4HAAA

Structure of ribonuclease binase glu43ala/phe81ala mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAAVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGARNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional studies of the ribonuclease binase Glu43Ala/Phe81Ala mutant.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4haaA00
1MGRA 1FUTA 1MGWA 1PYLA 1A2PA 5RNTA 1Q9EA 2KF6A 1I2EA 1TTOA 1BRSA 1B21A 3BU4A 1JBSA 4BIRA 2HOHA 2C4BA 1I2FA 3AGOA 2BU4A 2F5MA 3Q3FA 3AHSA 3SYUA 1YNVX 4HOHA 7GSPA 1FZUA 1UCJA 2RNTA 1LRAA 5BIRA 1TRQA 1I3IA 1DETA 1YVSA 1ZGXA 2KAAA 3DH2A 2BIRA 1LNIA 1RCLA 1BRNL 2KF3A 1B2ZA 1RNBA 1JBRA 2F56A 1BSAA 1BRGA 5GSPA 1BRKA 1LOWA 1R4YA 4BU4A 1BRHA 2AAEA 3BIRA 4HAAA 1YGWA 2GSPA 1BNEA 1RLSA 1I0XA 1RCKA 3D5GA 1GMRA 6GSPA 1GSPA 1X1YA 1X1UA 7RNTA 1DE3A 1TRPA 3WR2A 1BIRA 1IYYA 2F5WA 1I3FA 1UCKA 1BSDA 3D4AA 1B2XA 1GOYA 1RSNA 1BNRA 1RGAA 1RGFA 2ZA4A 2F4YA 6RNTA 1LOVA 1LOYA 3HOHA 1T2HA 9RNTA 1BNGA 1RMSA 3RNTA 1JBTA 1RGHA 1RHLA 1RGCA 5BU4A 3A5EA 1PY3A 3GSPA 1B2UA 3WHOA 1BVIA 2AADA 1RDSA 1BGSA 1I8VA 2RBIA 4GHOA 1B20A 1BOXA 1B27A 1X1WA 1UCLA 4J5GA 1GOVA 1GOUA 1T2IA 1B3SA 1RTUA 4GSPA 1RGLA 1SARA 1BRIA 1RGGA 1RN1A 1GMQA 3URPA 4RNTA 1BSBA 2KF5A 5HOHA 1I0VA 1BNSA 1BNJA 2KF4A 1C54A 1BAOA 1B2SA 1RGKA 8RNTA 1B2MA 1BU4A 1FW7A 4J5KA 1BANA 1CH0A 1G02A 3AGNA 1UCIA 1BSEA 1HZ1A 1AQZA 1BNIA 1BSCA 3DGYA 1BRJA 1RGEA 1RN4A 1GMPA 1I2GA 1FYSA 1BUJA 1BNFA 3AHWA 3KCHA 1HYFA 3D5IA 1I70A 2SARA 1FUSA 1AY7A 1X1XA 1RNTA
chains in the Genus database with same CATH superfamily
3LXUX 5AEUB 4NREA 3U97A 3CCR3 4EV2A 4N6OB 1A2PA 4HM1B 1GY5A 2W9PA 2KF6A 1I2EA 3AMOA 3UB1A 3S5CA 5AIIA 1WQLB 1MNLA 1OPYA 1W00A 2W0QA 1VQ93 2HOHA 5G1KA 3X41A 3X3YA 4BTWA 3SYUA 3LYGA 1VQ83 2ZL8A 3LTCA 4N6V0 2WGQA 1JB5A 4O3VA 2E2TA 4N6NB 3RGAA 1UDII 4EV5A 1OGZA 1A2VA 5IENA 1VQP3 1GD4A 1YVSA 1VQL3 1ZGXA 3OXAA 2KAAA 3FG3A 5FW5A 3GWRA 1LNIA 1YVBI 3PS8A 4WFOA 1BRNL 5TGNA 1U5OA 2OTL3 2IY2A 1RNBA 4HYZA 1BRGA 1C7HA 3D3LA 2PZVA 3T0UA 1R4YA 3G713 4HM6B 4BU4A 1T3BA 5IG5A 2XFSA 1LNHA 3EB8A 2GSPA 3DM8A 1V58A 3E99A 3LZAA 3DGNA 2ZDJA 4MJDA 1OHOA 1GMRA 3PCSA 5AIHA 1O7GB 1LOXA 3PZWA 1D6ZA 1O7PB 1DE3A 3OW22 1TRPA 3NM2A 1JN5A 1BIRA 1OH0A 3UL6A 1BSDA 1B2XA 1RSNA 4EXRA 1BNRA 3KN4A 4I5QA 3EBYA 1LOVA 1TUHA 7STDA 3X40A 3IPTA 4K1VA 3HOHA 9RNTA 3KFQC 5M18A 1VQ63 3NBBA 2XR8B 4GB5A 4KVHA 2CIUA 2YFIB 1K8A4 3H51A 2XSHB 4HM3B 4MMXB 2W56A 1ASKA 2L4VA 1ZX2A 3EQQB 4L8OA 5KP3A 3V92A 4Q53A 1SIIA 2W6JH 1GY7A 1JKGB 1ULIB 1AV4A 1KWIA 2P0MA 3SXXA 4RBNA 1VQM3 3GZRA 1O7MB 1DMMA 5CK6A 4J5GA 4K90B 1GOVA 1A67A 1B3SA 3CPW2 1RGLA 1SARA 1W01A 1W4NA 5AIFA 3URPA 1OCVA 2CFKA 2KF5A 1BNSA 1I0VA 2KF4A 3LTAA 3EBTA 4HM8B 2C11A 4FMBA 3OWUA 3D79A 1Q7HA 3I553 4XBYA 1DYUA 4WHAA 4J5KA 2RGQA 1GS3A 4N3VA 1T5YA 1IVVA 