4H9WA

Crystal structure of a methionine mutant of wci
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
177
structure length
177
Chain Sequence
b'DDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWMTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin inhibitor 3
publication title A conserved tryptophan (W91) at the barrel-lid junction modulates the packing and stability of Kunitz (STI) family of inhibitors.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 27
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4h9wA00
4P0JA 1L2HA 5BVPI 4D8HA 2WRYA 2Z49A 2HZ9A 2KI6B 2VXTI 2F8XC 3NBNA 1W3FA 1YTOA 3O4CA 3H6RB 4JPZA 3QR5A 4QC4A 1R8NA 3PHZA 4JKQA 2VUAA 3OGFA 1HWMB 2FGFA 3WINA 2ZQOA 2GZBA 3E8LC 2RSTA 3AKGA 3EF2A 2HWAA 3ZX7A 1NZKA 4ZOTA 3ZC8A 4EFQA 3N7JA 5HPZA 3V0AB 1DLLA 3IM5A 4XFSA 3AH1A 1BLAA 4OW4A 4F34A 3I29B 4I4QA 4LO7C 1I1BA 5JMCA 2L5XA 1JLXA 1Z4SA 3IAGC 4P0LA 3O49A 4XFTA 1YBIA 1P63A 2X2TA 1QQLA 3F1RA 4EEEB 2LIEA 1TFMB 4I4VA 3AKHA 3AKIA 4HA2A 1A8DA 3OJVA 1ISWA 4X39A 1IT0A 1MC9A 4X3AA 4ZFYB 1N4KA 3RSJA 2HWMA 3FGMA 4H04A 1V6UA 2K43A 4GP0A 3W9TA 1FMZA 1S0BA 2VSAA 4LO1A 1TWMA 3WMVA 8I1BA 3PUBA 2QN4A 4IZXA 4EFPA 4OEEA 4R6UB 2RG9B 1HIBA 2AQZA 3UD7A 4ISQA 1ITBA 1AVUA 1RG8A 2D7IA 3H6SE 9ILBA 1FWUA 2WBCA 4TLPA 3JRRA 1TTUA 2F2FC 1WBCA 3IM7A 4USPA 3V0BA 3PG0A 1M2TB 4EKXB 1TOOA 4EB2B 2D1ZA 1BFCA 3IIRA 4OUJA 4QKRA 1WD3A 2NVHA 4G6MA 2ZQNA 2D20A 2K8RA 4QBVA 5G00A 1G9CA 4I4UA 5DVHA 1JQZA 3BTAA 1G9BA 3ILAA 4Z9WB 3RTIB 1DFCA 3I2XA 3VEQA 3B9UA 5BQUC 4QD2C 3BRDA 2KLLA 3RTJB 4I6IA 1JT4A 3CU1B 4I4YA 1SZ6B 2DRYA 4ZLBB 2D43A 1NUNA 4LO3C 2DS0A 1FV3A 1IRPA 4QALA 3CRHA 3R4UA 5DSSB 3FUQA 3OJMA 1G9DA 4OWKA 3HALA 4Q9PA 3N7KA 3VT0A 1S0GA 3QYDA 3LLPA 1FV2A 3PMEA 3CAHA 4I4OA 3ZXGA 2Q9XA 3Q7YA 4CJMA 2KH2A 1XZZA 4L4HA 3CA1A 5FZUA 4OEGA 2VLCA 2FDBM 4OEFA 4ZKTB 1J0SA 1RMLA 3WA1A 1QQKA 3VWCA 1W3GA 1BA7A 2J3PA 2M49A 2NM1A 1YF8B 31BIA 4ISRA 4J2KA 3WO4A 2AAIB 3Q7XA 1PZZA 2X2SA 3OJ2A 4Q9GA 1BFFA 4ZFWB 2YUGA 4I96A 1CE7B 1V6XA 1ISVA 4D0ZA 3CQAA 4USOA 3UDAA 4J23B 3R4SA 2Y9FA 2AXMA 1WD4A 2Y9XE 3V0BB 3A07A 1DQGA 4JKXB 2F2FA 1BFGA 4X38A 4D0TA 3UJ4A 3O44A 3N7LA 3H6QA 2NZ9A 3FJIA 4XKIA 1DZDA 1ISZA 4ZGRB 3A21A 1DJSB 4J2XA 1S0FA 41BIA 5BXTA 3CRGA 4FVVA 3O3QA 4KBBA 3P6JA 4X37A 5BQUA 1KNMA 1JY0A 4OWLA 3FJJA 1EV2A 3S8KA 4OWJA 3CA0A 1DZCA 3CA3A 1GGPB 1TP0A 4J2YA 2MIBA 2VU9A 1F31A 2HW9A 1T4QA 1HCEA 5BXRA 1TIEA 3A23A 3ZXDA 2ET2A 1V6VA 1II4A 1JT3A 1I1EA 4KEKA 4XFUA 4A7YA 4I4PA 3RMXA 1S0LA 4DENA 1CVSA 4IONA 1FWVA 2AFGA 4P0KA 3OBRA 2R9KB 4LO8B 4PC4A 3BAQA 5E24E 3BAUA 5BOWA 2Y9WC 3BX1C 3HMYA 2FFUA 4I3NA 3CA6A 1PUMB 4G6JA 1ONKB 3VSFA 3FFZA 1SR4C 3OGGA 1IRAX 1HWPB 1AVXB 2P23A 1QXMA 3AH2A 3HOMA 1HCDA 3Q7WA 1V6WA 4II0A 5FNWA 4I1BA 1IILA 1ILR1 1PC8B 5D63A 4FGFA 1AVWB 1FQ9A 4IZEA 2KKIA 2P39A 3AJ6A 2DREA 3BAOA 3TC2A 4F83A 3CA4A 1AVAC 2VSEA 2NTDA 2K4AB 2Z48A 1M16A 1OQLB 1RY7A 4QD2B 1XG6A 2IWTB 1XYFA 3BA4A 4WBCA 3VUOA 3FUOA 4I4RA 4ZBVB 1IHKA 3AZWA 2I1BA 1BASA 4EFRA 3HBWA 1PUUB 2D22A 2E4MC 1EYLA 2NYYA 3V79C 3FJ8A 3BA5A 3FJFA 4G1RA 1AXMA 1DQOA 4JQ0A 5BXSA 4IYBA 1Z0HA 5EC5A 1G82A 1JT5A 2IHOA 3AJ5A 2UUSA 2ESUA 4IY9A 3VT2A 1Q03A 3NJ5A 2Q3NB 3BAVA 3FJBA 4I8MA 2BEAA 3NBDA 4G9MA 4LO0C 4HJJA 4I0YA 1K5VA 5F90A 4LO2C 1JTCA 4KEIA 1WBAA 4KC3A 1Q04A 4HR6C 3VT1A 3C9ZA 4J2SA 4G9NA 1G9AA 1DIWA 2D23A 3O4AA 1MD6A 4I4SA 5DUYA 5FNXA 1EVTA 4JRAA 3ZC9A 2MC2A 2Y9GA 3FJAA 3N7MA 1FGAA 1FMMS 4P6AA 1D0HA 1SR4A 3FJEA 5GAQA 1K5UA 1BARA 1PWAA 4QBCA 3BRFA 3N0KA 4GOVA 3WO2A 4DCKC 3POKA 5BXPA 4Q91A 4JP0A 4LO7B 4YOLA 1JLYA 2BFHA 4AN6A 5I1BA 3BADA 2VXRA 4LO3A 4GP3A 1AFCA 1YXWA 1EPWA 1UPSA 5D62A 3NBCA 3FJ9A 4I2SA 1HKNA 4A7KA 3P6IA 1S0CA 1HWOB 2BEBA 2GO2A 4GAIA 5BP5C 2D44A 1FN0A 3CA5A 3SNVA 1AF9A 3BRGC 1Z2VA 2FO1A 3MPPG 4KEJA 7I1BA 2KI4A 2E4MA 2D7RA 3BAGA 1R8OA 4IHZA 3AKFA 3UD9A 5B2HA 