57A 4P0AA 5F8PA 3HKEE 4OYJA 2EHOC 3PUAA 4IGUA 1G73A 4ZI2C 2VKOA 4PW8A 3PUSA 1MMAA 3K3NA 2OA5A 2IAKA 2KNDA 4KP3C 1WYCA 5ETWA 2LSGA 2K24A 3CKDA 2K9AA 4EZ4A 5LGNB 5LJNA 2L9QA 5LNKA 5JQGE 3ETUA 2KLQA 3DTOA 2E9XB 3R6NA 3LG7A 2RP4A 3U3IA 3ZN0B 5LBQB 3O9XA 2XAHB 5LA6E 1D1BA 1VRBA 3HKDE 3VKHA 4M1PA 1WYBA 2C0SA 3AVRA 2M67A 2WWUA 2WMOA 4GK0E 1IJ5A 5FXVA 5JREA 2H7OA 2CLYC 3P8CD 3NZPA 4ISSA 4PNIA 5J2UE 3E08A 1H7CA 5JDLA 4HN9A 4JLEA 2PFVA 4EXTA 2I59A 4DO0A 3GWHA 3CX6B 4O8SA 5F3JA 1Z0PA 2Q9QB 3KBUA 3ANWA 2YU1A 5HYAA 5IHYA 3RX6A 2JMHA 3MJXA 4IE5A 3HI2A 5HWYA 4I55E 4AKRB 2ZMAA 3N9QA 2W0GA 3C4ZA 3JC6D 4UV9B 4YFSA 3O4XE 4ZI2D 2NW7A 2DLRA 2CCQA 2PJQA 3RYFE 1HCIA 3GA8A 4C91A 2NWBA 1E1HB 2CWOA 2L3LA 4I4TE 3WAJA 4AXPA 3Q5XA 1HS7A 5ADXL 4PJLA 5BMVE 2X9XA 3LBXA 1BR2A 2LEHA 2PBIA 3MZKB 4CXWA 5FNVE 4HKAA 3F2EA 4QXCB 3KFWX 3L09A 4EYUA 2VWAA 3I9WA 1BR4A 2HPJA 3RRCA 4I43B 3ZJ1A 1U4QA 2VKHA 3LK42 4IE4A 3BQLA 4UF0A 2JQQA 2NTXA 2A2FX 3A5XA 2K5BB 3JC6C 2V7MA 3N9OA 4UXNB 5HXHA 2XUEA 2H3RA 2XHEB 3CWZB 3LBXB 3B13A 2P9BA 1LVFA 3OJAA 5TAOA 3O1HA 4MFRA 3HKBE 2VK9A 2Y48B 4H9OC 4JEUB 5L3EB 4DNDA 4ZOLE 1G8XA 5JRCA 3KBTA 1D0YA 3KVAA 4OHFA 3CQGB 3H37A 1HG2A 2JPFA 3OYZA 4AKIA 5LXTE 4UVAB 5LOVE 4IDZA 3WAKA 2VASA 2W61A 3CVRA 3LK3B 5HAXA 2QA7A 3AAIA 2Q9QA 3PDYA 3T8OA 3ESLA 3KV9A 3RH3A 5JRCB 3ONXA 1D0XA 1S94A 3BQIA 5JR9A 3ZMSB 4ISTA 2LSIA 3BQKA 3KV6A 2CWYA 3SS1A 2JRKA 4ZI7E 3MACA 4ADZA 3RPUA 3RYHE 2VKJA 1AJ3A 3V5UA 4UEMA 4EZHA 3J7Yq 3NZQA 2HH7A 3DJBA 4HGAA 2D5UA 4GYSA 4H9NC 3GMIA 2EHOA 2BVLA 3U78A 1MMNA 3PU8A 2VL8A 2IC9A 2YK0A 2PG8A 3ZCJA 3C98B 1MMGA 3O1IA 3ZPOA 1US7B 5JDGA 4H9PC 4MHCA 5JDQA 4KBMB 2XQYA 4UV8B 2D2SA 5L2LA 3ZMTB 4CI1B 2J1DG 4KUMB 5DABA 5EK2A 2N1GA 5EK4A 1MNEA 1LKXA 2DWGA 2QGSA 2CMRA 2X0LB 1U5PA 4MALA 1MIVA 3KDSE 2LSJA 1OWAA 4GIWA 2XAJB 5GONE 3ZYKA 5LHIB 3RKOA 2ZM0A 4DMVA 5HXEA 2NW9A 5JR9C 1V9DA 3O1JA 3UULA 2EHOD 2BZBA 4ANJA 2XASB 3OBVE 2W00A 5A1LA 4GK5E 4U72A 2N9DA 2KWHA 4V1Av 1YD8G 3ZC0A 1YW0A 5LGTB 3GN5A 3CX8B 3MXZA 4HFVA 2ES0A 2L8KA 3NRXA 4UVCB 5LCYA 5AFUL 3PE0A 2JJ9A 1QUUA 2V7IA 4AI6A 1YKHB 2LHNA 1SHZC 3HL6A 3TKLB 1FMVA 3CQXC 4YLHA 5CA1E 3AA6B 4X1IE 5L3GB 3V5SA 1B7TA 3I0QA 4YJ2E 4XAXB 5FY7A 3FB2A 1NAFA 4TV9E 4O4LE 1LVKA 2CEAA 4BA9A 4EOZB 4XBFB 4Z8XA 5DJQC 2C5KT 4WNKA 1IJ6A 3NBXX 3C4WA 1MNDA 5JDMA 5JDNA 4FJOA 5FYMA 4NUUA 1BR1A 3SWHA 4AKLA 2ODVA 3WI3A 2Y8DA 2X9YA 2LE8A 4H9RC 2KMFA 2A72A 2LSYA 4TZ4C 4TUYE 4F6RC 3ANWB 3MKDA 4O2AE 5L3CB 2CXLA 4N78D 4U74A 1HX8A 3N9NA 2X66A 3J9X1 1YKEB 3N9LA 2VB6A 3Q2MA 3RRWA 4CI2B 4GOUA 2B1EA 2NTYA 2KINB 3EVYA 3K8PC 1CUNA 1D0ZA 3AA0B 4PJNA 4TX5A 2CLYB 5DQWA 3AB3B 3SRZA 4PAGA 3QUJA 1FEWA 4AQFC 5LJMA 3RC8A 2A3DA 2YU2A 1IZNB 1D1CA 3S4UA 2N2NA 3IBPA 2SPCA 4ZI3C 2IC6A 5EK3A 2CXDA 2XAQB 2LT3A 3Q5WA 4CZZB 2RA1A 2DHRA 3SOLA 2CE7A 5EZYE 5FMNA 5HWXA 2E9XA 4IHJE 1EZ3A 5LP6E 4QKNA 3ZN1B 5JH7E 4P09A 2EHOB 4PK6A 2GK9A 3IF8B 4YJ3E 3UUNA 3RC3A 5L3BB 5E0OA 2UXNB 5LGUB 3CPZA 5LYJE 2W62A 3EDUA 5HXCA 4QWNB 3MA9A 4QX8B 5KMGP 5FY1A 4HTEA 2KWIB 1QSDA 1UCUA 3C50A 4CXXA 3ZMVB 4DBRA 2XTLA 3BK9A 1MMDA 2Y6XA 