3EN1B 3FH1A 1WTHA 1RRLA 4HM0B 1KD14 1N9JA 1BSEA 1JKGA 2QA43 4LYLB 1V74A 2F99A 3HIGA 1JB2A 3LMLA 1BNIA 3JUPA 3LOYA 3FSDA 3JUQA 2Q07A 1UI7A 1FYSA 3X3ZA 1D6UA 1FGTA 1VQQA 3BLZA 3G16A 3D5IA 4HKVB 4R80A 2P05A 1NWWA 2H0IA 1WMOA 3K0ZA 4GL6A 5KP4A 1SJWA 1Z1SA 4G1MB 3SVAA 4L7KA 1EQKA 4FCJA 1WMPA 5RNTA 3G6E3 1MWTA 3OWSA 3F7XA 4MEIA 3DGLA 4LZIA 2K54A 1G0TA 1Q40A 5G2GA 3UNLA 1AR0A 2D42A 1Q824 1O7WB 1W6GA 3GZXB 3MG1A 2CFDA 2F5MA 2XRXB 5LC7A 3N54B 3SX1A 3FGYA 3G0KA 3CC23 1QJGA 1LRAA 2Y73A 4BTYA 2GBXB 1I3IA 2CWTA 1ROAA 3IJEB 1OUNA 2Y74A 3QK9A 2O9UX 2BIRA 2XFTA 1TU5A 1VQ53 3K9MC 1VQK3 1JBRA 1K41A 2F56A 3JUNA 1RN7A 3CPOA 2OWPA 2F98A 1BRKA 1LOWA 2W03A 3GRDA 3NV0A 3OWYA 4FR9A 3CC43 3AMOB 5CF1A 1A90A 1BRHA 5D83A 3BIRA 1S723 5JBSA 1YGWA 1NU3A 1M904 1KC84 4J8TA 5DRVA 1RLSA 2E2VA 1AVKA 1VQ73 3CCQ3 4RZMA 5IG0A 1EG9B 1UUWB 1YGEA 3I0YA 3NM7A 3CCM3 3CCS3 2OOVC 1X1YA 4EC6A 4IPBA 3KZTA 3WR2A 2GU1A 2HMJB 1MWSA 5CF2A 3EE1A 1QMAA 3F14A 3D4AA 2Z6BA 1GOYA 3DZLA 3F8XA 4N6TA 3WA2X 1STDA 2F4YA 4FMCA 2GXFA 3RGRA 3Q1CA 1IV9A 1RKYA 1QVG2 1DVDA 4J9AA 5IF6A 1YJ93 1UGHI 2QGUA 1T2HA 4LEHA 3V98A 4HM2B 2CG0A 1RMSA 1TFKA 2UGIA 1K734 5JPUA 1CEWI 4H3UA 3NUVA 4I4KA 5BU4A 3MPHA 3A5EA 4XB5A 3NQYA 2XGLA 3GSPA 3S29A 4IIAA 3WHOA 1YJW3 3BNDA 6STDA 4HM5B 1Q40B 3DXOA 4KFFA 5HGRA 4ZM8A 1BOXA 1FUWA 2CHCA 1B27A 1IT7A 1IVWA 1X1WA 3CCU3 2FNQA 1LXEA 2R4IA 3CC73 1T2IA 1UW1A 1GOUA 3EHCA 4GSPA 2GEYA 2I9WA 3MYTA 3SOYA 3EC9A 3JUOA 2HMOB 2Z76A 4TX4A 3EJVA 4XBXA 2BHMA 2V1LA 1K9M4 1B2SA 1G96A 2BMQB 4FMDA 3CCL3 5AIGA 1S5AA 3DY5A 4KFDA 4KZ1A 1SPUA 5IW9A 3FLJA 2YFJB 1FW7A 1TIJA 1Q814 3X42A 1J2BA 1GY6A 2K0MA 3CNMA 3DUKA 5LC6A 2W04A 3AGNA 2Z7AA 4EW5A 1UCIA 1HZ1A 1BRJA 3EN8A 3B8LA 3CNXA 5EEOA 1BUJA 2CG1A 1FGRA 3JUMA 3NX0A 1HYFA 2HMNB 1I70A 1ZS7A 3H3HA 2SARA 1IT8A 3MWZA 1RNTA 5BIRA 1MGRA 2BNGA 1NB5I 1CYUA 1JZOA 4HZBB 1NJI4 1BUQA 4N6MA 1D6YA 1MGWA 2W56B 4QWTA 4XDWA 1Q9EA 3STDA 5AEWB 3S28A 3CU3A 1WNHA 4WYKB 1UUGB 1M9GA 1FA3A 1F8NA 3BNCA 3V99A 2BU4A 3KKGA 3QRDA 3AHSA 2HMMB 1JV2B 3L0RA 5M19A 1N9EA 3FCSB 1N5HA 1W2B2 5CXOA 1FZUA 1UCJA 2W2CA 1OGXA 2K3DA 1MOLA 1TRQA 4EYCA 1DETA 4MMYB 2BMOB 3M8CA 1JJ22 1OF5A 4K61A 4XBTA 3CCE3 1UUVB 3LT8A 3DH2A 4HZ9B 2CW9A 5IERA 1N8QA 1LQGC 3G8ZA 3CME3 1MWUA 4L8PA 4MMZB 1ULJB 4NHFA 1V57A 1B2ZA 1ZO2A 1BSAA 1FGOA 2FXTA 2BT3A 2KCDA 1IU7A 1US1A 1GYBA 3MHEA 3WMDA 2IMJA 3CMA3 2OQEA 4OUQA 3IMAB 3ALAA 3LTDA 1RCKA 2CFGA 3D5GA 3UJMA 1W6CA 6GSPA 2BO9B 1ROVA 1L5GB 1IK3A 1GSPA 1OF5B 2A15A 2HMKB 1PU4A 2B24B 1IYYA 3DMCA 3MSOA 3K63A 3G4S3 1I3FA 1UCKA 3PXMA 1TJDA 4HBRA 1R4CA 2OTJ3 2QIYA 2F86B 2ZA4A 3B7CA 6RNTA 2XEPA 3S67A 1KSIA 2ZHXB 3WDGB 1LOYA 3O8YA 4WYKA 4DKIA 1W6YA 2CX0A 1UI8A 3GZYB 3NQZA 3ROBA 1BNGA 3WODG 1ISKA 1O7NB 3NBRA 1JBTA 1RGHA 5STDA 2O3OA 1RHLA 1RGCA 5IG4A 3NBJA 1PY3A 