4HAAA

Structure of ribonuclease binase glu43ala/phe81ala mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AVINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAAVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGARNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Structure and functional studies of the ribonuclease binase Glu43Ala/Phe81Ala mutant.
pubmed doi rcsb
source organism Bacillus intermedius
molecule tags Hydrolase
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4haaA00
8RNTA 4J5KA 1JBTA 4HAAA 4GSPA 1GMRA 1LOWA 1A2PA 1BNSA 1RNBA 6GSPA 2HOHA 2KF3A 1LRAA 1GMPA 1RGGA 1BNJA 3AGOA 1B21A 1BRHA 3AHWA 4BU4A 1RGCA 3Q3FA 1BVIA 1RN1A 3D5IA 4BIRA 1GSPA 5HOHA 1B2MA 1BGSA 1I0XA 2KF4A 1LNIA 1YNVX 1JBSA 1B2SA 1BSEA 1I8VA 1B3SA 1JBRA 3AGNA 1PYLA 2F5MA 1B20A 1AY7A 1BRNL 1I2EA 1G02A 1MGWA 1T2IA 2GSPA 1RNTA 2F4YA 1TTOA 2F5WA 1RGEA 1MGRA 2KF5A 1YGWA 9RNTA 1HZ1A 1BRJA 1FUTA 1I0VA 3RNTA 3SYUA 1RDSA 3GSPA 1UCKA 4GHOA 2ZA4A 1FW7A 1GOUA 1X1UA 3KCHA 3HOHA 1CH0A 1YVSA 2AADA 1RN4A 1BRSA 5RNTA 3A5EA 7GSPA 1BIRA 6RNTA 1TRQA 2C4BA 1UCJA 7RNTA 1X1YA 1GMQA 1UCLA 1BSCA 3BU4A 1BNFA 1BNIA 1B2ZA 2BU4A 1BAOA 2KF6A 1HYFA 4J5GA 3BIRA 4HOHA 5BU4A 1FZUA 1RCKA 1BSDA 2F56A 1BNEA 1BSBA 1X1WA 2RNTA 1C54A 2SARA 1BSAA 3AHSA 1BNRA 1ZGXA 1R4YA 1BU4A 3URPA 1LOYA 1SARA 1PY3A 1BOXA 1BRKA 1T2HA 3D4AA 1I2GA 1FUSA 5BIRA 1DE3A 1RGLA 1RLSA 1B2XA 2AAEA 1FYSA 1DETA 3DH2A 3DGYA 1GOVA 1RHLA 1UCIA 1I2FA 1RSNA 1RGKA 1RCLA 1BUJA 1AQZA 1RMSA 1RGFA 1RTUA 4RNTA 3D5GA 1RGAA 1I70A 3WHOA 1BRGA 1LOVA 1BNGA 3WR2A 1BANA 1BRIA 5GSPA 1X1XA 2RBIA 2KAAA 1IYYA 1B27A 1B2UA 2BIRA 1TRPA 1RGHA 1I3FA 1GOYA 1Q9EA 1I3IA
chains in the Genus database with same CATH superfamily
3OX9A 3SOYA 1W02A 4WYKA 8RNTA 2W0QA 4CPKA 1E3VA 3CCU3 1TP6A 4HM7B 5AEUB 1D6YA 1GYBA 1OHPA 3SLUA 3B4PA 1UUWB 1A2PA 4HM4B 5D82A 1HU9A 3NV0A 5D83A 3HIGA 3GAXA 2BMOB 2HOHA 4FMCA 4BL3A 1MWTA 2KF3A 3G0KA 2YX9A 1BRHA 1Q42A 4BU4A 4L8OA 2CG1A 3J7Yd 3BB9A 3D5IA 3UL5A 2P05A 1GSPA 1K28A 1W6GA 1DMNA 1NWWA 3CU3A 1LNIA 1B2SA 3AGNA 3EC9A 1V57A 2F5MA 3CD63 1BRNL 3SOAA 1IQXA 4IPBA 3Q90A 2XGNA 1G02A 1MGWA 1M1K4 1K41A 3JUPA 1K9M4 1AVKA 5CXOA 2W6JH 3PCRA 1F8NA 2OCTA 3V98A 1RGEA 2JQ5A 1MGRA 2OWPA 1RRLA 3KSPA 3BLZA 8CHOA 1GY5A 3QRDA 1N5HA 1OCVA 4GHOA 1O7NB 2XF3A 1GOUA 5DREA 1AR0A 1M904 1X1UA 5G2GA 2O3OA 3DUKA 