4H9WA

Crystal structure of a methionine mutant of wci
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
177
structure length
177
Chain Sequence
DDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWMTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin inhibitor 3
publication title A conserved tryptophan (W91) at the barrel-lid junction modulates the packing and stability of Kunitz (STI) family of inhibitors.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 27
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4h9wA00
21BIA 4J23B 4I1BA 3OGGA 5F90A 3HSMA 2IHOA 1DQOA 1RZOB 1G82A 2VSAA 1JY0A 4ISQA 1EYLA 2VU9A 1SR4A 5BXPA 1ISYA 4A7ZA 1S0BA 5FNXA 1JT7A 5EC5A 2AXMA 5DZUA 2FFUA 4ZFWB 4X39A 3N7JA 1M2TB 1M16A 3AJ5A 4G6JA 3WMUA 3OJMA 3PUBA 1ISWA 5B2HA 2X2SA 2NVHA 3AH4A 3CA1A 4P0KA 4LO7B 3WO4A 2FO1A 3S8KA 1JLYA 3P53A 1G9CA 1W3AA 4G1RA 1P63A 1AXMA 1HKNA 4LO3C 1G9DA 1YF8B 3FJKA 2D43A 1S0FA 4GAIA 4IHZA 4P0LA 3BA5A 4QALA 4YOLA 3VWCA 4EEEB 2GZBA 2VUAA 1DJSB 1PC8B 1NZKA 1S0GA 3IM6A 3PHZA 3F62B 4LO0C 4XFTA 4X38A 1K5VA 3BA7A 3AH2A 3AKHA 1FGAA 3R4UA 2Q3NB 3A23A 3KMVA 6I1BA 5FZZA 1SR4C 2ZQOA 3WO2A 1AFCA 1BA7A 1PUUB 3Q7YA 2E4MC 1IHKA 4IZXA 4OWJA 1RY7A 3FUQA 3EF2A 1G9AA 1XG6A 8I1BA 3I29B 2J3PA 4HA2A 3UJ4A 1R8NA 1R8OA 3HN1A 3CA4A 4LO8B 2DS0A 1FWVA 4P0JA 2AQZA 1ONKB 1PWAA 4JPZA 2P39A 3H6QA 4I4UA 2VSEA 1J0SA 2F2FC 1V6XA 4GOVA 3W9TA 3AZWA 1XYFA 3O44A 2ERMA 4AN7B 3UD9A 3H6RB 3F1RA 5HPZA 4XFUA 4JQ0A 3BX1C 3CA5A 3FFZA 3A21A 4I4PA 4I4QA 3HMYA 3V0AA 2Y9WC 2ZQNA 3BAOA 3FJFA 4IYBA 4JKXB 1SZ6B 4LO1C 1TWEA 4OEGA 2KKIA 4OWKA 4USOA 3AH1A 1IOBA 2MLLB 1ILR1 1AVWB 1WD4A 1N4KA 1MC9A 2D7IA 1JQZA 4GOYA 4Q91A 4QBVA 4IY8A 1I1EA 3C9ZA 4AN6A 3S8JA 3OBTA 1F31A 4HR6C 3OGFA 4I1EA 4I2SA 4LO3A 4D8HA 4D0TA 1RMLA 3VSZA 2Z49A 2HWAA 1BLDA 1JT5A 3QYDA 3OJVA 1T4QA 2NM1A 1JLXA 4LO0A 1EVTA 1FV2A 2ESUA 1W3FA 3VT2A 2ET2A 2K43A 3H6SE 5BQUC 1V6WA 1FMMS 1II4A 3RTJB 3WMVA 1BFFA 3JUTA 1DFCA 4ZLBB 2ZR1B 1AVXB 2E4MA 3BA4A 4H04A 5BXRA 4ZKTB 4OEFA 4Z9WB 1EPWA 5BXTA 3CRGA 2VLCA 1HWPB 4I37A 3IM7A 3RTIB 4EFPA 4EFRA 2M49A 4Z8SB 2MIBA 4FVVA 3ZC9A 5D63A 2D24A 1WBCA 4G6MA 2D23A 4R6UB 3N7KA 3PG0A 1YBIA 2F2FA 1S0EA 3BADA 2K8RA 2FDBM 5EG6C 1A8DA 3RMXA 1JT3A 2KI6B 2UUSA 1HWMB 1JT4A 1TTUA 4QD2B 1HIBA 5DSSB 3NJ5A 1ITBA 3FJ8A 5JLVA 1HCEA 2VXTI 3O4DA 3MPPG 4LO1A 3FUOA 3FJHA 2QYIB 1Q04A 4H9WA 1BFCA 3P6JA 4XFSA 5FZUA 3NBNA 4IONA 1BFBA 3PMEA 2AAIB 1WBAA 1I1BA 3BAVA 1TP0A 4IZEA 4ZGRB 2F8XC 1G9BA 4JKQA 3FJDA 1FV3A 3SNVA 5BXSA 3IIRA 2D44A 3WINC 2AFGA 3V0BA 3POKA 3IAGC 3CA6A 1S0CA 3AKIA 4PC4A 5BQUA 1K5UA 4OW4A 4J2YA 1QXMA 3VUOA 3V0AB 2K4AB 3BAGA 2KLLA 3BAUA 4OEEA 4KEIA 4I4RA 3FJEA 3FJ9A 3T8SA 1IT0A 2RG9B 3Q7WA 1BFGA 3O49A 5BVPI 3IM5A 1TWMA 4DEPA 3E8LC 3UJ0A 4I7IA 1MD6A 1ABRB 1PUMB 31BIA 2R9KB 1XZZA 4Q9PA 4I0YA 3HALA 3HBWA 1QQLA 4WBCA 3VT1A 5BP5A 2RQ9A 4I96A 1ISXA 3VSFA 2NP0A 4DENA 5F8SA 2D1ZA 3LTQA 2NZ9A 2LIQA 5I1BA 2I1BA 1W3GA 4GAFA 2KI4A 2X2TA 1DZDA 3CRIA 4X37A 4ZFYB 1FWUA 9ILBA 4KC3A 3ILAA 4JRAA 1AVAC 3UD8A 2L5XA 3CU1B 3BRDA 4J2SA 3NBDA 1IRPA 4X3AA 3N0KA 3CA3A 1CVSA 3FJJA 3O5WB 4IY9A 3UDAA 4II0A 4QKRA 1DQGA 3AKGA 5D62A 4QC4A 5F8WA 1IILA 5G00A 3CRHA 3RSJA 1YYNA 4G9MA 1Q1UA 4USPA 4QBCA 4QO3A 3ZC8A 3ZXGA 3P6IA 1DLLA 4I8MA 1HWOB 3NBCA 3BAHA 3O3QA 1HCDA 4ZBVB 4EB2B 4F83A 1IJTA 2WRYA 3BB2A 1TIEA 2VXRA 4A7YA 5BP5C 1OQLB 4ENDA 4FGFA 4A7KA 2WBCA 3RMYA 5EHAA 3WINA 4KEKA 3VEQA 4J2KA 4ISRA 2HW9A 3A07A 4OUJA 2DREA 1ISZA 3WO3A 1JTCA 3FJCA 1EV2A 1S0LA 3BTAA 3BAQA 1VCLA 5DVHA 2NYYA 1AVUA 3WA1A 2D22A 3V79C 1NUNA 4LO2C 4TLPA 4I4XA 2P23A 3QR5A 2Z48A 3O4CA 1IRAX 1UPSA 3MALA 1ISVA 1Z0HA 1FMZA 3CAHA 5E24E 4I4SA 1FQ9A 3CQAA 41BIA 1RG8A 2DRZA 3Q7XA 4JP0A 3CA0A 4J2XA 3I2XA 3I2AA 1Z4SA 4L4IA 3A22A 3AKFA 4D0ZA 4GP3A 3D7WB 1KNMA 1YTOA 2Y9FA 5BOWA 1WD3A 2YUGA 3O4OA 4L4HA 1YXWA 3N7LA 3V0BB 3AJ6A 