4HAAA

Structure of ribonuclease binase glu43ala/phe81ala mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAAVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGARNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Structure and functional studies of the ribonuclease binase Glu43Ala/Phe81Ala mutant.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4haaA00
3RNTA 4GHOA 1B2UA 2GSPA 3AGOA 1HYFA 1RGGA 1RGEA 2AAEA 1I3IA 1BU4A 3Q3FA 1BOXA 1B2MA 1I2FA 1X1YA 1GMRA 1RHLA 1GOYA 1I3FA 1RGCA 2KF4A 1FUSA 1I0XA 1RNTA 3KCHA 1BRGA 1FUTA 1FYSA 1LNIA 1PY3A 7GSPA 2RBIA 4J5KA 8RNTA 1TRQA 1B2SA 3SYUA 1RN1A 1I70A 2BU4A 5BIRA 1BNJA 3D4AA 1X1UA 3DGYA 1LOVA 1B3SA 2AADA 1YGWA 3AHSA 1RCKA 1R4YA 3BU4A 2KF3A 2F4YA 4BIRA 1MGWA 1RN4A 2SARA 1BVIA 5HOHA 2C4BA 1JBTA 1LOYA 1YNVX 1LRAA 1UCJA 1X1XA 1B21A 1G02A 1GOVA 1LOWA 1TTOA 1T2IA 1MGRA 3URPA 1BSDA 5RNTA 1RGLA 1BRHA 1B27A 4J5GA 5BU4A 1BNFA 2KF5A 1RGAA 2F56A 1B20A 3AHWA 1BNRA 1JBRA 1RDSA 2BIRA 1BUJA 1BRJA 5GSPA 1RLSA 1BRNL 1AY7A 1I8VA 2RNTA 1GMQA 1X1WA 3D5GA 1BIRA 3GSPA 3D5IA 2KF6A 1BNEA 2HOHA 1TRPA 2F5MA 1GOUA 1I2GA 1BSEA 1RNBA 1DE3A 1BSBA 1SARA 1IYYA 2KAAA 1YVSA 1FZUA 1Q9EA 1RMSA 1UCIA 1BNSA 2ZA4A 3AGNA 1BAOA 3WR2A 1ZGXA 1B2ZA 6GSPA 1FW7A 1BRKA 1GSPA 1B2XA 1RTUA 3HOHA 1BNIA 4HOHA 1RGHA 4RNTA 9RNTA 1BSCA 1A2PA 1T2HA 1C54A 1RCLA 1HZ1A 1BANA 1BNGA 1BSAA 6RNTA 1DETA 1JBSA 1UCLA 1AQZA 1GMPA 4GSPA 1CH0A 1I0VA 1RGKA 1BRIA 1UCKA 3BIRA 1RSNA 3DH2A 1PYLA 7RNTA 1RGFA 4BU4A 2F5WA 3A5EA 1I2EA 4HAAA 1BGSA 1BRSA 3WHOA
chains in the Genus database with same CATH superfamily
4O2HA 3PGBA 3HI7A 4GHOA 3AGOA 3V92A 1Q7Y4 2CWUA 2RCDA 2XFSA 4IT7A 4R9LA 3EX9A 4XBYA 1JN5B 4RNZA 1X1YA 2XGNA 3NV0B 4QWTA 1RHLA 5EVHA 3FF2A 3GRDA 4KT3B 3WA2X 2QA43 4K1VA 1RRHA 2XH9A 1QVF2 3B4PA 4N6UA 1RNTA 4N6MA 3G6E3 1ZS7A 1U5OA 1PY3A 2K3DA 4O02B 3CME3 4WYKB 4G1MB 1E3VA 1NO3A 2GU1A 3OV4A 4NHFA 1D6UA 3B7CA 2CW9A 3SYUA 4NREA 3HIIA 1GD4A 3G8ZA 1X1UA 4LYLB 3RGRA 1JJ22 1UGHI 4EYCA 2Z7AA 1R4YA 3F9SA 3LTAA 3Q2PA 1W6YA 3CC43 3ECFA 2CFDA 1MGWA 4HM1B 2W6JH 2LQVA 3D9RA 1UI7A 2Y74A 2KRTA 5G1LA 1IVWA 2WGOA 3MHEA 3FLJA 1GY5A 1UUWB 3FCSB 4FMCA 4BTYA 3CCU3 2O9UX 3CPOA 1T3BA 1YVBI 1LRAA 1B21A 1AVKA 2ML5A 1G02A 3O8YA 2BO9B 2CX1A 2YFLB 3Q90A 4RNYA 4AKYA 2UX0A 1MOLA 2PZVA 3EF8A 3FKAA 1BSDA 3LTBA 3MKIA 4R9KA 2B1XB 2ZDJA 1BRHA 3OWYA 3NBBA 5DREA 5AEUB 3UB1A 1O7MB 5LC6A 1VQM3 1RGAA 4FCMA 3LH4A 4EBGA 3I553 4X2HA 1IV7A 2OQEA 2CH9A 1K8A4 1BNRA 1RDSA 3JUMA 2GBWB 4XB5A 5EEOA 3X3ZA 3DGMA 4FR9A 3FG1A 3AMOA 3G713 1EG9B 5GSPA 1A2VA 3H51A 1AY7A 5BXQA 3SOAA 1N8R4 2CX0A 2WOHA 3EE1A 3GZBA 3DM8A 4LEHA 1BIRA 1FGMA 2IUJA 5KP1A 3D5IA 3KKGA 2KF6A 4N6TA 1KD14 3F8XA 1JN5A 1V74A 5HGRA 4FCJA 3NV0A 1TRPA 3CCM3 2R41A 1DVDA 3CXC2 1BSEA 1QJGA 1W02A 1WMPA 4FCZA 3UNLA 1DE3A 2OQEC 4KZ1A 