4BL3A 3HI7A 1AVLA 1B2UA 2YX9A 1MWRA 3EF8A 1RDSA 2MC8A 1BGSA 3ZG5A 4FCZA 2LYXA 2JDIH 2XF3A 4CCVA 5I97A 5G1LA 2R41A 3DGOA 2GU3A 3FF2A 1IDPA 3OV4A 1RTUA 2YFLB 3MG2A 1BRIA 2RCDA 1A2KA 1Q864 1RGGA 2INXA 1RN1A 1U8CB 2P38A 4R9KA 4RNTA 1BSBA 5HOHA 2D1WA 1CYVA 1HU9A 1VQ43 4N6LA 8CHOA 3CXC2 1BAOA 1DMNA 1JZDA 4IT7A 1RGKA 4EBGA 3SLUA 2GEXA 2P09A 3B4PA 8RNTA 5KP1A 1BU4A 2CH9A 2IUJA 5D81A 3VF1A 4ILFA 4CPKA 1OHPA 1BANA 1CH0A 3LT9A 1G02A 1YIT3 1E97A 3NV0B 1M1K4 4XM4A 5ELJA 1EEJA 4LMIA 5D82A 3VGNA 3HK4A 4BL2A 1AQZA 1BSCA 1PFPA 3DGYA 3VSYA 3TDGA 1VQO3 3B4OA 3MKIA 4XDVA 2WGOA 1GMPA 5DREA 4RNZA 1BNFA 1KQS2 5BXQA 3KCHA 1TP6A 3F9SA 3GZBA 3LTBA 5M1AA 1FUSA 1YI23 3MG3A 2KXGA 1YJN3 3PYJA 1FUTA 4OVMA 1PYLA 1N5PA 3F8HA 3J7Yd 1TTOA 1BRSA 4O8SA 1B21A 2IA7A 3BU4A 5IEPA 3PCRA 4ORLA 3S27A 1IQXA 1JBSA 1QAFA 3ECFA 2C4BA 1I2FA 2P0XA 4AKZA 3AGOA 4BIRA 4LGQA 4N6UA 1Q7Y4 3Q3FA 3Q90A 3LH4A 1YNVX 3UL5A 1M1XB 4HOHA 7GSPA 1YIJ3 2XSOB 3FKAA 2RNTA 4HJLB 1RJOA 2MF7A 2LQVA 4RNYA 1E3VA 5AYRB 2XH9A 3SOAA 1IVXA 1IQYA 1UGIA 5A0OB 2CFLA 4NPBA 3K5TA 2GBWB 3HZPA 1JN5B 2IUKA 3EX9A 2ML6A 3ZG0A 4FCMA 1RCLA 2HMLB 1EKMA 1DVCA 5IEOA 2KF3A 1RRHA 3T8NA 4R4KA 4AEQA 4JRFA 2OQEC 5GSPA 2CKFB 4FMAA 4STDA 3ER7A 4H61A 3F7SA 3HX8A 1LQMB 3CCV3 2UX0A 2AAEA 4HAAA 2JQ5A 3CD63 2CK3H 3T8UA 1K28A 1BNEA 1QALA 2M7OA 4LSOA 4O2HA 1I0XA 3CCJ3 3Q2PA 2H0GA 3GAXA 2FGTA 2IYJA 1VQN3 1O7HB 1X1UA 1OACA 2PNCA 3KIIA 7RNTA 4R9LA 1Y4KA 5JPPA 3WOFB 2Z77A 1LVNA 2F5WA 4WWUC 1HKXA 1N8R4 3NXJA 1JB4A 2STDA 3N8BA 1RGAA 1RGFA 1STFI 1EUIC 1CQSA 2B1XB 2W9QA 3FG1A 1VZZA 4KT3B 5AI1A 2CWVA 1E3RA 3X3XA 2E2UA 2ML5A 2XGNA 4R1KA 2CWUA 2H0HA 4BTXA 1NO3A 2CFWA 3DGMA 2KRTA 3RNTA 2SBLA 3OX9A 1W02A 5BVBA 5EQLA 4X2OA 1IQ8A 1W7CA 2WO0A 1IV7A 3SEDA 1NDOB 1BVIA 2AADA 1FGMA 1SQWA 1YHQ3 3KSED 3FG4A 4K1UA 1EA2A 5FGOA 1I8VA 2RBIA 4GHOA 4U13A 5EVHA 1B20A 4CJNA 2CC3A 1W2ZA 1W5ZA 2QEX3 2BMRB 1UCLA 3F40A 1NB3I 1JRQA 3BB9A 1TFOA 3JVCA 2UUGC 4CDLA 1GMQA 3I563 5AYSC 4AKYA 1Q42A 1FGQA 4JF8A 1BNJA 1SIHA 2L1SA 5ELUA 3RDEA 1C54A 4OK0A 4X2HA 4HM4B 3N9HA 3PGBA 3HIIA 1NNVA 1B2MA 3FZWA 3ZFZA 1JNQA 2RFRA 3BNEA 4PEJA 3K7CA 1IVUA 1GD3A 4HM7B 4KFEA 5IG3A 1QVF2 2RSXA 2WOHA 2C10A 3NHXA 4WP5A 4O02B 3WOEB 3A76A 3KSPA 3U1WA 3FF0A 2CX1A 1RGEA 3D9RA 1DMQA 1RN4A 1I2GA 2WOFA 2OCTA 3AHWA 3KE7A 4HVNA 5CLKA 3BNBA 2OOVA 1WMNA 1OHSA 1QAKA 2J8XB 1AY7A 3WA3A 1X1XA
chains in the Genus database with same CATH topology
