4HAAA

Structure of ribonuclease binase glu43ala/phe81ala mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAAVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGARNADRLVYSSDWLIYKTTDHYATFTRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Structure and functional studies of the ribonuclease binase Glu43Ala/Phe81Ala mutant.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4haaA00
1X1UA 1BNGA 1PY3A 1B27A 1JBRA 3URPA 1CH0A 1G02A 1RGLA 3HOHA 1BNSA 2F5WA 5HOHA 1RNBA 7GSPA 1YNVX 1SARA 1HYFA 1X1YA 2AADA 4BU4A 1RN4A 1LRAA 1BRGA 5BIRA 2HOHA 1R4YA 1GOUA 1RLSA 1BSEA 2RBIA 3BU4A 1PYLA 1RTUA 1DETA 1X1WA 1B3SA 2KF5A 2RNTA 3WHOA 1RGKA 1BANA 1BSDA 1FYSA 3RNTA 1BSBA 2F56A 1I0VA 1RHLA 3A5EA 1RMSA 1B2UA 1UCIA 1RSNA 4HOHA 1BRSA 1I2GA 3GSPA 1BOXA 4J5GA 1RGFA 1BNIA 1C54A 1DE3A 1YGWA 1GOYA 1ZGXA 1RGHA 4BIRA 1AQZA 1JBSA 1B2ZA 1GOVA 3SYUA 3BIRA 1FZUA 1LOVA 1RGCA 1HZ1A 3AHWA 3DH2A 1GMRA 1RNTA 1B2SA 2AAEA 1FW7A 1RGAA 1TRPA 6RNTA 1BIRA 1GMPA 1BNEA 1B2MA 1LNIA 1I2FA 1RGGA 2C4BA 1I70A 1BRNL 2F4YA 1B2XA 1GMQA 1MGRA 2KF4A 1LOYA 5GSPA 2F5MA 7RNTA 8RNTA 1BVIA 2BU4A 1I8VA 2SARA 1RN1A 1T2HA 1UCKA 1BNJA 3AGNA 6GSPA 3AHSA 1RCLA 3WR2A 1I3IA 3DGYA 1BUJA 2KF6A 1Q9EA 3D4AA 1BRKA 1BNRA 1X1XA 1LOWA 4GHOA 1RDSA 1FUSA 2BIRA 1BRHA 3Q3FA 5BU4A 1YVSA 1GSPA 1FUTA 1BAOA 2KF3A 1RGEA 1BRIA 1UCLA 1UCJA 1JBTA 3D5GA 1BU4A 1BGSA 3D5IA 4GSPA 4J5KA 1BNFA 1I3FA 1TTOA 1BRJA 1MGWA 1B21A 1RCKA 1A2PA 1BSAA 1TRQA 2ZA4A 4HAAA 1AY7A 1I0XA 4RNTA 1IYYA 3AGOA 9RNTA 5RNTA 2KAAA 1B20A 1T2IA 1BSCA 2GSPA 3KCHA 1I2EA
chains in the Genus database with same CATH superfamily
1BNGA 1K28A 1PY3A 1UUVB 4KVHA 1JRQA 1N9EA 4STDA 3WA3A 2E2UA 3I553 1K9M4 3URPA 3DZLA 1M1K4 1MNLA 3V92A 1RKYA 1V74A 1KQS2 1EEJA 1IQ8A 2D42A 2W04A 2OCTA 2RFRA 3HOHA 1VZZA 2RSXA 1TIJA 3N8BA 1BNSA 2W03A 3MPHA 2QA43 3H51A 4HJLB 4XM4A 3U97A 1VQN3 1X1YA 3FF2A 4MEIA 1RN4A 5CXOA 1VQ73 4IPBA 3IPTA 2J8XB 5IG5A 1O7HB 2Y74A 4EW5A 4O3VA 1AVLA 2RBIA 3MG3A 1PYLA 4TX4A 2Z7AA 4R80A 3SOYA 1FA3A 3NQYA 5JPUA 1UW1A 3DY5A 3KZTA 2KF5A 3JUQA 1YIJ3 1QAFA 1US1A 3KE7A 2PNCA 3RNTA 5CK6A 5ELJA 2HMNB 4OK0A 3I0YA 4HOHA 5D82A 5FW5A 1FGRA 1UUGB 4NREA 4RBNA 5CF2A 3NUVA 1L5GB 1C54A 2K3DA 2W2CA 4R4KA 3DGLA 3FF0A 1J2BA 3ER7A 2GBWB 3F40A 3EF8A 4BIRA 1AQZA 4RNZA 1B2ZA 1GOVA 2XSOB 3VGNA 1RGCA 3DH2A 4BTXA 4O2HA 1MWTA 3CCJ3 1Z1SA 3OWSA 4PEJA 1DMNA 3ZFZA 1O7MB 3KSED 1GMPA 2CFDA 5EEOA 3KKGA 1R4CA 3CCU3 4H3UA 4ILFA 1BRNL 1Q7Y4 3IJEB 1DMQA 1B2XA 1GMQA 1FGQA 5GSPA 4GL6A 8RNTA 2CC3A 1RRLA 5ELUA 2INXA 1C7HA 4AEQA 3GZXB 3CC43 3AHSA 3KSPA 2UGIA 1RCLA 3DGYA 1CYVA 2KF6A 1BRKA 1FGMA 4O02B 1GY6A 3PS8A 5M19A 1EA2A 1JB5A 1ZO2A 3PCSA 2Z77A 1ULIB 3Q1CA 2BIRA 3Q3FA 1IDPA 3CD63 2WOFA 4KFDA 3FLJA 1T5YA 3NHXA 5IERA 1W00A 1A90A 3DGMA 3DM8A 3EX9A 1BGSA 1WMNA 3PXMA 3X41A 3F9SA 