3CCL3 1YVSA 1ZS7A 1G96A 4LSOA 3BNCA 3JUQA 5IF6A 1JNQA 5RNTA 1OGZA 2HMNB 1CQSA 1VQQA 4KVHA 5ELJA 3S27A 6RNTA 7GSPA 4Q53A 4R9KA 1E3RA 5IG4A 3GZYB 3HIIA 3U97A 5BVBA 1BSCA 3BU4A 4BL2A 1BNFA 1YIJ3 1LXEA 3DGOA 5IERA 4KFFA 1O7WB 2LQVA 4RNZA 3GZXB 4J5GA 2UUGC 2HMOB 4HOHA 1IQ8A 5BU4A 2IUJA 3CCE3 1BSDA 1GD4A 3M8CA 3TDGA 5TGNA 2XEPA 4O2HA 4XBYA 3WODG 3G8ZA 1K8A4 5DRVA 2V1LA 3X3XA 1BNRA 1W6CA 2OQEC 1YJW3 1AV4A 3DXOA 3FF0A 1OHOA 1W2B2 2WOHA 1UGIA 2GEXA 3LTCA 3LZAA 1QJGA 1SARA 2GU3A 2IA7A 3MSOA 1MWSA 3FG3A 3D4AA 4FMDA 2ML5A 2RSXA 1DE3A 2CC3A 4WWUC 1VQ63 4KFEA 1RLSA 2W56A 4KZ1A 3ROBA 2RCDA 2AAEA 1FYSA 1JJ22 1OH0A 4LZIA 5EVHA 1RHLA 4H3UA 2CWUA 3DY5A 3WA2X 1RSNA 4LEHA 1QAFA 4MJDA 4N6UA 1LQMB 4OK0A 1BUJA 3OV4A 5JPUA 3A76A 1AQZA 1RMSA 3T0UA 2QGUA 3D5GA 2CKFB 1RGAA 1D6UA 2JDIH 3NBRA 1BANA 2B1XB 2F99A 3KN4A 5GSPA 1A67A 2GU1A 2BMRB 2KAAA 1HKXA 1IVXA 2KCDA 3LT9A 2E2VA 2W03A 1RGHA 1J2BA 1OHSA 1GOYA 4LYLB 4RZMA 5AYRB 2WOFA 3ECFA 4RBNA 1MWRA 4EV2A 4IT7A 2BO9B 1FGMA 4HAAA 4J5KA 2OTJ3 3FGYA 3B4OA 5LC6A 3G16A 3KSED 3NM7A 1LOWA 2CG0A 1VQ93 3DZLA 3G4S3 3GZRA 2XH9A 2OOVC 3GWRA 1TUHA 4FMBA 1BNSA 4N3VA 4J9AA 1FGTA 2YFIB 2SBLA 1KQS2 1IT7A 3OXAA 3LH4A 3DGLA 3FCSB 1M1XB 2CFWA 1LRAA 1GMPA 3ALAA 3NM2A 3AHWA 1Q7Y4 4AEQA 1OUNA 3K63A 4CCVA 4I5QA 2BHMA 1YGEA 1VZZA 4HM2B 7STDA 1IVWA 2KRTA 1B2MA 3X3ZA 2Z76A 3IMAB 2KF4A 4RNYA 1YNVX 2ML6A 2XSOB 1I8VA 5IEOA 4EXRA 2C10A 3STDA 3CCM3 2UGIA 1AY7A 4BTYA 4NPBA 1Q40B 1I2EA 3DGMA 1TFOA 2GSPA 1TTOA 2CK3H 3FG1A 1G0TA 1K734 2F5WA 1QVG2 3KKGA 3PCSA 1VQ73 2FNQA 4O02B 2CWVA 3SVAA 2CFKA 2IYJA 3CPOA 1I0VA 3FH1A 3SYUA 1RDSA 5IG5A 2ZA4A 4HM1B 1ULIB 4GB5A 3WDGB 1VQ53 1FW7A 3GZBA 1NU3A 3HOHA 4HYZA 2AADA 3G6E3 4R1KA 1T5YA 3D9RA 2H0GA 4EYCA 1RN4A 1U8CB 2HMKB 3A5EA 5KP1A 2HMLB 2Z77A 1BIRA 2W04A 3L0RA 2WGOA 4JF8A 1UCJA 5IG3A 1UDII 3F7SA 3K9MC 5CK6A 1W6YA 1SIIA 2CFDA 5AIHA 1WMPA 1B2ZA 1ROVA 1BAOA 2BU4A 2YFJB 3WOEB 5IEPA 1Q40A 1IDPA 4CJNA 3BIRA 1V58A 4HBRA 2PZVA 3LYGA 1TU5A 1LOXA 4HJLB 2L4VA 4AKZA 1E97A 1SJWA 1BSAA 1PFPA 1YVBI 3NBBA 1DMMA 3AHSA 1ZGXA 1IQYA 2CWTA 1BU4A 1Q7HA 1SQWA 2CX0A 3QK9A 1CYUA 1OF5A 1OACA 2I9WA 2OQEA 1Q864 5FGOA 2W2CA 1PU4A 3SX1A 1NB3I 2D42A 4R4KA 3EJVA 3KZTA 1I2GA 1WMOA 2XSHB 3I553 1RN7A 1SPUA 3MKIA 1NNVA 2B24B 1WMNA 2W56B 2WO0A 3V99A 5KP4A 4X2HA 1B2XA 4AKYA 3BNEA 1YHQ3 2FXTA 3OW22 2KXGA 4GL6A 1NJI4 5AIFA 