1JT7A 2QYIB 3UD8A 4A7ZA 5EHAA 1T9FA 3H6RA 1S0DA 3BB2A 3O4DA 1ABRB 4L4IA 4Z8SB 3WMUA 4IQPA 4AN7B 1E0OA 3WINC 2XOAA 3LTQA 3HSMA 2ZR1B 3S8JA 1ISXA 3KMVA 4LO0A 4LO2A 5JLVA 3K1XA 3FJHA 3NBEA 3BAHA 4ZA3B 1Q1UA 3CRIA 3UJ0A 4H9WA 4ENDA 4ZFUB 5F8WA 5FZYA 3HN1A 3FJKA 2MLLB 3O4BA 3V0AA 3IM6A 4DEPA 3OBTA 3FJCA 1S0EA 1IJTA 1DFQA 1XHBA 2DRZA 4I1EA 1IOBA 2D24A 2NP0A 3WO3A 3AZVA 4I4XA 5DZUA 2FFVA 6I1BA 2RQ9A 4IY8A 3P53A 1HWNB 3FJDA 4I37A 1RZOB 4GAFA 3JUTA 5D61A 1VCLA 1W3AA 3BA7A 3F62B 2LIQA 3O4OA 3RMYA 5F8SA 4JAWA 3D7WB 4LO1C 4QKSA 1TWEA 3A22A 3T8SA 1BLDA 5BP5A 4GOYA 3VSZA 3I2AA 5EG6C 1BFBA 4I7IA 3AH4A 5FZZA 1YYNA 3MALA 21BIA 2ERMA 3O5WB 4QO3A 1ISYA 5F8YA
chains in the Genus database with same CATH superfamily
4P0JA 1L2HA 5BVPI 4D8HA 2WRYA 2Z49A 2HZ9A 2KI6B 2VXTI 2F8XC 3NBNA 1W3FA 1YTOA 3O4CA 3H6RB 4JPZA 3QR5A 4QC4A 1R8NA 3PHZA 4JKQA 2VUAA 3OGFA 1HWMB 2FGFA 3WINA 2ZQOA 2GZBA 4MZFB 3E8LC 2RSTA 3AKGA 3EF2A 2HWAA 3ZX7A 1NZKA 4ZOTA 3ZC8A 4EFQA 3N7JA 5HPZA 3V0AB 1DLLA 3IM5A 4XFSA 3AH1A 1BLAA 4OW4A 4F34A 3I29B 4I4QA 4LO7C 1I1BA 5JMCA 2L5XA 1JLXA 1Z4SA 3IAGC 4P0LA 3O49A 4XFTA 1YBIA 1P63A 2X2TA 1QQLA 3F1RA 4EEEB 2LIEA 1TFMB 4I4VA 3AKHA 3AKIA 4HA2A 1A8DA 3OJVA 1ISWA 4X39A 1IT0A 1MC9A 2NS2A 4X3AA 4ZFYB 1N4KA 3RSJA 2HWMA 3FGMA 4H04A 1V6UA 2K43A 4GP0A 3W9TA 1FMZA 1S0BA 2VSAA 4LO1A 1TWMA 3WMVA 8I1BA 3PUBA 2QN4A 4IZXA 4EFPA 4OEEA 4R6UB 2RG9B 1HIBA 2AQZA 3UD7A 4ISQA 1ITBA 1AVUA 1RG8A 2D7IA 3H6SE 9ILBA 1FWUA 2WBCA 4MZHA 4TLPA 3JRRA 1TTUA 2F2FC 1WBCA 3IM7A 4USPA 3V0BA 3PG0A 1M2TB 4EKXB 1TOOA 4EB2B 2D1ZA 1BFCA 3IIRA 4OUJA 4QKRA 1WD3A 2NVHA 4G6MA 2ZQNA 2D20A 2K8RA 4QBVA 5G00A 1G9CA 4I4UA 5DVHA 1JQZA 3BTAA 1G9BA 3ILAA 4Z9WB 3RTIB 1DFCA 3I2XA 3VEQA 3B9UA 5BQUC 4QD2C 3BRDA 2KLLA 3RTJB 4I6IA 1JT4A 3CU1B 4I4YA 1SZ6B 2DRYA 4ZLBB 2D43A 1NUNA 4LO3C 2DS0A 1FV3A 1IRPA 4QALA 3CRHA 3R4UA 5DSSB 3FUQA 3OJMA 1G9DA 4OWKA 3HALA 4Q9PA 3N7KA 3VT0A 1S0GA 3QYDA 3LLPA 1FV2A 3PMEA 3CAHA 4I4OA 3ZXGA 2Q9XA 3Q7YA 4CJMA 2KH2A 1XZZA 4L4HA 3CA1A 5FZUA 4OEGA 2VLCA 2FDBM 4OEFA 4ZKTB 1J0SA 1RMLA 3WA1A 1QQKA 3VWCA 1W3GA 1BA7A 2J3PA 2M49A 2NM1A 1YF8B 31BIA 4ISRA 4J2KA 3WO4A 2AAIB 3Q7XA 1PZZA 2X2SA 3OJ2A 4Q9GA 1BFFA 4ZFWB 2YUGA 4I96A 1CE7B 1V6XA 1ISVA 4D0ZA 3CQAA 4USOA 3UDAA 4J23B 3R4SA 2Y9FA 2AXMA 1WD4A 2Y9XE 3V0BB 3A07A 1DQGA 4JKXB 2F2FA 1BFGA 4X38A 4D0TA 3UJ4A 3O44A 3N7LA 3H6QA 2NZ9A 3FJIA 4XKIA 1DZDA 1ISZA 4ZGRB 3A21A 1DJSB 4J2XA 1S0FA 41BIA 5BXTA 3CRGA 4FVVA 3O3QA 4KBBA 3P6JA 4X37A 5BQUA 1KNMA 1JY0A 4OWLA 3FJJA 1EV2A 3S8KA 4OWJA 3CA0A 1DZCA 3CA3A 1GGPB 1TP0A 4J2YA 2MIBA 2VU9A 1F31A 2HW9A 1T4QA 1HCEA 5BXRA 1TIEA 3A23A 3ZXDA 2ET2A 1V6VA 1II4A 1JT3A 1I1EA 4KEKA 4XFUA 4A7YA 4I4PA 3RMXA 1S0LA 4DENA 1CVSA 4IONA 1FWVA 2AFGA 4P0KA 3OBRA 2R9KB 4LO8B 4PC4A 3BAQA 5E24E 3BAUA 5BOWA 2Y9WC 3BX1C 3HMYA 2FFUA 4I3NA 3CA6A 1PUMB 4G6JA 1ONKB 3VSFA 3FFZA 1SR4C 3OGGA 1IRAX 1HWPB 1AVXB 2P23A 1QXMA 3AH2A 3HOMA 1HCDA 3Q7WA 1V6WA 4II0A 5FNWA 4I1BA 1IILA 1ILR1 1PC8B 5D63A 4FGFA 1AVWB 1FQ9A 4IZEA 2KKIA 2P39A 3AJ6A 2DREA 3BAOA 3TC2A 4F83A 3CA4A 1AVAC 2VSEA 2NTDA 2K4AB 2Z48A 1M16A 1OQLB 1RY7A 4QD2B 1XG6A 2IWTB 1XYFA 3BA4A 4MZGB 4WBCA 3VUOA 3FUOA 4I4RA 4ZBVB 1IHKA 3AZWA 2I1BA 1BASA 4EFRA 3HBWA 1PUUB 2D22A 2E4MC 1EYLA 2NYYA 3V79C 3FJ8A 3BA5A 3FJFA 4G1RA 1AXMA 1DQOA 4JQ0A 5BXSA 4IYBA 1Z0HA 5EC5A 1G82A 1JT5A 2IHOA 3AJ5A 2UUSA 2ESUA 4IY9A 3VT2A 1Q03A 3NJ5A 2Q3NB 3BAVA 3FJBA 4I8MA 2BEAA 3NBDA 4G9MA 4LO0C 4HJJA 4I0YA 1K5VA 5F90A 4LO2C 1JTCA 4KEIA 1WBAA 4KC3A 1Q04A 4HR6C 3VT1A 3C9ZA 4J2SA 4G9NA 1G9AA 1DIWA 2D23A 3O4AA 1MD6A 4I4SA 5DUYA 5FNXA 1EVTA 4JRAA 3ZC9A 2MC2A 2Y9GA 3FJAA 3N7MA 1FGAA 1FMMS 4P6AA 1D0HA 1SR4A 3FJEA 5GAQA 1K5UA 1BARA 1PWAA 4QBCA 3BRFA 3N0KA 4GOVA 3WO2A 4DCKC 3POKA 5BXPA 4Q91A 4JP0A 4LO7B 4YOLA 1JLYA 2BFHA 4AN6A 5I1BA 3BADA 2VXRA 4LO3A 4GP3A 1AFCA 1YXWA 1EPWA 1UPSA 5D62A 3NBCA 