4HKVB 3RDEA 1OHSA 1BUQA 1BNFA 1RJOA 1TTOA 1AV4A 1ZX2A 3WODG 1GD3A 3NM2A 4HM5B 2OTJ3 5M1AA 1GY5A 1ULJB 7STDA 1CEWI 1JB2A 3A76A 5IEOA 3LXUX 5AEWB 2GU3A 4J8TA 5G1LA 4RNTA 2XGNA 1M9GA 4G1MB 2O3OA 1LQMB 4K1UA 2BT3A 1IYYA 3F8XA 2M7OA 4N6V0 2KAAA 2GSPA 2CIUA 4EYCA 2GU1A 2SBLA 4LZIA 1W7CA 2C10A 3LOYA 3X3XA 1F8NA 3ALAA 3O8YA 3CCV3 4H61A 3QRDA 4BL3A 1JBRA 2CWVA 3S29A 3OWUA 1G02A 2QGUA 1VQ83 1YGEA 4K90B 3LTCA 4X2HA 3CNXA 1DVDA 1W5ZA 3PCRA 5HOHA 1M904 3JUOA 2CG1A 1RNBA 1YNVX 4FMBA 1HYFA 1K41A 2HMKB 1OGXA 4BU4A 2XH9A 3S28A 5BIRA 4N6MA 1RLSA 2KCDA 3MKIA 1RTUA 1E3RA 1ZS7A 1A2VA 1KD14 1JNQA 2W0QA 3WDGB 5IENA 2H0GA 2H0IA 3HI7A 1WMPA 4HM6B 4HM2B 3FZWA 3OW22 1I0VA 4HBRA 1RHLA 1RRHA 2R41A 3KFQC 4O8SA 1DMMA 1UCIA 1RSNA 3K0ZA 1VQK3 3MG2A 1LQGC 2W6JH 1RGFA 1BNIA 3B4OA 4CCVA 2CG0A 3BLZA 1IVXA 1ZGXA 2OWPA 5AI1A 1NO3A 1JBSA 5KP4A 2PZVA 2UX0A 3GAXA 3DUKA 3PGBA 2CFWA 1HZ1A 2FNQA 2GEXA 2FGTA 1GMRA 1RNTA 1JN5A 3AHWA 1TP6A 4HYZA 1VQ63 2W56B 5EVHA 4HM3B 6RNTA 1GY7A 1JZOA 4FCZA 4N6UA 1BIRA 3EB8A 5LC7A 3BNBA 3G8ZA 1B2MA 1STFI 1RGGA 2C4BA 1MGRA 2HMLB 2F99A 2KF4A 2F5MA 2LYXA 4XBTA 3AMOB 1BVIA 1Q40B 2BU4A 3EN1B 1TFOA 3NBRA 2E2TA 1VQ43 4LMIA 3HX8A 4R9KA 3ZG5A 6GSPA 1W02A 3WR2A 2ML6A 3X42A 2CK3H 3X40A 5IEPA 1VQ53 5AIIA 3BNEA 3D3LA 4KZ1A 1EG9B 3CXC2 1YHQ3 4BL2A 1X1XA 3STDA 2R4IA 3DGOA 4I4KA 1EKMA 2CHCA 3LMLA 3B4PA 1IVUA 3JUPA 3N9HA 5BU4A 1JV2B 1FUTA 1BAOA 2KF3A 3LTBA 1RGEA 3SOAA 4BTYA 1D6YA 3K7CA 4L8PA 1STDA 4OVMA 3PZWA 1EUIC 2CFGA 3EBTA 4N3VA 4N6OB 3I563 3UL6A 1JBTA 2WGQA 1FGOA 1VQ93 3FGYA 3WOEB 2H0HA 4WWUC 1IVVA 5KP3A 1I3FA 4EV5A 1BRJA 2F98A 1SIIA 1RCKA 1WMOA 1A2PA 2ML5A 5STDA 3OX9A 1Q824 2ZA4A 3FSDA 3CC73 3LT8A 4XDWA 3BNCA 3HIIA 2IUKA 4RZMA 2IUJA 2OOVA 4EXRA 3NXJA 3Q2PA 3PYJA 2L1SA 2YX9A 3AGOA 3QK9A 4HZ9B 1IU7A 2CFLA 1B20A 4DKIA 1BSCA 3CCE3 3CMA3 2YFLB 1W01A 3KCHA 5TGNA 1W4NA 1I2EA 1QALA 2OQEA 3T8UA 3H3HA 1X1UA 2XR8B 3F7SA 3Q90A 5D83A 1NDOB 2WO0A 3MHEA 3TDGA 1V58A 1G0TA 1N9JA 2BMOB 1CH0A 1QAKA 4IIAA 2CX0A 4LYLB 1RGLA 3S27A 3NBJA 1W6YA 2IYJA 3HIGA 4I5QA 3J7Yd 1YVBI 3OV4A 4FR9A 4OUQA 7GSPA 3S67A 1SARA 2KXGA 3VSYA 1N8QA 2ZHXB 3CCQ3 4HM1B 2P0MA 2XF3A 4HM4B 1R4YA 1OHOA 3V98A 1G96A 3BU4A 1NB3I 4FMDA 3CU3A 4XDVA 4X2OA 4XBYA 1X1WA 3WOFB 3SVAA 1B3SA 2W56A 4NHFA 1TU5A 1DVCA 2RNTA 1TJDA 1BANA 3GZRA 4HM0B 3V99A 3GRDA 8CHOA 3F7XA 2XFTA 1FYSA 2A15A 1SIHA 3A5EA 4WHAA 3AMOA 1Q40A 3HK4A 1W6CA 1MWRA 5CF1A 4FCJA 1Q814 1BRSA 1I2GA 4K61A 4HM8B 1NB5I 2OTL3 1DE3A 1YGWA 2MC8A 3EQQB 1JB4A 1NU3A 1GOYA 1W6GA 1IT7A 3GWRA 4K1VA 1UGHI 4HM7B 4KFEA 4R1KA 5AIGA 4AKZA 3BB9A 2P05A 4FMAA 4MMZB 5DREA 2GXFA 1E97A 5A0OB 2CWTA 4N6LA 1T3BA 1LOVA 2ZDJA 1B2SA 1IQYA 1U5OA 1LVNA 4FMCA 2ZL8A 1CQSA 1OCVA 5AIFA 1YJ93 3KN4A 1QMAA 4U13A 1PFPA 3FG1A 4WYKB 1LNIA 2D1WA 3FKAA 5IF6A 1U8CB 5D81A 3SXXA 5JBSA 1E3VA 