3EF8A 2XR8B 1GOVA 3MWZA 5KP3A 4ILFA 1RGKA 1RCLA 4HM5B 1RKYA 2M7OA 3EB8A 2D1WA 1RJOA 5G1LA 3X40A 3LTBA 3IJEB 1VQN3 1BUQA 1RGFA 4RNTA 1UI7A 2IMJA 4N6OB 2XFSA 1I70A 3UJMA 1BRGA 1JN5B 1LOVA 2C11A 1BNGA 3BNBA 3WR2A 1BRIA 4ORLA 3N8BA 1O7HB 1X1XA 4G1MB 2RBIA 3RDEA 1IYYA 1B27A 1YIT3 1UUGB 1WQLB 3F40A 1JZOA 1I3FA 1Q9EA 1JZDA 1JKGB 2UX0A 1T3BA 3IPTA 1JBTA 4R9LA 4GSPA 5IG0A 1GMRA 1QMAA 4MMZB 2BNGA 2R41A 5A0OB 3BNDA 1JRQA 4XBTA 1FGOA 4XDVA 2OOVA 3HZPA 1RNBA 4XM4A 3PZWA 3NQZA 4BTXA 1AVLA 1FGQA 2GBWB 3EQQB 5HGRA 1YJ93 4L8PA 2STDA 1RGGA 3LXUX 3AGOA 1B21A 1UUVB 1KSIA 1JN5A 1JB5A 3E99A 3OWYA 1N9EA 4EW5A 3Q3FA 1ZO2A 4PEJA 1BVIA 1S723 1MOLA 3S5CA 1EEJA 4N6V0 4BIRA 1SIHA 5HOHA 3B7CA 3MHEA 1BGSA 3KIIA 3FLJA 4LMIA 1JBSA 1BSEA 1TIJA 5M19A 1JKGA 2K3DA 3CCQ3 1B20A 4OUQA 4K1UA 1NO3A 1ZX2A 2Y74A 3FZWA 3ER7A 3CPW2 2IUKA 4K90B 3Q2PA 2E2UA 1T2IA 4XDWA 6STDA 1RNTA 2RGQA 2ZL8A 3UNLA 1DYUA 2RFRA 3NXJA 3Q1CA 9RNTA 1HZ1A 1BRJA 1FUTA 1Z1SA 3RNTA 2P38A 3GSPA 3X42A 3FF2A 3EE1A 5D81A 3DGNA 3H3HA 2FGTA 3UB1A 4K61A 5AYSC 1W01A 1QALA 1BRSA 1EG9B 2IY2A 4HM0B 1QVF2 1TRQA 4L7KA 3MG1A 4OVMA 4U13A 7RNTA 1X1YA 4TX4A 1N8R4 1GMQA 1UCLA 3LOYA 4X2OA 3CNXA 1VQ83 1BNIA 2MC8A 3EBYA 1WTHA 2QA43 1HYFA 2CH9A 5LC7A 3VF1A 3NHXA 1RCKA 2F56A 2O9UX 5G1KA 3SXXA 4O3VA 3CNMA 4K1VA 1Q814 1VQ43 1MWUA 3EBTA 2K54A 1DVDA 2Z6BA 5AIGA 3EHCA 1R4YA 1OF5B 2XGLA 1FUWA 5STDA 2CFGA 3PS8A 2Z7AA 3PGBA 5BXQA 3PXMA 1PY3A 4N6LA 1BRKA 3ZG5A 3K5TA 1A90A 1O7MB 4JRFA 4NHFA 3CMA3 1MNLA 5BIRA 2BT3A 5AI1A 5EEOA 3SEDA 1RGLA 1STDA 4FR9A 2W9QA 4N6NB 1DETA 4FMAA 3DH2A 3F8XA 3KE7A 1Q824 3CC23 3MG2A 1M9GA 1I2FA 1W00A 1US1A 1YI23 3H51A 2H0IA 1RTUA 5FW5A 1GY7A 4XB5A 2K0MA 3EX9A 4WP5A 1GD3A 2W9PA 2Y73A 4HVNA 3WA3A 2F86B 3I0YA 3AMOB 5ELUA 1N5PA 4N6TA 3RGAA 1W2ZA 3LTDA 1B2UA 1LQGC 1EKMA 3LT8A 1TRPA 3F8HA 2HMMB 1GY6A 4KFDA 3D3LA 3HI7A 5AEWB 2GXFA 4EBGA 3CME3 2J8XB 2HMJB 3VSYA 3F9SA 2R4IA 1OPYA 2CW9A 1JB4A 3X41A 2GEYA 4HM6B 1CYVA 3NQYA 4HM8B 1ISKA 2PNCA 5CLKA 4CDLA 4MMXB 2CHCA 3HX8A 6GSPA 1O7PB 3CCR3 4HM3B 2A15A 1R4CA 4WHAA 1BNJA 1IU7A 1KWIA 1VQL3 3NX0A 2YFLB 1RGCA 1YJN3 4IIAA 3WMDA 3JUNA 1RN1A 1DVCA 3AMOA 3D79A 4N6MA 3B8LA 1O7GB 3U1WA 1UGHI 1I0XA 4FCJA 2P0MA 1VQP3 1ROAA 1B3SA 3GRDA 1JBRA 1PYLA 3DMCA 1IVVA 4J8TA 1FA3A 1STFI 1IVUA 3S28A 1EA2A 2F4YA 2P0XA 1IV9A 2LYXA 3CCJ3 3FSDA 5IW9A 1A2VA 2INXA 2KF5A 1YGWA 