1L2HA 3VT0A 5FNWA 2QN4A 3HOMA 4CJMA 2Y9GA 2Y9XE 5GAQA 4KEJA 1V6UA 2MC2A 3JRRA 1DZCA 4GP0A 2RSTA 4KBBA 3ZX7A 4EKXB 1TFMB 3NBEA 3O4BA 3K1XA 3B9UA 3BRFA 2FFVA 1DFQA 3O4AA 4I3NA 4P6AA 2BEBA 2XOAA 4ZFUB 4DCKC 7I1BA 4G9NA 3BRGC 1QQKA 3OJ2A 4IQPA 2HZ9A 5JMCA 1AF9A 2D7RA 3FJBA 3FGMA 2NTDA 5F8YA 4ZOTA 3OBRA 3N7MA 2IWTB 4LO7C 3TC2A 4EFQA 1TOOA 3ZXDA 4OWLA 4F34A 4XKIA 1V6VA 4I4YA 4I4OA 5DUYA 3UD7A 1CE7B 2KH2A 3R4SA 2BFHA 1XHBA 3H6RA 1BARA 1T9FA 4ZA3B 1GGPB 1Z2VA 1HWNB 3AZVA 4QD2C 2DRYA 4JAWA 4LO2A 1Q03A 5D61A 1S0DA 2GO2A 2Q9XA 4I4VA 3FJAA 3FJIA 1D0HA 1DIWA 1FN0A 1PZZA 1E0OA 2LIEA 4HJJA 4Q9GA 4I6IA 5FZYA 2FGFA 4QKSA 1BLAA 2BEAA 1BASA 2HWMA 2D20A 3LLPA
chains in the Genus database with same CATH superfamily
21BIA 4J23B 4I1BA 3OGGA 5F90A 3HSMA 2IHOA 1DQOA 1RZOB 1G82A 2VSAA 1JY0A 4ISQA 1EYLA 2VU9A 1SR4A 5BXPA 1ISYA 4A7ZA 1S0BA 5FNXA 1JT7A 5EC5A 2AXMA 5DZUA 2FFUA 4ZFWB 4X39A 3N7JA 1M2TB 1M16A 3AJ5A 4G6JA 3WMUA 3OJMA 3PUBA 1ISWA 5B2HA 2X2SA 2NVHA 3AH4A 3CA1A 4P0KA 4LO7B 3WO4A 2FO1A 3S8KA 1JLYA 3P53A 1G9CA 1W3AA 4G1RA 1P63A 1AXMA 1HKNA 4LO3C 1G9DA 1YF8B 3FJKA 2D43A 1S0FA 4GAIA 4IHZA 4P0LA 3BA5A 4QALA 4YOLA 3VWCA 4EEEB 2GZBA 2VUAA 1DJSB 1PC8B 1NZKA 1S0GA 3IM6A 3PHZA 3F62B 4LO0C 4XFTA 4X38A 1K5VA 3BA7A 3AH2A 3AKHA 1FGAA 3R4UA 2Q3NB 3A23A 3KMVA 6I1BA 5FZZA 1SR4C 2ZQOA 3WO2A 1AFCA 1BA7A 1PUUB 3Q7YA 2E4MC 1IHKA 4IZXA 4OWJA 1RY7A 3FUQA 3EF2A 1G9AA 1XG6A 8I1BA 3I29B 2J3PA 4HA2A 3UJ4A 1R8NA 1R8OA 3HN1A 3CA4A 4LO8B 2DS0A 1FWVA 4P0JA 2AQZA 1ONKB 1PWAA 4JPZA 2P39A 3H6QA 4I4UA 2VSEA 1J0SA 2F2FC 1V6XA 4GOVA 3W9TA 3AZWA 1XYFA 3O44A 2ERMA 4AN7B 3UD9A 3H6RB 3F1RA 5HPZA 4XFUA 4JQ0A 3BX1C 4H75A 3CA5A 3FFZA 3A21A 4I4PA 4I4QA 3HMYA 3V0AA 2Y9WC 2ZQNA 3BAOA 3FJFA 4IYBA 4JKXB 1SZ6B 4LO1C 1TWEA 4OEGA 2KKIA 4OWKA 4USOA 3AH1A 1IOBA 2MLLB 1ILR1 1AVWB 1WD4A 1N4KA 1MC9A 2D7IA 1JQZA 4GOYA 4Q91A 4QBVA 4IY8A 1I1EA 3C9ZA 4AN6A 3S8JA 3OBTA 1F31A 4HR6C 3OGFA 4I1EA 4I2SA 4LO3A 4D8HA 4D0TA 1RMLA 3VSZA 2Z49A 2HWAA 1BLDA 1JT5A 3QYDA 3OJVA 1T4QA 2NM1A 1JLXA 4LO0A 1EVTA 1FV2A 2ESUA 1W3FA 3VT2A 2ET2A 2K43A 3H6SE 5BQUC 1V6WA 1FMMS 1II4A 3RTJB 3WMVA 1BFFA 3JUTA 1DFCA 4ZLBB 2ZR1B 1AVXB 2E4MA 3BA4A 4H04A 5BXRA 4ZKTB 4OEFA 4Z9WB 1EPWA 5BXTA 3CRGA 2NS2A 2VLCA 1HWPB 4I37A 3IM7A 3RTIB 4EFPA 4EFRA 2M49A 4Z8SB 2MIBA 4FVVA 3ZC9A 5D63A 2D24A 1WBCA 4G6MA 2D23A 4R6UB 3N7KA 3PG0A 1YBIA 2F2FA 1S0EA 3BADA 2K8RA 2FDBM 5EG6C 1A8DA 3RMXA 1JT3A 2KI6B 2UUSA 1HWMB 1JT4A 1TTUA 4QD2B 1HIBA 5DSSB 3NJ5A 1ITBA 3FJ8A 5JLVA 1HCEA 2VXTI 3O4DA 3MPPG 4LO1A 3FUOA 3FJHA 2QYIB 1Q04A 4H9WA 1BFCA 3P6JA 4XFSA 5FZUA 3NBNA 4IONA 1BFBA 3PMEA 2AAIB 1WBAA 1I1BA 3BAVA 1TP0A 4IZEA 4ZGRB 2F8XC 1G9BA 4JKQA 3FJDA 1FV3A 3SNVA 5BXSA 3IIRA 2D44A 3WINC 2AFGA 3V0BA 3POKA 3IAGC 3CA6A 1S0CA 3AKIA 4PC4A 5BQUA 1K5UA 4OW4A 4J2YA 1QXMA 3VUOA 3V0AB 2K4AB 3BAGA 2KLLA 3BAUA 4OEEA 4KEIA 4I4RA 3FJEA 3FJ9A 3T8SA 1IT0A 2RG9B 3Q7WA 1BFGA 3O49A 5BVPI 3IM5A 1TWMA 4DEPA 3E8LC 3UJ0A 4I7IA 1MD6A 1ABRB 1PUMB 31BIA 2R9KB 1XZZA 4Q9PA 4I0YA 3HALA 3HBWA 1QQLA 4WBCA 3VT1A 5BP5A 2RQ9A 4I96A 1ISXA 3VSFA 2NP0A 4DENA 5F8SA 2D1ZA 3LTQA 2NZ9A 2LIQA 5I1BA 2I1BA 1W3GA 4GAFA 2KI4A 2X2TA 1DZDA 3CRIA 4X37A 4ZFYB 1FWUA 9ILBA 4KC3A 3ILAA 4JRAA 1AVAC 3UD8A 2L5XA 3CU1B 3BRDA 4J2SA 3NBDA 1IRPA 4X3AA 3N0KA 3CA3A 1CVSA 3FJJA 3O5WB 4IY9A 3UDAA 4II0A 4QKRA 1DQGA 3AKGA 5D62A 4QC4A 5F8WA 1IILA 5G00A 3CRHA 3RSJA 1YYNA 4G9MA 1Q1UA 4USPA 4QBCA 4QO3A 3ZC8A 3ZXGA 3P6IA 1DLLA 4I8MA 4MZFB 1HWOB 3NBCA 3BAHA 3O3QA 1HCDA 4ZBVB 4EB2B 4F83A 1IJTA 2WRYA 3BB2A 1TIEA 2VXRA 4A7YA 5BP5C 1OQLB 4ENDA 4FGFA 4A7KA 2WBCA 3RMYA 5EHAA 3WINA 4KEKA 3VEQA 4J2KA 4ISRA 2HW9A 3A07A 4OUJA 2DREA 1ISZA 3WO3A 1JTCA 3FJCA 1EV2A 1S0LA 3BTAA 3BAQA 1VCLA 5DVHA 2NYYA 1AVUA 3WA1A 2D22A 3V79C 1NUNA 4LO2C 4TLPA 4MZGB 4I4XA 2P23A 3QR5A 2Z48A 3O4CA 1IRAX 1UPSA 3MALA 1ISVA 1Z0HA 4MZHA 1FMZA 3CAHA 