3CX7B 3N9PA 4DBQA 3R84B 2DI4A 3UTKA 2DWKA 4WBOA 2WMNA 2CXFA 2WAUA 3KVBA 4UELA 1T98A 3C51A 3AA7B 4JUYA 4HE8A 1WRDA 2E9XD 2Q9QC 2V7JA 1MIYA 2BDEA 1WLXA 2UXXB 3B57A 4P0BA 4IE7A 4AKGA 2X9HA 1HF8A 2KXPB 1Y64B 2DNXA 4OFZA 4CI3B 2W63A 4G2AA 2H7VC 4IE0A 4QXBB 5L3DB 2E8IA 3GN5B 4OYKA 3ZMZB 4G63A 1UX5A 4JEHB 3N5LA 1HG5A 2KZ7B 3PUGA 3AA1B 2X9WA 3W15B 3ZMUB 2MOZA 3PU3A 1NWMX 1D1AA 2DCFA 3D0TA 4YHJA 5JDFA 3C4XA 4MBQA 3CQCB 4PK4A 4BAYB 1SA0E 3K3OA 4GYRA 1KNZA 3EUHA 3ZYLA 1IAPA 2C5JA 2NP9A 3H3AA 4O4HE 3HR0A 4PJJA 2MYSA 4A56A 2KT9A 2LSKA 4CXYA 4UVBB 3FBLA 4OK0A 1X79A 3FHNA 4ZS2A 3RYCE 3UUMA 4AQFA 2WSSV 2G0UA 3E22E 3KV5A 4H63V 4WW0A 3HA4A 1ZKEA 2WBLA 2NOXA 3QC9A 5CA0E 2D0UA 3ZC1A 3PUQA 3AVSA 4EAHA 4AQGA 3ZCIA 3N2KE 4IIJE 1KK7A 1FMWA 2NW8A 1OXZA 1HTJF 4H9SE 5FY0A 5FXZA 2ZLYA 2HPLA 4I50E 2ZM8A 4QXHB 2IW5B 2ACXA 4CQIA 2ZM2A 2YEVC 2BVMA 4ASKA 3VU7H 4O4JE 5KX5E 4X20E 1HFAA 2Z6EA 5LBMA 3EDVA 5IYZE 5H6QB 5LHHB 3PTRB 4MLKA 3ETVA 3KINB 1FIOA 3AAAB 2XAFB 3M65A 4O4IE 2X68A 4X1KE 3N2GE 5JR9B 5L3FB 3Q9DA 4IE6A 4NUVA 4O2BE 3UUXB 2ODUA 5HXSA 1O3XA 4B6XA 3E0ZA 3I0OA 2MTQA 4EIWA 5J2TE 1ZHCA 2LM9A 2WM9A 1ZV4X 1VOMA 1LRZA 5LG4A 4KMCA 4WBNE 3FXEB 4QHOA 4ZHQE 3DP7A 3P7IA 4H9QC 4ERRA 4L0RA 3QK6A 4ZI3D 2CA5A 2JMKA 3LFMA 3C64A 2C5IT 2LOPA 3AAEB 4BJNA 3N2OA 3OKQA 4PFPA 5CB4E 3MK7C 3NRYA 4TV8E 5FXWA 2LHRA 2X51A 5JVDE 4EB6E 5JDHA 5KDMC 2VKDA 3HKCE 4E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9Q C;  4HGA A;  5KDM C;  4H9O C;  4H9P C;  4H9N C;  4H9R C;  4H9S E; 
#chains in the Genus database with same CATH topology
 4L9I A;  3FXD B;  1T8B A;  3LJC A;  3KV4 A;  3UFE A;  3UT5 E;  1I6Z A;  1ZOY A;  4PJM A;  4YY3 T;  4BJM A;  4XZC A;  2CM0 A;  4UF0 B;  3EHZ A;  1T72 A;  3ZLI A;  1HX1 B;  5C8Y E;  1WCR A;  3TLV A;  1J5E T;  1MIW A;  2RPA A;  3JAD A;  3K3Q C;  2WZH A;  3ZJ2 A;  4DV0 T;  3CML A;  4NPP A;  3PUR A;  4OX9 T;  2LOS A;  4NXN T;  5IWA T;  2E9X C;  2Q9Q D;  4XBF B;  4JV5 T;  3AEE A;  3FBZ A;  3N9M A;  4K0U A;  2W4X A;  3ZYM A;  5FXX A;  2CRB A;  5L4H A;  2LM2 A;  1IBK T;  3CK6 A;  2WWV A;  4EYY R;  3I1A A;  4AKH A;  3VHL A;  3IHR A;  3ZEF B;  2B76 A;  4DID B;  4J2C A;  2X67 A;  3RYI E;  2V1D B;  2YIN A;  2JQ9 A;  5FP3 A;  4UIG A;  4JI1 T;  4TN7 B;  1BR0 A;  3VKG A;  2D0T A;  2V6Y B;  4FI5 A;  2XSA A;  3RIF A;  2XQ5 A;  1ZEE A;  4DVD A;  4U7Y A;  5LHG B;  2LJL A;  2V26 A;  1E7P A;  4HEA A;  4L5G A;  3L3P A;  3AE8 A;  4KI0 F;  1S35 A;  4PFO A;  2WY2 A;  3F31 A;  2V7L A;  3AXJ B;  1AJ3 A;  1UX4 A;  4U3C A;  4H63 H;  5J1G A;  4ILU A;  2M6I A;  1YQ3 A;  4HFD A;  4PK5 A;  4TNW A;  3OYX A;  4DMW A;  3LK2 B;  4ZS3 A;  2XAG B;  4IL4 A;  1WR6 A;  5DQV A;  3I9Y A;  5ABF B;  5HXR A;  2V7K A;  2V6Y A;  4C90 A;  5M4Y A;  4HFC A;  4E7S A;  4QX7 B;  2MBG A;  4KHP T;  2D9D A;  3EAB A;  5H6R B;  5C2T A;  2K48 A;  3IEE A;  4YTP A;  4X1Y E;  2UU9 T;  2E5L T;  1X9B A;  3F57 A;  4P0A A;  5F8P A;  3HKE E;  4OYJ A;  2EHO C;  2MAW A;  3AEG A;  3PUA A;  4HWD A;  4IGU A;  1G73 A;  3NKZ A;  4ZI2 C;  2VKO A;  4PW8 A;  2YOE A;  3PUS A;  