3MPHA 1QAKA 5JBSA 1W7CA 1VQM3 5I97A 1UCKA 1N9JA 4FCMA 1D6ZA 3K0ZA 3KCHA 1W5ZA 3JVCA 1CH0A 3CC43 2E2TA 4HZBB 2CFLA 4HZ9B 1NDOB 2BMQB 4H61A 4EV5A 1L5GB 4I4KA 1UW1A 2CX1A 3WOFB 1KD14 3CC73 3KFQC 2C4BA 2QIYA 4EC6A 5M1AA 3ZFZA 4LGQA 2P09A 3NBJA 2MF7A 1UI8A 1S5AA 1OGXA 2ZDJA 4KT3B 1IK3A 3FKAA 3LMLA 2KF6A 4HKVB 1NB5I 1ULJB 4DKIA 5EQLA 5IENA 1VQO3 3F14A 1FZUA 3OWSA 3LTAA 1BNEA 1BSBA 1X1WA 2RNTA 1IV7A 2XFTA 4NREA 3T8NA 3ZG0A 3CCV3 3NUVA 2CIUA 3JUOA 3EN1B 1DMQA 2SARA 3O8YA 3S29A 1C54A 1WNHA 2H0HA 2GBXB 1ASKA 3HK4A 3URPA 4WFOA 5AIIA 2WGQA 1LOYA 5JPPA 1KC84 1EUIC 1C7HA 1Y4KA 1A2KA 1BOXA 3FG4A 1T2HA 1W4NA 4WYKB 3MG3A 1V74A 4ZM8A 5CF1A 1FUSA 3CCS3 3G713 4O8SA 2L1SA 3DM8A 1N8QA 3F7XA 3EN8A 4STDA 3CXC2 1TFKA 4R80A 3DGYA 1GS3A 3N54B 1UCIA 3X3YA 1JB2A 3NV0B 1IT8A 5CF2A 3MYTA 4QWTA 4MMYB 2F98A 3V92A 5M18A 1RRHA 3I563 1TJDA 3RGRA 3WHOA 1JV2B 2XRXB 3OWUA 3N9HA 2Q07A 4XBXA 1LVNA 3JUMA 3UL6A 1LNHA 3VGNA 4BTWA 2QEX3 1VQK3 1EQKA 2OTL3 3PYJA 4FCZA 1FGRA 1U5OA 2BIRA 4MEIA 3S67A 1CEWI 2ZHXB 3T8UA 1I3IA 3K7CA
chains in the Genus database with same CATH topology
8RNTA 4J5KA 1JBTA 4HAAA 4GSPA 1GMRA 1LOWA 1A2PA 1BNSA 1RNBA 6GSPA 2HOHA 2KF3A 1LRAA 1GMPA 1RGGA 1BNJA 3AGOA 1B21A 1BRHA 3AHWA 4BU4A 1RGCA 3Q3FA 1BVIA 1RN1A 3D5IA 4BIRA 1GSPA 5HOHA 1B2MA 1BGSA 1I0XA 2KF4A 1LNIA 1YNVX 1JBSA 1B2SA 1BSEA 1I8VA 1B3SA 1JBRA 3AGNA 1PYLA 2F5MA 1B20A 1AY7A 1BRNL 1I2EA 1G02A 1MGWA 1T2IA 2GSPA 1RNTA 2F4YA 1TTOA 2F5WA 1RGEA 1MGRA 2KF5A 1YGWA 9RNTA 1HZ1A 1BRJA 1FUTA 1I0VA 3RNTA 3SYUA 1RDSA 3GSPA 1UCKA 4GHOA 2ZA4A 1FW7A 1GOUA 1X1UA 3KCHA 3HOHA 1CH0A 1YVSA 2AADA 1RN4A 1BRSA 5RNTA 3A5EA 7GSPA 1BIRA 6RNTA 1TRQA 2C4BA 1UCJA 7RNTA 1X1YA 1GMQA 1UCLA 1BSCA 3BU4A 1BNFA 1BNIA 1B2ZA 2BU4A 1BAOA 2KF6A 1HYFA 4J5GA 3BIRA 4HOHA 5BU4A 1FZUA 1RCKA 1BSDA 2F56A 1BNEA 1BSBA 1X1WA 2RNTA 1C54A 2SARA 1BSAA 3AHSA 1BNRA 1ZGXA 1R4YA 1BU4A 3URPA 1LOYA 1SARA 1PY3A 1BOXA 1BRKA 1T2HA 3D4AA 1I2GA 1FUSA 5BIRA 1DE3A 1RGLA 1RLSA 1B2XA 2AAEA 1FYSA 1DETA 3DH2A 3DGYA 1GOVA 1RHLA 1UCIA 1I2FA 1RSNA 1RGKA 1RCLA 1BUJA 1AQZA 1RMSA 1RGFA 1RTUA 4RNTA 3D5GA 1RGAA 1I70A 3WHOA 1BRGA 1LOVA 1BNGA 3WR2A 1BANA 1BRIA 5GSPA 1X1XA 2RBIA 2KAAA 1IYYA 1B27A 1B2UA 2BIRA 1TRPA 1RGHA 1I3FA 1GOYA 1Q9EA 1I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8RNT A;  4J5K A;  1JBT A;  4HAA A;  4GSP A;  1GMR A;  1LOW