5E24E 4I4SA 1FQ9A 3CQAA 41BIA 1RG8A 2DRZA 3Q7XA 4JP0A 3CA0A 4J2XA 3I2XA 3I2AA 1Z4SA 4L4IA 3A22A 3AKFA 4D0ZA 4GP3A 3D7WB 1KNMA 1YTOA 2Y9FA 5BOWA 1WD3A 2YUGA 3O4OA 4L4HA 1YXWA 3N7LA 3V0BB 3AJ6A 1L2HA 3VT0A 5FNWA 2QN4A 3HOMA 4CJMA 2Y9GA 2Y9XE 5GAQA 4KEJA 1V6UA 2MC2A 3JRRA 1DZCA 4GP0A 2RSTA 4KBBA 3ZX7A 4EKXB 1TFMB 3NBEA 3O4BA 3K1XA 3B9UA 3BRFA 2FFVA 1DFQA 3O4AA 4I3NA 4P6AA 2BEBA 2XOAA 4ZFUB 4DCKC 7I1BA 4G9NA 3BRGC 1QQKA 3OJ2A 4IQPA 2HZ9A 5JMCA 1AF9A 2D7RA 3FJBA 3FGMA 2NTDA 5F8YA 4ZOTA 3OBRA 3N7MA 2IWTB 4LO7C 3TC2A 4EFQA 1TOOA 3ZXDA 4OWLA 4F34A 4XKIA 1V6VA 4I4YA 4I4OA 5DUYA 3UD7A 1CE7B 2KH2A 3R4SA 2BFHA 1XHBA 3H6RA 1BARA 1T9FA 4ZA3B 1GGPB 1Z2VA 1HWNB 3AZVA 4QD2C 2DRYA 4JAWA 4LO2A 1Q03A 5D61A 1S0DA 2GO2A 2Q9XA 4I4VA 3FJAA 3FJIA 1D0HA 1DIWA 1FN0A 1PZZA 1E0OA 2LIEA 4HJJA 4Q9GA 4I6IA 5FZYA 2FGFA 4QKSA 1BLAA 4UY4A 2BEAA 1BASA 2HWMA 2D20A 3LLPA
chains in the Genus database with same CATH topology
21BIA 4J23B 4I1BA 3OGGA 5F90A 3HSMA 2IHOA 1DQOA 1RZOB 1G82A 2VSAA 1JY0A 4ISQA 1EYLA 2VU9A 1SR4A 5BXPA 1ISYA 4A7ZA 1S0BA 5FNXA 1JT7A 5EC5A 2AXMA 5DZUA 2FFUA 4ZFWB 4X39A 3N7JA 1M2TB 1M16A 3AJ5A 4G6JA 3WMUA 3OJMA 3PUBA 1ISWA 5B2HA 2X2SA 2NVHA 3AH4A 3CA1A 4P0KA 4LO7B 3WO4A 2FO1A 3S8KA 1JLYA 3P53A 1G9CA 1W3AA 4G1RA 1P63A 1AXMA 1HKNA 4LO3C 1G9DA 1YF8B 3FJKA 2D43A 1S0FA 4GAIA 4IHZA 4P0LA 3BA5A 4QALA 4YOLA 3VWCA 4EEEB 2GZBA 2VUAA 1DJSB 1PC8B 1NZKA 1S0GA 3IM6A 3PHZA 3F62B 4LO0C 4XFTA 4X38A 1K5VA 3BA7A 3AH2A 3AKHA 1FGAA 3R4UA 2Q3NB 3A23A 3KMVA 6I1BA 5FZZA 1SR4C 2ZQOA 3WO2A 1AFCA 1BA7A 1PUUB 3Q7YA 2E4MC 1IHKA 4IZXA 4OWJA 1RY7A 3FUQA 3EF2A 1G9AA 1XG6A 8I1BA 3I29B 2J3PA 4HA2A 3UJ4A 1R8NA 1R8OA 3HN1A 3CA4A 4LO8B 2DS0A 1FWVA 4P0JA 2AQZA 1ONKB 1PWAA 4JPZA 2P39A 3H6QA 4I4UA 2VSEA 1J0SA 2F2FC 1V6XA 4GOVA 3W9TA 3AZWA 1XYFA 3O44A 2ERMA 4AN7B 3UD9A 3H6RB 3F1RA 5HPZA 4XFUA 4JQ0A 3BX1C 4H75A 3CA5A 3FFZA 3A21A 4I4PA 4I4QA 3HMYA 3V0AA 2Y9WC 2ZQNA 3BAOA 3FJFA 4IYBA 4JKXB 1SZ6B 4LO1C 1TWEA 4OEGA 2KKIA 4OWKA 4USOA 3AH1A 1IOBA 2MLLB 1ILR1 1AVWB 1WD4A 1N4KA 1MC9A 2D7IA 1JQZA 4GOYA 4Q91A 4QBVA 4IY8A 1I1EA 3C9ZA 4AN6A 3S8JA 3OBTA 1F31A 4HR6C 3OGFA 4I1EA 4I2SA 4LO3A 4D8HA 4D0TA 1RMLA 3VSZA 2Z49A 2HWAA 1BLDA 1JT5A 3QYDA 3OJVA 1T4QA 2NM1A 1JLXA 4LO0A 1EVTA 1FV2A 2ESUA 1W3FA 3VT2A 2ET2A 2K43A 3H6SE 5BQUC 1V6WA 1FMMS 1II4A 3RTJB 3WMVA 1BFFA 3JUTA 1DFCA 4ZLBB 2ZR1B 1AVXB 2E4MA 3BA4A 4H04A 5BXRA 4ZKTB 4OEFA 4Z9WB 1EPWA 5BXTA 3CRGA 2NS2A 2VLCA 1HWPB 4I37A 3IM7A 3RTIB 4EFPA 4EFRA 2M49A 4Z8SB 2MIBA 4FVVA 3ZC9A 5D63A 2D24A 1WBCA 4G6MA 2D23A 4R6UB 3N7KA 3PG0A 1YBIA 2F2FA 1S0EA 3BADA 2K8RA 2FDBM 5EG6C 1A8DA 3RMXA 1JT3A 2KI6B 2UUSA 1HWMB 1JT4A 1TTUA 4QD2B 1HIBA 5DSSB 3NJ5A 1ITBA 3FJ8A 5JLVA 1HCEA 2VXTI 3O4DA 3MPPG 4LO1A 3FUOA 3FJHA 2QYIB 1Q04A 4H9WA 1BFCA 3P6JA 4XFSA 5FZUA 3NBNA 4IONA 1BFBA 3PMEA 2AAIB 1WBAA 1I1BA 3BAVA 1TP0A 4IZEA 4ZGRB 2F8XC 1G9BA 4JKQA 3FJDA 1FV3A 3SNVA 5BXSA 3IIRA 2D44A 3WINC 2AFGA 3V0BA 3POKA 3IAGC 3CA6A 1S0CA 3AKIA 4PC4A 5BQUA 1K5UA 4OW4A 4J2YA 1QXMA 3VUOA 3V0AB 2K4AB 3BAGA 2KLLA 3BAUA 4OEEA 4KEIA 4I4RA 3FJEA 3FJ9A 3T8SA 1IT0A 2RG9B 3Q7WA 1BFGA 3O49A 5BVPI 3IM5A 1TWMA 4DEPA 3E8LC 3UJ0A 4I7IA 1MD6A 1ABRB 1PUMB 31BIA 2R9KB 1XZZA 4Q9PA 4I0YA 3HALA 3HBWA 1QQLA 4WBCA 3VT1A 5BP5A 2RQ9A 4I96A 1ISXA 3VSFA 2NP0A 4DENA 5F8SA 2D1ZA 3LTQA 2NZ9A 2LIQA 5I1BA 2I1BA 1W3GA 4GAFA 2KI4A 2X2TA 1DZDA 3CRIA 4X37A 4ZFYB 1FWUA 9ILBA 4KC3A 3ILAA 4JRAA 1AVAC 3UD8A 2L5XA 3CU1B 3BRDA 4J2SA 3NBDA 1IRPA 4X3AA 3N0KA 3CA3A 1CVSA 3FJJA 3O5WB 4IY9A 3UDAA 4II0A 4QKRA 1DQGA 3AKGA 5D62A 4QC4A 5F8WA 1IILA 5G00A 3CRHA 3RSJA 1YYNA 4G9MA 1Q1UA 4USPA 4QBCA 4QO3A 3ZC8A 3ZXGA 3P6IA 1DLLA 4I8MA 4MZFB 1HWOB 3NBCA 3BAHA 3O3QA 1HCDA 4ZBVB 4EB2B 4F83A 1IJTA 2WRYA 3BB2A 1TIEA 2VXRA 4A7YA 5BP5C 1OQLB 4ENDA 4FGFA 4A7KA 2WBCA 3RMYA 5EHAA 3WINA 4KEKA 3VEQA 4J2KA 4ISRA 2HW9A 3A07A 4OUJA 2DREA 