1SARA 3K9MC 3JUQA 2KAAA 1CYUA 3FG4A 1QVG2 3ALAA 3BB9A 4OK0A 3NUVA 5AIFA 5IG5A 3HZPA 4WYKA 1N9EA 3HX8A 3UL6A 1UW1A 3EBTA 3MSOA 2BMQB 1B2ZA 2KCDA 6GSPA 1BRKA 1GSPA 3S5CA 3VSYA 1M1XB 4HM6B 1B2XA 1A67A 5KP4A 3LT8A 2JDIH 4HOHA 3EQQB 1YI23 4AKZA 4N6LA 3VF1A 1QMAA 1W7CA 2XSHB 4BL3A 1C54A 1T2HA 4BL2A 1RCLA 1OACA 2R4IA 3K0ZA 6RNTA 1BSAA 5G2GA 1QAKA 1GMPA 3BNEA 4HZ9B 1I0VA 1NB3I 3S29A 1UCKA 2CFLA 4CCVA 2CG0A 2W2CA 3WODG 2KXGA 4BU4A 2F5WA 1IVXA 1Q7HA 1BGSA 1BRSA 3PS8A 4HAAA 4RZMA 3RNTA 1Q864 2W56B 2XRXB 4CJNA 5ELJA 2C10A 3MG1A 2P0MA 2AAEA 3DY5A 4HZBB 5CLKA 1B2MA 1TFKA 3T8NA 3X3XA 3DMCA 3F14A 1GMRA 1TIJA 4OVMA 1GOYA 1RGCA 1DMQA 2KF4A 3GWRA 3BLZA 1AR0A 4HM2B 4ORLA 3F40A 5IERA 3LTCA 2IMJA 1W00A 1FUSA 1I0XA 1EUIC 3KCHA 2GEXA 1NDOB 1BRGA 1FYSA 2OWPA 2STDA 5EQLA 5M18A 2RBIA 2HMOB 3A76A 8RNTA 3CNXA 3I563 1YHQ3 1PFPA 1B2SA 2CWTA 1RN1A 1CEWI 3X42A 2BU4A 1O7NB 1BNJA 3QK9A 2YFIB 1LQMB 1LOVA 1NNVA 3NX0A 5FGOA 3BU4A 4R4KA 4BIRA 1E97A 3NM7A 3IPTA 3TDGA 3S67A 3U1WA 5IG4A 4EC6A 3CCV3 3KSED 4MJDA 3OX9A 2WGQA 3SX1A 2XF3A 1BVIA 2ZHXB 4FMAA 2MF7A 1JBTA 4WFOA 3DZLA 2QIYA 3ER7A 1LOYA 4N6OB 3IMAB 2E2TA 4R80A 3ZG0A 3VGNA 3KSPA 1T2IA 4DKIA 3JUOA 3B4OA 4PEJA 3B8LA 3URPA 3EN1B 4U13A 4J8TA 3D3LA 1YJN3 1VQL3 4JRFA 1RGLA 1M904 5FW5A 1OGZA 2KF5A 1FGQA 1SQWA 1O7HB 3AHWA 3OWUA 3S27A 3LYGA 3PZWA 1K9M4 1K41A 4K1UA 1GY7A 2XEPA 2K0MA 3NQYA 1D6YA 2IYJA 2W04A 3NXJA 4GL6A 4L8OA 3J7Yd 1TUHA 1VQ63 1TJDA 1BRNL 1MWSA 1MWTA 2CFWA 1STFI 4HVNA 1ASKA 1GMQA 3CC23 2F98A 2Y73A 3SOYA 5AYRB 1W2B2 1BNEA 2WO0A 1A90A 1VQP3 1N8QA 4HYZA 5IF6A 5CK6A 5D83A 1JZOA 1I2GA 1US1A 3N9HA 1RNBA 4Q53A 1IYYA 1OCVA 3HK4A 2MC8A 1Q9EA 4HM3B 1KC84 2P05A 1UCIA 1BNSA 4LSOA 6STDA 4N6NB 3KIIA 3WOEB 2Z6BA 1WQLB 1Q814 3EB8A 2IA7A 2YFJB 1MWUA 5A0OB 1T5YA 3CCE3 4X2OA 3MWZA 1V57A 1W4NA 4HM4B 4RBNA 1JRQA 2I9WA 4FMDA 4IIAA 3HOHA 1RGHA 1R4CA 3NHXA 4RNTA 3CU3A 3BNCA 2Z76A 3WA3A 3OXAA 1HZ1A 3DGLA 2CK3H 2Z77A 1Q824 2PNCA 1ZO2A 3UL5A 1STDA 1OF5B 1IT8A 1VQ73 1RGKA 1BRIA 1OH0A 5CXOA 4EV5A 1RSNA 1PYLA 1RGFA 2HMLB 3X40A 3M8CA 1GD3A 3DUKA 3WHOA 2P0XA 2ML6A 1B2UA 4JF8A 3KZTA 1D6ZA 1RGEA 1KQS2 3SVAA 3Q3FA 1BOXA 1I2FA 2XSOB 3CCL3 1EKMA 1EQKA 3LOYA 1OPYA 2GEYA 1ISKA 1IU7A 3DGNA 1WTHA 1LXEA 3F7SA 5KP3A 5CF2A 1BUQA 1DVCA 2JQ5A 2UUGC 1RN7A 2HMMB 1IK3A 4CDLA 3CNMA 2CWVA 4XDWA 5IEOA 4HJLB 3UJMA 3JUPA 7GSPA 1ULJB 3CMA3 4J5KA 4HBRA 4IPBA 2BMRB 1ULIB 2GXFA 3N54B 1GY6A 4HKVB 4KFEA 1B3SA 2Q07A 3IJEB 3ZFZA 1YGWA 1YIT3 3NQZA 2H0GA 1VQ83 1UGIA 1OGXA 2F4YA 2CC3A 2KF3A 5BVBA 1NB5I 1RN4A 2SARA 3PXMA 4LMIA 5AIIA 1JNQA 1UUVB 1ZX2A 3X3YA 4ILFA 5HOHA 1IQ8A 1E3RA 1Y4KA 2C4BA 3E99A 4HM0B 3V98A 3Q1CA 1YJ93 3G16A 2RSXA 4K90B 3OW22 1VQN3 2W0QA 3WDGB 2CKFB 1LOWA 1MGRA 1C7HA 5AI1A 5IW9A 1DYUA 4MMYB 1DMNA 1QAFA 2OOVA 5RNTA 1IDPA 1VQO3 4J5GA 4N3VA 1NJI4 