1MGRA 1FUTA 1MGWA 1PYLA 1A2PA 5RNTA 1Q9EA 2KF6A 1I2EA 1TTOA 1BRSA 1B21A 3BU4A 1JBSA 4BIRA 2HOHA 2C4BA 1I2FA 3AGOA 2BU4A 2F5MA 3Q3FA 3AHSA 3SYUA 1YNVX 4HOHA 7GSPA 1FZUA 1UCJA 2RNTA 1LRAA 5BIRA 1TRQA 1I3IA 1DETA 1YVSA 1ZGXA 2KAAA 3DH2A 2BIRA 1LNIA 1RCLA 1BRNL 2KF3A 1B2ZA 1RNBA 1JBRA 2F56A 1BSAA 1BRGA 5GSPA 1BRKA 1LOWA 1R4YA 4BU4A 1BRHA 2AAEA 3BIRA 4HAAA 1YGWA 2GSPA 1BNEA 1RLSA 1I0XA 1RCKA 3D5GA 1GMRA 6GSPA 1GSPA 1X1YA 1X1UA 7RNTA 1DE3A 1TRPA 3WR2A 1BIRA 1IYYA 2F5WA 1I3FA 1UCKA 1BSDA 3D4AA 1B2XA 1GOYA 1RSNA 1BNRA 1RGAA 1RGFA 2ZA4A 2F4YA 6RNTA 1LOVA 1LOYA 3HOHA 1T2HA 9RNTA 1BNGA 1RMSA 3RNTA 1JBTA 1RGHA 1RHLA 1RGCA 5BU4A 3A5EA 1PY3A 3GSPA 1B2UA 3WHOA 1BVIA 2AADA 1RDSA 1BGSA 1I8VA 2RBIA 4GHOA 1B20A 1BOXA 1B27A 1X1WA 1UCLA 4J5GA 1GOVA 1GOUA 1T2IA 1B3SA 1RTUA 4GSPA 1RGLA 1SARA 1BRIA 1RGGA 1RN1A 1GMQA 3URPA 4RNTA 1BSBA 2KF5A 5HOHA 1I0VA 1BNSA 1BNJA 2KF4A 1C54A 1BAOA 1B2SA 1RGKA 8RNTA 1B2MA 1BU4A 1FW7A 4J5KA 1BANA 1CH0A 1G02A 3AGNA 1UCIA 1BSEA 1HZ1A 1AQZA 1BNIA 1BSCA 3DGYA 1BRJA 1RGEA 1RN4A 1GMPA 1I2GA 1FYSA 1BUJA 1BNFA 3AHWA 3KCHA 1HYFA 3D5IA 1I70A 2SARA 1FUSA 1AY7A 1X1XA 1RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGR A;  1FUT A;  1MGW A;  1PYL A;  1A2P A;  5RNT A;  1Q9E A;  2KF6 A;  1I2E A;  1TTO A;  1BRS A;  1B21 A;  3BU4 A;  1JBS A;  4BIR A;  2HOH A;  2C4B A;  1I2F A;  3AGO A;  2BU4 A;  2F5M A;  3Q3F A;  3AHS A;  3SYU A;  1YNV X;  4HOH A;  7GSP A;  1FZU A;  1UCJ A;  2RNT A;  1LRA A;  5BIR A;  1TRQ A;  1I3I A;  1DET A;  1YVS A;  1ZGX A;  2KAA A;  3DH2 A;  2BIR A;  1LNI A;  1RCL A;  1BRN L;  2KF3 A;  1B2Z A;  1RNB A;  1JBR A;  2F56 A;  1BSA A;  1BRG A;  5GSP A;  1BRK A;  1LOW A;  1R4Y A;  4BU4 A;  1BRH A;  2AAE A;  3BIR A;  4HAA A;  1YGW A;  2GSP A;  1BNE A;  1RLS A;  1I0X A;  1RCK A;  3D5G A;  1GMR A;  6GSP A;  1GSP A;  1X1Y A;  1X1U A;  7RNT A;  1DE3 A;  1TRP A;  3WR2 A;  1BIR A;  1IYY A;  2F5W A;  1I3F A;  1UCK A;  1BSD A;  3D4A A;  1B2X A;  1GOY A;  1RSN A;  1BNR A;  1RGA A;  1RGF A;  2ZA4 A;  2F4Y A;  6RNT A;  1LOV A;  1LOY A;  3HOH A;  1T2H A;  9RNT A;  1BNG A;  1RMS A;  3RNT A;  1JBT A;  1RGH A;  1RHL A;  1RGC A;  5BU4 A;  3A5E A;  1PY3 A;  3GSP A;  1B2U A;  3WHO A;  1BVI A;  2AAD A;  1RDS A;  1BGS A;  1I8V A;  2RBI A;  4GHO A;  1B20 A;  1BOX A;  1B27 A;  1X1W A;  1UCL A;  4J5G A;  1GOV A;  1GOU A;  1T2I A;  1B3S A;  1RTU A;  4GSP A;  1RGL A;  1SAR A;  1BRI A;  1RGG A;  1RN1 A;  1GMQ A;  3URP A;  4RNT A;  1BSB A;  2KF5 A;  5HOH A;  1I0V A;  1BNS A;  1BNJ A;  2KF4 A;  1C54 A;  1BAO A;  1B2S A;  1RGK A;  8RNT A;  1B2M A;  1BU4 A;  1FW7 A;  4J5K A;  1BAN A;  1CH0 A;  1G02 A;  3AGN A;  1UCI A;  1BSE A;  1HZ1 A;  1AQZ A;  1BNI A;  1BSC A;  3DGY A;  1BRJ A;  1RGE A;  1RN4 A;  1GMP A;  1I2G A;  1FYS A;  1BUJ A;  1BNF A;  3AHW A;  3KCH A;  1HYF A;  3D5I A;  1I70 A;  2SAR A;  1FUS A;  1AY7 A;  1X1X A;  1RNT A; 
#chains in the Genus database with same CATH topology
