4HAAA

Structure of ribonuclease binase glu43ala/phe81ala mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAAVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGARNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional studies of the ribonuclease binase Glu43Ala/Phe81Ala mutant.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4haaA00
1RGLA 1HZ1A 1RDSA 1JBTA 3A5EA 8RNTA 1B2UA 1B2MA 1TRQA 1BRJA 2GSPA 1I0XA 1GMRA 7RNTA 1B20A 1GMQA 1X1WA 1GOYA 1RN4A 1BNEA 1GMPA 1RGFA 2F56A 1LRAA 2KF4A 1I2EA 3AHSA 4GSPA 3Q3FA 1T2HA 1RN1A 3KCHA 2F5MA 1BVIA 1GOUA 1T2IA 3BU4A 6RNTA 1UCJA 1PYLA 2C4BA 1BSCA 1RLSA 2AADA 1CH0A 1FUSA 3SYUA 2ZA4A 1BNIA 3WR2A 4BU4A 1BSAA 1I2FA 2HOHA 1BNJA 1LNIA 1B2ZA 1AQZA 2SARA 1I70A 1B2XA 1DE3A 1RGCA 6GSPA 1I3IA 5GSPA 1B27A 1BANA 1I2GA 1RGHA 1BUJA 2BU4A 1BIRA 1LOWA 1UCKA 3AGNA 1UCLA 2KF3A 1YNVX 1BRHA 9RNTA 3DH2A 4J5GA 1BNFA 1Q9EA 1MGRA 1RHLA 1ZGXA 1BRGA 2KF6A 4J5KA 7GSPA 3D5IA 1RMSA 1LOVA 1BAOA 1X1UA 3AGOA 4HAAA 1JBRA 1FZUA 1FYSA 1FUTA 3WHOA 1BNGA 2AAEA 2F4YA 1RGEA 1BGSA 1BRSA 1TTOA 1RGKA 3AHWA 1I3FA 1DETA 2KAAA 5BU4A 5HOHA 1RTUA 1TRPA 1BSBA 1YVSA 1RGGA 3GSPA 1R4YA 2RBIA 1BSDA 1HYFA 2BIRA 1AY7A 3HOHA 1BRKA 5BIRA 1JBSA 1RCKA 1SARA 1BNRA 1BSEA 1C54A 1MGWA 1RGAA 1X1YA 1I0VA 1YGWA 1GOVA 5RNTA 1BU4A 1PY3A 2KF5A 2RNTA 1FW7A 3URPA 4GHOA 1UCIA 3BIRA 3D4AA 1RCLA 1A2PA 1BRNL 1I8VA 4RNTA 1BOXA 1RSNA 1BNSA 1G02A 2F5WA 1BRIA 4BIRA 3RNTA 1B2SA 1GSPA 1X1XA 1RNBA 3D5GA 1IYYA 3DGYA 1B21A 1B3SA 1RNTA 4HOHA 1LOYA
chains in the Genus database with same CATH superfamily
1NB3I 3E99A 3RGRA 2WOHA 2B1XB 3A5EA 8RNTA 2RCDA 4XM4A 1JV2B 1MWSA 1A2VA 3IPTA 5AIGA 2XFSA 1NB5I 2PZVA 1FGTA 4XDVA 3B8LA 3QRDA 1RN4A 1SIHA 1BNEA 1GMPA 2F56A 3MSOA 3QK9A 1LRAA 2KF4A 5EEOA 1WTHA 2XSHB 1RN1A 2P05A 3K0ZA 3KCHA 2F5MA 4U13A 5ELJA 1T2IA 3JUMA 1MNLA 3BNCA 2H0IA 3EQQB 3GAXA 1UCJA 3DUKA 3SOYA 1BSCA 1RLSA 1FA3A 1ZS7A 4DKIA 1FUSA 1OHSA 2HMOB 3DY5A 3WR2A 1U5OA 3X3XA 2HOHA 4N6OB 2J8XB 3DMCA 1B2ZA 1TP6A 1UGHI 1AQZA 2XRXB 1I70A 2XSOB 4TX4A 5AEWB 1R4CA 2CC3A 1VQM3 1V58A 5IEOA 3UJMA 1I2GA 1BUJA 1GY6A 2OCTA 3SXXA 4HM7B 1JN5A 3LT8A 4FMDA 2IY2A 1WQLB 4MMXB 1W02A 5D82A 1JRQA 2INXA 3D3LA 3KKGA 7GSPA 3PGBA 4CCVA 3EN8A 1WMOA 1ZX2A 1VQQA 3FG1A 1JBRA 1S723 2XEPA 4O02B 1JKGB 1PFPA 1W6GA 1KWIA 1F8NA 4J9AA 3I563 4CDLA 2L1SA 1QMAA 2Q07A 4H61A 1Q824 3LT9A 2CK3H 5BU4A 3SX1A 2O9UX 2FXTA 1NNVA 1RTUA 1DVCA 5G1KA 2HMKB 3CME3 3BNEA 2OOVA 1K9M4 1W7CA 3CCE3 3GZXB 1ZO2A 2P0XA 5DRVA 1T3BA 1IV9A 3FF2A 1BSDA 2ML6A 2WGQA 3S27A 1WMPA 4K90B 1BRKA 3S67A 5BIRA 3WOEB 1IVXA 1AVLA 1STDA 3GZYB 2LYXA 1BSEA 5CK6A 1HU9A 5A0OB 1E3VA 1YIT3 3DZLA 3DGMA 1DVDA 1S5AA 2CFGA 1W01A 4HM5B 1UUVB 4FCMA 2BHMA 4OUQA 2IMJA 5JPUA 3BNBA 4HVNA 4MJDA 1TU5A 1UCIA 3CCS3 4WP5A 4HBRA 3CC23 1IVVA 1I8VA 1W4NA 4WYKB 