1ISZA 3WO3A 1JTCA 3FJCA 1EV2A 1S0LA 3BTAA 3BAQA 1VCLA 5DVHA 2NYYA 1AVUA 3WA1A 2D22A 3V79C 1NUNA 4LO2C 4TLPA 4MZGB 4I4XA 2P23A 3QR5A 2Z48A 3O4CA 1IRAX 1UPSA 3MALA 1ISVA 1Z0HA 4MZHA 1FMZA 3CAHA 5E24E 4I4SA 1FQ9A 3CQAA 41BIA 1RG8A 2DRZA 3Q7XA 4JP0A 3CA0A 4J2XA 3I2XA 3I2AA 1Z4SA 4L4IA 3A22A 3AKFA 4D0ZA 4GP3A 3D7WB 1KNMA 1YTOA 2Y9FA 5BOWA 1WD3A 2YUGA 3O4OA 4L4HA 1YXWA 3N7LA 3V0BB 3AJ6A 1L2HA 3VT0A 5FNWA 2QN4A 3HOMA 4CJMA 2Y9GA 2Y9XE 5GAQA 4KEJA 1V6UA 2MC2A 3JRRA 1DZCA 4GP0A 2RSTA 4KBBA 3ZX7A 4EKXB 1TFMB 3NBEA 3O4BA 3K1XA 3B9UA 3BRFA 2FFVA 1DFQA 3O4AA 4I3NA 4P6AA 2BEBA 2XOAA 4ZFUB 4DCKC 7I1BA 4G9NA 3BRGC 1QQKA 3OJ2A 4IQPA 2HZ9A 5JMCA 1AF9A 2D7RA 3FJBA 3FGMA 2NTDA 5F8YA 4ZOTA 3OBRA 3N7MA 2IWTB 4LO7C 3TC2A 4EFQA 1TOOA 3ZXDA 4OWLA 4F34A 4XKIA 1V6VA 4I4YA 4I4OA 5DUYA 3UD7A 1CE7B 2KH2A 3R4SA 2BFHA 1XHBA 3H6RA 1BARA 1T9FA 4ZA3B 1GGPB 1Z2VA 1HWNB 3AZVA 4QD2C 2DRYA 4JAWA 4LO2A 1Q03A 5D61A 1S0DA 2GO2A 2Q9XA 4I4VA 3FJAA 3FJIA 1D0HA 1DIWA 1FN0A 1PZZA 1E0OA 2LIEA 4HJJA 4Q9GA 4I6IA 5FZYA 2FGFA 4QKSA 1BLAA 4UY4A 2BEAA 1BASA 2HWMA 2D20A 3LLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 21BI A;  4J23 B;  4I1B A;  3OGG A;  5F90 A;  3HSM A;  2IHO A;  1DQO A;  1RZO B;  1G82 A;  2VSA A;  1JY0 A;  4ISQ A;  1EYL A;  2VU9 A;  1SR4 A;  5BXP A;  1ISY A;  4A7Z A;  1S0B A;  5FNX A;  1JT7 A;  5EC5 A;  2AXM A;  5DZU A;  2FFU A;  4ZFW B;  4X39 A;  3N7J A;  1M2T B;  1M16 A;  3AJ5 A;  4G6J A;  3WMU A;  3OJM A;  3PUB A;  1ISW A;  5B2H A;  2X2S A;  2NVH A;  3AH4 A;  3CA1 A;  4P0K A;  4LO7 B;  3WO4 A;  2FO1 A;  3S8K A;  1JLY A;  3P53 A;  1G9C A;  1W3A A;  4G1R A;  1P63 A;  1AXM A;  1HKN A;  4LO3 C;  1G9D A;  1YF8 B;  3FJK A;  2D43 A;  1S0F A;  4GAI A;  4IHZ A;  4P0L A;  3BA5 A;  4QAL A;  4YOL A;  3VWC A;  4EEE B;  2GZB A;  2VUA A;  1DJS B;  1PC8 B;  1NZK A;  1S0G A;  3IM6 A;  3PHZ A;  3F62 B;  4LO0 C;  4XFT A;  4X38 A;  1K5V A;  3BA7 A;  3AH2 A;  3AKH A;  1FGA A;  3R4U A;  2Q3N B;  3A23 A;  3KMV A;  6I1B A;  5FZZ A;  1SR4 C;  2ZQO A;  3WO2 A;  1AFC A;  1BA7 A;  1PUU B;  3Q7Y A;  2E4M C;  1IHK A;  4IZX A;  4OWJ A;  1RY7 A;  3FUQ A;  3EF2 A;  1G9A A;  1XG6 A;  8I1B A;  3I29 B;  2J3P A;  4HA2 A;  3UJ4 A;  1R8N A;  1R8O A;  3HN1 A;  3CA4 A;  4LO8 B;  2DS0 A;  1FWV A;  4P0J A;  2AQZ A;  1ONK B;  1PWA A;  4JPZ A;  2P39 A;  3H6Q A;  4I4U A;  2VSE A;  1J0S A;  2F2F C;  1V6X A;  4GOV A;  3W9T A;  3AZW A;  1XYF A;  3O44 A;  2ERM A;  4AN7 B;  3UD9 A;  3H6R B;  3F1R A;  5HPZ A;  4XFU A;  4JQ0 A;  3BX1 C;  3CA5 A;  3FFZ A;  3A21 A;  4I4P A;  4I4Q A;  3HMY A;  3V0A A;  2Y9W C;  2ZQN A;  3BAO A;  3FJF A;  4IYB A;  4JKX B;  1SZ6 B;  4LO1 C;  1TWE A;  4OEG A;  2KKI A;  4OWK A;  4USO A;  3AH1 A;  1IOB A;  2MLL B;  1ILR 1;  1AVW B;  1WD4 A;  1N4K A;  1MC9 A;  2D7I A;  1JQZ A;  4GOY A;  4Q91 A;  4QBV A;  4IY8 A;  1I1E A;  3C9Z A;  4AN6 A;  3S8J A;  3OBT A;  1F31 A;  4HR6 C;  3OGF A;  4I1E A;  4I2S A;  4LO3 A;  4D8H A;  4D0T A;  1RML A;  3VSZ A;  2Z49 A;  2HWA A;  1BLD A;  1JT5 A;  3QYD A;  3OJV A;  1T4Q A;  2NM1 A;  1JLX A;  4LO0 A;  1EVT A;  1FV2 A;  2ESU A;  1W3F A;  3VT2 A;  2ET2 A;  2K43 A;  3H6S E;  5BQU C;  1V6W A;  1FMM S;  1II4 A;  3RTJ B;  3WMV A;  1BFF A;  3JUT A;  1DFC A;  4ZLB B;  2ZR1 B;  1AVX B;  2E4M A;  3BA4 A;  4H04 A;  5BXR A;  4ZKT B;  4OEF A;  4Z9W B;  1EPW A;  5BXT A;  3CRG A;  2VLC A;  1HWP B;  4I37 A;  3IM7 A;  3RTI B;  4EFP A;  4EFR A;  2M49 A;  4Z8S B;  2MIB A;  4FVV A;  3ZC9 A;  5D63 A;  2D24 A;  1WBC A;  4G6M A;  2D23 A;  4R6U B;  3N7K A;  3PG0 A;  1YBI A;  2F2F A;  1S0E A;  3BAD A;  2K8R A;  2FDB M;  5EG6 C;  1A8D A;  3RMX A;  1JT3 A;  2KI6 B;  2UUS A;  1HWM B;  1JT4 A;  1TTU A;  4QD2 B;  1HIB A;  5DSS B;  3NJ5 A;  1ITB A;  3FJ8 A;  5JLV A;  1HCE A;  2VXT I;  3O4D A;  3MPP G;  4LO1 A;  3FUO A;  3FJH A;  2QYI B;  1Q04 A;  