3FJ9A 4I2SA 1HKNA 4A7KA 3P6IA 1S0CA 1HWOB 2BEBA 2GO2A 4GAIA 5BP5C 2D44A 1FN0A 3CA5A 3SNVA 1AF9A 3BRGC 1Z2VA 2FO1A 3MPPG 4KEJA 7I1BA 2KI4A 2E4MA 2D7RA 3BAGA 1R8OA 4IHZA 3AKFA 3UD9A 5B2HA 1JT7A 2QYIB 3UD8A 4A7ZA 5EHAA 1T9FA 3H6RA 1S0DA 3BB2A 3O4DA 1ABRB 4L4IA 4Z8SB 3WMUA 4IQPA 4AN7B 1E0OA 3WINC 2XOAA 3LTQA 3HSMA 2ZR1B 3S8JA 1ISXA 3KMVA 4LO0A 4LO2A 5JLVA 3K1XA 3FJHA 3NBEA 3BAHA 4ZA3B 1Q1UA 3CRIA 3UJ0A 4H9WA 4ENDA 4ZFUB 5F8WA 5FZYA 3HN1A 3FJKA 2MLLB 3O4BA 3V0AA 3IM6A 4DEPA 3OBTA 3FJCA 1S0EA 1IJTA 1DFQA 1XHBA 2DRZA 4I1EA 1IOBA 2D24A 2NP0A 3WO3A 3AZVA 4I4XA 5DZUA 2FFVA 6I1BA 2RQ9A 4IY8A 3P53A 1HWNB 3FJDA 4I37A 1RZOB 4GAFA 3JUTA 5D61A 1VCLA 4UY4A 4H75A 1W3AA 3BA7A 3F62B 2LIQA 3O4OA 3RMYA 5F8SA 4JAWA 3D7WB 4LO1C 4QKSA 1TWEA 3A22A 3T8SA 1BLDA 5BP5A 4GOYA 3VSZA 3I2AA 5EG6C 1BFBA 4I7IA 3AH4A 5FZZA 1YYNA 3MALA 21BIA 2ERMA 3O5WB 4QO3A 1ISYA 5F8YA
chains in the Genus database with same CATH topology
4P0JA 1L2HA 5BVPI 4D8HA 2WRYA 2Z49A 2HZ9A 2KI6B 2VXTI 2F8XC 3NBNA 1W3FA 1YTOA 3O4CA 3H6RB 4JPZA 3QR5A 4QC4A 1R8NA 3PHZA 4JKQA 2VUAA 3OGFA 1HWMB 2FGFA 3WINA 2ZQOA 2GZBA 4MZFB 3E8LC 2RSTA 3AKGA 3EF2A 2HWAA 3ZX7A 1NZKA 4ZOTA 3ZC8A 4EFQA 3N7JA 5HPZA 3V0AB 1DLLA 3IM5A 4XFSA 3AH1A 1BLAA 4OW4A 4F34A 3I29B 4I4QA 4LO7C 1I1BA 5JMCA 2L5XA 1JLXA 1Z4SA 3IAGC 4P0LA 3O49A 4XFTA 1YBIA 1P63A 2X2TA 1QQLA 3F1RA 4EEEB 2LIEA 1TFMB 4I4VA 3AKHA 3AKIA 4HA2A 1A8DA 3OJVA 1ISWA 4X39A 1IT0A 1MC9A 2NS2A 4X3AA 4ZFYB 1N4KA 3RSJA 2HWMA 3FGMA 4H04A 1V6UA 2K43A 4GP0A 3W9TA 1FMZA 1S0BA 2VSAA 4LO1A 1TWMA 3WMVA 8I1BA 3PUBA 2QN4A 4IZXA 4EFPA 4OEEA 4R6UB 2RG9B 1HIBA 2AQZA 3UD7A 4ISQA 1ITBA 1AVUA 1RG8A 2D7IA 3H6SE 9ILBA 1FWUA 2WBCA 4MZHA 4TLPA 3JRRA 1TTUA 2F2FC 1WBCA 3IM7A 4USPA 3V0BA 3PG0A 1M2TB 4EKXB 1TOOA 4EB2B 2D1ZA 1BFCA 3IIRA 4OUJA 4QKRA 1WD3A 2NVHA 4G6MA 2ZQNA 2D20A 2K8RA 4QBVA 5G00A 1G9CA 4I4UA 5DVHA 1JQZA 3BTAA 1G9BA 3ILAA 4Z9WB 3RTIB 1DFCA 3I2XA 3VEQA 3B9UA 5BQUC 4QD2C 3BRDA 2KLLA 3RTJB 4I6IA 1JT4A 3CU1B 4I4YA 1SZ6B 2DRYA 4ZLBB 2D43A 1NUNA 4LO3C 2DS0A 1FV3A 1IRPA 4QALA 3CRHA 3R4UA 5DSSB 3FUQA 3OJMA 1G9DA 4OWKA 3HALA 4Q9PA 3N7KA 3VT0A 1S0GA 3QYDA 3LLPA 1FV2A 3PMEA 3CAHA 4I4OA 3ZXGA 2Q9XA 3Q7YA 4CJMA 2KH2A 1XZZA 4L4HA 3CA1A 5FZUA 4OEGA 2VLCA 2FDBM 4OEFA 4ZKTB 1J0SA 1RMLA 3WA1A 1QQKA 3VWCA 1W3GA 1BA7A 2J3PA 2M49A 2NM1A 1YF8B 31BIA 4ISRA 4J2KA 3WO4A 2AAIB 3Q7XA 1PZZA 2X2SA 3OJ2A 4Q9GA 1BFFA 4ZFWB 2YUGA 4I96A 1CE7B 1V6XA 1ISVA 4D0ZA 3CQAA 4USOA 3UDAA 4J23B 3R4SA 2Y9FA 2AXMA 1WD4A 2Y9XE 3V0BB 3A07A 1DQGA 4JKXB 2F2FA 1BFGA 4X38A 4D0TA 3UJ4A 3O44A 3N7LA 3H6QA 2NZ9A 3FJIA 4XKIA 1DZDA 1ISZA 4ZGRB 3A21A 1DJSB 4J2XA 1S0FA 41BIA 5BXTA 3CRGA 4FVVA 3O3QA 4KBBA 3P6JA 4X37A 5BQUA 1KNMA 1JY0A 4OWLA 3FJJA 1EV2A 3S8KA 4OWJA 3CA0A 1DZCA 3CA3A 1GGPB 1TP0A 4J2YA 2MIBA 2VU9A 1F31A 2HW9A 1T4QA 1HCEA 5BXRA 1TIEA 3A23A 3ZXDA 2ET2A 1V6VA 1II4A 1JT3A 1I1EA 4KEKA 4XFUA 4A7YA 4I4PA 3RMXA 1S0LA 4DENA 1CVSA 4IONA 1FWVA 2AFGA 4P0KA 3OBRA 2R9KB 4LO8B 4PC4A 3BAQA 5E24E 3BAUA 5BOWA 2Y9WC 3BX1C 3HMYA 2FFUA 4I3NA 3CA6A 1PUMB 4G6JA 1ONKB 3VSFA 3FFZA 1SR4C 3OGGA 1IRAX 1HWPB 1AVXB 2P23A 1QXMA 3AH2A 3HOMA 1HCDA 3Q7WA 1V6WA 4II0A 5FNWA 4I1BA 1IILA 1ILR1 1PC8B 5D63A 4FGFA 1AVWB 1FQ9A 4IZEA 2KKIA 2P39A 3AJ6A 2DREA 3BAOA 3TC2A 4F83A 3CA4A 1AVAC 2VSEA 2NTDA 2K4AB 2Z48A 1M16A 1OQLB 1RY7A 4QD2B 1XG6A 2IWTB 1XYFA 3BA4A 4MZGB 4WBCA 3VUOA 3FUOA 4I4RA 4ZBVB 1IHKA 3AZWA 2I1BA 1BASA 4EFRA 3HBWA 1PUUB 2D22A 2E4MC 1EYLA 2NYYA 3V79C 3FJ8A 3BA5A 3FJFA 4G1RA 1AXMA 1DQOA 4JQ0A 5BXSA 4IYBA 1Z0HA 5EC5A 1G82A 1JT5A 2IHOA 3AJ5A 2UUSA 2ESUA 4IY9A 3VT2A 1Q03A 3NJ5A 2Q3NB 3BAVA 3FJBA 4I8MA 2BEAA 3NBDA 4G9MA 4LO0C 4HJJA 4I0YA 1K5VA 5F90A 4LO2C 1JTCA 4KEIA 1WBAA 4KC3A 1Q04A 4HR6C 3VT1A 3C9ZA 4J2SA 4G9NA 1G9AA 1DIWA 2D23A 3O4AA 1MD6A 4I4SA 5DUYA 5FNXA 1EVTA 4JRAA 3ZC9A 2MC2A 2Y9GA 3FJAA 3N7MA 1FGAA 1FMMS 4P6AA 1D0HA 