1N5PA 2F99A 1NJI4 2RSXA 2P38A 1G02A 3MWZA 2F5WA 3FSDA 1IQ8A 3BNDA 1IV7A 3F40A 3LTAA 1VQ73 1KC84 1B2SA 3SVAA 1QAKA 2OQEC 1FGQA 3J7Yd 1IT7A 4RNZA 3D9RA 3BB9A 1UUGB 4QWTA 1B21A 2H0GA 4AKYA 1A67A 1OGZA 3CCJ3 5CXOA 1YGWA 4FMCA 1HZ1A 1RDSA 3WMDA 2R4IA 3LH4A 3HK4A 1B2MA 4N6MA 2RFRA 1VQ63 3LTDA 1BRJA 3FG4A 1I0XA 1GMRA 2KCDA 1M1K4 3KIIA 2HMLB 1HKXA 2STDA 1IU7A 3EN1B 3NUVA 4G1MB 2CHCA 1GOYA 5AYSC 1O7MB 4R4KA 1I2EA 1EG9B 2CFDA 2JQ5A 1ULIB 3Q3FA 5M18A 1OF5A 4KFFA 4BL3A 1BVIA 3OW22 1VQL3 2CFKA 3PXMA 1D6UA 1EQKA 1PYLA 3F8XA 4BL2A 1Q864 3WOFB 1UDII 1V57A 4HM1B 4BTYA 1YI23 3G16A 5IW9A 3JUOA 2XGLA 2ZA4A 3G4S3 4BU4A 1BSAA 4OK0A 1LNIA 1LVNA 3CXC2 1EA2A 3EJVA 1B2XA 3HI7A 3G713 1U8CB 2Z76A 3WA3A 1YHQ3 2P0MA 3F9SA 1QALA 3PCRA 3FCSB 1K41A 4MMYB 3I0YA 4XBYA 3SEDA 1RGHA 2W56A 1FUWA 1N9JA 3D79A 1G0TA 2BU4A 2BO9B 4XBTA 1ASKA 3UL5A 3X3YA 5AEUB 2GEXA 1UCKA 1RRHA 1OH0A 2KF3A 1O7HB 4RBNA 5AI1A 1IVWA 3ER7A 1YNVX 3CCL3 1RKYA 6STDA 4MMZB 4X2OA 3DH2A 4FMBA 5IF6A 2OTJ3 3CNMA 5AIIA 2GBWB 1AR0A 1GY5A 1LOXA 2L4VA 4HM3B 1VQ83 2CWTA 1EEJA 3FH1A 1LOVA 3T8UA 1QJGA 4EXRA 3CD63 1CQSA 1UUWB 2OOVC 3STDA 2CG1A 5LC7A 1FUTA 5IEPA 3WHOA 3B4PA 3KZTA 4EC6A 2F4YA 3Q1CA 3FG3A 4IPBA 4LYLB 1LQGC 4K1UA 1MWTA 1MWUA 1BRSA 4HM8B 3MHEA 1I3FA 1MOLA 1DETA 2KAAA 2XGNA 1MWRA 5CLKA 1BSBA 5IERA 1YVBI 3JUQA 1FGOA 5EQLA 2IA7A 4LGQA 1SPUA 3GSPA 8CHOA 3Q90A 3F8HA 4HZBB 4HM4B 1W00A 1W5ZA 2W6JH 1A90A 2QEX3 1JJ22 1RCKA 1YJN3 3G8ZA 4NREA 1A2KA 3V99A 2A15A 3H51A 1O7PB 1C54A 4L8OA 3VSYA 3WDGB 1JB2A 1I0VA 4L7KA 2CW9A 2FGTA 1GOVA 4WHAA 1K8A4 1GYBA 3CCQ3 1D6YA 2RNTA 1YIJ3 1CYVA 4KFEA 1FW7A 3URPA 5KP1A 3CCR3 3BIRA 3D4AA 3EE1A 1GD4A 5BXQA 4AEQA 2CG0A 1BNSA 2UX0A 4I5QA 5KP4A 4RNYA 2P09A 1EKMA 1BRIA 3CPOA 1YGEA 1EUIC 2CX1A 1L5GB 2ZDJA 1X1XA 1Z1SA 1JN5B 3KN4A 4ILFA 3DM8A 1JZOA 3DGNA 3V98A 1IYYA 3DGYA 3GZBA 2Z77A 3KE7A 1B3SA 1IQYA 2CKFB 5CF1A 2Z6BA 4KVHA 3LTBA 4GL6A 4HOHA 1RGLA 3A76A 1KQS2 1FGMA 1W6YA 2F98A 3DXOA 2MF7A 3EC9A 3VGNA 1TRQA 4XDWA 5JBSA 2D1WA 3HX8A 3NM2A 7RNTA 1JKGA 2QIYA 1LQMB 1B20A 1GMQA 3UNLA 3FF0A 4R1KA 3CMA3 1WMNA 2IUKA 3GZRA 3LMLA 1T2HA 2QGUA 1T5YA 1O7WB 2CWVA 2K3DA 1GOUA 3GRDA 2RGQA 3BU4A 5D83A 2W9QA 1IDPA 2SBLA 3SOAA 1BUQA 2CH9A 2OTL3 4RZMA 3RDEA 1OGXA 3SYUA 2HMMB 1BNIA 1KD14 1I2FA 3I553 1BNJA 2BT3A 3NBRA 3EHCA 1DE3A 1Q814 1UI7A 1E97A 1W2ZA 1O7NB 2XF3A 2W04A 5IG5A 4L8PA 4HM2B 4K1VA 4BTXA 4XB5A 3EX9A 2LQVA 4FR9A 3B7CA 3UL6A 1BIRA 1KSIA 3NM7A 1VZZA 1LOWA 2W0QA 4GB5A 1W6CA 1LXEA 1Q7HA 3H3HA 1ROVA 3IMAB 1BRHA 4X2HA 3U97A 9RNTA 1TFOA 3LTCA 2YFLB 4O3VA 1TUHA 1BNFA 2Y73A 1MGRA 1RHLA 1ZGXA 1BRGA 2E2TA 2KF6A 4J5KA 3WODG 1YJ93 1NWWA 3D5IA 1N9EA 4NHFA 5EVHA 1VQK3 5FGOA 1UW1A 2XFTA 1X1UA 3G6E3 1FZUA 4N3VA 4EYCA 1FYSA 3RGAA 4R80A 5HGRA 5CF2A 2IYJA 1AV4A 2YX9A 3JVCA 1BNGA 2D42A 2K54A 3CU3A 