1BNFA 4ZM8A 2F56A 2WOFA 3BNDA 4KFDA 3JVCA 1IV9A 1OHOA 1O7WB 1Z1SA 3PCRA 3T0UA 3X41A 1PU4A 1BUJA 1SIIA 3CCS3 4KVHA 1AV4A 1RLSA 4NPBA 2P09A 1VZZA 4L7KA 5JPPA 5JPUA 2K54A 2HMJB 4CPKA 1JZDA 2RNTA 1X1WA 3D5GA 1WMNA 3EN8A 1RRLA 2BT3A 2YX9A 4BTXA 2FNQA 2OOVC 4STDA 2BMOB 1FGOA 5ELUA 2E2VA 1V58A 2F5MA 1GOUA 1JB5A 1M9GA 4XDVA 3SXXA 3L0RA 1IQYA 4LZIA 1FZUA 1EEJA 1RMSA 2W9PA 3LZAA 3AGNA 7STDA 5D81A 1VQK3 2F86B 1F8NA 4MMXB 1HKXA 3GZRA 4HM5B 3WR2A 3CCQ3 4O8SA 4WP5A 1TU5A 1N5PA 1JKGB 2L4VA 1FW7A 1SJWA 1YIJ3 2D1WA 1W5ZA 2HMNB 2W56A 4K61A 5IG3A 3KN4A 3D79A 3LXUX 1JB4A 1KWIA 1A2PA 1GS3A 3CCR3 4I4KA 1BANA 1DETA 3LMLA 1JBSA 1UCLA 1AQZA 1M1K4 3GZYB 1HU9A 3BIRA 2HMKB 3DH2A 1S5AA 3EC9A 1W6CA 1RJOA 2J8XB 1CQSA 1OUNA 1U8CB 3RDEA 5IENA 1W2ZA 1K28A 5I97A 1SIHA 2GU3A 3HIGA 2GSPA 4OUQA 2H0HA 4GB5A 5D82A 1HYFA 2XFTA 1CYVA 1LOXA 1RGGA 5M1AA 1I3IA 1BU4A 1KSIA 1YJW3 3CCJ3 4XBTA 1RKYA 3CC73 5CF1A 1VQ43 1SPUA 3I0YA 5AEWB 3EJVA 2IY2A 3MYTA 1I3FA 1AVLA 2CFGA 1Q40B 1YGEA 2CIUA 1IT7A 3CPW2 2H0IA 3F8HA 3WOFB 1UUGB 3G0KA 3WMDA 1N5HA 5AIHA 3T8UA 3GZXB 5IG0A 4TX4A 1FUTA 1LNIA 1O7PB 3JUNA 1K734 1O7GB 1G96A 8CHOA 1TRQA 2A15A 2QGUA 3FZWA 5M19A 1OHSA 4H3UA 1I70A 2M7OA 5BIRA 1VQ93 2INXA 1MNLA 2XGLA 3D4AA 1NWWA 2W9QA 2AADA 1MWRA 3DGYA 1TP6A 3AHSA 2XR8B 1LQGC 3ROBA 3V99A 3BNBA 1RCKA 3K7CA 3MPHA 1VQQA 4EV2A 2B24B 2IUKA 1JV2B 1N9JA 5LC7A 4L8PA 3U97A 5AYSC 4BTWA 1UI8A 1FGRA 3KFQC 3MG2A 3SLUA 1YNVX 1VQ53 2FGTA 4WHAA 2OTL3 1UCJA 1UDII 2W03A 1GYBA 1JKGA 1X1XA 1GOVA 1LNHA 1TTOA 2CG1A 1WNHA 2LYXA 5JBSA 1L5GB 2F99A 1S723 2UGIA 2E2UA 3S28A 3DXOA 2BHMA 2CFKA 3ZG5A 2OCTA 3F7XA 1B27A 3KE7A 5STDA 5BU4A 1DMMA 4J9AA 5TGNA 4H61A 1JB2A 4MMZB 1B20A 2D42A 2C11A 3H3HA 1WMOA 1JBRA 2BIRA 4EW5A 1BRJA 2L1SA 1TFOA 1OHPA 1I8VA 4LGQA 1G0TA 4HM7B 3LT9A 3GSPA 2CHCA 3FH1A 3EHCA 1FA3A 2HOHA 3SEDA 1ROVA 2BNGA 3PCSA 3LTDA 4R1KA 4O3VA 3CD63 1Q40A 1Q42A 3FF0A 4AEQA 1J2BA 2RFRA 1BSBA 1QALA 1IQXA 1YVSA 1LVNA 5IEPA 2ZA4A 1FGTA 3QRDA 5AIGA 1BAOA 2GBXB 5G1KA 1OF5A 3STDA 1ZGXA 1W6GA 2QEX3 4EXRA 3K63A 4XBXA 1RTUA 3N8BA 1IVUA 3OWSA 1BNIA 3RGAA 3FG3A 4N6V0 9RNTA 1BSCA 1W01A 1NU3A 3DGOA 1FUWA 3G4S3 5DRVA 2OTJ3 2SBLA 1IVVA 1ROAA 2RGQA 1BNGA 2V1LA 3K5TA 1EA2A 4FMBA 3GAXA 3NBRA 1A2KA 2O3OA 1CH0A 3MG3A 2ZL8A 3PYJA 4GSPA 2FXTA 3FSDA 4HM8B 7RNTA 3AMOB 3EBYA 4I5QA 3FGYA 3NM2A 3NBJA 2P38A 4XM4A 3A5EA 4KFFA 1I2EA 4MEIA 4WWUC
chains in the Genus database with same CATH topology