2K3W A;  1MMA A;  3K3N A;  2OA5 A;  2IAK A;  3UU4 A;  2KND A;  1IBM T;  4KP3 C;  1WYC A;  5ETW A;  2LSG A;  4GKJ T;  4DR1 T;  2K24 A;  3CKD A;  4IRE A;  2K9A A;  3P4S A;  5AQJ B;  2OLT A;  2YKS A;  4EZ4 A;  5LGN B;  5LJN A;  4X66 T;  2L9Q A;  4TWD A;  5JQG E;  3ETU A;  2XQ7 A;  2KLQ A;  3DTO A;  5JTG A;  2E9X B;  5AQL B;  3R6N A;  3LG7 A;  3VRA A;  2RP4 A;  3U3I A;  3ZN0 B;  5LBQ B;  3O9X A;  2XAH B;  5LA6 E;  5HEH A;  1D1B A;  1VRB A;  5HCM A;  3HKD E;  3SFD A;  4M1P A;  1WYB A;  2WCA A;  3ZST A;  2C0S A;  3AVR A;  4EEB A;  2H89 A;  2M67 A;  2WWU A;  2WB5 A;  4LF4 T;  3RQU A;  2JIW A;  2WMO A;  4GK0 E;  1IJ5 A;  4QH4 A;  5FXV A;  5JRE A;  2H7O A;  3EI0 A;  2CLY C;  4KX6 A;  3P8C D;  2XM2 A;  3NZP A;  1N33 T;  4EED A;  3QOF A;  1KNR A;  4ISS A;  4PNI A;  4CN6 A;  5J2U E;  3E08 A;  1H7C A;  4U2Z A;  5JDL A;  4HN9 A;  4JLE A;  2PFV A;  3FZH B;  4EXT A;  2I59 A;  4DO0 A;  3GWH A;  3CX6 B;  5JVD E;  3AE3 A;  2WU5 A;  2LRL A;  4O8S A;  5F3J A;  2BKN A;  1Z0P A;  1J5W A;  2Q9Q B;  5AQV B;  2F4V T;  3KBU A;  3ANW A;  2YU1 A;  4IDO A;  3UU5 A;  5HYA A;  5IHY A;  2J4G A;  3RX6 A;  2JMH A;  3MJX A;  4IE5 A;  3HI2 A;  5HWY A;  4I55 E;  4IDN A;  4IDQ A;  4AKR B;  2FUP A;  4P1N A;  2ZMA A;  2QRX A;  2W0G A;  3C4Z A;  3JC6 D;  3N9Q A;  4UV9 B;  4YFS A;  4YT0 A;  3O4X E;  4ZI2 D;  2NW7 A;  2DLR A;  1XMQ T;  1M62 A;  2VQE T;  2LKG A;  2CBJ A;  3OVU A;  2PJQ A;  2CCQ A;  3H3M A;  3RYF E;  3ZT5 A;  1HCI A;  5LMU T;  2HN2 A;  3GA8 A;  4C91 A;  2NWB A;  1E1H B;  2CWO A;  2L3L A;  4I4T E;  3WAJ A;  4LF9 T;  4AXP A;  3Q5X A;  1HS7 A;  4DUZ T;  5ADX L;  4PJL A;  4TWH A;  5BMV E;  2X9X A;  4A97 A;  3B5M A;  3LBX A;  4LF5 T;  1BR2 A;  2LEH A;  2PBI A;  4ZZB A;  3MZK B;  4CXW A;  5FNV E;  2JQK A;  3F2E A;  4HKA A;  4QXC B;  3KFW X;  3L09 A;  4EYU A;  2VWA A;  2BG9 C;  3I9W A;  3M3Z B;  1BR4 A;  1Y01 A;  5FKY A;  2HPJ A;  1L0V A;  3RRC A;  2IIU A;  4I43 B;  5HEU A;  3ZJ1 A;  1U4Q A;  2VKH A;  2NR4 A;  3LK4 2;  3BQL A;  4IE4 A;  2JQQ A;  2NTX A;  2PTF A;  2A2F X;  3CIR A;  4UF0 A;  3RKG A;  3A5X A;  3ABV A;  3AED A;  3ONJ A;  2K5B B;  3AE4 A;  2V7M A;  2E2A A;  3JC6 C;  3N9O A;  2XUE A;  4UXN B;  5HXH A;  4HWH A;  1NEK A;  5FL1 A;  2H3R A;  2XHE B;  2IHR 1;  3CWZ B;  3LBX B;  2E5V A;  3B13 A;  2P9B A;  1LVF A;  3OJA A;  5TAO A;  3O1H A;  4MFR A;  5IUX A;  3HKB E;  1QLB A;  5C3J A;  2VUR A;  2VK9 A;  2Y48 B;  4H9O C;  4JEU B;  5L3E B;  4IL9 A;  2OV9 A;  4ZOL E;  4DND A;  1G8X A;  5JRC A;  3KBT A;  4YSX A;  1D0Y A;  3KVA A;  1GQE A;  4OHF A;  2R6G F;  3CQG B;  3H37 A;  2V5D A;  1UGO A;  4ILA A;  1HG2 A;  2JPF A;  3LSV A;  3OYZ A;  5LB7 B;  4AKI A;  5LXT E;  2I0M A;  4AIU A;  2DL1 A;  1JNR A;  4UVA B;  5LOV E;  4IDZ A;  2X0H A;  3WAK A;  5FXW A;  2YN6 A;  2FJA A;  4CN1 A;  1N36 T;  2VAS A;  2W61 A;  3CVR A;  3LK3 B;  5HAX A;  2QA7 A;  3AAI A;  2Q9Q A;  3PDY A;  3T8O A;  1HNZ T;  3ESL A;  1VCS A;  3KV9 A;  3UU3 A;  3RH3 A;  3ZT6 A;  5JRC B;  3ONX A;  4JI4 T;  1D0X A;  1S94 A;  3BQI A;  5JR9 A;  3ZMS B;  