3N54B 1QAFA 1RGEA 3NQYA 3O8YA 4HM6B 4JRFA 1TTOA 2HMJB 5D81A 5FW5A 5LC6A 3LXUX 1RGKA 4N6UA 3MPHA 1QVF2 3LOYA 1SQWA 3ZFZA 3L0RA 1G96A 4KZ1A 1Y4KA 1YVSA 2F86B 1RGGA 1NO3A 1UI8A 3AMOB 3K5TA 3KSPA 2ZL8A 5IG3A 1R4YA 1OUNA 2RBIA 4NPBA 5IENA 4R9KA 1E3RA 4MEIA 4XBXA 3HOHA 1VQO3 3EBYA 5AIHA 3ROBA 3NXJA 2BMOB 3S28A 4K61A 1JBSA 1IQXA 1OPYA 3JUPA 2UUGC 3OWYA 2OWPA 1V74A 3KFQC 2B24B 3Q2PA 4OVMA 1N5HA 1X1YA 3M8CA 2GEYA 1BU4A 2KF5A 5JPPA 1TJDA 5BVBA 4GHOA 2BNGA 3IJEB 5AYRB 1BRNL 4RNTA 3OX9A 1BOXA 3F7SA 2GXFA 4H3UA 3CCM3 3EBTA 5TGNA 4HYZA 3OWUA 1OACA 4ORLA 1Q7Y4 2XH9A 1IVUA 3X3ZA 3CCU3 3X42A 4N6NB 3RNTA 2W56B 3NV0A 1STFI 3PCSA 4Q53A 4FCJA 1RNBA 3D5GA 3SLUA 4IIAA 1ISKA 5M19A 3AMOA 1GS3A 1SJWA 1RNTA 2IUJA 1Q40B 3N9HA 5STDA 1GY7A 1C7HA 1LOYA 3OXAA 1UGIA 1JBTA 2C11A 2K0MA 2Z7AA 4ZM8A 1B2UA 1AVKA 1Q42A 2CFLA 3PS8A 3WA2X 2GBXB 2GSPA 1FGRA 4CPKA 1X1WA 2CX0A 4IT7A 2KRTA 1RGFA 2MC8A 3GWRA 4N6LA 1CEWI 1OHPA 3JUNA 4LEHA 1VQ43 1US1A 3AHSA 3ALAA 4GSPA 3HIIA 3K9MC 3NBJA 1DMMA 2YFIB 6RNTA 1M1XB 1TIJA 2C4BA 2E2UA 2HMNB 4LMIA 4N6V0 2AADA 1CH0A 2XR8B 4JF8A 4HM0B 1JZDA 4PEJA 5DREA 2UGIA 1VQ93 1J2BA 3CPW2 2WOFA 2SARA 4WYKA 2OQEA 1RGCA 2M7OA 3T0UA 1I3IA 1JNQA 5GSPA 6GSPA 1WNHA 3PYJA 3FZWA 3CCV3 1O7GB 1B27A 4LZIA 5G2GA 1BANA 2KXGA 2R41A 3LYGA 2BMQB 2BMRB 3AGNA 1DMNA 1UCLA 3F14A 1ROAA 3F7XA 2H0HA 3N8BA 1GD3A 3MG2A 3KSED 4J5GA 1Q9EA 2ML5A 1OCVA 3OV4A 3CNXA 3DGOA 4I4KA 3TDGA 3X40A 1RMSA 5M1AA 1YJW3 3NV0B 1IK3A 3VF1A 1BAOA 3AGOA 2E2VA 4HAAA 1JB4A 2ZHXB 3T8NA 3HIGA 4N6TA 2CIUA 5IG4A 2GU1A 7STDA 1DMQA 2AAEA 4EV2A 3CC73 1BGSA 4WFOA 2W2CA 2W9PA 4AKZA 1M9GA 3AHWA 2CWUA 5IG0A 5HOHA 3DGLA 3LZAA 3BLZA 3MKIA 3NQZA 2V1LA 1OF5B 1TRPA 4LSOA 4EV5A 1VQN3 3S29A 2QA43 1QVG2 1M904 1VQ53 4J8TA 1DYUA 2GU3A 2JDIH 4O2HA 4EW5A 1HYFA 1Q40A 2BIRA 1AY7A 1OHOA 3MYTA 3FGYA 1RRLA 4EBGA 1N8QA 3EB8A 2PNCA 2Y74A 1NU3A 1SARA 1BNRA 3NHXA 3UB1A 3G0KA 4KT3B 1RN7A 2YFJB 3ECFA 1LNHA 1N8R4 1MGWA 1RGAA 3V92A 4BTWA 1D6ZA 3PZWA 2FNQA 3MG3A 5RNTA 1PY3A 1NDOB 4FMAA 1VQP3 1CYUA 2WO0A 4STDA 1K28A 1RCLA 1A2PA 2CFWA 4WWUC 3S5CA 3X41A 4FCZA 1RSNA 3FLJA 4O8SA 2WGOA 1K734 4HJLB 4CJNA 3NBBA 1PU4A 5I97A 4BIRA 3K7CA 1JB5A 1W2B2 2I9WA 3ZG5A 4HZ9B 3FKAA 1GSPA 3HZPA 5G1LA 3K63A 4R9LA 3EF8A 1ULJB 3NX0A 3U1WA 5KP3A 3CC43 3MG1A 1RJOA 1SIIA 4HKVB 1IT8A 4KFDA 1TFKA 2W03A 3B4OA 2C10A 5ELUA 3ZG0A 5AIFA 3OWSA 2O3OA
chains in the Genus database with same CATH topology