1SR4A 3FJEA 5GAQA 1K5UA 1BARA 1PWAA 4QBCA 3BRFA 3N0KA 4GOVA 3WO2A 4DCKC 3POKA 5BXPA 4Q91A 4JP0A 4LO7B 4YOLA 1JLYA 2BFHA 4AN6A 5I1BA 3BADA 2VXRA 4LO3A 4GP3A 1AFCA 1YXWA 1EPWA 1UPSA 5D62A 3NBCA 3FJ9A 4I2SA 1HKNA 4A7KA 3P6IA 1S0CA 1HWOB 2BEBA 2GO2A 4GAIA 5BP5C 2D44A 1FN0A 3CA5A 3SNVA 1AF9A 3BRGC 1Z2VA 2FO1A 3MPPG 4KEJA 7I1BA 2KI4A 2E4MA 2D7RA 3BAGA 1R8OA 4IHZA 3AKFA 3UD9A 5B2HA 1JT7A 2QYIB 3UD8A 4A7ZA 5EHAA 1T9FA 3H6RA 1S0DA 3BB2A 3O4DA 1ABRB 4L4IA 4Z8SB 3WMUA 4IQPA 4AN7B 1E0OA 3WINC 2XOAA 3LTQA 3HSMA 2ZR1B 3S8JA 1ISXA 3KMVA 4LO0A 4LO2A 5JLVA 3K1XA 3FJHA 3NBEA 3BAHA 4ZA3B 1Q1UA 3CRIA 3UJ0A 4H9WA 4ENDA 4ZFUB 5F8WA 5FZYA 3HN1A 3FJKA 2MLLB 3O4BA 3V0AA 3IM6A 4DEPA 3OBTA 3FJCA 1S0EA 1IJTA 1DFQA 1XHBA 2DRZA 4I1EA 1IOBA 2D24A 2NP0A 3WO3A 3AZVA 4I4XA 5DZUA 2FFVA 6I1BA 2RQ9A 4IY8A 3P53A 1HWNB 3FJDA 4I37A 1RZOB 4GAFA 3JUTA 5D61A 1VCLA 4UY4A 4H75A 1W3AA 3BA7A 3F62B 2LIQA 3O4OA 3RMYA 5F8SA 4JAWA 3D7WB 4LO1C 4QKSA 1TWEA 3A22A 3T8SA 1BLDA 5BP5A 4GOYA 3VSZA 3I2AA 5EG6C 1BFBA 4I7IA 3AH4A 5FZZA 1YYNA 3MALA 21BIA 2ERMA 3O5WB 4QO3A 1ISYA 5F8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0J A;  1L2H A;  5BVP I;  4D8H A;  2WRY A;  2Z49 A;  2HZ9 A;  2KI6 B;  2VXT I;  2F8X C;  3NBN A;  1W3F A;  1YTO A;  3O4C A;  3H6R B;  4JPZ A;  3QR5 A;  4QC4 A;  1R8N A;  3PHZ A;  4JKQ A;  2VUA A;  3OGF A;  1HWM B;  2FGF A;  3WIN A;  2ZQO A;  2GZB A;  3E8L C;  2RST A;  3AKG A;  3EF2 A;  2HWA A;  3ZX7 A;  1NZK A;  4ZOT A;  3ZC8 A;  4EFQ A;  3N7J A;  5HPZ A;  3V0A B;  1DLL A;  3IM5 A;  4XFS A;  3AH1 A;  1BLA A;  4OW4 A;  4F34 A;  3I29 B;  4I4Q A;  4LO7 C;  1I1B A;  5JMC A;  2L5X A;  1JLX A;  1Z4S A;  3IAG C;  4P0L A;  3O49 A;  4XFT A;  1YBI A;  1P63 A;  2X2T A;  1QQL A;  3F1R A;  4EEE B;  2LIE A;  1TFM B;  4I4V A;  3AKH A;  3AKI A;  4HA2 A;  1A8D A;  3OJV A;  1ISW A;  4X39 A;  1IT0 A;  1MC9 A;  4X3A A;  4ZFY B;  1N4K A;  3RSJ A;  2HWM A;  3FGM A;  4H04 A;  1V6U A;  2K43 A;  4GP0 A;  3W9T A;  1FMZ A;  1S0B A;  2VSA A;  4LO1 A;  1TWM A;  3WMV A;  8I1B A;  3PUB A;  2QN4 A;  4IZX A;  4EFP A;  4OEE A;  4R6U B;  2RG9 B;  1HIB A;  2AQZ A;  3UD7 A;  4ISQ A;  1ITB A;  1AVU A;  1RG8 A;  2D7I A;  3H6S E;  9ILB A;  1FWU A;  2WBC A;  4TLP A;  3JRR A;  1TTU A;  2F2F C;  1WBC A;  3IM7 A;  4USP A;  3V0B A;  3PG0 A;  1M2T B;  4EKX B;  1TOO A;  4EB2 B;  2D1Z A;  1BFC A;  3IIR A;  4OUJ A;  4QKR A;  1WD3 A;  2NVH A;  4G6M A;  2ZQN A;  2D20 A;  2K8R A;  4QBV A;  5G00 A;  1G9C A;  4I4U A;  5DVH A;  1JQZ A;  3BTA A;  1G9B A;  3ILA A;  4Z9W B;  3RTI B;  1DFC A;  3I2X A;  3VEQ A;  3B9U A;  5BQU C;  4QD2 C;  3BRD A;  2KLL A;  3RTJ B;  4I6I A;  1JT4 A;  3CU1 B;  4I4Y A;  1SZ6 B;  2DRY A;  4ZLB B;  2D43 A;  1NUN A;  4LO3 C;  2DS0 A;  1FV3 A;  1IRP A;  4QAL A;  3CRH A;  3R4U A;  5DSS B;  3FUQ A;  3OJM A;  1G9D A;  4OWK A;  3HAL A;  4Q9P A;  3N7K A;  3VT0 A;  1S0G A;  3QYD A;  3LLP A;  1FV2 A;  3PME A;  3CAH A;  4I4O A;  3ZXG A;  2Q9X A;  3Q7Y A;  4CJM A;  2KH2 A;  1XZZ A;  4L4H A;  3CA1 A;  5FZU A;  4OEG A;  2VLC A;  2FDB M;  4OEF A;  4ZKT B;  1J0S A;  1RML A;  3WA1 A;  1QQK A;  3VWC A;  1W3G A;  1BA7 A;  2J3P A;  2M49 A;  2NM1 A;  1YF8 B;  31BI A;  4ISR A;  4J2K A;  3WO4 A;  2AAI B;  3Q7X A;  1PZZ A;  2X2S A;  3OJ2 A;  4Q9G A;  1BFF A;  4ZFW B;  2YUG A;  4I96 A;  1CE7 B;  1V6X A;  1ISV A;  4D0Z A;  3CQA A;  4USO A;  3UDA A;  4J23 B;  3R4S A;  2Y9F A;  2AXM A;  1WD4 A;  2Y9X E;  3V0B B;  3A07 A;  1DQG A;  4JKX B;  2F2F A;  1BFG A;  4X38 A;  4D0T A;  3UJ4 A;  3O44 A;  3N7L A;  3H6Q A;  2NZ9 A;  3FJI A;  4XKI A;  1DZD A;  1ISZ A;  4ZGR B;  3A21 A;  1DJS B;  4J2X A;  1S0F A;  41BI A;  5BXT A;  3CRG A;  4FVV A;  3O3Q A;  4KBB A;  3P6J A;  4X37 A;  5BQU A;  1KNM A;  1JY0 A;  4OWL A;  3FJJ A;  1EV2 A;  3S8K A;  4OWJ A;  3CA0 A;  1DZC A;  3CA3 A;  1GGP B;  1TP0 A;  