A;  1A2P A;  1BNS A;  1RNB A;  6GSP A;  2HOH A;  2KF3 A;  1LRA A;  1GMP A;  1RGG A;  1BNJ A;  3AGO A;  1B21 A;  1BRH A;  3AHW A;  4BU4 A;  1RGC A;  3Q3F A;  1BVI A;  1RN1 A;  3D5I A;  4BIR A;  1GSP A;  5HOH A;  1B2M A;  1BGS A;  1I0X A;  2KF4 A;  1LNI A;  1YNV X;  1JBS A;  1B2S A;  1BSE A;  1I8V A;  1B3S A;  1JBR A;  3AGN A;  1PYL A;  2F5M A;  1B20 A;  1AY7 A;  1BRN L;  1I2E A;  1G02 A;  1MGW A;  1T2I A;  2GSP A;  1RNT A;  2F4Y A;  1TTO A;  2F5W A;  1RGE A;  1MGR A;  2KF5 A;  1YGW A;  9RNT A;  1HZ1 A;  1BRJ A;  1FUT A;  1I0V A;  3RNT A;  3SYU A;  1RDS A;  3GSP A;  1UCK A;  4GHO A;  2ZA4 A;  1FW7 A;  1GOU A;  1X1U A;  3KCH A;  3HOH A;  1CH0 A;  1YVS A;  2AAD A;  1RN4 A;  1BRS A;  5RNT A;  3A5E A;  7GSP A;  1BIR A;  6RNT A;  1TRQ A;  2C4B A;  1UCJ A;  7RNT A;  1X1Y A;  1GMQ A;  1UCL A;  1BSC A;  3BU4 A;  1BNF A;  1BNI A;  1B2Z A;  2BU4 A;  1BAO A;  2KF6 A;  1HYF A;  4J5G A;  3BIR A;  4HOH A;  5BU4 A;  1FZU A;  1RCK A;  1BSD A;  2F56 A;  1BNE A;  1BSB A;  1X1W A;  2RNT A;  1C54 A;  2SAR A;  1BSA A;  3AHS A;  1BNR A;  1ZGX A;  1R4Y A;  1BU4 A;  3URP A;  1LOY A;  1SAR A;  1PY3 A;  1BOX A;  1BRK A;  1T2H A;  3D4A A;  1I2G A;  1FUS A;  5BIR A;  1DE3 A;  1RGL A;  1RLS A;  1B2X A;  2AAE A;  1FYS A;  1DET A;  3DH2 A;  3DGY A;  1GOV A;  1RHL A;  1UCI A;  1I2F A;  1RSN A;  1RGK A;  1RCL A;  1BUJ A;  1AQZ A;  1RMS A;  1RGF A;  1RTU A;  4RNT A;  3D5G A;  1RGA A;  1I70 A;  3WHO A;  1BRG A;  1LOV A;  1BNG A;  3WR2 A;  1BAN A;  1BRI A;  5GSP A;  1X1X A;  2RBI A;  2KAA A;  1IYY A;  1B27 A;  1B2U A;  2BIR A;  1TRP A;  1RGH A;  1I3F A;  1GOY A;  1Q9E A;  1I3I A; 
#chains in the Genus database with same CATH topology
 3OX9 A;  3SOY A;  1W02 A;  4WYK A;  8RNT A;  2W0Q A;  4CPK A;  1E3V A;  3CCU 3;  1TP6 A;  4HM7 B;  5AEU B;  1D6Y A;  1GYB A;  1OHP A;  3SLU A;  3B4P A;  1UUW B;  1A2P A;  4HM4 B;  5D82 A;  1HU9 A;  3NV0 A;  5D83 A;  3HIG A;  3GAX A;  2BMO B;  2HOH A;  4FMC A;  4BL3 A;  1MWT A;  2KF3 A;  3G0K A;  2YX9 A;  1BRH A;  1Q42 A;  4BU4 A;  4L8O A;  2CG1 A;  3J7Y d;  3BB9 A;  3D5I A;  3UL5 A;  2P05 A;  1GSP A;  1K28 A;  1W6G A;  1DMN A;  1NWW A;  3CU3 A;  1LNI A;  1B2S A;  3AGN A;  3EC9 A;  1V57 A;  2F5M A;  3CD6 3;  1BRN L;  3SOA A;  1IQX A;  4IPB A;  3Q90 A;  2XGN A;  1G02 A;  1MGW A;  1M1K 4;  1K41 A;  3JUP A;  1K9M 4;  