1RGLA 1HZ1A 1RDSA 1JBTA 3A5EA 8RNTA 1B2UA 1B2MA 1TRQA 1BRJA 2GSPA 1I0XA 1GMRA 7RNTA 1B20A 1GMQA 1X1WA 1GOYA 1RN4A 1BNEA 1GMPA 1RGFA 2F56A 1LRAA 2KF4A 1I2EA 3AHSA 4GSPA 3Q3FA 1T2HA 1RN1A 3KCHA 2F5MA 1BVIA 1GOUA 1T2IA 3BU4A 6RNTA 1UCJA 1PYLA 2C4BA 1BSCA 1RLSA 2AADA 1CH0A 1FUSA 3SYUA 2ZA4A 1BNIA 3WR2A 4BU4A 1BSAA 1I2FA 2HOHA 1BNJA 1LNIA 1B2ZA 1AQZA 2SARA 1I70A 1B2XA 1DE3A 1RGCA 6GSPA 1I3IA 5GSPA 1B27A 1BANA 1I2GA 1RGHA 1BUJA 2BU4A 1BIRA 1LOWA 1UCKA 3AGNA 1UCLA 2KF3A 1YNVX 1BRHA 9RNTA 3DH2A 4J5GA 1BNFA 1Q9EA 1MGRA 1RHLA 1ZGXA 1BRGA 2KF6A 4J5KA 7GSPA 3D5IA 1RMSA 1LOVA 1BAOA 1X1UA 3AGOA 4HAAA 1JBRA 1FZUA 1FYSA 1FUTA 3WHOA 1BNGA 2AAEA 2F4YA 1RGEA 1BGSA 1BRSA 1TTOA 1RGKA 3AHWA 1I3FA 1DETA 2KAAA 5BU4A 5HOHA 1RTUA 1TRPA 1BSBA 1YVSA 1RGGA 3GSPA 1R4YA 2RBIA 1BSDA 1HYFA 2BIRA 1AY7A 3HOHA 1BRKA 5BIRA 1JBSA 1RCKA 1SARA 1BNRA 1BSEA 1C54A 1MGWA 1RGAA 1X1YA 1I0VA 1YGWA 1GOVA 5RNTA 1BU4A 1PY3A 2KF5A 2RNTA 1FW7A 3URPA 4GHOA 1UCIA 3BIRA 3D4AA 1RCLA 1A2PA 1BRNL 1I8VA 4RNTA 1BOXA 1RSNA 1BNSA 1G02A 2F5WA 1BRIA 4BIRA 3RNTA 1B2SA 1GSPA 1X1XA 1RNBA 3D5GA 1IYYA 3DGYA 1B21A 1B3SA 1RNTA 4HOHA 1LOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGL A;  1HZ1 A;  1RDS A;  1JBT A;  3A5E A;  8RNT A;  1B2U A;  1B2M A;  1TRQ A;  1BRJ A;  2GSP A;  1I0X A;  1GMR A;  7RNT A;  1B20 A;  1GMQ A;  1X1W A;  1GOY A;  1RN4 A;  1BNE A;  1GMP A;  1RGF A;  2F56 A;  1LRA A;  2KF4 A;  1I2E A;  3AHS A;  4GSP A;  3Q3F A;  1T2H A;  1RN1 A;  3KCH A;  2F5M A;  1BVI A;  1GOU A;  1T2I A;  3BU4 A;  6RNT A;  1UCJ A;  1PYL A;  2C4B A;  1BSC A;  1RLS A;  2AAD A;  1CH0 A;  1FUS A;  3SYU A;  2ZA4 A;  1BNI A;  3WR2 A;  4BU4 A;  1BSA A;  1I2F A;  2HOH A;  1BNJ A;  1LNI A;  1B2Z A;  1AQZ A;  2SAR A;  1I70 A;  1B2X A;  1DE3 A;  1RGC A;  6GSP A;  1I3I A;  5GSP A;  1B27 A;  1BAN A;  1I2G A;  1RGH A;  1BUJ A;  2BU4 A;  1BIR A;  1LOW A;  1UCK A;  3AGN A;  1UCL A;  2KF3 A;  1YNV X;  1BRH A;  9RNT A;  3DH2 A;  4J5G A;  1BNF A;  1Q9E A;  1MGR A;  1RHL A;  1ZGX A;  1BRG A;  2KF6 A;  4J5K A;  7GSP A;  3D5I A;  1RMS A;  1LOV A;  1BAO A;  1X1U A;  3AGO A;  4HAA A;  1JBR A;  1FZU A;  1FYS A;  1FUT A;  3WHO A;  1BNG A;  2AAE A;  2F4Y A;  1RGE A;  1BGS A;  1BRS A;  1TTO A;  1RGK A;  3AHW A;  1I3F A;  1DET A;  2KAA A;  5BU4 A;  5HOH A;  1RTU A;  1TRP A;  1BSB A;  1YVS A;  1RGG A;  3GSP A;  1R4Y A;  2RBI A;  1BSD A;  1HYF A;  2BIR A;  1AY7 A;  3HOH A;  1BRK A;  5BIR A;  1JBS A;  1RCK A;  1SAR A;  1BNR A;  1BSE A;  1C54 A;  1MGW A;  1RGA A;  1X1Y A;  1I0V A;  1YGW A;  1GOV A;  5RNT A;  1BU4 A;  1PY3 A;  2KF5 A;  2RNT A;  1FW7 A;  3URP A;  4GHO A;  1UCI A;  3BIR A;  3D4A A;  1RCL A;  1A2P A;  1BRN L;  1I8V A;  4RNT A;  1BOX A;  1RSN A;  1BNS A;  1G02 A;  2F5W A;  1BRI A;  4BIR A;  3RNT A;  1B2S A;  1GSP A;  1X1X A;  1RNB A;  3D5G A;  1IYY A;  3DGY A;  1B21 A;  1B3S A;  1RNT A;  4HOH A;  1LOY A; 
#chains in the Genus database with same CATH topology
 1NB3 I;  3E99 A;  3RGR A;  2WOH A;  2B1X B;  3A5E A;  8RNT A;  2RCD A;  4XM4 A;  1JV2 B;  1MWS A;  1A2V A;  3IPT A;  5AIG A;  2XFS A;  1NB5 I;  2PZV A;  1FGT A;  4XDV A;  3B8L A;  3QRD A;  1RN4 A;  1SIH A;  1BNE A;  1GMP A;  2F56 A;  3MSO A;  3QK9 A;  1LRA A;  2KF4 A;  5EEO A;  1WTH A;  2XSH B;  1RN1 A;  2P05 A;  3K0Z A;  3KCH A;  2F5M A;  4U13 A;  5ELJ A;  1T2I A;  3JUM A;  1MNL A;  3BNC A;  2H0I A;  3EQQ B;  3GAX A;  1UCJ A;  3DUK A;  3SOY A;  1BSC A;  1RLS A;  1FA3 A;  1ZS7 A;  4DKI A;  1FUS A;  1OHS A;  2HMO B;  3DY5 A;  3WR2 A;  1U5O A;  3X3X A;  2HOH A;  4N6O B;  2J8X B;  3DMC A;  1B2Z A;  1TP6 A;  1UGH I;  1AQZ A;  2XRX B;  1I70 A;  2XSO B;  4TX4 A;  5AEW B;  1R4C A;  2CC3 A;  1VQM 3;  1V58 A;  5IEO A;  3UJM A;  1I2G A;  1BUJ A;  1GY6 A;  2OCT A;  3SXX A;  4HM7 B;  1JN5 A;  3LT8 A;  4FMD A;  2IY2 A;  1WQL B;  4MMX B;  1W02 A;  5D82 A;  1JRQ A;  2INX A;  3D3L A;  3KKG A;  7GSP A;  3PGB A;  4CCV A;  3EN8 A;  1WMO A;  1ZX2 A;  1VQQ A;  3FG1 A;  1JBR A;  1S72 3;  2XEP A;  4O02 B;  1JKG B;  1PFP A;  1W6G A;  1KWI A;  1F8N A;  4J9A A;  3I56 3;  4CDL A;  2L1S A;  1QMA A;  2Q07 A;  4H61 A;  1Q82 4;  3LT9 A;  2CK3 H;  5BU4 A;  3SX1 A;  2O9U X;  2FXT A;  1NNV A;  1RTU A;  1DVC A;  5G1K A;  2HMK B;  3CME 3;  3BNE A;  2OOV A;  1K9M 4;  1W7C A;  3CCE 3;  3GZX B;  1ZO2 A;  2P0X A;  5DRV A;  1T3B A;  1IV9 A;  3FF2 A;  1BSD A;  2ML6 A;  2WGQ A;  3S27 A;  1WMP A;  4K90 B;  1BRK A;  3S67 A;  5BIR A;  3WOE B;  1IVX A;  1AVL A;  1STD A;  3GZY B;  2LYX A;  1BSE A;  5CK6 A;  1HU9 A;  5A0O B;  1E3V A;  1YIT 3;  3DZL A;  3DGM A;  1DVD A;  1S5A A;  2CFG A;  1W01 A;  4HM5 B;  1UUV B;  4FCM A;  2BHM A;  4OUQ A;  2IMJ A;  5JPU A;  3BNB A;  4HVN A;  4MJD A;  1TU5 A;  1UCI A;  3CCS 3;  4WP5 A;  4HBR A;  3CC2 3;  1IVV A;  1I8V A;  1W4N A;  4WYK B;  1N5P A;  2F99 A;  1NJI 4;  2RSX A;  2P38 A;  1G02 A;  3MWZ A;  2F5W A;  3FSD A;  1IQ8 A;  3BND A;  1IV7 A;  3F40 A;  3LTA A;  1VQ7 3;  1KC8 4;  1B2S A;  3SVA A;  1QAK A;  2OQE C;  1FGQ A;  3J7Y d;  1IT7 A;  4RNZ A;  3D9R A;  3BB9 A;  1UUG B;  4QWT A;  1B21 A;  2H0G A;  4AKY A;  1A67 A;  1OGZ A;  3CCJ 3;  5CXO A;  1YGW A;  4FMC A;  1HZ1 A;  1RDS A;  3WMD A;  2R4I A;  3LH4 A;  3HK4 A;  1B2M A;  4N6M A;  2RFR A;  1VQ6 3;  3LTD A;  1BRJ A;  3FG4 A;  1I0X A;  1GMR A;  2KCD A;  1M1K 4;  3KII A;  2HML B;  1HKX A;  2STD A;  1IU7 A;  3EN1 B;  3NUV A;  4G1M B;  2CHC A;  1GOY A;  5AYS C;  1O7M B;  4R4K A;  1I2E A;  1EG9 B;  2CFD A;  2JQ5 A;  1ULI B;  3Q3F A;  5M18 A;  1OF5 A;  4KFF A;  4BL3 A;  1BVI A;  3OW2 2;  1VQL 3;  2CFK A;  3PXM A;  1D6U A;  1EQK A;  1PYL A;  3F8X A;  4BL2 A;  1Q86 4;  3WOF B;  1UDI I;  1V57 A;  4HM1 B;  4BTY A;  1YI2 3;  3G16 A;  5IW9 A;  3JUO A;  2XGL A;  2ZA4 A;  3G4S 3;  4BU4 A;  1BSA A;  4OK0 A;  1LNI A;  1LVN A;  3CXC 2;  1EA2 A;  3EJV A;  1B2X A;  3HI7 A;  3G71 3;  1U8C B;  2Z76 A;  3WA3 A;  1YHQ 3;  2P0M A;  3F9S A;  1QAL A;  3PCR A;  3FCS B;  1K41 A;  4MMY B;  3I0Y A;  4XBY