2Z76A 1ISKA 2YFIB 7RNTA 3NV0B 2CW9A 4MJDA 2P09A 1KSIA 3NQZA 1RN1A 1T2HA 3GZYB 1UCKA 1BNJA 3AGNA 3FG3A 1MOLA 1IVWA 1IK3A 1I3IA 3G4S3 2F86B 3CME3 1MWSA 3EBYA 3UJMA 2P0XA 1HKXA 3D4AA 3EC9A 1UUWB 3LT9A 2BHMA 5IW9A 1O7WB 1SPUA 3LH4A 1IV7A 1D6ZA 3ECFA 1Y4KA 2W9QA 4J9AA 1IQXA 1LOWA 2Z6BA 4GHOA 3SEDA 2B24B 2YFJB 1MWUA 5AIHA 3U1WA 5DRVA 3T0UA 3OWYA 3NX0A 2K0MA 1GSPA 3BNDA 5BXQA 3CCS3 1QVG2 1K734 1BRIA 1UCLA 3JUNA 1UCJA 2CH9A 2CX1A 3JVCA 1UGIA 3MYTA 1YJN3 1VQL3 1D6UA 3RGRA 1IT8A 1Q7HA 2CFKA 2JQ5A 4J5KA 3WA2X 1NJI4 2RCDA 3D79A 1MGWA 4N6TA 4R9LA 2STDA 3DXOA 1JKGB 4EBGA 1BSAA 2B1XB 3CPOA 4NPBA 3JUMA 4HAAA 3S5CA 2MF7A 2Q07A 4EV2A 1AY7A 3MWZA 4LGQA 4MMXB 3B8LA 3E99A 3EHCA 2CWUA 2L4VA 3DGNA 3EJVA 3G16A 4KFFA 1O7NB 5RNTA 2UUGC 3MG1A 3ROBA 1O7PB 2BO9B 1SQWA 1T2IA 2E2VA 1VQQA 4MMYB 1W2ZA 1OHPA 2IMJA 5CLKA 6STDA 1OGZA 3G713 1LOXA 1GD4A 1OF5B 3GZBA 4JF8A 5I97A 2C11A 1B27A 2CKFB 3CNMA 3X3ZA 4AKYA 4ZM8A 3VF1A 3RGAA 5EQLA 5IG4A 1GS3A 1OACA 1JZDA 3NM7A 3CCR3 1N5HA 5AYRB 1WQLB 2F5WA 1N8R4 3OXAA 1Q42A 2QIYA 3F8HA 1YJW3 5G1KA 2AADA 4KT3B 1QJGA 2XRXB 4EC6A 1LRAA 1BRGA 2HOHA 2GEYA 4HVNA 1GOUA 1BSEA 2Y73A 4IT7A 5JPPA 1ROAA 1DETA 1ROVA 1VQO3 3CPW2 1TUHA 3WHOA 2RGQA 1LNHA 1RGKA 1BSDA 4WYKA 1HU9A 1K8A4 5AEUB 4N6NB 1RN7A 1WNHA 1BSBA 2F56A 2LQVA 3LTDA 3NV0A 1AR0A 1RMSA 1B2UA 5BVBA 1TFKA 1O7GB 4L8OA 5HGRA 4HZBB 5G2GA 2OOVC 3GSPA 2GBXB 3HZPA 3UB1A 4CDLA 1BOXA 1LXEA 2XEPA 3DMCA 1PU4A 3F14A 4J5GA 4ORLA 1VQP3 4Q53A 1SJWA 2WGOA 1JJ22 1RGHA 1UI7A 1A2KA 1OUNA 2OQEC 3M8CA 3SYUA 3BIRA 1FZUA 3CC23 1JN5B 2AAEA 2I9WA 1FW7A 2BNGA 5FGOA 1VQM3 1YIT3 4FCMA 5AYSC 3LZAA 1M1XB 1RGAA 1TRPA 1Q864 2XGLA 4CJNA 4WP5A 1BNEA 1UI8A 2IY2A 2W9PA 3UL5A 1QVF2 3G6E3 1I2FA 2BMRB 1I70A 3NBBA 2F4YA 2QEX3 1LOYA 3LTAA 1NNVA 3FH1A 1I8VA 1IV9A 1JKGA 2SARA 5IG3A 4GB5A 1S723 2JDIH 4WFOA 1GYBA 1BUJA 4L7KA 1Q9EA 2FXTA 3K5TA 1BNRA 4LEHA 4LSOA 1YI23 1W2B2 4XBXA 5M18A 1A67A 2WOHA 3SLUA 2KRTA 1RDSA 1CYUA 1KC84 1OF5A 1FUSA 1S5AA 3D9RA 1KWIA 3X3YA 2HMJB 3N54B 1BRHA 3SX1A 3ZG0A 1YVSA 3CCM3 3EN8A 2HMMB 4QWTA 4RNYA 3K63A 2V1LA 3KIIA 4CPKA 3EE1A 1AVKA 3B7CA 3WMDA 3D5GA 1BU4A 3D5IA 3IMAB 4BTWA 3MSOA 5KP1A 4GSPA 3CCL3 1ASKA 2K54A 2P38A 4XB5A 3T8NA 3UNLA 1B21A 1OPYA 2HMOB 1TRQA 3L0RA 1V57A 1UDII 5IG0A 3K9MC 1N5PA 1NWWA 2IA7A 3LYGA 1I0XA 5LC6A 1FGTA 1OH0A 2BMQB 2XSHB 3FCSB 1EQKA 9RNTA 2XFSA 1FUWA 4JRFA 3FG4A 1DYUA 2O9UX 1WTHA 3G0KA
chains in the Genus database with same CATH topology