3RNTA 4GHOA 1B2UA 2GSPA 3AGOA 1HYFA 1RGGA 1RGEA 2AAEA 1I3IA 1BU4A 3Q3FA 1BOXA 1B2MA 1I2FA 1X1YA 1GMRA 1RHLA 1GOYA 1I3FA 1RGCA 2KF4A 1FUSA 1I0XA 1RNTA 3KCHA 1BRGA 1FUTA 1FYSA 1LNIA 1PY3A 7GSPA 2RBIA 4J5KA 8RNTA 1TRQA 1B2SA 3SYUA 1RN1A 1I70A 2BU4A 5BIRA 1BNJA 3D4AA 1X1UA 3DGYA 1LOVA 1B3SA 2AADA 1YGWA 3AHSA 1RCKA 1R4YA 3BU4A 2KF3A 2F4YA 4BIRA 1MGWA 1RN4A 2SARA 1BVIA 5HOHA 2C4BA 1JBTA 1LOYA 1YNVX 1LRAA 1UCJA 1X1XA 1B21A 1G02A 1GOVA 1LOWA 1TTOA 1T2IA 1MGRA 3URPA 1BSDA 5RNTA 1RGLA 1BRHA 1B27A 4J5GA 5BU4A 1BNFA 2KF5A 1RGAA 2F56A 1B20A 3AHWA 1BNRA 1JBRA 1RDSA 2BIRA 1BUJA 1BRJA 5GSPA 1RLSA 1BRNL 1AY7A 1I8VA 2RNTA 1GMQA 1X1WA 3D5GA 1BIRA 3GSPA 3D5IA 2KF6A 1BNEA 2HOHA 1TRPA 2F5MA 1GOUA 1I2GA 1BSEA 1RNBA 1DE3A 1BSBA 1SARA 1IYYA 2KAAA 1YVSA 1FZUA 1Q9EA 1RMSA 1UCIA 1BNSA 2ZA4A 3AGNA 1BAOA 3WR2A 1ZGXA 1B2ZA 6GSPA 1FW7A 1BRKA 1GSPA 1B2XA 1RTUA 3HOHA 1BNIA 4HOHA 1RGHA 4RNTA 9RNTA 1BSCA 1A2PA 1T2HA 1C54A 1RCLA 1HZ1A 1BANA 1BNGA 1BSAA 6RNTA 1DETA 1JBSA 1UCLA 1AQZA 1GMPA 4GSPA 1CH0A 1I0VA 1RGKA 1BRIA 1UCKA 3BIRA 1RSNA 3DH2A 1PYLA 7RNTA 1RGFA 4BU4A 2F5WA 3A5EA 1I2EA 4HAAA 1BGSA 1BRSA 3WHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNT A;  4GHO A;  1B2U A;  2GSP A;  3AGO A;  1HYF A;  1RGG A;  1RGE A;  2AAE A;  1I3I A;  1BU4 A;  3Q3F A;  1BOX A;  1B2M A;  1I2F A;  1X1Y A;  1GMR A;  1RHL A;  1GOY A;  1I3F A;  1RGC A;  2KF4 A;  1FUS A;  1I0X A;  1RNT A;  3KCH A;  1BRG A;  1FUT A;  1FYS A;  1LNI A;  1PY3 A;  7GSP A;  2RBI A;  4J5K A;  8RNT A;  1TRQ A;  1B2S A;  3SYU A;  1RN1 A;  1I70 A;  2BU4 A;  5BIR A;  1BNJ A;  3D4A A;  1X1U A;  3DGY A;  1LOV A;  1B3S A;  2AAD A;  1YGW A;  3AHS A;  1RCK A;  1R4Y A;  3BU4 A;  2KF3 A;  2F4Y A;  4BIR A;  1MGW A;  1RN4 A;  2SAR A;  1BVI A;  5HOH A;  2C4B A;  1JBT A;  1LOY A;  1YNV X;  1LRA A;  1UCJ A;  1X1X A;  1B21 A;  1G02 A;  1GOV A;  1LOW A;  1TTO A;  1T2I A;  1MGR A;  3URP A;  1BSD A;  5RNT A;  1RGL A;  1BRH A;  1B27 A;  4J5G A;  5BU4 A;  1BNF A;  2KF5 A;  1RGA A;  2F56 A;  1B20 A;  3AHW A;  1BNR A;  1JBR A;  1RDS A;  2BIR A;  1BUJ A;  1BRJ A;  5GSP A;  1RLS A;  1BRN L;  1AY7 A;  1I8V A;  2RNT A;  1GMQ A;  1X1W A;  3D5G A;  1BIR A;  3GSP A;  3D5I A;  2KF6 A;  1BNE A;  2HOH A;  1TRP A;  2F5M A;  1GOU A;  1I2G A;  1BSE A;  1RNB A;  1DE3 A;  1BSB A;  1SAR A;  1IYY A;  2KAA A;  1YVS A;  1FZU A;  1Q9E A;  1RMS A;  1UCI A;  1BNS A;  2ZA4 A;  3AGN A;  1BAO A;  3WR2 A;  1ZGX A;  1B2Z A;  6GSP A;  1FW7 A;  1BRK A;  1GSP A;  1B2X A;  1RTU A;  3HOH A;  1BNI A;  4HOH A;  1RGH A;  4RNT A;  9RNT A;  1BSC A;  1A2P A;  1T2H A;  1C54 A;  1RCL A;  1HZ1 A;  1BAN A;  1BNG A;  1BSA A;  6RNT A;  1DET A;  1JBS A;  1UCL A;  1AQZ A;  1GMP A;  4GSP A;  1CH0 A;  1I0V A;  1RGK A;  1BRI A;  1UCK A;  3BIR A;  1RSN A;  3DH2 A;  1PYL A;  7RNT A;  1RGF A;  4BU4 A;  2F5W A;  3A5E A;  1I2E A;  4HAA A;  1BGS A;  1BRS A;  3WHO A; 
#chains in the Genus database with same CATH topology