4H9W A;  1BFC A;  3P6J A;  4XFS A;  5FZU A;  3NBN A;  4ION A;  1BFB A;  3PME A;  2AAI B;  1WBA A;  1I1B A;  3BAV A;  1TP0 A;  4IZE A;  4ZGR B;  2F8X C;  1G9B A;  4JKQ A;  3FJD A;  1FV3 A;  3SNV A;  5BXS A;  3IIR A;  2D44 A;  3WIN C;  2AFG A;  3V0B A;  3POK A;  3IAG C;  3CA6 A;  1S0C A;  3AKI A;  4PC4 A;  5BQU A;  1K5U A;  4OW4 A;  4J2Y A;  1QXM A;  3VUO A;  3V0A B;  2K4A B;  3BAG A;  2KLL A;  3BAU A;  4OEE A;  4KEI A;  4I4R A;  3FJE A;  3FJ9 A;  3T8S A;  1IT0 A;  2RG9 B;  3Q7W A;  1BFG A;  3O49 A;  5BVP I;  3IM5 A;  1TWM A;  4DEP A;  3E8L C;  3UJ0 A;  4I7I A;  1MD6 A;  1ABR B;  1PUM B;  31BI A;  2R9K B;  1XZZ A;  4Q9P A;  4I0Y A;  3HAL A;  3HBW A;  1QQL A;  4WBC A;  3VT1 A;  5BP5 A;  2RQ9 A;  4I96 A;  1ISX A;  3VSF A;  2NP0 A;  4DEN A;  5F8S A;  2D1Z A;  3LTQ A;  2NZ9 A;  2LIQ A;  5I1B A;  2I1B A;  1W3G A;  4GAF A;  2KI4 A;  2X2T A;  1DZD A;  3CRI A;  4X37 A;  4ZFY B;  1FWU A;  9ILB A;  4KC3 A;  3ILA A;  4JRA A;  1AVA C;  3UD8 A;  2L5X A;  3CU1 B;  3BRD A;  4J2S A;  3NBD A;  1IRP A;  4X3A A;  3N0K A;  3CA3 A;  1CVS A;  3FJJ A;  3O5W B;  4IY9 A;  3UDA A;  4II0 A;  4QKR A;  1DQG A;  3AKG A;  5D62 A;  4QC4 A;  5F8W A;  1IIL A;  5G00 A;  3CRH A;  3RSJ A;  1YYN A;  4G9M A;  1Q1U A;  4USP A;  4QBC A;  4QO3 A;  3ZC8 A;  3ZXG A;  3P6I A;  1DLL A;  4I8M A;  1HWO B;  3NBC A;  3BAH A;  3O3Q A;  1HCD A;  4ZBV B;  4EB2 B;  4F83 A;  1IJT A;  2WRY A;  3BB2 A;  1TIE A;  2VXR A;  4A7Y A;  5BP5 C;  1OQL B;  4END A;  4FGF A;  4A7K A;  2WBC A;  3RMY A;  5EHA A;  3WIN A;  4KEK A;  3VEQ A;  4J2K A;  4ISR A;  2HW9 A;  3A07 A;  4OUJ A;  2DRE A;  1ISZ A;  3WO3 A;  1JTC A;  3FJC A;  1EV2 A;  1S0L A;  3BTA A;  3BAQ A;  1VCL A;  5DVH A;  2NYY A;  1AVU A;  3WA1 A;  2D22 A;  3V79 C;  1NUN A;  4LO2 C;  4TLP A;  4I4X A;  2P23 A;  3QR5 A;  2Z48 A;  3O4C A;  1IRA X;  1UPS A;  3MAL A;  1ISV A;  1Z0H A;  1FMZ A;  3CAH A;  5E24 E;  4I4S A;  1FQ9 A;  3CQA A;  41BI A;  1RG8 A;  2DRZ A;  3Q7X A;  4JP0 A;  3CA0 A;  4J2X A;  3I2X A;  3I2A A;  1Z4S A;  4L4I A;  3A22 A;  3AKF A;  4D0Z A;  4GP3 A;  3D7W B;  1KNM A;  1YTO A;  2Y9F A;  5BOW A;  1WD3 A;  2YUG A;  3O4O A;  4L4H A;  1YXW A;  3N7L A;  3V0B B;  3AJ6 A;  1L2H A;  3VT0 A;  5FNW A;  2QN4 A;  3HOM A;  4CJM A;  2Y9G A;  2Y9X E;  5GAQ A;  4KEJ A;  1V6U A;  2MC2 A;  3JRR A;  1DZC A;  4GP0 A;  2RST A;  4KBB A;  3ZX7 A;  4EKX B;  1TFM B;  3NBE A;  3O4B A;  3K1X A;  3B9U A;  3BRF A;  2FFV A;  1DFQ A;  3O4A A;  4I3N A;  4P6A A;  2BEB A;  2XOA A;  4ZFU B;  4DCK C;  7I1B A;  4G9N A;  3BRG C;  1QQK A;  3OJ2 A;  4IQP A;  2HZ9 A;  5JMC A;  1AF9 A;  2D7R A;  3FJB A;  3FGM A;  2NTD A;  5F8Y A;  4ZOT A;  3OBR A;  3N7M A;  2IWT B;  4LO7 C;  3TC2 A;  4EFQ A;  1TOO A;  3ZXD A;  4OWL A;  4F34 A;  4XKI A;  1V6V A;  4I4Y A;  4I4O A;  5DUY A;  3UD7 A;  1CE7 B;  2KH2 A;  3R4S A;  2BFH A;  1XHB A;  3H6R A;  1BAR A;  1T9F A;  4ZA3 B;  1GGP B;  1Z2V A;  1HWN B;  3AZV A;  4QD2 C;  2DRY A;  4JAW A;  4LO2 A;  1Q03 A;  5D61 A;  1S0D A;  2GO2 A;  2Q9X A;  4I4V A;  3FJA A;  3FJI A;  1D0H A;  1DIW A;  1FN0 A;  1PZZ A;  1E0O A;  2LIE A;  4HJJ A;  4Q9G A;  4I6I A;  5FZY A;  2FGF A;  4QKS A;  1BLA A;  2BEA A;  1BAS A;  2HWM A;  2D20 A;  3LLP A; 
#chains in the Genus database with same CATH topology