4J2Y A;  2MIB A;  2VU9 A;  1F31 A;  2HW9 A;  1T4Q A;  1HCE A;  5BXR A;  1TIE A;  3A23 A;  3ZXD A;  2ET2 A;  1V6V A;  1II4 A;  1JT3 A;  1I1E A;  4KEK A;  4XFU A;  4A7Y A;  4I4P A;  3RMX A;  1S0L A;  4DEN A;  1CVS A;  4ION A;  1FWV A;  2AFG A;  4P0K A;  3OBR A;  2R9K B;  4LO8 B;  4PC4 A;  3BAQ A;  5E24 E;  3BAU A;  5BOW A;  2Y9W C;  3BX1 C;  3HMY A;  2FFU A;  4I3N A;  3CA6 A;  1PUM B;  4G6J A;  1ONK B;  3VSF A;  3FFZ A;  1SR4 C;  3OGG A;  1IRA X;  1HWP B;  1AVX B;  2P23 A;  1QXM A;  3AH2 A;  3HOM A;  1HCD A;  3Q7W A;  1V6W A;  4II0 A;  5FNW A;  4I1B A;  1IIL A;  1ILR 1;  1PC8 B;  5D63 A;  4FGF A;  1AVW B;  1FQ9 A;  4IZE A;  2KKI A;  2P39 A;  3AJ6 A;  2DRE A;  3BAO A;  3TC2 A;  4F83 A;  3CA4 A;  1AVA C;  2VSE A;  2NTD A;  2K4A B;  2Z48 A;  1M16 A;  1OQL B;  1RY7 A;  4QD2 B;  1XG6 A;  2IWT B;  1XYF A;  3BA4 A;  4WBC A;  3VUO A;  3FUO A;  4I4R A;  4ZBV B;  1IHK A;  3AZW A;  2I1B A;  1BAS A;  4EFR A;  3HBW A;  1PUU B;  2D22 A;  2E4M C;  1EYL A;  2NYY A;  3V79 C;  3FJ8 A;  3BA5 A;  3FJF A;  4G1R A;  1AXM A;  1DQO A;  4JQ0 A;  5BXS A;  4IYB A;  1Z0H A;  5EC5 A;  1G82 A;  1JT5 A;  2IHO A;  3AJ5 A;  2UUS A;  2ESU A;  4IY9 A;  3VT2 A;  1Q03 A;  3NJ5 A;  2Q3N B;  3BAV A;  3FJB A;  4I8M A;  2BEA A;  3NBD A;  4G9M A;  4LO0 C;  4HJJ A;  4I0Y A;  1K5V A;  5F90 A;  4LO2 C;  1JTC A;  4KEI A;  1WBA A;  4KC3 A;  1Q04 A;  4HR6 C;  3VT1 A;  3C9Z A;  4J2S A;  4G9N A;  1G9A A;  1DIW A;  2D23 A;  3O4A A;  1MD6 A;  4I4S A;  5DUY A;  5FNX A;  1EVT A;  4JRA A;  3ZC9 A;  2MC2 A;  2Y9G A;  3FJA A;  3N7M A;  1FGA A;  1FMM S;  4P6A A;  1D0H A;  1SR4 A;  3FJE A;  5GAQ A;  1K5U A;  1BAR A;  1PWA A;  4QBC A;  3BRF A;  3N0K A;  4GOV A;  3WO2 A;  4DCK C;  3POK A;  5BXP A;  4Q91 A;  4JP0 A;  4LO7 B;  4YOL A;  1JLY A;  2BFH A;  4AN6 A;  5I1B A;  3BAD A;  2VXR A;  4LO3 A;  4GP3 A;  1AFC A;  1YXW A;  1EPW A;  1UPS A;  5D62 A;  3NBC A;  3FJ9 A;  4I2S A;  1HKN A;  4A7K A;  3P6I A;  1S0C A;  1HWO B;  2BEB A;  2GO2 A;  4GAI A;  5BP5 C;  2D44 A;  1FN0 A;  3CA5 A;  3SNV A;  1AF9 A;  3BRG C;  1Z2V A;  2FO1 A;  3MPP G;  4KEJ A;  7I1B A;  2KI4 A;  2E4M A;  2D7R A;  3BAG A;  1R8O A;  4IHZ A;  3AKF A;  3UD9 A;  5B2H A;  1JT7 A;  2QYI B;  3UD8 A;  4A7Z A;  5EHA A;  1T9F A;  3H6R A;  1S0D A;  3BB2 A;  3O4D A;  1ABR B;  4L4I A;  4Z8S B;  3WMU A;  4IQP A;  4AN7 B;  1E0O A;  3WIN C;  2XOA A;  3LTQ A;  3HSM A;  2ZR1 B;  3S8J A;  1ISX A;  3KMV A;  4LO0 A;  4LO2 A;  5JLV A;  3K1X A;  3FJH A;  3NBE A;  3BAH A;  4ZA3 B;  1Q1U A;  3CRI A;  3UJ0 A;  4H9W A;  4END A;  4ZFU B;  5F8W A;  5FZY A;  3HN1 A;  3FJK A;  2MLL B;  3O4B A;  3V0A A;  3IM6 A;  4DEP A;  3OBT A;  3FJC A;  1S0E A;  1IJT A;  1DFQ A;  1XHB A;  2DRZ A;  4I1E A;  1IOB A;  2D24 A;  2NP0 A;  3WO3 A;  3AZV A;  4I4X A;  5DZU A;  2FFV A;  6I1B A;  2RQ9 A;  4IY8 A;  3P53 A;  1HWN B;  3FJD A;  4I37 A;  1RZO B;  4GAF A;  3JUT A;  5D61 A;  1VCL A;  1W3A A;  3BA7 A;  3F62 B;  2LIQ A;  3O4O A;  3RMY A;  5F8S A;  4JAW A;  3D7W B;  4LO1 C;  4QKS A;  1TWE A;  3A22 A;  3T8S A;  1BLD A;  5BP5 A;  4GOY A;  3VSZ A;  3I2A A;  5EG6 C;  1BFB A;  4I7I A;  3AH4 A;  5FZZ A;  1YYN A;  3MAL A;  21BI A;  2ERM A;  3O5W B;  4QO3 A;  1ISY A;  5F8Y A; 
#chains in the Genus database with same CATH topology