1AVK A;  5CXO A;  2W6J H;  3PCR A;  1F8N A;  2OCT A;  3V98 A;  1RGE A;  2JQ5 A;  1MGR A;  2OWP A;  1RRL A;  3KSP A;  3BLZ A;  8CHO A;  1GY5 A;  3QRD A;  1N5H A;  1OCV A;  4GHO A;  1O7N B;  2XF3 A;  1GOU A;  5DRE A;  1AR0 A;  1M90 4;  1X1U A;  5G2G A;  2O3O A;  3DUK A;  3CCL 3;  1YVS A;  1ZS7 A;  1G96 A;  4LSO A;  3BNC A;  3JUQ A;  5IF6 A;  1JNQ A;  5RNT A;  1OGZ A;  2HMN B;  1CQS A;  1VQQ A;  4KVH A;  5ELJ A;  3S27 A;  6RNT A;  7GSP A;  4Q53 A;  4R9K A;  1E3R A;  5IG4 A;  3GZY B;  3HII A;  3U97 A;  5BVB A;  1BSC A;  3BU4 A;  4BL2 A;  1BNF A;  1YIJ 3;  1LXE A;  3DGO A;  5IER A;  4KFF A;  1O7W B;  2LQV A;  4RNZ A;  3GZX B;  4J5G A;  2UUG C;  2HMO B;  4HOH A;  1IQ8 A;  5BU4 A;  2IUJ A;  3CCE 3;  1BSD A;  1GD4 A;  3M8C A;  3TDG A;  5TGN A;  2XEP A;  4O2H A;  4XBY A;  3WOD G;  3G8Z A;  1K8A 4;  5DRV A;  2V1L A;  3X3X A;  1BNR A;  1W6C A;  2OQE C;  1YJW 3;  1AV4 A;  3DXO A;  3FF0 A;  1OHO A;  1W2B 2;  2WOH A;  1UGI A;  2GEX A;  3LTC A;  3LZA A;  1QJG A;  1SAR A;  2GU3 A;  2IA7 A;  3MSO A;  1MWS A;  3FG3 A;  3D4A A;  4FMD A;  2ML5 A;  2RSX A;  1DE3 A;  2CC3 A;  4WWU C;  1VQ6 3;  4KFE A;  1RLS A;  2W56 A;  4KZ1 A;  3ROB A;  2RCD A;  2AAE A;  1FYS A;  1JJ2 2;  1OH0 A;  4LZI A;  5EVH A;  1RHL A;  4H3U A;  2CWU A;  3DY5 A;  3WA2 X;  1RSN A;  4LEH A;  1QAF A;  4MJD A;  4N6U A;  1LQM B;  4OK0 A;  1BUJ A;  3OV4 A;  5JPU A;  3A76 A;  1AQZ A;  1RMS A;  3T0U A;  2QGU A;  3D5G A;  2CKF B;  1RGA A;  1D6U A;  2JDI H;  3NBR A;  1BAN A;  2B1X B;  2F99 A;  3KN4 A;  5GSP A;  1A67 A;  2GU1 A;  2BMR B;  2KAA A;  1HKX A;  1IVX A;  2KCD A;  3LT9 A;  2E2V A;  2W03 A;  1RGH A;  1J2B A;  1OHS A;  1GOY A;  4LYL B;  4RZM A;  5AYR B;  2WOF A;  3ECF A;  4RBN A;  1MWR A;  4EV2 A;  4IT7 A;  2BO9 B;  1FGM A;  4HAA A;  4J5K A;  2OTJ 3;  3FGY A;  3B4O A;  5LC6 A;  3G16 A;  3KSE D;  3NM7 A;  1LOW A;  2CG0 A;  1VQ9 3;  3DZL A;  3G4S 3;  3GZR A;  2XH9 A;  2OOV C;  3GWR A;  1TUH A;  4FMB A;  1BNS A;  4N3V A;  4J9A A;  1FGT A;  2YFI B;  2SBL A;  1KQS 2;  1IT7 A;  3OXA A;  3LH4 A;  3DGL A;  3FCS B;  1M1X B;  2CFW A;  1LRA A;  1GMP A;  3ALA A;  3NM2 A;  3AHW A;  1Q7Y 4;  4AEQ A;  1OUN A;  3K63 A;  4CCV A;  4I5Q A;  2BHM A;  1YGE A;  1VZZ A;  4HM2 B;  7STD A;  1IVW A;  2KRT A;  1B2M A;  3X3Z A;  2Z76 A;  3IMA B;  2KF4 A;  4RNY A;  1YNV X;  2ML6 A;  