 3LXU X;  5AEU B;  4NRE A;  3U97 A;  3CCR 3;  4EV2 A;  4N6O B;  1A2P A;  4HM1 B;  1GY5 A;  2W9P A;  2KF6 A;  1I2E A;  3AMO A;  3UB1 A;  3S5C A;  5AII A;  1WQL B;  1MNL A;  1OPY A;  1W00 A;  2W0Q A;  1VQ9 3;  2HOH A;  5G1K A;  3X41 A;  3X3Y A;  4BTW A;  3SYU A;  3LYG A;  1VQ8 3;  2ZL8 A;  3LTC A;  4N6V 0;  2WGQ A;  1JB5 A;  4O3V A;  2E2T A;  4N6N B;  3RGA A;  1UDI I;  4EV5 A;  1OGZ A;  1A2V A;  5IEN A;  1VQP 3;  1GD4 A;  1YVS A;  1VQL 3;  1ZGX A;  3OXA A;  2KAA A;  3FG3 A;  5FW5 A;  3GWR A;  1LNI A;  1YVB I;  3PS8 A;  4WFO A;  1BRN L;  5TGN A;  1U5O A;  2OTL 3;  2IY2 A;  1RNB A;  4HYZ A;  1BRG A;  1C7H A;  3D3L A;  2PZV A;  3T0U A;  1R4Y A;  3G71 3;  4HM6 B;  4BU4 A;  1T3B A;  5IG5 A;  2XFS A;  1LNH A;  3EB8 A;  2GSP A;  3DM8 A;  1V58 A;  3E99 A;  3LZA A;  3DGN A;  2ZDJ A;  4MJD A;  1OHO A;  1GMR A;  3PCS A;  5AIH A;  1O7G B;  1LOX A;  3PZW A;  1D6Z A;  1O7P B;  1DE3 A;  3OW2 2;  1TRP A;  3NM2 A;  1JN5 A;  1BIR A;  1OH0 A;  3UL6 A;  1BSD A;  1B2X A;  1RSN A;  4EXR A;  1BNR A;  3KN4 A;  4I5Q A;  3EBY A;  1LOV A;  1TUH A;  7STD A;  3X40 A;  3IPT A;  4K1V A;  3HOH A;  9RNT A;  3KFQ C;  5M18 A;  1VQ6 3;  3NBB A;  2XR8 B;  4GB5 A;  4KVH A;  2CIU A;  2YFI B;  1K8A 4;  3H51 A;  2XSH B;  4HM3 B;  4MMX B;  2W56 A;  1ASK A;  2L4V A;  1ZX2 A;  3EQQ B;  4L8O A;  5KP3 A;  3V92 A;  4Q53 A;  1SII A;  2W6J H;  1GY7 A;  1JKG B;  1ULI B;  1AV4 A;  1KWI A;  2P0M A;  3SXX A;  4RBN A;  1VQM 3;  3GZR A;  1O7M B;  1DMM A;  5CK6 A;  4J5G A;  4K90 B;  1GOV A;  1A67 A;  1B3S A;  3CPW 2;  1RGL A;  1SAR A;  1W01 A;  1W4N A;  5AIF A;  3URP A;  1OCV A;  2CFK A;  2KF5 A;  1BNS A;  1I0V A;  2KF4 A;  3LTA A;  3EBT A;  4HM8 B;  2C11 A;  4FMB A;  3OWU A;  3D79 A;  1Q7H A;  3I55 3;  4XBY A;  1DYU A;  4WHA A;  4J5K A;  2RGQ A;  1GS3 A;  4N3V A;  1T5Y A;  1IVV A;  3EN1 B;  3FH1 A;  1WTH A;  1RRL A;  4HM0 B;  1KD1 4;  1N9J A;  1BSE A;  1JKG A;  2QA4 3;  4LYL B;  1V74 A;  2F99 A;  3HIG A;  1JB2 A;  3LML A;  1BNI A;  3JUP A;  3LOY A;  3FSD A;  3JUQ A;  2Q07 A;  1UI7 A;  1FYS A;  3X3Z A;  1D6U A;  1FGT A;  1VQQ A;  3BLZ A;  3G16 A;  3D5I A;  4HKV B;  4R80 A;  2P05 A;  1NWW A;  2H0I A;  1WMO A;  3K0Z A;  4GL6 A;  5KP4 A;  1SJW A;  1Z1S A;  4G1M B;  3SVA A;  4L7K A;  1EQK A;  4FCJ A;  1WMP A;  5RNT A;  3G6E 3;  1MWT A;  3OWS A;  3F7X A;  4MEI A;  3DGL A;  4LZI A;  2K54 A;  1G0T A;  1Q40 A;  5G2G A;  3UNL A;  1AR0 A;  2D42 A;  1Q82 4;  1O7W B;  1W6G A;  3GZX B;  3MG1 A;  2CFD A;  2F5M A;  2XRX B;  5LC7 A;  3N54 B;  3SX1 A;  3FGY A;  3G0K A;  3CC2 3;  1QJG A;  1LRA A;  2Y73 A;  4BTY A;  2GBX B;  1I3I A;  2CWT A;  1ROA A;  3IJE B;  1OUN A;  2Y74 A;  3QK9 A;  2O9U X;  2BIR A;  2XFT A;  1TU5 A;  1VQ5 3;  3K9M C;  1VQK 3;  1JBR A;  1K41 A;  2F56 A;  3JUN A;  1RN7 A;  3CPO A;  2OWP A;  2F98 A;  1BRK A;  1LOW A;  2W03 A;  3GRD A;  3NV0 A;  3OWY A;  4FR9 A;  3CC4 3;  3AMO B;  5CF1 A;  1A90 A;  1BRH A;  5D83 A;  3BIR A;  1S72 3;  5JBS A;  1YGW A;  1NU3 A;  1M90 4;  1KC8 