1X1UA 1BNGA 1PY3A 1B27A 1JBRA 3URPA 1CH0A 1G02A 1RGLA 3HOHA 1BNSA 2F5WA 5HOHA 1RNBA 7GSPA 1YNVX 1SARA 1HYFA 1X1YA 2AADA 4BU4A 1RN4A 1LRAA 1BRGA 5BIRA 2HOHA 1R4YA 1GOUA 1RLSA 1BSEA 2RBIA 3BU4A 1PYLA 1RTUA 1DETA 1X1WA 1B3SA 2KF5A 2RNTA 3WHOA 1RGKA 1BANA 1BSDA 1FYSA 3RNTA 1BSBA 2F56A 1I0VA 1RHLA 3A5EA 1RMSA 1B2UA 1UCIA 1RSNA 4HOHA 1BRSA 1I2GA 3GSPA 1BOXA 4J5GA 1RGFA 1BNIA 1C54A 1DE3A 1YGWA 1GOYA 1ZGXA 1RGHA 4BIRA 1AQZA 1JBSA 1B2ZA 1GOVA 3SYUA 3BIRA 1FZUA 1LOVA 1RGCA 1HZ1A 3AHWA 3DH2A 1GMRA 1RNTA 1B2SA 2AAEA 1FW7A 1RGAA 1TRPA 6RNTA 1BIRA 1GMPA 1BNEA 1B2MA 1LNIA 1I2FA 1RGGA 2C4BA 1I70A 1BRNL 2F4YA 1B2XA 1GMQA 1MGRA 2KF4A 1LOYA 5GSPA 2F5MA 7RNTA 8RNTA 1BVIA 2BU4A 1I8VA 2SARA 1RN1A 1T2HA 1UCKA 1BNJA 3AGNA 6GSPA 3AHSA 1RCLA 3WR2A 1I3IA 3DGYA 1BUJA 2KF6A 1Q9EA 3D4AA 1BRKA 1BNRA 1X1XA 1LOWA 4GHOA 1RDSA 1FUSA 2BIRA 1BRHA 3Q3FA 5BU4A 1YVSA 1GSPA 1FUTA 1BAOA 2KF3A 1RGEA 1BRIA 1UCLA 1UCJA 1JBTA 3D5GA 1BU4A 1BGSA 3D5IA 4GSPA 4J5KA 1BNFA 1I3FA 1TTOA 1BRJA 1MGWA 1B21A 1RCKA 1A2PA 1BSAA 1TRQA 2ZA4A 4HAAA 1AY7A 1I0XA 4RNTA 1IYYA 3AGOA 9RNTA 5RNTA 2KAAA 1B20A 1T2IA 1BSCA 2GSPA 3KCHA 1I2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1U A;  1BNG A;  1PY3 A;  1B27 A;  1JBR A;  3URP A;  1CH0 A;  1G02 A;  1RGL A;  3HOH A;  1BNS A;  2F5W A;  5HOH A;  1RNB A;  7GSP A;  1YNV X;  1SAR A;  1HYF A;  1X1Y A;  2AAD A;  4BU4 A;  1RN4 A;  1LRA A;  1BRG A;  5BIR A;  2HOH A;  1R4Y A;  1GOU A;  1RLS A;  1BSE A;  2RBI A;  3BU4 A;  1PYL A;  1RTU A;  1DET A;  1X1W A;  1B3S A;  2KF5 A;  2RNT A;  3WHO A;  1RGK A;  1BAN A;  1BSD A;  1FYS A;  3RNT A;  1BSB A;  2F56 A;  1I0V A;  1RHL A;  3A5E A;  1RMS A;  1B2U A;  1UCI A;  1RSN A;  4HOH A;  1BRS A;  1I2G A;  3GSP A;  1BOX A;  4J5G A;  1RGF A;  1BNI A;  1C54 A;  1DE3 A;  1YGW A;  1GOY A;  1ZGX A;  1RGH A;  4BIR A;  1AQZ A;  1JBS A;  1B2Z A;  1GOV A;  3SYU A;  3BIR A;  1FZU A;  1LOV A;  1RGC A;  1HZ1 A;  3AHW A;  3DH2 A;  1GMR A;  1RNT A;  1B2S A;  2AAE A;  1FW7 A;  1RGA A;  1TRP A;  6RNT A;  1BIR A;  1GMP A;  1BNE A;  1B2M A;  1LNI A;  1I2F A;  1RGG A;  2C4B A;  1I70 A;  1BRN L;  2F4Y A;  1B2X A;  1GMQ A;  1MGR A;  2KF4 A;  1LOY A;  5GSP A;  2F5M A;  7RNT A;  8RNT A;  1BVI A;  2BU4 A;  1I8V A;  2SAR A;  1RN1 A;  1T2H A;  1UCK A;  1BNJ A;  3AGN A;  6GSP A;  3AHS A;  1RCL A;  3WR2 A;  1I3I A;  3DGY A;  1BUJ A;  2KF6 A;  1Q9E A;  3D4A A;  1BRK A;  1BNR A;  1X1X A;  1LOW A;  4GHO A;  1RDS A;  1FUS A;  2BIR A;  1BRH A;  3Q3F A;  5BU4 A;  1YVS A;  1GSP A;  1FUT A;  1BAO A;  2KF3 A;  1RGE A;  1BRI A;  1UCL A;  1UCJ A;  1JBT A;  3D5G A;  1BU4 A;  1BGS A;  3D5I A;  4GSP A;  4J5K A;  1BNF A;  1I3F A;  1TTO A;  1BRJ A;  1MGW A;  1B21 A;  1RCK A;  1A2P A;  1BSA A;  1TRQ A;  2ZA4 A;  4HAA A;  1AY7 A;  1I0X A;  4RNT A;  1IYY A;  3AGO A;  9RNT A;  5RNT A;  2KAA A;  1B20 A;  1T2I A;  1BSC A;  2GSP A;  3KCH A;  1I2E A; 
#chains in the Genus database with same CATH topology