A;  3SED A;  1RGH A;  2W56 A;  1FUW A;  1N9J A;  3D79 A;  1G0T A;  2BU4 A;  2BO9 B;  4XBT A;  1ASK A;  3UL5 A;  3X3Y A;  5AEU B;  2GEX A;  1UCK A;  1RRH A;  1OH0 A;  2KF3 A;  1O7H B;  4RBN A;  5AI1 A;  1IVW A;  3ER7 A;  1YNV X;  3CCL 3;  1RKY A;  6STD A;  4MMZ B;  4X2O A;  3DH2 A;  4FMB A;  5IF6 A;  2OTJ 3;  3CNM A;  5AII A;  2GBW B;  1AR0 A;  1GY5 A;  1LOX A;  2L4V A;  4HM3 B;  1VQ8 3;  2CWT A;  1EEJ A;  3FH1 A;  1LOV A;  3T8U A;  1QJG A;  4EXR A;  3CD6 3;  1CQS A;  1UUW B;  2OOV C;  3STD A;  2CG1 A;  5LC7 A;  1FUT A;  5IEP A;  3WHO A;  3B4P A;  3KZT A;  4EC6 A;  2F4Y A;  3Q1C A;  3FG3 A;  4IPB A;  4LYL B;  1LQG C;  4K1U A;  1MWT A;  1MWU A;  1BRS A;  4HM8 B;  3MHE A;  1I3F A;  1MOL A;  1DET A;  2KAA A;  2XGN A;  1MWR A;  5CLK A;  1BSB A;  5IER A;  1YVB I;  3JUQ A;  1FGO A;  5EQL A;  2IA7 A;  4LGQ A;  1SPU A;  3GSP A;  8CHO A;  3Q90 A;  3F8H A;  4HZB B;  4HM4 B;  1W00 A;  1W5Z A;  2W6J H;  1A90 A;  2QEX 3;  1JJ2 2;  1RCK A;  1YJN 3;  3G8Z A;  4NRE A;  1A2K A;  3V99 A;  2A15 A;  3H51 A;  1O7P B;  1C54 A;  4L8O A;  3VSY A;  3WDG B;  1JB2 A;  1I0V A;  4L7K A;  2CW9 A;  2FGT A;  1GOV A;  4WHA A;  1K8A 4;  1GYB A;  3CCQ 3;  1D6Y A;  2RNT A;  1YIJ 3;  1CYV A;  4KFE A;  1FW7 A;  3URP A;  5KP1 A;  3CCR 3;  3BIR A;  3D4A A;  3EE1 A;  1GD4 A;  5BXQ A;  4AEQ A;  2CG0 A;  1BNS A;  2UX0 A;  4I5Q A;  5KP4 A;  4RNY A;  2P09 A;  1EKM A;  1BRI A;  3CPO A;  1YGE A;  1EUI C;  2CX1 A;  1L5G B;  2ZDJ A;  1X1X A;  1Z1S A;  1JN5 B;  3KN4 A;  4ILF A;  3DM8 A;  1JZO A;  3DGN A;  3V98 A;  1IYY A;  3DGY A;  3GZB A;  2Z77 A;  3KE7 A;  1B3S A;  1IQY A;  2CKF B;  5CF1 A;  2Z6B A;  4KVH A;  3LTB A;  4GL6 A;  4HOH A;  1RGL A;  3A76 A;  1KQS 2;  1FGM A;  1W6Y A;  2F98 A;  3DXO A;  2MF7 A;  3EC9 A;  3VGN A;  1TRQ A;  4XDW A;  5JBS A;  2D1W A;  3HX8 A;  3NM2 A;  7RNT A;  1JKG A;  2QIY A;  1LQM B;  1B20 A;  1GMQ A;  3UNL A;  3FF0 A;  4R1K A;  3CMA 3;  1WMN A;  2IUK A;  3GZR A;  3LML A;  1T2H A;  2QGU A;  1T5Y A;  1O7W B;  2CWV A;  2K3D A;  1GOU A;  3GRD A;  2RGQ A;  3BU4 A;  5D83 A;  2W9Q A;  1IDP A;  2SBL A;  3SOA A;  1BUQ A;  2CH9 A;  2OTL 3;  4RZM A;  3RDE A;  1OGX A;  3SYU A;  2HMM B;  1BNI A;  1KD1 4;  1I2F A;  3I55 3;  1BNJ A;  2BT3 A;  3NBR A;  3EHC A;  1DE3 A;  1Q81 4;  1UI7 A;  1E97 A;  1W2Z A;  1O7N B;  2XF3 A;  2W04 A;  5IG5 A;  4L8P A;  4HM2 B;  4K1V A;  4BTX A;  4XB5 A;  3EX9 A;  2LQV A;  4FR9 A;  3B7C A;  3UL6 A;  1BIR A;  1KSI A;  3NM7 A;  1VZZ A;  1LOW A;  2W0Q A;  4GB5 A;  1W6C A;  1LXE A;  1Q7H A;  3H3H A;  1ROV A;  3IMA B;  1BRH A;  4X2H A;  3U97 A;  9RNT A;  1TFO A;  3LTC A;  2YFL B;  4O3V A;  1TUH A;  1BNF A;  2Y73 A;  1MGR A;  1RHL A;  1ZGX A;  1BRG A;  2E2T A;  2KF6 A;  4J5K A;  3WOD G;  1YJ9 3;  1NWW A;  3D5I A;  1N9E A;  