2XSO B;  1I8V A;  5IEO A;  4EXR A;  2C10 A;  3STD A;  3CCM 3;  2UGI A;  1AY7 A;  4BTY A;  4NPB A;  1Q40 B;  1I2E A;  3DGM A;  1TFO A;  2GSP A;  1TTO A;  2CK3 H;  3FG1 A;  1G0T A;  1K73 4;  2F5W A;  1QVG 2;  3KKG A;  3PCS A;  1VQ7 3;  2FNQ A;  4O02 B;  2CWV A;  3SVA A;  2CFK A;  2IYJ A;  3CPO A;  1I0V A;  3FH1 A;  3SYU A;  1RDS A;  5IG5 A;  2ZA4 A;  4HM1 B;  1ULI B;  4GB5 A;  3WDG B;  1VQ5 3;  1FW7 A;  3GZB A;  1NU3 A;  3HOH A;  4HYZ A;  2AAD A;  3G6E 3;  4R1K A;  1T5Y A;  3D9R A;  2H0G A;  4EYC A;  1RN4 A;  1U8C B;  2HMK B;  3A5E A;  5KP1 A;  2HML B;  2Z77 A;  1BIR A;  2W04 A;  3L0R A;  2WGO A;  4JF8 A;  1UCJ A;  5IG3 A;  1UDI I;  3F7S A;  3K9M C;  5CK6 A;  1W6Y A;  1SII A;  2CFD A;  5AIH A;  1WMP A;  1B2Z A;  1ROV A;  1BAO A;  2BU4 A;  2YFJ B;  3WOE B;  5IEP A;  1Q40 A;  1IDP A;  4CJN A;  3BIR A;  1V58 A;  4HBR A;  2PZV A;  3LYG A;  1TU5 A;  1LOX A;  4HJL B;  2L4V A;  4AKZ A;  1E97 A;  1SJW A;  1BSA A;  1PFP A;  1YVB I;  3NBB A;  1DMM A;  3AHS A;  1ZGX A;  1IQY A;  2CWT A;  1BU4 A;  1Q7H A;  1SQW A;  2CX0 A;  3QK9 A;  1CYU A;  1OF5 A;  1OAC A;  2I9W A;  2OQE A;  1Q86 4;  5FGO A;  2W2C A;  1PU4 A;  3SX1 A;  1NB3 I;  2D42 A;  4R4K A;  3EJV A;  3KZT A;  1I2G A;  1WMO A;  2XSH B;  3I55 3;  1RN7 A;  1SPU A;  3MKI A;  1NNV A;  2B24 B;  1WMN A;  2W56 B;  2WO0 A;  3V99 A;  5KP4 A;  4X2H A;  1B2X A;  4AKY A;  3BNE A;  1YHQ 3;  2FXT A;  3OW2 2;  2KXG A;  4GL6 A;  1NJI 4;  5AIF A;  3EF8 A;  2XR8 B;  1GOV A;  3MWZ A;  5KP3 A;  4ILF A;  1RGK A;  1RCL A;  4HM5 B;  1RKY A;  2M7O A;  3EB8 A;  2D1W A;  1RJO A;  5G1L A;  3X40 A;  3LTB A;  3IJE B;  1VQN 3;  1BUQ A;  1RGF A;  4RNT A;  1UI7 A;  2IMJ A;  4N6O B;  2XFS A;  1I70 A;  3UJM A;  1BRG A;  1JN5 B;  1LOV A;  2C11 A;  1BNG A;  3BNB A;  3WR2 A;  1BRI A;  4ORL A;  3N8B A;  1O7H B;  1X1X A;  4G1M B;  2RBI A;  3RDE A;  1IYY A;  1B27 A;  1YIT 3;  1UUG B;  1WQL B;  3F40 A;  1JZO A;  1I3F A;  1Q9E A;  1JZD A;  1JKG B;  2UX0 A;  1T3B A;  3IPT A;  1JBT A;  4R9L A;  4GSP A;  5IG0 A;  1GMR A;  1QMA A;  4MMZ B;  2BNG A;  2R41 A;  5A0O B;  3BND A;  1JRQ A;  4XBT A;  1FGO A;  4XDV A;  2OOV A;  3HZP A;  1RNB A;  4XM4 A;  3PZW A;  3NQZ A;  4BTX A;  1AVL A;  1FGQ A;  2GBW B;  3EQQ B;  5HGR A;  1YJ9 3;  4L8P A;  2STD A;  1RGG A;  3LXU X;  3AGO A;  1B21 A;  1UUV B;  1KSI A;  1JN5 A;  1JB5 