 1BNG A;  1K28 A;  1PY3 A;  1UUV B;  4KVH A;  1JRQ A;  1N9E A;  4STD A;  3WA3 A;  2E2U A;  3I55 3;  1K9M 4;  3URP A;  3DZL A;  1M1K 4;  1MNL A;  3V92 A;  1RKY A;  1V74 A;  1KQS 2;  1EEJ A;  1IQ8 A;  2D42 A;  2W04 A;  2OCT A;  2RFR A;  3HOH A;  1VZZ A;  2RSX A;  1TIJ A;  3N8B A;  1BNS A;  2W03 A;  3MPH A;  2QA4 3;  3H51 A;  4HJL B;  4XM4 A;  3U97 A;  1VQN 3;  1X1Y A;  3FF2 A;  4MEI A;  1RN4 A;  5CXO A;  1VQ7 3;  4IPB A;  3IPT A;  2J8X B;  5IG5 A;  1O7H B;  2Y74 A;  4EW5 A;  4O3V A;  1AVL A;  2RBI A;  3MG3 A;  1PYL A;  4TX4 A;  2Z7A A;  4R80 A;  3SOY A;  1FA3 A;  3NQY A;  5JPU A;  1UW1 A;  3DY5 A;  3KZT A;  2KF5 A;  3JUQ A;  1YIJ 3;  1QAF A;  1US1 A;  3KE7 A;  2PNC A;  3RNT A;  5CK6 A;  5ELJ A;  2HMN B;  4OK0 A;  3I0Y A;  4HOH A;  5D82 A;  5FW5 A;  1FGR A;  1UUG B;  4NRE A;  4RBN A;  5CF2 A;  3NUV A;  1L5G B;  1C54 A;  2K3D A;  2W2C A;  4R4K A;  3DGL A;  3FF0 A;  1J2B A;  3ER7 A;  2GBW B;  3F40 A;  3EF8 A;  4BIR A;  1AQZ A;  4RNZ A;  1B2Z A;  1GOV A;  2XSO B;  3VGN A;  1RGC A;  3DH2 A;  4BTX A;  4O2H A;  1MWT A;  3CCJ 3;  1Z1S A;  3OWS A;  4PEJ A;  1DMN A;  3ZFZ A;  1O7M B;  3KSE D;  1GMP A;  2CFD A;  5EEO A;  3KKG A;  1R4C A;  3CCU 3;  4H3U A;  4ILF A;  1BRN L;  1Q7Y 4;  3IJE B;  1DMQ A;  1B2X A;  1GMQ A;  1FGQ A;  5GSP A;  4GL6 A;  8RNT A;  2CC3 A;  1RRL A;  5ELU A;  2INX A;  1C7H A;  4AEQ A;  3GZX B;  3CC4 3;  3AHS A;  3KSP A;  2UGI A;  1RCL A;  3DGY A;  1CYV A;  2KF6 A;  1BRK A;  1FGM A;  4O02 B;  1GY6 A;  3PS8 A;  5M19 A;  1EA2 A;  1JB5 A;  1ZO2 A;  3PCS A;  2Z77 A;  1ULI B;  3Q1C A;  2BIR A;  3Q3F A;  1IDP A;  3CD6 3;  2WOF A;  4KFD A;  3FLJ A;  1T5Y A;  3NHX A;  5IER A;  1W00 A;  1A90 A;  3DGM A;  3DM8 A;  3EX9 A;  1BGS A;  1WMN A;  3PXM A;  3X41 A;  3F9S A;  4HKV B;  3RDE A;  1OHS A;  1BUQ A;  1BNF A;  1RJO A;  1TTO A;  1AV4 A;  1ZX2 A;  3WOD G;  1GD3 A;  3NM2 A;  4HM5 B;  2OTJ 3;  5M1A A;  1GY5 A;  1ULJ B;  7STD A;  1CEW I;  1JB2 A;  3A76 A;  5IEO A;  3LXU X;  5AEW B;  2GU3 A;  4J8T A;  5G1L A;  4RNT A;  2XGN A;  1M9G A;  4G1M B;  2O3O A;  1LQM B;  4K1U A;  2BT3 A;  1IYY A;  3F8X A;  2M7O A;  4N6V 0;  2KAA A;  2GSP A;  2CIU A;  4EYC A;  2GU1 A;  2SBL A;  4LZI A;  1W7C A;  2C10 A;  3LOY A;  3X3X A;  1F8N A;  3ALA A;  3O8Y A;  3CCV 3;  4H61 A;  3QRD A;  4BL3 A;  1JBR A;  2CWV A;  3S29 A;  3OWU A;  1G02 A;  2QGU A;  1VQ8 3;  1YGE A;  4K90 B;  3LTC A;  4X2H A;  3CNX A;  1DVD A;  1W5Z A;  3PCR A;  5HOH A;  1M90 4;  3JUO A;  2CG1 A;  1RNB A;  1YNV X;  4FMB A;  1HYF A;  1K41 A;  2HMK B;  1OGX A;  4BU4 A;  2XH9 A;  3S28 A;  5BIR A;  4N6M A;  1RLS A;  2KCD A;  3MKI A;  1RTU A;  1E3R A;  1ZS7 A;  1A2V A;  1KD1 4;  1JNQ A;  2W0Q A;  3WDG B;  5IEN A;  2H0G A;  2H0I A;  3HI7 A;  1WMP A;  4HM6 B;  4HM2 B;  3FZW A;  3OW2 2;  1I0V A;  4HBR A;  1RHL A;  1RRH A;  2R41 A;  3KFQ C;  4O8S A;  1DMM A;  1UCI A;  1RSN A;  3K0Z A;  1VQK 3;  3MG2 A;  1LQG C;  2W6J H;  1RGF A;  1BNI A;  3B4O A;  4CCV A;  2CG0 A;  3BLZ A;  1IVX A;  1ZGX A;  2OWP A;  5AI1 A;  1NO3 A;  1JBS A;  5KP4 A;  2PZV A;  2UX0 A;  3GAX A;  3DUK A;  3PGB A;  2CFW A;  1HZ1 A;  2FNQ A;  2GEX A;  2FGT A;  1GMR A;  1RNT A;  1JN5 A;  3AHW A;  1TP6 A;  4HYZ A;  1VQ6 3;  2W56 B;  5EVH A;  4HM3 B;  6RNT A;  1GY7 A;  1JZO A;  4FCZ A;  4N6U A;  1BIR A;  3EB8 A;  5LC7 A;  3BNB A;  3G8Z A;  1B2M A;  1STF I;  1RGG A;  2C4B A;  1MGR A;  2HML B;  2F99 A;  2KF4 A;  2F5M A;  2LYX A;  4XBT A;  3AMO B;  1BVI A;  1Q40 B;  2BU4 A;  3EN1 B;  1TFO A;  3NBR A;  2E2T A;  1VQ4 3;  4LMI A;  3HX8 A;  4R9K A;  3ZG5 A;  6GSP A;  1W02 A;  3WR2 A;  2ML6 A;  3X42 A;  2CK3 H;  3X40 A;  5IEP A;  1VQ5 3;  5AII A;  3BNE A;  3D3L A;  4KZ1 A;  1EG9 B;  3CXC 2;  1YHQ 3;  4BL2 A;  1X1X A;  3STD A;  2R4I A;  3DGO A;  4I4K A;  1EKM A;  2CHC A;  3LML A;  3B4P A;  1IVU A;  3JUP A;  3N9H A;  5BU4 A;  1JV2 B;  1FUT A;  1BAO A;  2KF3 A;  3LTB A;  1RGE A;  3SOA A;  4BTY A;  1D6Y A;  3K7C A;  4L8P A;  1STD A;  4OVM A;  3PZW A;  1EUI C;  2CFG A;  3EBT A;  4N3V A;  4N6O B;  3I56 3;  3UL6 A;  1JBT A;  2WGQ A;  1FGO A;  1VQ9 3;  3FGY A;  3WOE B;  2H0H A;  4WWU C;  1IVV A;  5KP3 A;  1I3F A;  4EV5 A;  1BRJ A;  2F98 A;  1SII A;  1RCK A;  1WMO A;  1A2P A;  2ML5 A;  5STD A;  3OX9 A;  1Q82 4;  2ZA4 A;  3FSD A;  3CC7 3;  3LT8 A;  4XDW A;  3BNC A;  3HII A;  2IUK A;  4RZM A;  2IUJ A;  2OOV A;  4EXR A;  3NXJ A;  3Q2P A;  3PYJ A;  2L1S A;  2YX9 A;  3AGO A;  3QK9 A;  4HZ9 B;  1IU7 A;  2CFL A;  1B20 A;  4DKI A;  1BSC A;  3CCE 3;  3CMA 3;  2YFL B;  1W01 A;  3KCH A;  5TGN A;  1W4N A;  1I2E A;  1QAL A;  2OQE A;  3T8U A;  3H3H A;  1X1U A;  2XR8 B;  3F7S A;  3Q90 A;  5D83 A;  1NDO B;  2WO0 A;  3MHE A;  3TDG A;  1V58 A;  1G0T A;  1N9J A;  2BMO B;  1CH0 A;  1QAK A;  4IIA A;  2CX0 A;  4LYL B;  1RGL A;  3S27 A;  3NBJ A;  1W6Y A;  2IYJ A;  3HIG A;  4I5Q A;  3J7Y d;  1YVB I;  3OV4 A;  4FR9 A;  4OUQ A;  7GSP A;  3S67 A;  1SAR A;  2KXG A;  3VSY A;  1N8Q A;  2ZHX B;  3CCQ 3;  4HM1 B;  2P0M A;  2XF3 A;  4HM4 B;  1R4Y A;  1OHO A;  3V98 A;  1G96 A;  3BU4 A;  1NB3 I;  4FMD A;  3CU3 A;  4XDV A;  4X2O A;  4XBY A;  1X1W A;  3WOF B;  3SVA A;  1B3S A;  2W56 A;  4NHF A;  1TU5 A;  1DVC A;  2RNT A;  1TJD A;  1BAN A;  3GZR A;  4HM0 B;  3V99 A;  3GRD A;  8CHO A;  3F7X A;  2XFT A;  1FYS A;  2A15 A;  1SIH A;  3A5E A;  4WHA A;  3AMO A;  1Q40 A;  3HK4 A;  1W6C A;  1MWR A;  5CF1 A;  4FCJ A;  1Q81 4;  1BRS A;  1I2G A;  4K61 A;  4HM8 B;  1NB5 I;  2OTL 3;  1DE3 A;  1YGW A;  2MC8 A;  3EQQ B;  1JB4 A;  1NU3 A;  1GOY A;  1W6G A;  1IT7 A;  3GWR A;  4K1V A;  1UGH I;  4HM7 B;  4KFE A;  4R1K A;  5AIG A;  4AKZ A;  3BB9 A;  2P05 A;  4FMA A;  4MMZ B;  5DRE A;  2GXF A;  1E97 A;  5A0O B;  2CWT A;  4N6L A;  1T3B A;  1LOV A;  2ZDJ A;  1B2S A;  1IQY A;  1U5O A;  1LVN A;  4FMC A;  