4;  4J8T A;  5DRV A;  1RLS A;  2E2V A;  1AVK A;  1VQ7 3;  3CCQ 3;  4RZM A;  5IG0 A;  1EG9 B;  1UUW B;  1YGE A;  3I0Y A;  3NM7 A;  3CCM 3;  3CCS 3;  2OOV C;  1X1Y A;  4EC6 A;  4IPB A;  3KZT A;  3WR2 A;  2GU1 A;  2HMJ B;  1MWS A;  5CF2 A;  3EE1 A;  1QMA A;  3F14 A;  3D4A A;  2Z6B A;  1GOY A;  3DZL A;  3F8X A;  4N6T A;  3WA2 X;  1STD A;  2F4Y A;  4FMC A;  2GXF A;  3RGR A;  3Q1C A;  1IV9 A;  1RKY A;  1QVG 2;  1DVD A;  4J9A A;  5IF6 A;  1YJ9 3;  1UGH I;  2QGU A;  1T2H A;  4LEH A;  3V98 A;  4HM2 B;  2CG0 A;  1RMS A;  1TFK A;  2UGI A;  1K73 4;  5JPU A;  1CEW I;  4H3U A;  3NUV A;  4I4K A;  5BU4 A;  3MPH A;  3A5E A;  4XB5 A;  3NQY A;  2XGL A;  3GSP A;  3S29 A;  4IIA A;  3WHO A;  1YJW 3;  3BND A;  6STD A;  4HM5 B;  1Q40 B;  3DXO A;  4KFF A;  5HGR A;  4ZM8 A;  1BOX A;  1FUW A;  2CHC A;  1B27 A;  1IT7 A;  1IVW A;  1X1W A;  3CCU 3;  2FNQ A;  1LXE A;  2R4I A;  3CC7 3;  1T2I A;  1UW1 A;  1GOU A;  3EHC A;  4GSP A;  2GEY A;  2I9W A;  3MYT A;  3SOY A;  3EC9 A;  3JUO A;  2HMO B;  2Z76 A;  4TX4 A;  3EJV A;  4XBX A;  2BHM A;  2V1L A;  1K9M 4;  1B2S A;  1G96 A;  2BMQ B;  4FMD A;  3CCL 3;  5AIG A;  1S5A A;  3DY5 A;  4KFD A;  4KZ1 A;  1SPU A;  5IW9 A;  3FLJ A;  2YFJ B;  1FW7 A;  1TIJ A;  1Q81 4;  3X42 A;  1J2B A;  1GY6 A;  2K0M A;  3CNM A;  3DUK A;  5LC6 A;  2W04 A;  3AGN A;  2Z7A A;  4EW5 A;  1UCI A;  1HZ1 A;  1BRJ A;  3EN8 A;  3B8L A;  3CNX A;  5EEO A;  1BUJ A;  2CG1 A;  1FGR A;  3JUM A;  3NX0 A;  1HYF A;  2HMN B;  1I70 A;  1ZS7 A;  3H3H A;  2SAR A;  1IT8 A;  3MWZ A;  1RNT A;  5BIR A;  1MGR A;  2BNG A;  1NB5 I;  1CYU A;  1JZO A;  4HZB B;  1NJI 4;  1BUQ A;  4N6M A;  1D6Y A;  1MGW A;  2W56 B;  4QWT A;  4XDW A;  1Q9E A;  3STD A;  5AEW B;  3S28 A;  3CU3 A;  1WNH A;  4WYK B;  1UUG B;  1M9G A;  1FA3 A;  1F8N A;  3BNC A;  3V99 A;  2BU4 A;  3KKG A;  3QRD A;  3AHS A;  2HMM B;  1JV2 B;  3L0R A;  5M19 A;  1N9E A;  3FCS B;  1N5H A;  1W2B 2;  5CXO A;  1FZU A;  1UCJ A;  2W2C A;  1OGX A;  2K3D A;  1MOL A;  1TRQ A;  4EYC A;  1DET A;  4MMY B;  2BMO B;  3M8C A;  1JJ2 2;  1OF5 A;  4K61 A;  4XBT A;  3CCE 3;  1UUV B;  3LT8 A;  3DH2 A;  4HZ9 B;  2CW9 A;  5IER A;  1N8Q A;  1LQG C;  3G8Z A;  3CME 3;  1MWU A;  4L8P A;  4MMZ B;  1ULJ B;  4NHF A;  1V57 A;  1B2Z A;  1ZO2 A;  1BSA A;  1FGO A;  2FXT A;  2BT3 A;  2KCD A;  1IU7 A;  1US1 A;  1GYB A;  3MHE A;  3WMD A;  2IMJ A;  3CMA 3;  2OQE A;  4OUQ A;  3IMA B;  3ALA A;  3LTD A;  1RCK A;  2CFG A;  3D5G A;  3UJM A;  1W6C A;  6GSP A;  2BO9 B;  1ROV A;  1L5G B;  1IK3 A;  1GSP A;  1OF5 B;  2A15 A;  2HMK B;  1PU4 A;  2B24 B;  1IYY A;  3DMC A;  3MSO A;  3K63 A;  3G4S 3;  1I3F A;  1UCK A;  3PXM A;  1TJD A;  4HBR A;  1R4C A;  2OTJ 3;  2QIY A;  2F86 B;  2ZA4 A;  3B7C A;  6RNT A;  2XEP A;  3S67 A;  1KSI A;  2ZHX B;  3WDG B;  