 4P0J A;  1L2H A;  5BVP I;  4D8H A;  2WRY A;  2Z49 A;  2HZ9 A;  2KI6 B;  2VXT I;  2F8X C;  3NBN A;  1W3F A;  1YTO A;  3O4C A;  3H6R B;  4JPZ A;  3QR5 A;  4QC4 A;  1R8N A;  3PHZ A;  4JKQ A;  2VUA A;  3OGF A;  1HWM B;  2FGF A;  3WIN A;  2ZQO A;  2GZB A;  4MZF B;  3E8L C;  2RST A;  3AKG A;  3EF2 A;  2HWA A;  3ZX7 A;  1NZK A;  4ZOT A;  3ZC8 A;  4EFQ A;  3N7J A;  5HPZ A;  3V0A B;  1DLL A;  3IM5 A;  4XFS A;  3AH1 A;  1BLA A;  4OW4 A;  4F34 A;  3I29 B;  4I4Q A;  4LO7 C;  1I1B A;  5JMC A;  2L5X A;  1JLX A;  1Z4S A;  3IAG C;  4P0L A;  3O49 A;  4XFT A;  1YBI A;  1P63 A;  2X2T A;  1QQL A;  3F1R A;  4EEE B;  2LIE A;  1TFM B;  4I4V A;  3AKH A;  3AKI A;  4HA2 A;  1A8D A;  3OJV A;  1ISW A;  4X39 A;  1IT0 A;  1MC9 A;  2NS2 A;  4X3A A;  4ZFY B;  1N4K A;  3RSJ A;  2HWM A;  3FGM A;  4H04 A;  1V6U A;  2K43 A;  4GP0 A;  3W9T A;  1FMZ A;  1S0B A;  2VSA A;  4LO1 A;  1TWM A;  3WMV A;  8I1B A;  3PUB A;  2QN4 A;  4IZX A;  4EFP A;  4OEE A;  4R6U B;  2RG9 B;  1HIB A;  2AQZ A;  3UD7 A;  4ISQ A;  1ITB A;  1AVU A;  1RG8 A;  2D7I A;  3H6S E;  9ILB A;  1FWU A;  2WBC A;  4MZH A;  4TLP A;  3JRR A;  1TTU A;  2F2F C;  1WBC A;  3IM7 A;  4USP A;  3V0B A;  3PG0 A;  1M2T B;  4EKX B;  1TOO A;  4EB2 B;  2D1Z A;  1BFC A;  3IIR A;  4OUJ A;  4QKR A;  1WD3 A;  2NVH A;  4G6M A;  2ZQN A;  2D20 A;  2K8R A;  4QBV A;  5G00 A;  1G9C A;  4I4U A;  5DVH A;  1JQZ A;  3BTA A;  1G9B A;  3ILA A;  4Z9W B;  3RTI B;  1DFC A;  3I2X A;  3VEQ A;  3B9U A;  5BQU C;  4QD2 C;  3BRD A;  2KLL A;  3RTJ B;  4I6I A;  1JT4 A;  3CU1 B;  4I4Y A;  1SZ6 B;  2DRY A;  4ZLB B;  2D43 A;  1NUN A;  4LO3 C;  2DS0 A;  1FV3 A;  1IRP A;  4QAL A;  3CRH A;  3R4U A;  5DSS B;  3FUQ A;  3OJM A;  1G9D A;  4OWK A;  3HAL A;  4Q9P A;  3N7K A;  3VT0 A;  1S0G A;  3QYD A;  3LLP A;  1FV2 A;  3PME A;  3CAH A;  4I4O A;  3ZXG A;  2Q9X A;  3Q7Y A;  4CJM A;  2KH2 A;  1XZZ A;  4L4H A;  3CA1 A;  5FZU A;  4OEG A;  2VLC A;  2FDB M;  4OEF A;  4ZKT B;  1J0S A;  1RML A;  3WA1 A;  1QQK A;  3VWC A;  1W3G A;  1BA7 A;  2J3P A;  2M49 A;  2NM1 A;  1YF8 B;  31BI A;  4ISR A;  4J2K A;  3WO4 A;  2AAI B;  3Q7X A;  1PZZ A;  2X2S A;  3OJ2 A;  4Q9G A;  1BFF A;  4ZFW B;  2YUG A;  4I96 A;  1CE7 B;  1V6X A;  1ISV A;  4D0Z A;  3CQA A;  4USO A;  3UDA A;  4J23 B;  3R4S A;  2Y9F A;  2AXM A;  1WD4 A;  2Y9X E;  3V0B B;  3A07 A;  1DQG A;  4JKX B;  2F2F A;  1BFG A;  4X38 A;  4D0T A;  3UJ4 A;  3O44 A;  3N7L A;  3H6Q A;  2NZ9 A;  3FJI A;  4XKI A;  1DZD A;  1ISZ A;  4ZGR B;  3A21 A;  1DJS B;  4J2X A;  1S0F A;  41BI A;  5BXT A;  3CRG A;  4FVV A;  3O3Q A;  4KBB A;  3P6J A;  4X37 A;  5BQU A;  1KNM A;  1JY0 A;  4OWL A;  3FJJ A;  1EV2 A;  3S8K A;  4OWJ A;  3CA0 A;  1DZC A;  3CA3 A;  1GGP B;  1TP0 A;  4J2Y A;  2MIB A;  2VU9 A;  1F31 A;  2HW9 A;  1T4Q A;  1HCE A;  5BXR A;  1TIE A;  3A23 A;  3ZXD A;  2ET2 A;  1V6V A;  1II4 A;  1JT3 A;  1I1E A;  4KEK A;  4XFU A;  4A7Y A;  4I4P A;  3RMX A;  1S0L A;  4DEN A;  1CVS A;  4ION A;  1FWV A;  2AFG A;  4P0K A;  3OBR A;  2R9K B;  4LO8 B;  4PC4 A;  3BAQ A;  5E24 E;  3BAU A;  5BOW A;  2Y9W C;  3BX1 C;  3HMY A;  2FFU A;  4I3N A;  3CA6 A;  1PUM B;  4G6J A;  1ONK B;  3VSF A;  3FFZ A;  1SR4 C;  3OGG A;  1IRA X;  1HWP B;  1AVX B;  2P23 A;  1QXM A;  3AH2 A;  3HOM A;  1HCD A;  3Q7W A;  1V6W A;  4II0 A;  5FNW A;  4I1B A;  1IIL A;  1ILR 1;  1PC8 B;  5D63 A;  4FGF A;  1AVW B;  1FQ9 A;  4IZE A;  2KKI A;  2P39 A;  3AJ6 A;  2DRE A;  3BAO A;  3TC2 A;  4F83 A;  3CA4 A;  1AVA C;  2VSE A;  2NTD A;  2K4A B;  2Z48 A;  1M16 A;  1OQL B;  1RY7 A;  4QD2 B;  1XG6 A;  2IWT B;  1XYF A;  3BA4 A;  4MZG B;  4WBC A;  3VUO A;  3FUO A;  4I4R A;  4ZBV B;  1IHK A;  3AZW A;  2I1B A;  1BAS A;  4EFR A;  3HBW A;  1PUU B;  2D22 A;  2E4M C;  1EYL A;  2NYY A;  3V79 C;  3FJ8 A;  3BA5 A;  3FJF A;  4G1R A;  1AXM A;  1DQO A;  4JQ0 A;  5BXS A;  4IYB A;  1Z0H A;  5EC5 A;  1G82 A;  1JT5 A;  2IHO A;  3AJ5 A;  2UUS A;  2ESU A;  4IY9 A;  3VT2 A;  1Q03 A;  3NJ5 A;  2Q3N B;  3BAV A;  3FJB A;  4I8M A;  2BEA A;  3NBD A;  4G9M A;  4LO0 C;  4HJJ A;  4I0Y A;  1K5V A;  5F90 A;  4LO2 C;  1JTC A;  4KEI A;  1WBA A;  4KC3 A;  1Q04 A;  4HR6 C;  3VT1 A;  3C9Z A;  4J2S A;  4G9N A;  1G9A A;  1DIW A;  2D23 A;  3O4A A;  1MD6 A;  4I4S A;  5DUY A;  5FNX A;  1EVT A;  4JRA A;  3ZC9 A;  2MC2 A;  2Y9G A;  3FJA A;  3N7M A;  1FGA A;  1FMM S;  4P6A A;  1D0H A;  1SR4 A;  3FJE A;  5GAQ A;  1K5U A;  1BAR A;  