2ZL8 A;  1CQS A;  1OCV A;  5AIF A;  1YJ9 3;  3KN4 A;  1QMA A;  4U13 A;  1PFP A;  3FG1 A;  4WYK B;  1LNI A;  2D1W A;  3FKA A;  5IF6 A;  1U8C B;  5D81 A;  3SXX A;  5JBS A;  1E3V A;  2Z76 A;  1ISK A;  2YFI B;  7RNT A;  3NV0 B;  2CW9 A;  4MJD A;  2P09 A;  1KSI A;  3NQZ A;  1RN1 A;  1T2H A;  3GZY B;  1UCK A;  1BNJ A;  3AGN A;  3FG3 A;  1MOL A;  1IVW A;  1IK3 A;  1I3I A;  3G4S 3;  2F86 B;  3CME 3;  1MWS A;  3EBY A;  3UJM A;  2P0X A;  1HKX A;  3D4A A;  3EC9 A;  1UUW B;  3LT9 A;  2BHM A;  5IW9 A;  1O7W B;  1SPU A;  3LH4 A;  1IV7 A;  1D6Z A;  3ECF A;  1Y4K A;  2W9Q A;  4J9A A;  1IQX A;  1LOW A;  2Z6B A;  4GHO A;  3SED A;  2B24 B;  2YFJ B;  1MWU A;  5AIH A;  3U1W A;  5DRV A;  3T0U A;  3OWY A;  3NX0 A;  2K0M A;  1GSP A;  3BND A;  5BXQ A;  3CCS 3;  1QVG 2;  1K73 4;  1BRI A;  1UCL A;  3JUN A;  1UCJ A;  2CH9 A;  2CX1 A;  3JVC A;  1UGI A;  3MYT A;  1YJN 3;  1VQL 3;  1D6U A;  3RGR A;  1IT8 A;  1Q7H A;  2CFK A;  2JQ5 A;  4J5K A;  3WA2 X;  1NJI 4;  2RCD A;  3D79 A;  1MGW A;  4N6T A;  4R9L A;  2STD A;  3DXO A;  1JKG B;  4EBG A;  1BSA A;  2B1X B;  3CPO A;  4NPB A;  3JUM A;  4HAA A;  3S5C A;  2MF7 A;  2Q07 A;  4EV2 A;  1AY7 A;  3MWZ A;  4LGQ A;  4MMX B;  3B8L A;  3E99 A;  3EHC A;  2CWU A;  2L4V A;  3DGN A;  3EJV A;  3G16 A;  4KFF A;  1O7N B;  5RNT A;  2UUG C;  3MG1 A;  3ROB A;  1O7P B;  2BO9 B;  1SQW A;  1T2I A;  2E2V A;  1VQQ A;  4MMY B;  1W2Z A;  1OHP A;  2IMJ A;  5CLK A;  6STD A;  1OGZ A;  3G71 3;  1LOX A;  1GD4 A;  1OF5 B;  3GZB A;  4JF8 A;  5I97 A;  2C11 A;  1B27 A;  2CKF B;  3CNM A;  3X3Z A;  4AKY A;  4ZM8 A;  3VF1 A;  3RGA A;  5EQL A;  5IG4 A;  1GS3 A;  1OAC A;  1JZD A;  3NM7 A;  3CCR 3;  1N5H A;  5AYR B;  1WQL B;  2F5W A;  1N8R 4;  3OXA A;  1Q42 A;  2QIY A;  3F8H A;  1YJW 3;  5G1K A;  2AAD A;  4KT3 B;  1QJG A;  2XRX B;  4EC6 A;  1LRA A;  1BRG A;  2HOH A;  2GEY A;  4HVN A;  1GOU A;  1BSE A;  2Y73 A;  4IT7 A;  5JPP A;  1ROA A;  1DET A;  1ROV A;  1VQO 3;  3CPW 2;  1TUH A;  3WHO A;  2RGQ A;  1LNH A;  1RGK A;  1BSD A;  4WYK A;  1HU9 A;  1K8A 4;  5AEU B;  4N6N B;  1RN7 A;  1WNH A;  1BSB A;  2F56 A;  2LQV A;  3LTD A;  3NV0 A;  1AR0 A;  1RMS A;  1B2U A;  5BVB A;  1TFK A;  1O7G B;  4L8O A;  5HGR A;  4HZB B;  5G2G A;  2OOV C;  3GSP A;  2GBX B;  3HZP A;  3UB1 A;  4CDL A;  1BOX A;  1LXE A;  2XEP A;  3DMC A;  1PU4 A;  3F14 A;  4J5G A;  4ORL A;  1VQP 3;  4Q53 A;  1SJW A;  2WGO A;  1JJ2 2;  1RGH A;  1UI7 A;  1A2K A;  1OUN A;  2OQE C;  3M8C A;  3SYU A;  3BIR A;  1FZU A;  3CC2 3;  1JN5 B;  2AAE A;  2I9W A;  1FW7 A;  2BNG A;  5FGO A;  1VQM 3;  1YIT 3;  4FCM A;  5AYS C;  3LZA A;  1M1X B;  1RGA A;  1TRP A;  1Q86 4;  2XGL A;  4CJN A;  4WP5 A;  1BNE A;  1UI8 A;  2IY2 A;  2W9P A;  3UL5 A;  1QVF 2;  3G6E 3;  1I2F A;  2BMR B;  1I70 A;  3NBB A;  2F4Y A;  2QEX 