4NHF A;  5EVH A;  1VQK 3;  5FGO A;  1UW1 A;  2XFT A;  1X1U A;  3G6E 3;  1FZU A;  4N3V A;  4EYC A;  1FYS A;  3RGA A;  4R80 A;  5HGR A;  5CF2 A;  2IYJ A;  1AV4 A;  2YX9 A;  3JVC A;  1BNG A;  2D42 A;  2K54 A;  3CU3 A;  3N54 B;  1QAF A;  1RGE A;  3NQY A;  3O8Y A;  4HM6 B;  4JRF A;  1TTO A;  2HMJ B;  5D81 A;  5FW5 A;  5LC6 A;  3LXU X;  1RGK A;  4N6U A;  3MPH A;  1QVF 2;  3LOY A;  1SQW A;  3ZFZ A;  3L0R A;  1G96 A;  4KZ1 A;  1Y4K A;  1YVS A;  2F86 B;  1RGG A;  1NO3 A;  1UI8 A;  3AMO B;  3K5T A;  3KSP A;  2ZL8 A;  5IG3 A;  1R4Y A;  1OUN A;  2RBI A;  4NPB A;  5IEN A;  4R9K A;  1E3R A;  4MEI A;  4XBX A;  3HOH A;  1VQO 3;  3EBY A;  5AIH A;  3ROB A;  3NXJ A;  2BMO B;  3S28 A;  4K61 A;  1JBS A;  1IQX A;  1OPY A;  3JUP A;  2UUG C;  3OWY A;  2OWP A;  1V74 A;  3KFQ C;  2B24 B;  3Q2P A;  4OVM A;  1N5H A;  1X1Y A;  3M8C A;  2GEY A;  1BU4 A;  2KF5 A;  5JPP A;  1TJD A;  5BVB A;  4GHO A;  2BNG A;  3IJE B;  5AYR B;  1BRN L;  4RNT A;  3OX9 A;  1BOX A;  3F7S A;  2GXF A;  4H3U A;  3CCM 3;  3EBT A;  5TGN A;  4HYZ A;  3OWU A;  1OAC A;  4ORL A;  1Q7Y 4;  2XH9 A;  1IVU A;  3X3Z A;  3CCU 3;  3X42 A;  4N6N B;  3RNT A;  2W56 B;  3NV0 A;  1STF I;  3PCS A;  4Q53 A;  4FCJ A;  1RNB A;  3D5G A;  3SLU A;  4IIA A;  1ISK A;  5M19 A;  3AMO A;  1GS3 A;  1SJW A;  1RNT A;  2IUJ A;  1Q40 B;  3N9H A;  5STD A;  1GY7 A;  1C7H A;  1LOY A;  3OXA A;  1UGI A;  1JBT A;  2C11 A;  2K0M A;  2Z7A A;  4ZM8 A;  1B2U A;  1AVK A;  1Q42 A;  2CFL A;  3PS8 A;  3WA2 X;  2GBX B;  2GSP A;  1FGR A;  4CPK A;  1X1W A;  2CX0 A;  4IT7 A;  2KRT A;  1RGF A;  2MC8 A;  3GWR A;  4N6L A;  1CEW I;  1OHP A;  3JUN A;  4LEH A;  1VQ4 3;  1US1 A;  3AHS A;  3ALA A;  4GSP A;  3HII A;  3K9M C;  3NBJ A;  1DMM A;  2YFI B;  6RNT A;  1M1X B;  1TIJ A;  2C4B A;  2E2U A;  2HMN B;  4LMI A;  4N6V 0;  2AAD A;  1CH0 A;  2XR8 B;  4JF8 A;  4HM0 B;  1JZD A;  4PEJ A;  5DRE A;  2UGI A;  1VQ9 3;  1J2B A;  3CPW 2;  2WOF A;  2SAR A;  4WYK A;  2OQE A;  1RGC A;  2M7O A;  3T0U A;  1I3I A;  1JNQ A;  5GSP A;  6GSP A;  1WNH A;  3PYJ A;  3FZW A;  3CCV 3;  1O7G B;  1B27 A;  4LZI A;  5G2G A;  1BAN A;  2KXG A;  2R41 A;  3LYG A;  2BMQ B;  2BMR B;  3AGN A;  1DMN A;  1UCL A;  3F14 A;  1ROA A;  3F7X A;  2H0H A;  3N8B A;  1GD3 A;  3MG2 A;  3KSE D;  4J5G A;  1Q9E A;  2ML5 A;  1OCV A;  3OV4 A;  3CNX A;  3DGO A;  4I4K A;  3TDG A;  3X40 A;  1RMS A;  5M1A A;  1YJW 3;  3NV0 B;  1IK3 A;  3VF1 A;  1BAO A;  3AGO A;  2E2V A;  4HAA A;  1JB4 A;  2ZHX B;  3T8N A;  3HIG A;  4N6T A;  2CIU A;  5IG4 A;  2GU1 A;  7STD A;  1DMQ A;  2AAE A;  4EV2 A;  3CC7 3;  1BGS A;  4WFO A;  2W2C A;  2W9P A;  4AKZ A;  1M9G A;  3AHW A;  2CWU A;  5IG0 A;  5HOH A;  3DGL A;  3LZA A;  3BLZ A;  3MKI A;  3NQZ A;  2V1L A;  1OF5 B;  1TRP A;  4LSO A;  4EV5 A;  1VQN 3;  3S29 A;  