4IST A;  4EGW A;  2UUC T;  2LSI A;  3BQK A;  3KV6 A;  2CWY A;  3TLW A;  1OED E;  3SS1 A;  2JRK A;  4JI0 T;  4ZI7 E;  3MAC A;  4ADZ A;  2WDR A;  3RPU A;  3RYH E;  3Q5E A;  2VKJ A;  3UQ7 A;  4U2Y A;  4JI7 T;  5AQI B;  4UEM A;  3V5U A;  4COF A;  4EZH A;  3J7Y q;  3OTO T;  3NZQ A;  2HH7 A;  3DJB A;  2HHH T;  2BG9 A;  2IUB A;  4HGA A;  2BKP A;  3PJA J;  3AE5 A;  2D5U A;  4GYS A;  4H9N C;  4Q25 A;  2VVN A;  1JNZ A;  3QB5 K;  5AQF B;  4LF6 T;  3AE7 A;  2EHO A;  2BVL A;  3GMI A;  4HFH A;  1MMN A;  3PU8 A;  2VL8 A;  3U78 A;  5FVK A;  2IC9 A;  2YK0 A;  4NIQ A;  4X65 T;  2PG8 A;  3ZCJ A;  3C98 B;  1W0A A;  1MMG A;  3O1I A;  3ZPO A;  5AQT B;  3AE1 A;  5ABH A;  1US7 B;  2KSR A;  3VR9 A;  4F8H A;  5JDG A;  4NXM T;  4H9P C;  2WDV A;  4MHC A;  5JDQ A;  4KBM B;  2XQY A;  1Z8U A;  4UV8 B;  4JI3 T;  4DR4 T;  2D2S A;  5L2L A;  3ZMT B;  4CI1 B;  2J1D G;  4IDP A;  4KUM B;  5DAB A;  2XPK A;  2XZE A;  4YTN A;  5EK2 A;  2N1G A;  5EK4 A;  3T1Y T;  4Z91 A;  1MNE A;  1LKX A;  2DWG A;  2QGS A;  4YXD A;  2CMR A;  3UQ4 A;  1T7S A;  3TLT A;  4JYA T;  2X0L B;  3UU6 A;  1U5P A;  4U31 A;  4HFB A;  2XM1 A;  4MAL A;  1XNR T;  1MIV A;  3L8R A;  1KF6 A;  2AXD S;  2CHN A;  2LSJ A;  3KDS E;  4KHZ F;  1OWA A;  2XSB A;  4GIW A;  3RIU C;  2XAJ B;  4DR5 T;  5GON E;  3ZYK A;  5LHI B;  3RKO A;  2WS3 A;  2ZM0 A;  4DMV A;  2BS3 A;  5FL0 A;  5HXE A;  2NW9 A;  3RIA A;  4DV4 T;  4DR6 T;  5JR9 C;  1V9D A;  3O1J A;  3UUL A;  2EHO D;  3PUZ F;  2BZB A;  4ANJ A;  2XAS B;  1HNX T;  3OBV E;  2W00 A;  4EV6 A;  2BKO A;  4GK5 E;  5A1L A;  4U72 A;  2N9D A;  3P50 A;  2KWH A;  4V1A v;  1IBL T;  1YD8 G;  3ZC0 A;  5L4E A;  1YW0 A;  4JI2 T;  4HWF A;  3CX8 B;  3GN5 A;  3MXZ A;  1UUS A;  2CPT A;  4HFV A;  5LGT B;  2ES0 A;  2WZI A;  3RI5 A;  2L8K A;  3NRX A;  4UVC B;  5LCY A;  4HFE A;  5AFU L;  3PE0 A;  5CFB A;  4X62 T;  4X64 T;  4DR3 T;  2JJ9 A;  1QUU A;  2XQ8 A;  3AE6 A;  5L47 A;  4LFA T;  2V7I A;  2BG9 E;  4AI6 A;  1YKH B;  2LHN A;  2XQ9 A;  1SHZ C;  1KEY A;  3HL6 A;  3PUW F;  4DUY T;  3TKL B;  1FMV A;  3CQX C;  4YLH A;  5CA1 E;  3AA6 B;  4X1I E;  5AQM B;  3V5S A;  1B7T A;  3I0Q A;  3UFG A;  4XAX B;  4YJ2 E;  5L3G B;  5FY7 A;  3FB2 A;  1NAF A;  2UUB T;  1OED A;  4O4L E;  1LVK A;  2CEA A;  2W66 A;  4TV9 E;  5AQR B;  4BA9 A;  4Z8X A;  4EOZ B;  5DJQ C;  3A8Y C;  2J62 A;  2C5K T;  4WNK A;  5HEG A;  2CHO A;  2WQY A;  3NBX X;  3C4W A;  1MND A;  5HEJ A;  5JDM A;  5JDN A;  4FJO A;  5FYM A;  1DU2 A;  4NUU A;  1BR1 A;  2UUA T;  3SWH A;  4AKL A;  2ODV A;  1W09 A;  2XQA A;  2Y8D A;  3WI3 A;  2X9Y A;  5CJ5 A;  5J0Z A;  2LE8 A;  4H9R C;  3FZM B;  3RF1 A;  2KMF A;  2A72 A;  2LSY A;  4TZ4 C;  4A98 A;  2UXD T;  4TUY E;  3JAF A;  3VR8 A;  4F6R C;  1SE7 A;  1WR0 A;  4YSY A;  1SUM B;  1WFD A;  3ANW B;  3MKD A;  4O2A E;  5L3C B;  2BBJ A;  2CXL A;  2JQH A;  4N78 D;  4YHH T;  4U74 A;  1HX8 A;  3N9N A;  2X66 A;  3J9X 1;  1YKE B;  3N9L A;  2VB6 A;  3Q2M A;  3RRW A;  4CI2 B;  5HCJ A;  3UUB A;  4AIS A;  1W0B A;  2B1E A;  2NTY A;  4GOU A;  2KIN B;  3EVY A;  3K8P C;  4ILB