 4O2H A;  3PGB A;  3HI7 A;  4GHO A;  3AGO A;  3V92 A;  1Q7Y 4;  2CWU A;  2RCD A;  2XFS A;  4IT7 A;  4R9L A;  3EX9 A;  4XBY A;  1JN5 B;  4RNZ A;  1X1Y A;  2XGN A;  3NV0 B;  4QWT A;  1RHL A;  5EVH A;  3FF2 A;  3GRD A;  4KT3 B;  3WA2 X;  2QA4 3;  4K1V A;  1RRH A;  2XH9 A;  1QVF 2;  3B4P A;  4N6U A;  1RNT A;  4N6M A;  3G6E 3;  1ZS7 A;  1U5O A;  1PY3 A;  2K3D A;  4O02 B;  3CME 3;  4WYK B;  4G1M B;  1E3V A;  1NO3 A;  2GU1 A;  3OV4 A;  4NHF A;  1D6U A;  3B7C A;  2CW9 A;  3SYU A;  4NRE A;  3HII A;  1GD4 A;  3G8Z A;  1X1U A;  4LYL B;  3RGR A;  1JJ2 2;  1UGH I;  4EYC A;  2Z7A A;  1R4Y A;  3F9S A;  3LTA A;  3Q2P A;  1W6Y A;  3CC4 3;  3ECF A;  2CFD A;  1MGW A;  4HM1 B;  2W6J H;  2LQV A;  3D9R A;  1UI7 A;  2Y74 A;  2KRT A;  5G1L A;  1IVW A;  2WGO A;  3MHE A;  3FLJ A;  1GY5 A;  1UUW B;  3FCS B;  4FMC A;  4BTY A;  3CCU 3;  2O9U X;  3CPO A;  1T3B A;  1YVB I;  1LRA A;  1B21 A;  1AVK A;  2ML5 A;  1G02 A;  3O8Y A;  2BO9 B;  2CX1 A;  2YFL B;  3Q90 A;  4RNY A;  4AKY A;  2UX0 A;  1MOL A;  2PZV A;  3EF8 A;  3FKA A;  1BSD A;  3LTB A;  3MKI A;  4R9K A;  2B1X B;  2ZDJ A;  1BRH A;  3OWY A;  3NBB A;  5DRE A;  5AEU B;  3UB1 A;  1O7M B;  5LC6 A;  1VQM 3;  1RGA A;  4FCM A;  3LH4 A;  4EBG A;  3I55 3;  4X2H A;  1IV7 A;  2OQE A;  2CH9 A;  1K8A 4;  1BNR A;  1RDS A;  3JUM A;  2GBW B;  4XB5 A;  5EEO A;  3X3Z A;  3DGM A;  4FR9 A;  3FG1 A;  3AMO A;  3G71 3;  1EG9 B;  5GSP A;  1A2V A;  3H51 A;  1AY7 A;  5BXQ A;  3SOA A;  1N8R 4;  2CX0 A;  2WOH A;  3EE1 A;  3GZB A;  3DM8 A;  4LEH A;  1BIR A;  1FGM A;  2IUJ A;  5KP1 A;  3D5I A;  3KKG A;  2KF6 A;  4N6T A;  1KD1 4;  3F8X A;  1JN5 A;  1V74 A;  5HGR A;  4FCJ A;  3NV0 A;  1TRP A;  3CCM 3;  2R41 A;  1DVD A;  3CXC 2;  1BSE A;  1QJG A;  1W02 A;  1WMP A;  4FCZ A;  3UNL A;  1DE3 A;  2OQE C;  4KZ1 A;  1SAR A;  3K9M C;  3JUQ A;  2KAA A;  1CYU A;  3FG4 A;  1QVG 2;  3ALA A;  3BB9 A;  4OK0 A;  3NUV A;  5AIF A;  5IG5 A;  3HZP A;  4WYK A;  1N9E A;  3HX8 A;  3UL6 A;  1UW1 A;  3EBT A;  3MSO A;  2BMQ B;  1B2Z A;  2KCD A;  6GSP A;  1BRK A;  1GSP A;  3S5C A;  3VSY A;  1M1X B;  4HM6 B;  1B2X A;  1A67 A;  5KP4 A;  3LT8 A;  2JDI H;  4HOH A;  3EQQ B;  1YI2 3;  4AKZ A;  4N6L A;  3VF1 A;  1QMA A;  1W7C A;  2XSH B;  4BL3 A;  1C54 A;  1T2H A;  4BL2 A;  1RCL A;  1OAC A;  2R4I A;  3K0Z A;  6RNT A;  1BSA A;  5G2G A;  1QAK A;  1GMP A;  3BNE A;  4HZ9 B;  1I0V A;  1NB3 I;  3S29 A;  1UCK A;  2CFL A;  4CCV A;  2CG0 A;  2W2C A;  3WOD G;  2KXG A;  4BU4 A;  2F5W A;  1IVX A;  1Q7H A;  1BGS A;  1BRS A;  3PS8 A;  4HAA A;  4RZM A;  3RNT A;  1Q86 4;  2W56 B;  2XRX B;  4CJN A;  5ELJ A;  2C10 A;  3MG1 A;  2P0M A;  2AAE A;  3DY5 A;  4HZB B;  5CLK A;  1B2M A;  1TFK A;  3T8N A;  3X3X A;  3DMC A;  3F14 A;  1GMR A;  1TIJ A;  4OVM A;  1GOY A;  1RGC A;  1DMQ A;  2KF4 A;  3GWR A;  3BLZ A;  1AR0 A;  4HM2 B;  4ORL A;  3F40 A;  5IER A;  3LTC A;  2IMJ A;  1W00 A;  1FUS A;  1I0X A;  1EUI C;  3KCH A;  2GEX A;  1NDO B;  1BRG A;  1FYS A;  2OWP A;  2STD A;  5EQL