 21BI A;  4J23 B;  4I1B A;  3OGG A;  5F90 A;  3HSM A;  2IHO A;  1DQO A;  1RZO B;  1G82 A;  2VSA A;  1JY0 A;  4ISQ A;  1EYL A;  2VU9 A;  1SR4 A;  5BXP A;  1ISY A;  4A7Z A;  1S0B A;  5FNX A;  1JT7 A;  5EC5 A;  2AXM A;  5DZU A;  2FFU A;  4ZFW B;  4X39 A;  3N7J A;  1M2T B;  1M16 A;  3AJ5 A;  4G6J A;  3WMU A;  3OJM A;  3PUB A;  1ISW A;  5B2H A;  2X2S A;  2NVH A;  3AH4 A;  3CA1 A;  4P0K A;  4LO7 B;  3WO4 A;  2FO1 A;  3S8K A;  1JLY A;  3P53 A;  1G9C A;  1W3A A;  4G1R A;  1P63 A;  1AXM A;  1HKN A;  4LO3 C;  1G9D A;  1YF8 B;  3FJK A;  2D43 A;  1S0F A;  4GAI A;  4IHZ A;  4P0L A;  3BA5 A;  4QAL A;  4YOL A;  3VWC A;  4EEE B;  2GZB A;  2VUA A;  1DJS B;  1PC8 B;  1NZK A;  1S0G A;  3IM6 A;  3PHZ A;  3F62 B;  4LO0 C;  4XFT A;  4X38 A;  1K5V A;  3BA7 A;  3AH2 A;  3AKH A;  1FGA A;  3R4U A;  2Q3N B;  3A23 A;  3KMV A;  6I1B A;  5FZZ A;  1SR4 C;  2ZQO A;  3WO2 A;  1AFC A;  1BA7 A;  1PUU B;  3Q7Y A;  2E4M C;  1IHK A;  4IZX A;  4OWJ A;  1RY7 A;  3FUQ A;  3EF2 A;  1G9A A;  1XG6 A;  8I1B A;  3I29 B;  2J3P A;  4HA2 A;  3UJ4 A;  1R8N A;  1R8O A;  3HN1 A;  3CA4 A;  4LO8 B;  2DS0 A;  1FWV A;  4P0J A;  2AQZ A;  1ONK B;  1PWA A;  4JPZ A;  2P39 A;  3H6Q A;  4I4U A;  2VSE A;  1J0S A;  2F2F C;  1V6X A;  4GOV A;  3W9T A;  3AZW A;  1XYF A;  3O44 A;  2ERM A;  4AN7 B;  3UD9 A;  3H6R B;  3F1R A;  5HPZ A;  4XFU A;  4JQ0 A;  3BX1 C;  4H75 A;  3CA5 A;  3FFZ A;  3A21 A;  4I4P A;  4I4Q A;  3HMY A;  3V0A A;  2Y9W C;  2ZQN A;  3BAO A;  3FJF A;  4IYB A;  4JKX B;  1SZ6 B;  4LO1 C;  1TWE A;  4OEG A;  2KKI A;  4OWK A;  4USO A;  3AH1 A;  1IOB A;  2MLL B;  1ILR 1;  1AVW B;  1WD4 A;  1N4K A;  1MC9 A;  2D7I A;  1JQZ A;  4GOY A;  4Q91 A;  4QBV A;  4IY8 A;  1I1E A;  3C9Z A;  4AN6 A;  3S8J A;  3OBT A;  1F31 A;  4HR6 C;  3OGF A;  4I1E A;  4I2S A;  4LO3 A;  4D8H A;  4D0T A;  1RML A;  3VSZ A;  2Z49 A;  2HWA A;  1BLD A;  1JT5 A;  3QYD A;  3OJV A;  1T4Q A;  2NM1 A;  1JLX A;  4LO0 A;  1EVT A;  1FV2 A;  2ESU A;  1W3F A;  3VT2 A;  2ET2 A;  2K43 A;  3H6S E;  5BQU C;  1V6W A;  1FMM S;  1II4 A;  3RTJ B;  3WMV A;  1BFF A;  3JUT A;  1DFC A;  4ZLB B;  2ZR1 B;  1AVX B;  2E4M A;  3BA4 A;  4H04 A;  5BXR A;  4ZKT B;  4OEF A;  4Z9W B;  1EPW A;  5BXT A;  3CRG A;  2NS2 A;  2VLC A;  1HWP B;  4I37 A;  3IM7 A;  3RTI B;  4EFP A;  4EFR A;  2M49 A;  4Z8S B;  2MIB A;  4FVV A;  3ZC9 A;  5D63 A;  2D24 A;  1WBC A;  4G6M A;  2D23 A;  4R6U B;  3N7K A;  3PG0 A;  1YBI A;  2F2F A;  1S0E A;  3BAD A;  2K8R A;  2FDB M;  5EG6 C;  1A8D A;  3RMX A;  1JT3 A;  2KI6 B;  2UUS A;  1HWM B;  1JT4 A;  1TTU A;  4QD2 B;  1HIB A;  5DSS B;  3NJ5 A;  1ITB A;  3FJ8 A;  5JLV A;  1HCE A;  2VXT I;  3O4D A;  3MPP G;  4LO1 A;  3FUO A;  3FJH A;  2QYI B;  1Q04 A;  4H9W A;  1BFC A;  3P6J A;  4XFS A;  5FZU A;  3NBN A;  4ION A;  1BFB A;  3PME A;  2AAI B;  1WBA A;  1I1B A;  3BAV A;  1TP0 A;  4IZE A;  4ZGR B;  2F8X C;  1G9B A;  4JKQ A;  3FJD A;  1FV3 A;  3SNV A;  5BXS A;  3IIR A;  2D44 A;  3WIN C;  2AFG A;  3V0B A;  3POK A;  3IAG C;  3CA6 A;  1S0C A;  3AKI A;  4PC4 A;  5BQU A;  1K5U A;  4OW4 A;  4J2Y A;  1QXM A;  3VUO A;  3V0A B;  2K4A B;  3BAG A;  2KLL A;  3BAU A;  4OEE A;  4KEI A;  4I4R A;  3FJE A;  3FJ9 A;  3T8S A;  1IT0 A;  2RG9 B;  3Q7W A;  1BFG A;  3O49 A;  5BVP I;  3IM5 A;  1TWM A;  4DEP A;  3E8L C;  3UJ0 A;  4I7I A;  1MD6 A;  1ABR B;  1PUM B;  31BI A;  2R9K B;  1XZZ A;  4Q9P A;  4I0Y A;  3HAL A;  3HBW A;  1QQL A;  4WBC A;  3VT1 A;  5BP5 A;  2RQ9 A;  4I96 A;  1ISX A;  3VSF A;  2NP0 A;  4DEN A;  5F8S A;  2D1Z A;  3LTQ A;  2NZ9 A;  2LIQ A;  5I1B A;  2I1B A;  1W3G A;  4GAF A;  2KI4 A;  2X2T A;  1DZD A;  3CRI A;  4X37 A;  4ZFY B;  1FWU A;  9ILB A;  4KC3 A;  3ILA A;  4JRA A;  1AVA C;  3UD8 A;  2L5X A;  3CU1 B;  3BRD A;  4J2S A;  3NBD A;  1IRP A;  4X3A A;  3N0K A;  3CA3 A;  1CVS A;  3FJJ A;  3O5W B;  4IY9 A;  3UDA A;  4II0 A;  4QKR A;  1DQG A;  3AKG A;  5D62 A;  4QC4 A;  5F8W A;  1IIL A;  5G00 A;  3CRH A;  3RSJ A;  1YYN A;  4G9M A;  1Q1U A;  4USP A;  4QBC A;  4QO3 A;  3ZC8 A;  3ZXG A;  3P6I A;  1DLL A;  4I8M A;  4MZF B;  1HWO B;  3NBC A;  3BAH A;  3O3Q A;  1HCD A;  4ZBV B;  4EB2 B;  4F83 A;  1IJT A;  2WRY A;  3BB2 A;  1TIE A;  2VXR A;  4A7Y A;  5BP5 C;  1OQL B;  4END A;  4FGF A;  4A7K A;  2WBC A;  3RMY A;  5EHA A;  3WIN A;  4KEK A;  3VEQ A;  4J2K A;  4ISR A;  2HW9 A;  3A07 A;  4OUJ A;  2DRE A;  1ISZ A;  3WO3 A;  1JTC A;  3FJC A;  1EV2 