A;  1CUN A;  1D0Z A;  3AA0 B;  4PJN A;  4TX5 A;  2CLY B;  5DQW A;  3AB3 B;  2UXC T;  3SRZ A;  4PAG A;  3QUJ A;  1FEW A;  2LRK A;  4AQF C;  5LJM A;  3RC8 A;  5LMN T;  2A3D A;  2YU2 A;  1IZN B;  1D1C A;  4WZX A;  3S4U A;  2N2N A;  3IBP A;  3ZKR A;  5AQS B;  2SPC A;  4ZI3 C;  4DV1 T;  4B3R T;  2IC6 A;  5EK3 A;  4A5X A;  2CXD A;  2FJD A;  2XAQ B;  3JAE A;  2LT3 A;  3Q5W A;  4CZZ B;  2RA1 A;  2DHR A;  4LMJ A;  3SOL A;  2VQF T;  2CE7 A;  3Q5D A;  5EZY E;  5FMN A;  2XQ6 A;  3RHW A;  4ZEY A;  2E9X A;  5HWX A;  4IHJ E;  1EZ3 A;  4UR9 A;  2BS4 A;  5LP6 E;  3FZK B;  1XWM A;  4I0U A;  4QKN A;  3ZN1 B;  5JH7 E;  4P09 A;  2EHO B;  4PK6 A;  2GK9 A;  3IF8 B;  4YJ3 E;  3UUN A;  3RC3 A;  2XQ4 A;  5L3B B;  5E0O A;  2UXN B;  5LGU B;  3CPZ A;  2BG9 B;  5LYJ E;  4HFI A;  2W62 A;  4LFC T;  3EDU A;  5HXC A;  4QWN B;  2YDR A;  3RQW A;  3MA9 A;  3RGL A;  4QX8 B;  1CHU A;  4TV8 E;  5KMG P;  4AQY T;  5FY1 A;  1N32 T;  1YQ4 A;  4HTE A;  2KWI B;  3FZF B;  1QSD A;  2BBH A;  1UCU A;  3C50 A;  3P4R A;  2LLY A;  3RLF F;  3ZMV B;  4CXX A;  2XTL A;  3BK9 A;  4DBR A;  1MMD A;  2Y6X A;  3CX7 B;  3N9P A;  4DBQ A;  2QVA A;  3R84 B;  4DV7 T;  3A7M A;  2DI4 A;  3UTK A;  4DR2 T;  2DWK A;  4WBO A;  2WMN A;  4EB6 E;  2CXF A;  2WAU A;  4ZXL A;  4LFB T;  3KVB A;  4UEL A;  5AQO B;  1T98 A;  3C51 A;  3AA7 B;  4JUY A;  4HE8 A;  1WRD A;  2E9X D;  2Q9Q C;  2V7J A;  5CGM A;  1MIY A;  4ZZC A;  4CN4 A;  5LG3 A;  2BDE A;  1WLX A;  4K0K T;  2UXX B;  3B57 A;  4P0B A;  1HR0 T;  4IE7 A;  4JI8 T;  4AKG A;  2X9H A;  1HF8 A;  2KXP B;  2X0Y A;  1Y64 B;  2DNX A;  4B3T T;  4OFZ A;  4CI3 B;  4DV3 T;  2W63 A;  5ABF A;  4G2A A;  2H7V C;  3L39 A;  1W9R A;  4IE0 A;  4QXB B;  5L3D B;  2E8I A;  4QH5 A;  3PUY F;  3GN5 B;  4OYK A;  1HNW T;  4QH1 A;  3ZMZ B;  3NWI A;  1UX5 A;  4G63 A;  3TLS A;  2VKD A;  3PUX F;  1XZY A;  3N5L A;  3G06 A;  4JEH B;  2ZM6 T;  1HG5 A;  3FZL B;  2KZ7 B;  3PUG A;  3AA1 B;  3PUV F;  2I6H A;  2X9W A;  3OPC A;  4U7I A;  4B3S T;  5AQG B;  3W15 B;  3ZMU B;  2UXB T;  2MOZ A;  3PU3 A;  2W67 A;  2V8S V;  2XJ7 A;  1NWM X;  1D1A A;  2DCF A;  3D0T A;  4YHJ A;  4X5T A;  2H88 A;  1UK5 A;  5JDF A;  3C4X A;  5HEO A;  4MBQ A;  3CQC B;  2V6X A;  4PK4 A;  4BAY B;  1SA0 E;  2J47 A;  3K3O A;  3P4P A;  4GYR A;  2FJE A;  3AE9 A;  1KNZ A;  3EUH A;  4LML A;  3ZYL A;  1IAP A;  2C5J A;  2NP9 A;  3H3A A;  4O4H E;  4YTM A;  1UUR A;  3HR0 A;  4PJJ A;  2MYS A;  3UU8 A;  4A56 A;  3ZSS A;  2KT9 A;  2LSK A;  3LDQ B;  1M7K A;  4TNV A;  4UVB B;  3FBL A;  4OK0 A;  4CXY A;  2HN1 A;  3PJA A;  4U33 A;  1X79 A;  4DR7 T;  3AEA A;  2XY8 B;  3FHN A;  1E2A A;  4DV6 T;  4HWC A;  4ZS2 A;  3RYC E;  2IDO B;  3UUM A;  2WSS V;  2G0U A;  4AQF A;  3E22 E;  3KV5 A;  3QB5 A;  2CBI A;  3RIU A;  4H63 V;  4WW0 A;  4JI6 T;  2LKH A;  4TWF A;  3HA4 A;  5FVL A;  2VL0 A;  1ZKE A;  2WBL A;  2NOX A;  3QC9 A;  2M6B A;  3AEC A;  5CA0 E;  3AEB A;  2D0U A;  3AE2 A;  2W2U A;  3ZC1 A;  5AQP B;  3PUQ A;  2BS2 A;  3AVS A;  1NEN A;  1I94 T;  5F5W A;  4EAH A;  2ACZ A;  4AQG A;  3ZCI A;  3N2K E;  