1LOY A;  3O8Y A;  4WYK A;  4DKI A;  1W6Y A;  2CX0 A;  1UI8 A;  3GZY B;  3NQZ A;  3ROB A;  1BNG A;  3WOD G;  1ISK A;  1O7N B;  3NBR A;  1JBT A;  1RGH A;  5STD A;  2O3O A;  1RHL A;  1RGC A;  5IG4 A;  3NBJ A;  1PY3 A;  4BL3 A;  3HI7 A;  1AVL A;  1B2U A;  2YX9 A;  1MWR A;  3EF8 A;  1RDS A;  2MC8 A;  1BGS A;  3ZG5 A;  4FCZ A;  2LYX A;  2JDI H;  2XF3 A;  4CCV A;  5I97 A;  5G1L A;  2R41 A;  3DGO A;  2GU3 A;  3FF2 A;  1IDP A;  3OV4 A;  1RTU A;  2YFL B;  3MG2 A;  1BRI A;  2RCD A;  1A2K A;  1Q86 4;  1RGG A;  2INX A;  1RN1 A;  1U8C B;  2P38 A;  4R9K A;  4RNT A;  1BSB A;  5HOH A;  2D1W A;  1CYV A;  1HU9 A;  1VQ4 3;  4N6L A;  8CHO A;  3CXC 2;  1BAO A;  1DMN A;  1JZD A;  4IT7 A;  1RGK A;  4EBG A;  3SLU A;  2GEX A;  2P09 A;  3B4P A;  8RNT A;  5KP1 A;  1BU4 A;  2CH9 A;  2IUJ A;  5D81 A;  3VF1 A;  4ILF A;  4CPK A;  1OHP A;  1BAN A;  1CH0 A;  3LT9 A;  1G02 A;  1YIT 3;  1E97 A;  3NV0 B;  1M1K 4;  4XM4 A;  5ELJ A;  1EEJ A;  4LMI A;  5D82 A;  3VGN A;  3HK4 A;  4BL2 A;  1AQZ A;  1BSC A;  1PFP A;  3DGY A;  3VSY A;  3TDG A;  1VQO 3;  3B4O A;  3MKI A;  4XDV A;  2WGO A;  1GMP A;  5DRE A;  4RNZ A;  1BNF A;  1KQS 2;  5BXQ A;  3KCH A;  1TP6 A;  3F9S A;  3GZB A;  3LTB A;  5M1A A;  1FUS A;  1YI2 3;  3MG3 A;  2KXG A;  1YJN 3;  3PYJ A;  1FUT A;  4OVM A;  1PYL A;  1N5P A;  3F8H A;  3J7Y d;  1TTO A;  1BRS A;  4O8S A;  1B21 A;  2IA7 A;  3BU4 A;  5IEP A;  3PCR A;  4ORL A;  3S27 A;  1IQX A;  1JBS A;  1QAF A;  3ECF A;  2C4B A;  1I2F A;  2P0X A;  4AKZ A;  3AGO A;  4BIR A;  4LGQ A;  4N6U A;  1Q7Y 4;  3Q3F A;  3Q90 A;  3LH4 A;  1YNV X;  3UL5 A;  1M1X B;  4HOH A;  7GSP A;  1YIJ 3;  2XSO B;  3FKA A;  2RNT A;  4HJL B;  1RJO A;  2MF7 A;  2LQV A;  4RNY A;  1E3V A;  5AYR B;  2XH9 A;  3SOA A;  1IVX A;  1IQY A;  1UGI A;  5A0O B;  2CFL A;  4NPB A;  3K5T A;  2GBW B;  3HZP A;  1JN5 B;  2IUK A;  3EX9 A;  2ML6 A;  3ZG0 A;  4FCM A;  1RCL A;  2HML B;  1EKM A;  1DVC A;  5IEO A;  2KF3 A;  1RRH A;  3T8N A;  4R4K A;  4AEQ A;  4JRF A;  2OQE C;  5GSP A;  2CKF B;  4FMA A;  4STD A;  3ER7 A;  4H61 A;  3F7S A;  3HX8 A;  1LQM B;  3CCV 3;  2UX0 A;  2AAE A;  4HAA A;  2JQ5 A;  3CD6 3;  2CK3 H;  3T8U A;  1K28 A;  1BNE A;  1QAL A;  2M7O A;  4LSO A;  4O2H A;  1I0X A;  3CCJ 3;  3Q2P A;  2H0G A;  3GAX A;  2FGT A;  2IYJ A;  1VQN 3;  1O7H B;  1X1U A;  1OAC A;  2PNC A;  3KII A;  7RNT A;  4R9L A;  1Y4K A;  5JPP A;  3WOF B;  2Z77 A;  1LVN A;  2F5W A;  4WWU C;  1HKX A;  1N8R 4;  3NXJ A;  1JB4 A;  2STD A;  3N8B A;  1RGA A;  1RGF A;  1STF I;  1EUI C;  1CQS A;  2B1X B;  2W9Q A;  3FG1 A;  1VZZ A;  4KT3 B;  5AI1 A;  2CWV A;  1E3R A;  3X3X A;  2E2U A;  2ML5 A;  2XGN A;  4R1K A;  2CWU A;  2H0H A;  4BTX A;  1NO3 A;  2CFW A;  3DGM A;  2KRT A;  3RNT A;  2SBL A;  3OX9 A;  1W02 A;  5BVB A;  5EQL A;  4X2O A;  