A;  5M18 A;  2RBI A;  2HMO B;  3A76 A;  8RNT A;  3CNX A;  3I56 3;  1YHQ 3;  1PFP A;  1B2S A;  2CWT A;  1RN1 A;  1CEW I;  3X42 A;  2BU4 A;  1O7N B;  1BNJ A;  3QK9 A;  2YFI B;  1LQM B;  1LOV A;  1NNV A;  3NX0 A;  5FGO A;  3BU4 A;  4R4K A;  4BIR A;  1E97 A;  3NM7 A;  3IPT A;  3TDG A;  3S67 A;  3U1W A;  5IG4 A;  4EC6 A;  3CCV 3;  3KSE D;  4MJD A;  3OX9 A;  2WGQ A;  3SX1 A;  2XF3 A;  1BVI A;  2ZHX B;  4FMA A;  2MF7 A;  1JBT A;  4WFO A;  3DZL A;  2QIY A;  3ER7 A;  1LOY A;  4N6O B;  3IMA B;  2E2T A;  4R80 A;  3ZG0 A;  3VGN A;  3KSP A;  1T2I A;  4DKI A;  3JUO A;  3B4O A;  4PEJ A;  3B8L A;  3URP A;  3EN1 B;  4U13 A;  4J8T A;  3D3L A;  1YJN 3;  1VQL 3;  4JRF A;  1RGL A;  1M90 4;  5FW5 A;  1OGZ A;  2KF5 A;  1FGQ A;  1SQW A;  1O7H B;  3AHW A;  3OWU A;  3S27 A;  3LYG A;  3PZW A;  1K9M 4;  1K41 A;  4K1U A;  1GY7 A;  2XEP A;  2K0M A;  3NQY A;  1D6Y A;  2IYJ A;  2W04 A;  3NXJ A;  4GL6 A;  4L8O A;  3J7Y d;  1TUH A;  1VQ6 3;  1TJD A;  1BRN L;  1MWS A;  1MWT A;  2CFW A;  1STF I;  4HVN A;  1ASK A;  1GMQ A;  3CC2 3;  2F98 A;  2Y73 A;  3SOY A;  5AYR B;  1W2B 2;  1BNE A;  2WO0 A;  1A90 A;  1VQP 3;  1N8Q A;  4HYZ A;  5IF6 A;  5CK6 A;  5D83 A;  1JZO A;  1I2G A;  1US1 A;  3N9H A;  1RNB A;  4Q53 A;  1IYY A;  1OCV A;  3HK4 A;  2MC8 A;  1Q9E A;  4HM3 B;  1KC8 4;  2P05 A;  1UCI A;  1BNS A;  4LSO A;  6STD A;  4N6N B;  3KII A;  3WOE B;  2Z6B A;  1WQL B;  1Q81 4;  3EB8 A;  2IA7 A;  2YFJ B;  1MWU A;  5A0O B;  1T5Y A;  3CCE 3;  4X2O A;  3MWZ A;  1V57 A;  1W4N A;  4HM4 B;  4RBN A;  1JRQ A;  2I9W A;  4FMD A;  4IIA A;  3HOH A;  1RGH A;  1R4C A;  3NHX A;  4RNT A;  3CU3 A;  3BNC A;  2Z76 A;  3WA3 A;  3OXA A;  1HZ1 A;  3DGL A;  2CK3 H;  2Z77 A;  1Q82 4;  2PNC A;  1ZO2 A;  3UL5 A;  1STD A;  1OF5 B;  1IT8 A;  1VQ7 3;  1RGK A;  1BRI A;  1OH0 A;  5CXO A;  4EV5 A;  1RSN A;  1PYL A;  1RGF A;  2HML B;  3X40 A;  3M8C A;  1GD3 A;  3DUK A;  3WHO A;  2P0X A;  2ML6 A;  1B2U A;  4JF8 A;  3KZT A;  1D6Z A;  1RGE A;  1KQS 2;  3SVA A;  3Q3F A;  1BOX A;  1I2F A;  2XSO B;  3CCL 3;  1EKM A;  1EQK A;  3LOY A;  1OPY A;  2GEY A;  1ISK A;  1IU7 A;  3DGN A;  1WTH A;  1LXE A;  3F7S A;  5KP3 A;  5CF2 A;  1BUQ A;  1DVC A;  2JQ5 A;  2UUG C;  1RN7 A;  2HMM B;  1IK3 A;  4CDL A;  3CNM A;  2CWV A;  4XDW A;  5IEO A;  4HJL B;  3UJM A;  3JUP A;  7GSP A;  1ULJ B;  3CMA 3;  4J5K A;  4HBR A;  4IPB A;  2BMR B;  1ULI B;  2GXF A;  3N54 B;  1GY6 A;  4HKV B;  4KFE A;  1B3S A;  2Q07 A;  3IJE B;  3ZFZ A;  1YGW A;  1YIT 3;  3NQZ A;  2H0G A;  1VQ8 3;  1UGI A;  1OGX A;  2F4Y A;  2CC3 A;  2KF3 A;  5BVB A;  1NB5 I;  1RN4 A;  2SAR A;  3PXM A;  4LMI A;  5AII A;  1JNQ A;  1UUV B;  1ZX2 A;  3X3Y A;  4ILF A;  5HOH A;  1IQ8 A;  1E3R A;  1Y4K A;  2C4B A;  3E99 A;  4HM0 B;  3V98 A;  3Q1C A;  1YJ9 3;  3G16 A;  2RSX