4IIJ E;  3P4Q A;  1KK7 A;  1J1J A;  2NW8 A;  1FMW A;  1OXZ A;  1HTJ F;  4H9S E;  5FY0 A;  2WP9 A;  5FXZ A;  5ABE A;  2MPK A;  2ZLY A;  2HPL A;  4I50 E;  2ZM8 A;  3JCF A;  5AQK B;  4QXH B;  5AQN B;  4B3M T;  1R8I A;  2YDQ A;  2IW5 B;  2ACX A;  4CQI A;  2ZM2 A;  2YEV C;  5AQQ B;  2BVM A;  4JI5 T;  5BR8 T;  1YXR A;  4ASK A;  3VU7 H;  1XNQ T;  3SFE A;  4O4J E;  3X1D A;  5KX5 E;  4X20 E;  1VCT A;  5ABG A;  1HFA A;  2Z6E A;  5LBM A;  5KXJ A;  3EDV A;  4WYV A;  5LNK A;  4LF7 T;  5IYZ E;  5H6Q B;  5LHH B;  2FJB A;  3PTR B;  1XDO A;  2V5C A;  4MLK A;  3EAM A;  3ETV A;  3KIN B;  1FIO A;  1XDP A;  3AAA B;  4IT4 A;  1KNP A;  2XAF B;  3M65 A;  4Z90 A;  4LF8 T;  3VKH A;  3P4W A;  4O4I E;  2X68 A;  4X1K E;  2IML A;  3N2G E;  5JR9 B;  3ONL C;  5L3F B;  3Q9D A;  4IE6 A;  3K1S A;  4ILC A;  4NUV A;  4O2B E;  1OED B;  3UUX B;  2ODU A;  5HXS A;  1O3X A;  2FBW A;  4B6X A;  3T1H T;  3E0Z A;  3I0O A;  4DV5 T;  2MTQ A;  4EIW A;  3AXJ A;  5J2T E;  5JDH A;  1ZHC A;  2LM9 A;  2WM9 A;  1ZV4 X;  1VOM A;  2WDQ A;  5AQH B;  1LRZ A;  2AE9 A;  4JBW F;  4KMC A;  3TLU A;  5LG4 A;  3IA3 A;  4WBN E;  1N34 T;  4GKK T;  1FJG T;  3VRB A;  3FXE B;  4DV2 T;  1KFY A;  4QHO A;  3PV0 F;  3DP7 A;  4ZHQ E;  1ZP0 A;  2WU2 A;  2XQ3 A;  2VVS A;  3P7I A;  4H9Q C;  4L0R A;  3ZT7 A;  4ERR A;  3QK6 A;  4YSZ A;  4ZI3 D;  2CA5 A;  2JMK A;  3LFM A;  2C5I T;  2LOP A;  3C64 A;  1XMO T;  3NVO A;  3AAE B;  4BJN A;  3N2O A;  3OKQ A;  4PFP A;  1OED C;  5CB4 E;  3MK7 C;  5AQU B;  2QYW A;  3NRY A;  3AEF A;  2LHR A;  2X51 A;  3QNU A;  4HWI B;  4LMK A;  2A9U A;  2YDS A;  1IJ6 A;  5KDM C;  3HKC E;  4E7Z A; 
#chains in the Genus database with same CATH homology
 4L9I A;  3FXD B;  3LJC A;  3KV4 A;  3UFE A;  3UT5 E;  4PJM A;  4BJM A;  4XZC A;  2CM0 A;  4UF0 B;  3ZLI A;  5C8Y E;  1MIW A;  3K3Q C;  3ZJ2 A;  3CML A;  3PUR A;  2LOS A;  2E9X C;  2Q9Q D;  3N9M A;  3FBZ A;  4K0U A;  3ZYM A;  5FXX A;  4AKH A;  4EYY R;  3I1A A;  3VHL A;  3IHR A;  3ZEF B;  4J2C A;  2X67 A;  3RYI E;  2V1D B;  2YIN A;  5FP3 A;  4UIG A;  4TN7 B;  1BR0 A;  3VKG A;  2D0T A;  4FI5 A;  1ZEE A;  4DVD A;  5LHG B;  2LJL A;  2V26 A;  4HEA A;  4L5G A;  4PFO A;  3L3P A;  1S35 A;  3F31 A;  2V7L A;  1UX4 A;  4H63 H;  5J1G A;  4ILU A;  4DMW A;  4PK5 A;  3OYX A;  3LK2 B;  4ZS3 A;  2XAG B;  1WR6 A;  5DQV A;  3I9Y A;  5HXR A;  2V7K A;  4C90 A;  5M4Y A;  4E7S A;  4QX7 B;  2MBG A;  5H6R B;  2K48 A;  3IEE A;  4X1Y E;  3F57 A;  4P0A A;  5F8P A;  3HKE E;  4OYJ A;  2EHO C;  3PUA A;  4IGU A;  1G73 A;  4ZI2 C;  2VKO A;  4PW8 A;  3PUS A;  1MMA A;  3K3N A;  2OA5 A;  2IAK A;  2KND A;  4KP3 C;  1WYC A;  5ETW A;  2LSG A;  2K24 A;  3CKD A;  2K9A A;  4EZ4 A;  5LGN B;  5LJN A;  2L9Q A;  5LNK A;  5JQG E;  3ETU A;  2KLQ A;  3DTO A;  2E9X B;  3R6N A;  3LG7 A;  2RP4 A;  3U3I A;  3ZN0 B;  5LBQ B;  3O9X A;  2XAH B;  5LA6 E;  1D1B A;  1VRB A;  3HKD E;  3VKH A;  4M1P A;  1WYB A;  2C0S A;  3AVR A;  2M67 A;  2WWU A;  2WMO A;  4GK0 E;  1IJ5 A;  5FXV A;  5JRE A;  2H7O A;  2CLY C;  3P8C D;  3NZP A;  4ISS A;  4PNI A;  5J2U