3;  1LOY A;  3LTA A;  1NNV A;  3FH1 A;  1I8V A;  1IV9 A;  1JKG A;  2SAR A;  5IG3 A;  4GB5 A;  1S72 3;  2JDI H;  4WFO A;  1GYB A;  1BUJ A;  4L7K A;  1Q9E A;  2FXT A;  3K5T A;  1BNR A;  4LEH A;  4LSO A;  1YI2 3;  1W2B 2;  4XBX A;  5M18 A;  1A67 A;  2WOH A;  3SLU A;  2KRT A;  1RDS A;  1CYU A;  1KC8 4;  1OF5 A;  1FUS A;  1S5A A;  3D9R A;  1KWI A;  3X3Y A;  2HMJ B;  3N54 B;  1BRH A;  3SX1 A;  3ZG0 A;  1YVS A;  3CCM 3;  3EN8 A;  2HMM B;  4QWT A;  4RNY A;  3K63 A;  2V1L A;  3KII A;  4CPK A;  3EE1 A;  1AVK A;  3B7C A;  3WMD A;  3D5G A;  1BU4 A;  3D5I A;  3IMA B;  4BTW A;  3MSO A;  5KP1 A;  4GSP A;  3CCL 3;  1ASK A;  2K54 A;  2P38 A;  4XB5 A;  3T8N A;  3UNL A;  1B21 A;  1OPY A;  2HMO B;  1TRQ A;  3L0R A;  1V57 A;  1UDI I;  5IG0 A;  3K9M C;  1N5P A;  1NWW A;  2IA7 A;  3LYG A;  1I0X A;  5LC6 A;  1FGT A;  1OH0 A;  2BMQ B;  2XSH B;  3FCS B;  1EQK A;  9RNT A;  2XFS A;  1FUW A;  4JRF A;  3FG4 A;  1DYU A;  2O9U X;  1WTH A;  3G0K A; 
#chains in the Genus database with same CATH homology
 1X1U A;  1BNG A;  1PY3 A;  1B27 A;  1JBR A;  3URP A;  1CH0 A;  1G02 A;  1RGL A;  3HOH A;  1BNS A;  2F5W A;  5HOH A;  1RNB A;  7GSP A;  1YNV X;  1SAR A;  1HYF A;  1X1Y A;  2AAD A;  4BU4 A;  1RN4 A;  1LRA A;  1BRG A;  5BIR A;  2HOH A;  1R4Y A;  1GOU A;  1RLS A;  1BSE A;  2RBI A;  3BU4 A;  1PYL A;  1RTU A;  1DET A;  1X1W A;  1B3S A;  2KF5 A;  2RNT A;  3WHO A;  1RGK A;  1BAN A;  1BSD A;  1FYS A;  3RNT A;  1BSB A;  2F56 A;  1I0V A;  1RHL A;  3A5E A;  1RMS A;  1B2U A;  1UCI A;  1RSN A;  4HOH A;  1BRS A;  1I2G A;  3GSP A;  1BOX A;  4J5G A;  1RGF A;  1BNI A;  1C54 A;  1DE3 A;  1YGW A;  1GOY A;  1ZGX A;  1RGH A;  4BIR A;  1AQZ A;  1JBS A;  1B2Z A;  1GOV A;  3SYU A;  3BIR A;  1FZU A;  1LOV A;  1RGC A;  1HZ1 A;  3AHW A;  3DH2 A;  1GMR A;  1RNT A;  1B2S A;  2AAE A;  1FW7 A;  1RGA A;  1TRP A;  6RNT A;  1BIR A;  1GMP A;  1BNE A;  1B2M A;  1LNI A;  1I2F A;  1RGG A;  2C4B A;  1I70 A;  1BRN L;  2F4Y A;  1B2X A;  1GMQ A;  1MGR A;  2KF4 A;  1LOY A;  5GSP A;  2F5M A;  7RNT A;  8RNT A;  1BVI A;  2BU4 A;  1I8V A;  2SAR A;  1RN1 A;  1T2H A;  1UCK A;  1BNJ A;  3AGN A;  6GSP A;  3AHS A;  1RCL A;  3WR2 A;  1I3I A;  3DGY A;  1BUJ A;  2KF6 A;  1Q9E A;  3D4A A;  1BRK A;  1BNR A;  1X1X A;  1LOW A;  4GHO A;  1RDS A;  1FUS A;  2BIR A;  1BRH A;  3Q3F A;  5BU4 A;  1YVS A;  1GSP A;  1FUT A;  1BAO A;  2KF3 A;  1RGE A;  1BRI A;  1UCL A;  1UCJ A;  1JBT A;  3D5G A;  1BU4 A;  1BGS A;  3D5I A;  4GSP A;  4J5K A;  1BNF A;  1I3F A;  1TTO A;  1BRJ A;  1MGW A;  1B21 A;  1RCK A;  1A2P A;  1BSA A;  1TRQ A;  2ZA4 A;  4HAA A;  1AY7 A;  1I0X A;  4RNT A;  1IYY A;  3AGO A;  9RNT A;  5RNT A;  2KAA A;  1B20 A;  1T2I A;  1BSC A;  2GSP A;  3KCH A;  1I2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...