A;  1S0L A;  3BTA A;  3BAQ A;  1VCL A;  5DVH A;  2NYY A;  1AVU A;  3WA1 A;  2D22 A;  3V79 C;  1NUN A;  4LO2 C;  4TLP A;  4MZG B;  4I4X A;  2P23 A;  3QR5 A;  2Z48 A;  3O4C A;  1IRA X;  1UPS A;  3MAL A;  1ISV A;  1Z0H A;  4MZH A;  1FMZ A;  3CAH A;  5E24 E;  4I4S A;  1FQ9 A;  3CQA A;  41BI A;  1RG8 A;  2DRZ A;  3Q7X A;  4JP0 A;  3CA0 A;  4J2X A;  3I2X A;  3I2A A;  1Z4S A;  4L4I A;  3A22 A;  3AKF A;  4D0Z A;  4GP3 A;  3D7W B;  1KNM A;  1YTO A;  2Y9F A;  5BOW A;  1WD3 A;  2YUG A;  3O4O A;  4L4H A;  1YXW A;  3N7L A;  3V0B B;  3AJ6 A;  1L2H A;  3VT0 A;  5FNW A;  2QN4 A;  3HOM A;  4CJM A;  2Y9G A;  2Y9X E;  5GAQ A;  4KEJ A;  1V6U A;  2MC2 A;  3JRR A;  1DZC A;  4GP0 A;  2RST A;  4KBB A;  3ZX7 A;  4EKX B;  1TFM B;  3NBE A;  3O4B A;  3K1X A;  3B9U A;  3BRF A;  2FFV A;  1DFQ A;  3O4A A;  4I3N A;  4P6A A;  2BEB A;  2XOA A;  4ZFU B;  4DCK C;  7I1B A;  4G9N A;  3BRG C;  1QQK A;  3OJ2 A;  4IQP A;  2HZ9 A;  5JMC A;  1AF9 A;  2D7R A;  3FJB A;  3FGM A;  2NTD A;  5F8Y A;  4ZOT A;  3OBR A;  3N7M A;  2IWT B;  4LO7 C;  3TC2 A;  4EFQ A;  1TOO A;  3ZXD A;  4OWL A;  4F34 A;  4XKI A;  1V6V A;  4I4Y A;  4I4O A;  5DUY A;  3UD7 A;  1CE7 B;  2KH2 A;  3R4S A;  2BFH A;  1XHB A;  3H6R A;  1BAR A;  1T9F A;  4ZA3 B;  1GGP B;  1Z2V A;  1HWN B;  3AZV A;  4QD2 C;  2DRY A;  4JAW A;  4LO2 A;  1Q03 A;  5D61 A;  1S0D A;  2GO2 A;  2Q9X A;  4I4V A;  3FJA A;  3FJI A;  1D0H A;  1DIW A;  1FN0 A;  1PZZ A;  1E0O A;  2LIE A;  4HJJ A;  4Q9G A;  4I6I A;  5FZY A;  2FGF A;  4QKS A;  1BLA A;  4UY4 A;  2BEA A;  1BAS A;  2HWM A;  2D20 A;  3LLP A; 
#chains in the Genus database with same CATH homology
 21BI A;  4J23 B;  4I1B A;  3OGG A;  5F90 A;  3HSM A;  2IHO A;  1DQO A;  1RZO B;  1G82 A;  2VSA A;  1JY0 A;  4ISQ A;  1EYL A;  2VU9 A;  1SR4 A;  5BXP A;  1ISY A;  4A7Z A;  1S0B A;  5FNX A;  1JT7 A;  5EC5 A;  2AXM A;  5DZU A;  2FFU A;  4ZFW B;  4X39 A;  3N7J A;  1M2T B;  1M16 A;  3AJ5 A;  4G6J A;  3WMU A;  3OJM A;  3PUB A;  1ISW A;  5B2H A;  2X2S A;  2NVH A;  3AH4 A;  3CA1 A;  4P0K A;  4LO7 B;  3WO4 A;  2FO1 A;  3S8K A;  1JLY A;  3P53 A;  1G9C A;  1W3A A;  4G1R A;  1P63 A;  1AXM A;  1HKN A;  4LO3 C;  1G9D A;  1YF8 B;  3FJK A;  2D43 A;  1S0F A;  4GAI A;  4IHZ A;  4P0L A;  3BA5 A;  4QAL A;  4YOL A;  3VWC A;  4EEE B;  2GZB A;  2VUA A;  1DJS B;  1PC8 B;  1NZK A;  1S0G A;  3IM6 A;  3PHZ A;  3F62 B;  4LO0 C;  4XFT A;  4X38 A;  1K5V A;  3BA7 A;  3AH2 A;  3AKH A;  1FGA A;  3R4U A;  2Q3N B;  3A23 A;  3KMV A;  6I1B A;  5FZZ A;  1SR4 C;  2ZQO A;  3WO2 A;  1AFC A;  1BA7 A;  1PUU B;  3Q7Y A;  2E4M C;  1IHK A;  4IZX A;  4OWJ A;  1RY7 A;  3FUQ A;  3EF2 A;  1G9A A;  1XG6 A;  8I1B A;  3I29 B;  2J3P A;  4HA2 A;  3UJ4 A;  1R8N A;  1R8O A;  3HN1 A;  3CA4 A;  4LO8 B;  2DS0 A;  1FWV A;  4P0J A;  2AQZ A;  1ONK B;  1PWA A;  4JPZ A;  2P39 A;  3H6Q A;  4I4U A;  2VSE A;  1J0S A;  2F2F C;  1V6X A;  4GOV A;  3W9T A;  3AZW A;  1XYF A;  3O44 A;  2ERM A;  4AN7 B;  3UD9 A;  3H6R B;  3F1R A;  5HPZ A;  4XFU A;  4JQ0 A;  3BX1 C;  4H75 A;  3CA5 A;  3FFZ A;  3A21 A;  4I4P A;  4I4Q A;  3HMY A;  3V0A A;  2Y9W C;  2ZQN A;  3BAO A;  3FJF A;  4IYB A;  4JKX B;  1SZ6 B;  4LO1 C;  1TWE A;  4OEG A;  2KKI A;  4OWK A;  4USO A;  3AH1 A;  1IOB A;  2MLL B;  1ILR 1;  1AVW B;  1WD4 A;  1N4K A;  1MC9 A;  2D7I A;  1JQZ A;  4GOY A;  4Q91 A;  4QBV A;  4IY8 A;  1I1E A;  3C9Z A;  4AN6 A;  3S8J A;  3OBT A;  1F31 A;  4HR6 C;  3OGF A;  4I1E A;  4I2S A;  4LO3 A;  4D8H A;  4D0T A;  1RML A;  3VSZ A;  2Z49 A;  2HWA A;  1BLD A;  1JT5 A;  3QYD A;  3OJV A;  1T4Q A;  2NM1 A;  1JLX A;  4LO0 A;  1EVT A;  1FV2 A;  2ESU A;  1W3F A;  3VT2 A;  2ET2 A;  2K43 A;  3H6S E;  5BQU C;  1V6W A;  1FMM S;  1II4 A;  3RTJ B;  3WMV A;  1BFF A;  3JUT A;  1DFC A;  4ZLB B;  2ZR1 B;  1AVX B;  2E4M A;  3BA4 A;  4H04 A;  5BXR A;  4ZKT B;  4OEF A;  4Z9W