1PWA A;  4QBC A;  3BRF A;  3N0K A;  4GOV A;  3WO2 A;  4DCK C;  3POK A;  5BXP A;  4Q91 A;  4JP0 A;  4LO7 B;  4YOL A;  1JLY A;  2BFH A;  4AN6 A;  5I1B A;  3BAD A;  2VXR A;  4LO3 A;  4GP3 A;  1AFC A;  1YXW A;  1EPW A;  1UPS A;  5D62 A;  3NBC A;  3FJ9 A;  4I2S A;  1HKN A;  4A7K A;  3P6I A;  1S0C A;  1HWO B;  2BEB A;  2GO2 A;  4GAI A;  5BP5 C;  2D44 A;  1FN0 A;  3CA5 A;  3SNV A;  1AF9 A;  3BRG C;  1Z2V A;  2FO1 A;  3MPP G;  4KEJ A;  7I1B A;  2KI4 A;  2E4M A;  2D7R A;  3BAG A;  1R8O A;  4IHZ A;  3AKF A;  3UD9 A;  5B2H A;  1JT7 A;  2QYI B;  3UD8 A;  4A7Z A;  5EHA A;  1T9F A;  3H6R A;  1S0D A;  3BB2 A;  3O4D A;  1ABR B;  4L4I A;  4Z8S B;  3WMU A;  4IQP A;  4AN7 B;  1E0O A;  3WIN C;  2XOA A;  3LTQ A;  3HSM A;  2ZR1 B;  3S8J A;  1ISX A;  3KMV A;  4LO0 A;  4LO2 A;  5JLV A;  3K1X A;  3FJH A;  3NBE A;  3BAH A;  4ZA3 B;  1Q1U A;  3CRI A;  3UJ0 A;  4H9W A;  4END A;  4ZFU B;  5F8W A;  5FZY A;  3HN1 A;  3FJK A;  2MLL B;  3O4B A;  3V0A A;  3IM6 A;  4DEP A;  3OBT A;  3FJC A;  1S0E A;  1IJT A;  1DFQ A;  1XHB A;  2DRZ A;  4I1E A;  1IOB A;  2D24 A;  2NP0 A;  3WO3 A;  3AZV A;  4I4X A;  5DZU A;  2FFV A;  6I1B A;  2RQ9 A;  4IY8 A;  3P53 A;  1HWN B;  3FJD A;  4I37 A;  1RZO B;  4GAF A;  3JUT A;  5D61 A;  1VCL A;  4UY4 A;  4H75 A;  1W3A A;  3BA7 A;  3F62 B;  2LIQ A;  3O4O A;  3RMY A;  5F8S A;  4JAW A;  3D7W B;  4LO1 C;  4QKS A;  1TWE A;  3A22 A;  3T8S A;  1BLD A;  5BP5 A;  4GOY A;  3VSZ A;  3I2A A;  5EG6 C;  1BFB A;  4I7I A;  3AH4 A;  5FZZ A;  1YYN A;  3MAL A;  21BI A;  2ERM A;  3O5W B;  4QO3 A;  1ISY A;  5F8Y A; 
#chains in the Genus database with same CATH homology
 4P0J A;  1L2H A;  5BVP I;  4D8H A;  2WRY A;  2Z49 A;  2HZ9 A;  2KI6 B;  2VXT I;  2F8X C;  3NBN A;  1W3F A;  1YTO A;  3O4C A;  3H6R B;  4JPZ A;  3QR5 A;  4QC4 A;  1R8N A;  3PHZ A;  4JKQ A;  2VUA A;  3OGF A;  1HWM B;  2FGF A;  3WIN A;  2ZQO A;  2GZB A;  4MZF B;  3E8L C;  2RST A;  3AKG A;  3EF2 A;  2HWA A;  3ZX7 A;  1NZK A;  4ZOT A;  3ZC8 A;  4EFQ A;  3N7J A;  5HPZ A;  3V0A B;  1DLL A;  3IM5 A;  4XFS A;  3AH1 A;  1BLA A;  4OW4 A;  4F34 A;  3I29 B;  4I4Q A;  4LO7 C;  1I1B A;  5JMC A;  2L5X A;  1JLX A;  1Z4S A;  3IAG C;  4P0L A;  3O49 A;  4XFT A;  1YBI A;  1P63 A;  2X2T A;  1QQL A;  3F1R A;  4EEE B;  2LIE A;  1TFM B;  4I4V A;  3AKH A;  3AKI A;  4HA2 A;  1A8D A;  3OJV A;  1ISW A;  4X39 A;  1IT0 A;  1MC9 A;  2NS2 A;  4X3A A;  4ZFY B;  1N4K A;  3RSJ A;  2HWM A;  3FGM A;  4H04 A;  1V6U A;  2K43 A;  4GP0 A;  3W9T A;  1FMZ A;  1S0B A;  2VSA A;  4LO1 A;  1TWM A;  3WMV A;  8I1B A;  3PUB A;  2QN4 A;  4IZX A;  4EFP A;  4OEE A;  4R6U B;  2RG9 B;  1HIB A;  2AQZ A;  3UD7 A;  4ISQ A;  1ITB A;  1AVU A;  1RG8 A;  2D7I A;  3H6S E;  9ILB A;  1FWU A;  2WBC A;  4MZH A;  4TLP A;  3JRR A;  1TTU A;  2F2F C;  1WBC A;  3IM7 A;  4USP A;  3V0B A;  3PG0 A;  1M2T B;  4EKX B;  1TOO A;  4EB2 B;  2D1Z A;  1BFC A;  3IIR A;  4OUJ A;  4QKR A;  1WD3 A;  2NVH A;  4G6M A;  2ZQN A;  2D20 A;  2K8R A;  4QBV A;  5G00 A;  1G9C A;  4I4U A;  5DVH A;  1JQZ A;  3BTA A;  1G9B A;  3ILA A;  4Z9W B;  3RTI B;  1DFC A;  3I2X A;  3VEQ A;  3B9U A;  5BQU C;  4QD2 C;  3BRD A;  2KLL A;  3RTJ B;  4I6I A;  1JT4 A;  3CU1 B;  4I4Y A;  1SZ6 B;  2DRY A;  4ZLB B;  2D43 A;  1NUN A;  4LO3 C;  2DS0 A;  1FV3 A;  1IRP A;  4QAL A;  3CRH A;  3R4U A;  5DSS B;  3FUQ A;  3OJM A;  1G9D A;  4OWK A;  3HAL A;  4Q9P A;  3N7K A;  3VT0 A;  1S0G A;  3QYD A;  3LLP A;  1FV2 A;  3PME A;  3CAH A;  4I4O A;  3ZXG A;  2Q9X A;  3Q7Y A;  4CJM A;  2KH2 A;  1XZZ A;  4L4H A;  3CA1 A;  5FZU A;  4OEG A;  2VLC A;  2FDB M;  4OEF A;  4ZKT B;  1J0S A;  1RML A;  3WA1 A;  1QQK A;  3VWC A;  1W3G A;  1BA7 A;  2J3P A;  2M49 A;  2NM1 A;  1YF8 B;  31BI A;  4ISR A;  4J2K A;  3WO4 A;  2AAI B;  3Q7X A;  1PZZ A;  2X2S A;  3OJ2 A;  4Q9G A;  1BFF A;  4ZFW B;  2YUG A;  4I96 