E;  3E08 A;  1H7C A;  5JDL A;  4HN9 A;  4JLE A;  2PFV A;  4EXT A;  2I59 A;  4DO0 A;  3GWH A;  3CX6 B;  4O8S A;  5F3J A;  1Z0P A;  2Q9Q B;  3KBU A;  3ANW A;  2YU1 A;  5HYA A;  5IHY A;  3RX6 A;  2JMH A;  3MJX A;  4IE5 A;  3HI2 A;  5HWY A;  4I55 E;  4AKR B;  2ZMA A;  3N9Q A;  2W0G A;  3C4Z A;  3JC6 D;  4UV9 B;  4YFS A;  3O4X E;  4ZI2 D;  2NW7 A;  2DLR A;  2CCQ A;  2PJQ A;  3RYF E;  1HCI A;  3GA8 A;  4C91 A;  2NWB A;  1E1H B;  2CWO A;  2L3L A;  4I4T E;  3WAJ A;  4AXP A;  3Q5X A;  1HS7 A;  5ADX L;  4PJL A;  5BMV E;  2X9X A;  3LBX A;  1BR2 A;  2LEH A;  2PBI A;  3MZK B;  4CXW A;  5FNV E;  4HKA A;  3F2E A;  4QXC B;  3KFW X;  3L09 A;  4EYU A;  2VWA A;  3I9W A;  1BR4 A;  2HPJ A;  3RRC A;  4I43 B;  3ZJ1 A;  1U4Q A;  2VKH A;  3LK4 2;  4IE4 A;  3BQL A;  4UF0 A;  2JQQ A;  2NTX A;  2A2F X;  3A5X A;  2K5B B;  3JC6 C;  2V7M A;  3N9O A;  4UXN B;  5HXH A;  2XUE A;  2H3R A;  2XHE B;  3CWZ B;  3LBX B;  3B13 A;  2P9B A;  1LVF A;  3OJA A;  5TAO A;  3O1H A;  4MFR A;  3HKB E;  2VK9 A;  2Y48 B;  4H9O C;  4JEU B;  5L3E B;  4DND A;  4ZOL E;  1G8X A;  5JRC A;  3KBT A;  1D0Y A;  3KVA A;  4OHF A;  3CQG B;  3H37 A;  1HG2 A;  2JPF A;  3OYZ A;  4AKI A;  5LXT E;  4UVA B;  5LOV E;  4IDZ A;  3WAK A;  2VAS A;  2W61 A;  3CVR A;  3LK3 B;  5HAX A;  2QA7 A;  3AAI A;  2Q9Q A;  3PDY A;  3T8O A;  3ESL A;  3KV9 A;  3RH3 A;  5JRC B;  3ONX A;  1D0X A;  1S94 A;  3BQI A;  5JR9 A;  3ZMS B;  4IST A;  2LSI A;  3BQK A;  3KV6 A;  2CWY A;  3SS1 A;  2JRK A;  4ZI7 E;  3MAC A;  4ADZ A;  3RPU A;  3RYH E;  2VKJ A;  1AJ3 A;  3V5U A;  4UEM A;  4EZH A;  3J7Y q;  3NZQ A;  2HH7 A;  3DJB A;  4HGA A;  2D5U A;  4GYS A;  4H9N C;  3GMI A;  2EHO A;  2BVL A;  3U78 A;  1MMN A;  3PU8 A;  2VL8 A;  2IC9 A;  2YK0 A;  2PG8 A;  3ZCJ A;  3C98 B;  1MMG A;  3O1I A;  3ZPO A;  1US7 B;  5JDG A;  4H9P C;  4MHC A;  5JDQ A;  4KBM B;  2XQY A;  4UV8 B;  2D2S A;  5L2L A;  3ZMT B;  4CI1 B;  2J1D G;  4KUM B;  5DAB A;  5EK2 A;  2N1G A;  5EK4 A;  1MNE A;  1LKX A;  2DWG A;  2QGS A;  2CMR A;  2X0L B;  1U5P A;  4MAL A;  1MIV A;  3KDS E;  2LSJ A;  1OWA A;  4GIW A;  2XAJ B;  5GON E;  3ZYK A;  5LHI B;  3RKO A;  2ZM0 A;  4DMV A;  5HXE A;  2NW9 A;  5JR9 C;  1V9D A;  3O1J A;  3UUL A;  2EHO D;  2BZB A;  4ANJ A;  2XAS B;  3OBV E;  2W00 A;  5A1L A;  4GK5 E;  4U72 A;  2N9D A;  2KWH A;  4V1A v;  1YD8 G;  3ZC0 A;  1YW0 A;  5LGT B;  3GN5 A;  3CX8 B;  3MXZ A;  4HFV A;  2ES0 A;  2L8K A;  3NRX A;  4UVC B;  5LCY A;  5AFU L;  3PE0 A;  2JJ9 A;  1QUU A;  2V7I A;  4AI6 A;  1YKH B;  2LHN A;  1SHZ C;  3HL6 A;  3TKL B;  1FMV A;  3CQX C;  4YLH A;  5CA1 E;  3AA6 B;  4X1I E;  5L3G B;  3V5S A;  1B7T A;  3I0Q A;  4YJ2 E;  4XAX B;  5FY7 A;  3FB2 A;  1NAF A;  4TV9 E;  4O4L E;  1LVK A;  2CEA A;  4BA9 A;  4EOZ B;  4XBF B;  4Z8X A;  5DJQ C;  2C5K T;  4WNK A;  1IJ6 A;  3NBX X;  3C4W A;  1MND A;  5JDM A;  5JDN A;  4FJO A;  5FYM A;  4NUU A;  1BR1 A;  3SWH A;  4AKL A;  2ODV A;  3WI3 A;  2Y8D A;  2X9Y A;  2LE8 A;  4H9R C;  2KMF A;  2A72 A;  2LSY A;  4TZ4 C;  4TUY E;  4F6R C;  3ANW B;  3MKD A;  4O2A E;  5L3C B;  