A;  4K90 B;  3OW2 2;  1VQN 3;  2W0Q A;  3WDG B;  2CKF B;  1LOW A;  1MGR A;  1C7H A;  5AI1 A;  5IW9 A;  1DYU A;  4MMY B;  1DMN A;  1QAF A;  2OOV A;  5RNT A;  1IDP A;  1VQO 3;  4J5G A;  4N3V A;  1NJI 4;  1BNF A;  4ZM8 A;  2F56 A;  2WOF A;  3BND A;  4KFD A;  3JVC A;  1IV9 A;  1OHO A;  1O7W B;  1Z1S A;  3PCR A;  3T0U A;  3X41 A;  1PU4 A;  1BUJ A;  1SII A;  3CCS 3;  4KVH A;  1AV4 A;  1RLS A;  4NPB A;  2P09 A;  1VZZ A;  4L7K A;  5JPP A;  5JPU A;  2K54 A;  2HMJ B;  4CPK A;  1JZD A;  2RNT A;  1X1W A;  3D5G A;  1WMN A;  3EN8 A;  1RRL A;  2BT3 A;  2YX9 A;  4BTX A;  2FNQ A;  2OOV C;  4STD A;  2BMO B;  1FGO A;  5ELU A;  2E2V A;  1V58 A;  2F5M A;  1GOU A;  1JB5 A;  1M9G A;  4XDV A;  3SXX A;  3L0R A;  1IQY A;  4LZI A;  1FZU A;  1EEJ A;  1RMS A;  2W9P A;  3LZA A;  3AGN A;  7STD A;  5D81 A;  1VQK 3;  2F86 B;  1F8N A;  4MMX B;  1HKX A;  3GZR A;  4HM5 B;  3WR2 A;  3CCQ 3;  4O8S A;  4WP5 A;  1TU5 A;  1N5P A;  1JKG B;  2L4V A;  1FW7 A;  1SJW A;  1YIJ 3;  2D1W A;  1W5Z A;  2HMN B;  2W56 A;  4K61 A;  5IG3 A;  3KN4 A;  3D79 A;  3LXU X;  1JB4 A;  1KWI A;  1A2P A;  1GS3 A;  3CCR 3;  4I4K A;  1BAN A;  1DET A;  3LML A;  1JBS A;  1UCL A;  1AQZ A;  1M1K 4;  3GZY B;  1HU9 A;  3BIR A;  2HMK B;  3DH2 A;  1S5A A;  3EC9 A;  1W6C A;  1RJO A;  2J8X B;  1CQS A;  1OUN A;  1U8C B;  3RDE A;  5IEN A;  1W2Z A;  1K28 A;  5I97 A;  1SIH A;  2GU3 A;  3HIG A;  2GSP A;  4OUQ A;  2H0H A;  4GB5 A;  5D82 A;  1HYF A;  2XFT A;  1CYV A;  1LOX A;  1RGG A;  5M1A A;  1I3I A;  1BU4 A;  1KSI A;  1YJW 3;  3CCJ 3;  4XBT A;  1RKY A;  3CC7 3;  5CF1 A;  1VQ4 3;  1SPU A;  3I0Y A;  5AEW B;  3EJV A;  2IY2 A;  3MYT A;  1I3F A;  1AVL A;  2CFG A;  1Q40 B;  1YGE A;  2CIU A;  1IT7 A;  3CPW 2;  2H0I A;  3F8H A;  3WOF B;  1UUG B;  3G0K A;  3WMD A;  1N5H A;  5AIH A;  3T8U A;  3GZX B;  5IG0 A;  4TX4 A;  1FUT A;  1LNI A;  1O7P B;  3JUN A;  1K73 4;  1O7G B;  1G96 A;  8CHO A;  1TRQ A;  2A15 A;  2QGU A;  3FZW A;  5M19 A;  1OHS A;  4H3U A;  1I70 A;  2M7O A;  5BIR A;  1VQ9 3;  2INX A;  1MNL A;  2XGL A;  3D4A A;  1NWW A;  2W9Q A;  2AAD A;  1MWR A;  3DGY A;  1TP6 A;  3AHS A;  2XR8 B;  1LQG C;  3ROB A;  3V99 A;  3BNB A;  1RCK A;  3K7C A;  3MPH A;  1VQQ A;  4EV2 A;  2B24 B;  2IUK A;  1JV2 B;  1N9J A;  5LC7 A;  4L8P A;  3U97 A;  5AYS C;  4BTW A;  1UI8 A;  1FGR A;  3KFQ C;  3MG2 A;  3SLU A;  1YNV X;  1VQ5 3;  2FGT A;  4WHA A;  2OTL 3;  1UCJ A;  1UDI I;  2W03 A;  1GYB A;  1JKG A;  1X1X A;  1GOV A;  1LNH A;  1TTO A;  2CG1 A;  1WNH A;  2LYX A;  5JBS A;  1L5G B;  2F99 A;  1S72 3;  2UGI A;  2E2U A;  3S28 A;  3DXO A;  2BHM A;  2CFK A;  3ZG5 A;  2OCT A;  3F7X A;  1B27 A;  3KE7 A;  5STD A;  5BU4 A;  1DMM A;  4J9A A;  5TGN A;  4H61 A;  1JB2 A;  4MMZ B;  1B20 A;  2D42 A;  2C11 A;  3H3H A;  1WMO A;  1JBR A;  2BIR