A;  1CE7 B;  1V6X A;  1ISV A;  4D0Z A;  3CQA A;  4USO A;  3UDA A;  4J23 B;  3R4S A;  2Y9F A;  2AXM A;  1WD4 A;  2Y9X E;  3V0B B;  3A07 A;  1DQG A;  4JKX B;  2F2F A;  1BFG A;  4X38 A;  4D0T A;  3UJ4 A;  3O44 A;  3N7L A;  3H6Q A;  2NZ9 A;  3FJI A;  4XKI A;  1DZD A;  1ISZ A;  4ZGR B;  3A21 A;  1DJS B;  4J2X A;  1S0F A;  41BI A;  5BXT A;  3CRG A;  4FVV A;  3O3Q A;  4KBB A;  3P6J A;  4X37 A;  5BQU A;  1KNM A;  1JY0 A;  4OWL A;  3FJJ A;  1EV2 A;  3S8K A;  4OWJ A;  3CA0 A;  1DZC A;  3CA3 A;  1GGP B;  1TP0 A;  4J2Y A;  2MIB A;  2VU9 A;  1F31 A;  2HW9 A;  1T4Q A;  1HCE A;  5BXR A;  1TIE A;  3A23 A;  3ZXD A;  2ET2 A;  1V6V A;  1II4 A;  1JT3 A;  1I1E A;  4KEK A;  4XFU A;  4A7Y A;  4I4P A;  3RMX A;  1S0L A;  4DEN A;  1CVS A;  4ION A;  1FWV A;  2AFG A;  4P0K A;  3OBR A;  2R9K B;  4LO8 B;  4PC4 A;  3BAQ A;  5E24 E;  3BAU A;  5BOW A;  2Y9W C;  3BX1 C;  3HMY A;  2FFU A;  4I3N A;  3CA6 A;  1PUM B;  4G6J A;  1ONK B;  3VSF A;  3FFZ A;  1SR4 C;  3OGG A;  1IRA X;  1HWP B;  1AVX B;  2P23 A;  1QXM A;  3AH2 A;  3HOM A;  1HCD A;  3Q7W A;  1V6W A;  4II0 A;  5FNW A;  4I1B A;  1IIL A;  1ILR 1;  1PC8 B;  5D63 A;  4FGF A;  1AVW B;  1FQ9 A;  4IZE A;  2KKI A;  2P39 A;  3AJ6 A;  2DRE A;  3BAO A;  3TC2 A;  4F83 A;  3CA4 A;  1AVA C;  2VSE A;  2NTD A;  2K4A B;  2Z48 A;  1M16 A;  1OQL B;  1RY7 A;  4QD2 B;  1XG6 A;  2IWT B;  1XYF A;  3BA4 A;  4MZG B;  4WBC A;  3VUO A;  3FUO A;  4I4R A;  4ZBV B;  1IHK A;  3AZW A;  2I1B A;  1BAS A;  4EFR A;  3HBW A;  1PUU B;  2D22 A;  2E4M C;  1EYL A;  2NYY A;  3V79 C;  3FJ8 A;  3BA5 A;  3FJF A;  4G1R A;  1AXM A;  1DQO A;  4JQ0 A;  5BXS A;  4IYB A;  1Z0H A;  5EC5 A;  1G82 A;  1JT5 A;  2IHO A;  3AJ5 A;  2UUS A;  2ESU A;  4IY9 A;  3VT2 A;  1Q03 A;  3NJ5 A;  2Q3N B;  3BAV A;  3FJB A;  4I8M A;  2BEA A;  3NBD A;  4G9M A;  4LO0 C;  4HJJ A;  4I0Y A;  1K5V A;  5F90 A;  4LO2 C;  1JTC A;  4KEI A;  1WBA A;  4KC3 A;  1Q04 A;  4HR6 C;  3VT1 A;  3C9Z A;  4J2S A;  4G9N A;  1G9A A;  1DIW A;  2D23 A;  3O4A A;  1MD6 A;  4I4S A;  5DUY A;  5FNX A;  1EVT A;  4JRA A;  3ZC9 A;  2MC2 A;  2Y9G A;  3FJA A;  3N7M A;  1FGA A;  1FMM S;  4P6A A;  1D0H A;  1SR4 A;  3FJE A;  5GAQ A;  1K5U A;  1BAR A;  1PWA A;  4QBC A;  3BRF A;  3N0K A;  4GOV A;  3WO2 A;  4DCK C;  3POK A;  5BXP A;  4Q91 A;  4JP0 A;  4LO7 B;  4YOL A;  1JLY A;  2BFH A;  4AN6 A;  5I1B A;  3BAD A;  2VXR A;  4LO3 A;  4GP3 A;  1AFC A;  1YXW A;  1EPW A;  1UPS A;  5D62 A;  3NBC A;  3FJ9 A;  4I2S A;  1HKN A;  4A7K A;  3P6I A;  1S0C A;  1HWO B;  2BEB A;  2GO2 A;  4GAI A;  5BP5 C;  2D44 A;  1FN0 A;  3CA5 A;  3SNV A;  1AF9 A;  3BRG C;  1Z2V A;  2FO1 A;  3MPP G;  4KEJ A;  7I1B A;  2KI4 A;  2E4M A;  2D7R A;  3BAG A;  1R8O A;  4IHZ A;  3AKF A;  3UD9 A;  5B2H A;  1JT7 A;  2QYI B;  3UD8 A;  4A7Z A;  5EHA A;  1T9F A;  3H6R A;  1S0D A;  3BB2 A;  3O4D A;  1ABR B;  4L4I A;  4Z8S B;  3WMU A;  4IQP A;  4AN7 B;  1E0O A;  3WIN C;  2XOA A;  3LTQ A;  3HSM A;  2ZR1 B;  3S8J A;  1ISX A;  3KMV A;  4LO0 A;  4LO2 A;  5JLV A;  3K1X A;  3FJH A;  3NBE A;  3BAH A;  4ZA3 B;  1Q1U A;  3CRI A;  3UJ0 A;  4H9W A;  4END A;  4ZFU B;  5F8W A;  5FZY A;  3HN1 A;  3FJK A;  2MLL B;  3O4B A;  3V0A A;  3IM6 A;  4DEP A;  3OBT A;  3FJC A;  1S0E A;  1IJT A;  1DFQ A;  1XHB A;  2DRZ A;  4I1E A;  1IOB A;  2D24 A;  2NP0 A;  3WO3 A;  3AZV A;  4I4X A;  5DZU A;  2FFV A;  6I1B A;  2RQ9 A;  4IY8 A;  3P53 A;  1HWN B;  3FJD A;  4I37 A;  1RZO B;  4GAF A;  3JUT A;  5D61 A;  1VCL A;  4UY4 A;  4H75 A;  1W3A A;  3BA7 A;  3F62 B;  2LIQ A;  3O4O A;  3RMY A;  5F8S A;  4JAW A;  3D7W B;  4LO1 C;  4QKS A;  1TWE A;  3A22 A;  3T8S A;  1BLD A;  5BP5 A;  4GOY A;  3VSZ A;  3I2A A;  5EG6 C;  1BFB A;  4I7I A;  3AH4 A;  5FZZ A;  1YYN A;  3MAL A;  21BI A;  2ERM A;  3O5W B;  4QO3 A;  1ISY A;  5F8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...