2QA4 3;  1QVG 2;  1M90 4;  1VQ5 3;  4J8T A;  1DYU A;  2GU3 A;  2JDI H;  4O2H A;  4EW5 A;  1HYF A;  1Q40 A;  2BIR A;  1AY7 A;  1OHO A;  3MYT A;  3FGY A;  1RRL A;  4EBG A;  1N8Q A;  3EB8 A;  2PNC A;  2Y74 A;  1NU3 A;  1SAR A;  1BNR A;  3NHX A;  3UB1 A;  3G0K A;  4KT3 B;  1RN7 A;  2YFJ B;  3ECF A;  1LNH A;  1N8R 4;  1MGW A;  1RGA A;  3V92 A;  4BTW A;  1D6Z A;  3PZW A;  2FNQ A;  3MG3 A;  5RNT A;  1PY3 A;  1NDO B;  4FMA A;  1VQP 3;  1CYU A;  2WO0 A;  4STD A;  1K28 A;  1RCL A;  1A2P A;  2CFW A;  4WWU C;  3S5C A;  3X41 A;  4FCZ A;  1RSN A;  3FLJ A;  4O8S A;  2WGO A;  1K73 4;  4HJL B;  4CJN A;  3NBB A;  1PU4 A;  5I97 A;  4BIR A;  3K7C A;  1JB5 A;  1W2B 2;  2I9W A;  3ZG5 A;  4HZ9 B;  3FKA A;  1GSP A;  3HZP A;  5G1L A;  3K63 A;  4R9L A;  3EF8 A;  1ULJ B;  3NX0 A;  3U1W A;  5KP3 A;  3CC4 3;  3MG1 A;  1RJO A;  1SII A;  4HKV B;  1IT8 A;  4KFD A;  1TFK A;  2W03 A;  3B4O A;  2C10 A;  5ELU A;  3ZG0 A;  5AIF A;  3OWS A;  2O3O A; 
#chains in the Genus database with same CATH homology
 1RGL A;  1HZ1 A;  1RDS A;  1JBT A;  3A5E A;  8RNT A;  1B2U A;  1B2M A;  1TRQ A;  1BRJ A;  2GSP A;  1I0X A;  1GMR A;  7RNT A;  1B20 A;  1GMQ A;  1X1W A;  1GOY A;  1RN4 A;  1BNE A;  1GMP A;  1RGF A;  2F56 A;  1LRA A;  2KF4 A;  1I2E A;  3AHS A;  4GSP A;  3Q3F A;  1T2H A;  1RN1 A;  3KCH A;  2F5M A;  1BVI A;  1GOU A;  1T2I A;  3BU4 A;  6RNT A;  1UCJ A;  1PYL A;  2C4B A;  1BSC A;  1RLS A;  2AAD A;  1CH0 A;  1FUS A;  3SYU A;  2ZA4 A;  1BNI A;  3WR2 A;  4BU4 A;  1BSA A;  1I2F A;  2HOH A;  1BNJ A;  1LNI A;  1B2Z A;  1AQZ A;  2SAR A;  1I70 A;  1B2X A;  1DE3 A;  1RGC A;  6GSP A;  1I3I A;  5GSP A;  1B27 A;  1BAN A;  1I2G A;  1RGH A;  1BUJ A;  2BU4 A;  1BIR A;  1LOW A;  1UCK A;  3AGN A;  1UCL A;  2KF3 A;  1YNV X;  1BRH A;  9RNT A;  3DH2 A;  4J5G A;  1BNF A;  1Q9E A;  1MGR A;  1RHL A;  1ZGX A;  1BRG A;  2KF6 A;  4J5K A;  7GSP A;  3D5I A;  1RMS A;  1LOV A;  1BAO A;  1X1U A;  3AGO A;  4HAA A;  1JBR A;  1FZU A;  1FYS A;  1FUT A;  3WHO A;  1BNG A;  2AAE A;  2F4Y A;  1RGE A;  1BGS A;  1BRS A;  1TTO A;  1RGK A;  3AHW A;  1I3F A;  1DET A;  2KAA A;  5BU4 A;  5HOH A;  1RTU A;  1TRP A;  1BSB A;  1YVS A;  1RGG A;  3GSP A;  1R4Y A;  2RBI A;  1BSD A;  1HYF A;  2BIR A;  1AY7 A;  3HOH A;  1BRK A;  5BIR A;  1JBS A;  1RCK A;  1SAR A;  1BNR A;  1BSE A;  1C54 A;  1MGW A;  1RGA A;  1X1Y A;  1I0V A;  1YGW A;  1GOV A;  5RNT A;  1BU4 A;  1PY3 A;  2KF5 A;  2RNT A;  1FW7 A;  3URP A;  4GHO A;  1UCI A;  3BIR A;  3D4A A;  1RCL A;  1A2P A;  1BRN L;  1I8V A;  4RNT A;  1BOX A;  1RSN A;  1BNS A;  1G02 A;  2F5W A;  1BRI A;  4BIR A;  3RNT A;  1B2S A;  1GSP A;  1X1X A;  1RNB A;  3D5G A;  1IYY A;  3DGY A;  1B21 A;  1B3S A;  1RNT A;  4HOH A;  1LOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...