A;  4EW5 A;  1BRJ A;  2L1S A;  1TFO A;  1OHP A;  1I8V A;  4LGQ A;  1G0T A;  4HM7 B;  3LT9 A;  3GSP A;  2CHC A;  3FH1 A;  3EHC A;  1FA3 A;  2HOH A;  3SED A;  1ROV A;  2BNG A;  3PCS A;  3LTD A;  4R1K A;  4O3V A;  3CD6 3;  1Q40 A;  1Q42 A;  3FF0 A;  4AEQ A;  1J2B A;  2RFR A;  1BSB A;  1QAL A;  1IQX A;  1YVS A;  1LVN A;  5IEP A;  2ZA4 A;  1FGT A;  3QRD A;  5AIG A;  1BAO A;  2GBX B;  5G1K A;  1OF5 A;  3STD A;  1ZGX A;  1W6G A;  2QEX 3;  4EXR A;  3K63 A;  4XBX A;  1RTU A;  3N8B A;  1IVU A;  3OWS A;  1BNI A;  3RGA A;  3FG3 A;  4N6V 0;  9RNT A;  1BSC A;  1W01 A;  1NU3 A;  3DGO A;  1FUW A;  3G4S 3;  5DRV A;  2OTJ 3;  2SBL A;  1IVV A;  1ROA A;  2RGQ A;  1BNG A;  2V1L A;  3K5T A;  1EA2 A;  4FMB A;  3GAX A;  3NBR A;  1A2K A;  2O3O A;  1CH0 A;  3MG3 A;  2ZL8 A;  3PYJ A;  4GSP A;  2FXT A;  3FSD A;  4HM8 B;  7RNT A;  3AMO B;  3EBY A;  4I5Q A;  3FGY A;  3NM2 A;  3NBJ A;  2P38 A;  4XM4 A;  3A5E A;  4KFF A;  1I2E A;  4MEI A;  4WWU C; 
#chains in the Genus database with same CATH homology
 3RNT A;  4GHO A;  1B2U A;  2GSP A;  3AGO A;  1HYF A;  1RGG A;  1RGE A;  2AAE A;  1I3I A;  1BU4 A;  3Q3F A;  1BOX A;  1B2M A;  1I2F A;  1X1Y A;  1GMR A;  1RHL A;  1GOY A;  1I3F A;  1RGC A;  2KF4 A;  1FUS A;  1I0X A;  1RNT A;  3KCH A;  1BRG A;  1FUT A;  1FYS A;  1LNI A;  1PY3 A;  7GSP A;  2RBI A;  4J5K A;  8RNT A;  1TRQ A;  1B2S A;  3SYU A;  1RN1 A;  1I70 A;  2BU4 A;  5BIR A;  1BNJ A;  3D4A A;  1X1U A;  3DGY A;  1LOV A;  1B3S A;  2AAD A;  1YGW A;  3AHS A;  1RCK A;  1R4Y A;  3BU4 A;  2KF3 A;  2F4Y A;  4BIR A;  1MGW A;  1RN4 A;  2SAR A;  1BVI A;  5HOH A;  2C4B A;  1JBT A;  1LOY A;  1YNV X;  1LRA A;  1UCJ A;  1X1X A;  1B21 A;  1G02 A;  1GOV A;  1LOW A;  1TTO A;  1T2I A;  1MGR A;  3URP A;  1BSD A;  5RNT A;  1RGL A;  1BRH A;  1B27 A;  4J5G A;  5BU4 A;  1BNF A;  2KF5 A;  1RGA A;  2F56 A;  1B20 A;  3AHW A;  1BNR A;  1JBR A;  1RDS A;  2BIR A;  1BUJ A;  1BRJ A;  5GSP A;  1RLS A;  1BRN L;  1AY7 A;  1I8V A;  2RNT A;  1GMQ A;  1X1W A;  3D5G A;  1BIR A;  3GSP A;  3D5I A;  2KF6 A;  1BNE A;  2HOH A;  1TRP A;  2F5M A;  1GOU A;  1I2G A;  1BSE A;  1RNB A;  1DE3 A;  1BSB A;  1SAR A;  1IYY A;  2KAA A;  1YVS A;  1FZU A;  1Q9E A;  1RMS A;  1UCI A;  1BNS A;  2ZA4 A;  3AGN A;  1BAO A;  3WR2 A;  1ZGX A;  1B2Z A;  6GSP A;  1FW7 A;  1BRK A;  1GSP A;  1B2X A;  1RTU A;  3HOH A;  1BNI A;  4HOH A;  1RGH A;  4RNT A;  9RNT A;  1BSC A;  1A2P A;  1T2H A;  1C54 A;  1RCL A;  1HZ1 A;  1BAN A;  1BNG A;  1BSA A;  6RNT A;  1DET A;  1JBS A;  1UCL A;  1AQZ A;  1GMP A;  4GSP A;  1CH0 A;  1I0V A;  1RGK A;  1BRI A;  1UCK A;  3BIR A;  1RSN A;  3DH2 A;  1PYL A;  7RNT A;  1RGF A;  4BU4 A;  2F5W A;  3A5E A;  1I2E A;  4HAA A;  1BGS A;  1BRS A;  3WHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...