2CXL A;  4N78 D;  4U74 A;  1HX8 A;  3N9N A;  2X66 A;  3J9X 1;  1YKE B;  3N9L A;  2VB6 A;  3Q2M A;  3RRW A;  4CI2 B;  4GOU A;  2B1E A;  2NTY A;  2KIN B;  3EVY A;  3K8P C;  1CUN A;  1D0Z A;  3AA0 B;  4PJN A;  4TX5 A;  2CLY B;  5DQW A;  3AB3 B;  3SRZ A;  4PAG A;  3QUJ A;  1FEW A;  4AQF C;  5LJM A;  3RC8 A;  2A3D A;  2YU2 A;  1IZN B;  1D1C A;  3S4U A;  2N2N A;  3IBP A;  2SPC A;  4ZI3 C;  2IC6 A;  5EK3 A;  2CXD A;  2XAQ B;  2LT3 A;  3Q5W A;  4CZZ B;  2RA1 A;  2DHR A;  3SOL A;  2CE7 A;  5EZY E;  5FMN A;  5HWX A;  2E9X A;  4IHJ E;  1EZ3 A;  5LP6 E;  4QKN A;  3ZN1 B;  5JH7 E;  4P09 A;  2EHO B;  4PK6 A;  2GK9 A;  3IF8 B;  4YJ3 E;  3UUN A;  3RC3 A;  5L3B B;  5E0O A;  2UXN B;  5LGU B;  3CPZ A;  5LYJ E;  2W62 A;  3EDU A;  5HXC A;  4QWN B;  3MA9 A;  4QX8 B;  5KMG P;  5FY1 A;  4HTE A;  2KWI B;  1QSD A;  1UCU A;  3C50 A;  4CXX A;  3ZMV B;  4DBR A;  2XTL A;  3BK9 A;  1MMD A;  2Y6X A;  3CX7 B;  3N9P A;  4DBQ A;  3R84 B;  2DI4 A;  3UTK A;  2DWK A;  4WBO A;  2WMN A;  2CXF A;  2WAU A;  3KVB A;  4UEL A;  1T98 A;  3C51 A;  3AA7 B;  4JUY A;  4HE8 A;  1WRD A;  2E9X D;  2Q9Q C;  2V7J A;  1MIY A;  2BDE A;  1WLX A;  2UXX B;  3B57 A;  4P0B A;  4IE7 A;  4AKG A;  2X9H A;  1HF8 A;  2KXP B;  1Y64 B;  2DNX A;  4OFZ A;  4CI3 B;  2W63 A;  4G2A A;  2H7V C;  4IE0 A;  4QXB B;  5L3D B;  2E8I A;  3GN5 B;  4OYK A;  3ZMZ B;  4G63 A;  1UX5 A;  4JEH B;  3N5L A;  1HG5 A;  2KZ7 B;  3PUG A;  3AA1 B;  2X9W A;  3W15 B;  3ZMU B;  2MOZ A;  3PU3 A;  1NWM X;  1D1A A;  2DCF A;  3D0T A;  4YHJ A;  5JDF A;  3C4X A;  4MBQ A;  3CQC B;  4PK4 A;  4BAY B;  1SA0 E;  3K3O A;  4GYR A;  1KNZ A;  3EUH A;  3ZYL A;  1IAP A;  2C5J A;  2NP9 A;  3H3A A;  4O4H E;  3HR0 A;  4PJJ A;  2MYS A;  4A56 A;  2KT9 A;  2LSK A;  4CXY A;  4UVB B;  3FBL A;  4OK0 A;  1X79 A;  3FHN A;  4ZS2 A;  3RYC E;  3UUM A;  4AQF A;  2WSS V;  2G0U A;  3E22 E;  3KV5 A;  4H63 V;  4WW0 A;  3HA4 A;  1ZKE A;  2WBL A;  2NOX A;  3QC9 A;  5CA0 E;  2D0U A;  3ZC1 A;  3PUQ A;  3AVS A;  4EAH A;  4AQG A;  3ZCI A;  3N2K E;  4IIJ E;  1KK7 A;  1FMW A;  2NW8 A;  1OXZ A;  1HTJ F;  4H9S E;  5FY0 A;  5FXZ A;  2ZLY A;  2HPL A;  4I50 E;  2ZM8 A;  4QXH B;  2IW5 B;  2ACX A;  4CQI A;  2ZM2 A;  2YEV C;  2BVM A;  4ASK A;  3VU7 H;  4O4J E;  5KX5 E;  4X20 E;  1HFA A;  2Z6E A;  5LBM A;  3EDV A;  5IYZ E;  5H6Q B;  5LHH B;  3PTR B;  4MLK A;  3ETV A;  3KIN B;  1FIO A;  3AAA B;  2XAF B;  3M65 A;  4O4I E;  2X68 A;  4X1K E;  3N2G E;  5JR9 B;  5L3F B;  3Q9D A;  4IE6 A;  4NUV A;  4O2B E;  3UUX B;  2ODU A;  5HXS A;  1O3X A;  4B6X A;  3E0Z A;  3I0O A;  2MTQ A;  4EIW A;  5J2T E;  1ZHC A;  2LM9 A;  2WM9 A;  1ZV4 X;  1VOM A;  1LRZ A;  5LG4 A;  4KMC A;  4WBN E;  3FXE B;  4QHO A;  4ZHQ E;  3DP7 A;  3P7I A;  4H9Q C;  4ERR A;  4L0R A;  3QK6 A;  4ZI3 D;  2CA5 A;  2JMK A;  3LFM A;  3C64 A;  2C5I T;  2LOP A;  3AAE B;  4BJN A;  3N2O A;  3OKQ A;  4PFP A;  5CB4 E;  3MK7 C;  3NRY A;  4TV8 E;  5FXW A;  2LHR A;  2X51 A;  5JVD E;  4EB6 E;  5JDH A;  5KDM C;  2VKD A;  3HKC E;  4E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...