B;  1EPW A;  5BXT A;  3CRG A;  2NS2 A;  2VLC A;  1HWP B;  4I37 A;  3IM7 A;  3RTI B;  4EFP A;  4EFR A;  2M49 A;  4Z8S B;  2MIB A;  4FVV A;  3ZC9 A;  5D63 A;  2D24 A;  1WBC A;  4G6M A;  2D23 A;  4R6U B;  3N7K A;  3PG0 A;  1YBI A;  2F2F A;  1S0E A;  3BAD A;  2K8R A;  2FDB M;  5EG6 C;  1A8D A;  3RMX A;  1JT3 A;  2KI6 B;  2UUS A;  1HWM B;  1JT4 A;  1TTU A;  4QD2 B;  1HIB A;  5DSS B;  3NJ5 A;  1ITB A;  3FJ8 A;  5JLV A;  1HCE A;  2VXT I;  3O4D A;  3MPP G;  4LO1 A;  3FUO A;  3FJH A;  2QYI B;  1Q04 A;  4H9W A;  1BFC A;  3P6J A;  4XFS A;  5FZU A;  3NBN A;  4ION A;  1BFB A;  3PME A;  2AAI B;  1WBA A;  1I1B A;  3BAV A;  1TP0 A;  4IZE A;  4ZGR B;  2F8X C;  1G9B A;  4JKQ A;  3FJD A;  1FV3 A;  3SNV A;  5BXS A;  3IIR A;  2D44 A;  3WIN C;  2AFG A;  3V0B A;  3POK A;  3IAG C;  3CA6 A;  1S0C A;  3AKI A;  4PC4 A;  5BQU A;  1K5U A;  4OW4 A;  4J2Y A;  1QXM A;  3VUO A;  3V0A B;  2K4A B;  3BAG A;  2KLL A;  3BAU A;  4OEE A;  4KEI A;  4I4R A;  3FJE A;  3FJ9 A;  3T8S A;  1IT0 A;  2RG9 B;  3Q7W A;  1BFG A;  3O49 A;  5BVP I;  3IM5 A;  1TWM A;  4DEP A;  3E8L C;  3UJ0 A;  4I7I A;  1MD6 A;  1ABR B;  1PUM B;  31BI A;  2R9K B;  1XZZ A;  4Q9P A;  4I0Y A;  3HAL A;  3HBW A;  1QQL A;  4WBC A;  3VT1 A;  5BP5 A;  2RQ9 A;  4I96 A;  1ISX A;  3VSF A;  2NP0 A;  4DEN A;  5F8S A;  2D1Z A;  3LTQ A;  2NZ9 A;  2LIQ A;  5I1B A;  2I1B A;  1W3G A;  4GAF A;  2KI4 A;  2X2T A;  1DZD A;  3CRI A;  4X37 A;  4ZFY B;  1FWU A;  9ILB A;  4KC3 A;  3ILA A;  4JRA A;  1AVA C;  3UD8 A;  2L5X A;  3CU1 B;  3BRD A;  4J2S A;  3NBD A;  1IRP A;  4X3A A;  3N0K A;  3CA3 A;  1CVS A;  3FJJ A;  3O5W B;  4IY9 A;  3UDA A;  4II0 A;  4QKR A;  1DQG A;  3AKG A;  5D62 A;  4QC4 A;  5F8W A;  1IIL A;  5G00 A;  3CRH A;  3RSJ A;  1YYN A;  4G9M A;  1Q1U A;  4USP A;  4QBC A;  4QO3 A;  3ZC8 A;  3ZXG A;  3P6I A;  1DLL A;  4I8M A;  4MZF B;  1HWO B;  3NBC A;  3BAH A;  3O3Q A;  1HCD A;  4ZBV B;  4EB2 B;  4F83 A;  1IJT A;  2WRY A;  3BB2 A;  1TIE A;  2VXR A;  4A7Y A;  5BP5 C;  1OQL B;  4END A;  4FGF A;  4A7K A;  2WBC A;  3RMY A;  5EHA A;  3WIN A;  4KEK A;  3VEQ A;  4J2K A;  4ISR A;  2HW9 A;  3A07 A;  4OUJ A;  2DRE A;  1ISZ A;  3WO3 A;  1JTC A;  3FJC A;  1EV2 A;  1S0L A;  3BTA A;  3BAQ A;  1VCL A;  5DVH A;  2NYY A;  1AVU A;  3WA1 A;  2D22 A;  3V79 C;  1NUN A;  4LO2 C;  4TLP A;  4MZG B;  4I4X A;  2P23 A;  3QR5 A;  2Z48 A;  3O4C A;  1IRA X;  1UPS A;  3MAL A;  1ISV A;  1Z0H A;  4MZH A;  1FMZ A;  3CAH A;  5E24 E;  4I4S A;  1FQ9 A;  3CQA A;  41BI A;  1RG8 A;  2DRZ A;  3Q7X A;  4JP0 A;  3CA0 A;  4J2X A;  3I2X A;  3I2A A;  1Z4S A;  4L4I A;  3A22 A;  3AKF A;  4D0Z A;  4GP3 A;  3D7W B;  1KNM A;  1YTO A;  2Y9F A;  5BOW A;  1WD3 A;  2YUG A;  3O4O A;  4L4H A;  1YXW A;  3N7L A;  3V0B B;  3AJ6 A;  1L2H A;  3VT0 A;  5FNW A;  2QN4 A;  3HOM A;  4CJM A;  2Y9G A;  2Y9X E;  5GAQ A;  4KEJ A;  1V6U A;  2MC2 A;  3JRR A;  1DZC A;  4GP0 A;  2RST A;  4KBB A;  3ZX7 A;  4EKX B;  1TFM B;  3NBE A;  3O4B A;  3K1X A;  3B9U A;  3BRF A;  2FFV A;  1DFQ A;  3O4A A;  4I3N A;  4P6A A;  2BEB A;  2XOA A;  4ZFU B;  4DCK C;  7I1B A;  4G9N A;  3BRG C;  1QQK A;  3OJ2 A;  4IQP A;  2HZ9 A;  5JMC A;  1AF9 A;  2D7R A;  3FJB A;  3FGM A;  2NTD A;  5F8Y A;  4ZOT A;  3OBR A;  3N7M A;  2IWT B;  4LO7 C;  3TC2 A;  4EFQ A;  1TOO A;  3ZXD A;  4OWL A;  4F34 A;  4XKI A;  1V6V A;  4I4Y A;  4I4O A;  5DUY A;  3UD7 A;  1CE7 B;  2KH2 A;  3R4S A;  2BFH A;  1XHB A;  3H6R A;  1BAR A;  1T9F A;  4ZA3 B;  1GGP B;  1Z2V A;  1HWN B;  3AZV A;  4QD2 C;  2DRY A;  4JAW A;  4LO2 A;  1Q03 A;  5D61 A;  1S0D A;  2GO2 A;  2Q9X A;  4I4V A;  3FJA A;  3FJI A;  1D0H A;  1DIW A;  1FN0 A;  1PZZ A;  1E0O A;  2LIE A;  4HJJ A;  4Q9G A;  4I6I A;  5FZY A;  2FGF A;  4QKS A;  1BLA A;  4UY4 A;  2BEA A;  1BAS A;  2HWM A;  2D20 A;  3LLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...