1IQ8 A;  1W7C A;  2WO0 A;  1IV7 A;  3SED A;  1NDO B;  1BVI A;  2AAD A;  1FGM A;  1SQW A;  1YHQ 3;  3KSE D;  3FG4 A;  4K1U A;  1EA2 A;  5FGO A;  1I8V A;  2RBI A;  4GHO A;  4U13 A;  5EVH A;  1B20 A;  4CJN A;  2CC3 A;  1W2Z A;  1W5Z A;  2QEX 3;  2BMR B;  1UCL A;  3F40 A;  1NB3 I;  1JRQ A;  3BB9 A;  1TFO A;  3JVC A;  2UUG C;  4CDL A;  1GMQ A;  3I56 3;  5AYS C;  4AKY A;  1Q42 A;  1FGQ A;  4JF8 A;  1BNJ A;  1SIH A;  2L1S A;  5ELU A;  3RDE A;  1C54 A;  4OK0 A;  4X2H A;  4HM4 B;  3N9H A;  3PGB A;  3HII A;  1NNV A;  1B2M A;  3FZW A;  3ZFZ A;  1JNQ A;  2RFR A;  3BNE A;  4PEJ A;  3K7C A;  1IVU A;  1GD3 A;  4HM7 B;  4KFE A;  5IG3 A;  1QVF 2;  2RSX A;  2WOH A;  2C10 A;  3NHX A;  4WP5 A;  4O02 B;  3WOE B;  3A76 A;  3KSP A;  3U1W A;  3FF0 A;  2CX1 A;  1RGE A;  3D9R A;  1DMQ A;  1RN4 A;  1I2G A;  2WOF A;  2OCT A;  3AHW A;  3KE7 A;  4HVN A;  5CLK A;  3BNB A;  2OOV A;  1WMN A;  1OHS A;  1QAK A;  2J8X B;  1AY7 A;  3WA3 A;  1X1X A; 
#chains in the Genus database with same CATH homology
 1MGR A;  1FUT A;  1MGW A;  1PYL A;  1A2P A;  5RNT A;  1Q9E A;  2KF6 A;  1I2E A;  1TTO A;  1BRS A;  1B21 A;  3BU4 A;  1JBS A;  4BIR A;  2HOH A;  2C4B A;  1I2F A;  3AGO A;  2BU4 A;  2F5M A;  3Q3F A;  3AHS A;  3SYU A;  1YNV X;  4HOH A;  7GSP A;  1FZU A;  1UCJ A;  2RNT A;  1LRA A;  5BIR A;  1TRQ A;  1I3I A;  1DET A;  1YVS A;  1ZGX A;  2KAA A;  3DH2 A;  2BIR A;  1LNI A;  1RCL A;  1BRN L;  2KF3 A;  1B2Z A;  1RNB A;  1JBR A;  2F56 A;  1BSA A;  1BRG A;  5GSP A;  1BRK A;  1LOW A;  1R4Y A;  4BU4 A;  1BRH A;  2AAE A;  3BIR A;  4HAA A;  1YGW A;  2GSP A;  1BNE A;  1RLS A;  1I0X A;  1RCK A;  3D5G A;  1GMR A;  6GSP A;  1GSP A;  1X1Y A;  1X1U A;  7RNT A;  1DE3 A;  1TRP A;  3WR2 A;  1BIR A;  1IYY A;  2F5W A;  1I3F A;  1UCK A;  1BSD A;  3D4A A;  1B2X A;  1GOY A;  1RSN A;  1BNR A;  1RGA A;  1RGF A;  2ZA4 A;  2F4Y A;  6RNT A;  1LOV A;  1LOY A;  3HOH A;  1T2H A;  9RNT A;  1BNG A;  1RMS A;  3RNT A;  1JBT A;  1RGH A;  1RHL A;  1RGC A;  5BU4 A;  3A5E A;  1PY3 A;  3GSP A;  1B2U A;  3WHO A;  1BVI A;  2AAD A;  1RDS A;  1BGS A;  1I8V A;  2RBI A;  4GHO A;  1B20 A;  1BOX A;  1B27 A;  1X1W A;  1UCL A;  4J5G A;  1GOV A;  1GOU A;  1T2I A;  1B3S A;  1RTU A;  4GSP A;  1RGL A;  1SAR A;  1BRI A;  1RGG A;  1RN1 A;  1GMQ A;  3URP A;  4RNT A;  1BSB A;  2KF5 A;  5HOH A;  1I0V A;  1BNS A;  1BNJ A;  2KF4 A;  1C54 A;  1BAO A;  1B2S A;  1RGK A;  8RNT A;  1B2M A;  1BU4 A;  1FW7 A;  4J5K A;  1BAN A;  1CH0 A;  1G02 A;  3AGN A;  1UCI A;  1BSE A;  1HZ1 A;  1AQZ A;  1BNI A;  1BSC A;  3DGY A;  1BRJ A;  1RGE A;  1RN4 A;  1GMP A;  1I2G A;  1FYS A;  1BUJ A;  1BNF A;  3AHW A;  3KCH A;  1HYF A;  3D5I A;  1I70 A;  2SAR A;  1FUS A;  1AY7 A;  1X1X A;  1RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...