A;  3E99 A;  3OWY A;  1N9E A;  4EW5 A;  3Q3F A;  1ZO2 A;  4PEJ A;  1BVI A;  1S72 3;  1MOL A;  3S5C A;  1EEJ A;  4N6V 0;  4BIR A;  1SIH A;  5HOH A;  3B7C A;  3MHE A;  1BGS A;  3KII A;  3FLJ A;  4LMI A;  1JBS A;  1BSE A;  1TIJ A;  5M19 A;  1JKG A;  2K3D A;  3CCQ 3;  1B20 A;  4OUQ A;  4K1U A;  1NO3 A;  1ZX2 A;  2Y74 A;  3FZW A;  3ER7 A;  3CPW 2;  2IUK A;  4K90 B;  3Q2P A;  2E2U A;  1T2I A;  4XDW A;  6STD A;  1RNT A;  2RGQ A;  2ZL8 A;  3UNL A;  1DYU A;  2RFR A;  3NXJ A;  3Q1C A;  9RNT A;  1HZ1 A;  1BRJ A;  1FUT A;  1Z1S A;  3RNT A;  2P38 A;  3GSP A;  3X42 A;  3FF2 A;  3EE1 A;  5D81 A;  3DGN A;  3H3H A;  2FGT A;  3UB1 A;  4K61 A;  5AYS C;  1W01 A;  1QAL A;  1BRS A;  1EG9 B;  2IY2 A;  4HM0 B;  1QVF 2;  1TRQ A;  4L7K A;  3MG1 A;  4OVM A;  4U13 A;  7RNT A;  1X1Y A;  4TX4 A;  1N8R 4;  1GMQ A;  1UCL A;  3LOY A;  4X2O A;  3CNX A;  1VQ8 3;  1BNI A;  2MC8 A;  3EBY A;  1WTH A;  2QA4 3;  1HYF A;  2CH9 A;  5LC7 A;  3VF1 A;  3NHX A;  1RCK A;  2F56 A;  2O9U X;  5G1K A;  3SXX A;  4O3V A;  3CNM A;  4K1V A;  1Q81 4;  1VQ4 3;  1MWU A;  3EBT A;  2K54 A;  1DVD A;  2Z6B A;  5AIG A;  3EHC A;  1R4Y A;  1OF5 B;  2XGL A;  1FUW A;  5STD A;  2CFG A;  3PS8 A;  2Z7A A;  3PGB A;  5BXQ A;  3PXM A;  1PY3 A;  4N6L A;  1BRK A;  3ZG5 A;  3K5T A;  1A90 A;  1O7M B;  4JRF A;  4NHF A;  3CMA 3;  1MNL A;  5BIR A;  2BT3 A;  5AI1 A;  5EEO A;  3SED A;  1RGL A;  1STD A;  4FR9 A;  2W9Q A;  4N6N B;  1DET A;  4FMA A;  3DH2 A;  3F8X A;  3KE7 A;  1Q82 4;  3CC2 3;  3MG2 A;  1M9G A;  1I2F A;  1W00 A;  1US1 A;  1YI2 3;  3H51 A;  2H0I A;  1RTU A;  5FW5 A;  1GY7 A;  4XB5 A;  2K0M A;  3EX9 A;  4WP5 A;  1GD3 A;  2W9P A;  2Y73 A;  4HVN A;  3WA3 A;  2F86 B;  3I0Y A;  3AMO B;  5ELU A;  1N5P A;  4N6T A;  3RGA A;  1W2Z A;  3LTD A;  1B2U A;  1LQG C;  1EKM A;  3LT8 A;  1TRP A;  3F8H A;  2HMM B;  1GY6 A;  4KFD A;  3D3L A;  3HI7 A;  5AEW B;  2GXF A;  4EBG A;  3CME 3;  2J8X B;  2HMJ B;  3VSY A;  3F9S A;  2R4I A;  1OPY A;  2CW9 A;  1JB4 A;  3X41 A;  2GEY A;  4HM6 B;  1CYV A;  3NQY A;  4HM8 B;  1ISK A;  2PNC A;  5CLK A;  4CDL A;  4MMX B;  2CHC A;  3HX8 A;  6GSP A;  1O7P B;  3CCR 3;  4HM3 B;  2A15 A;  1R4C A;  4WHA A;  1BNJ A;  1IU7 A;  1KWI A;  1VQL 3;  3NX0 A;  2YFL B;  1RGC A;  1YJN 3;  4IIA A;  3WMD A;  3JUN A;  1RN1 A;  1DVC A;  3AMO A;  3D79 A;  4N6M A;  3B8L A;  1O7G B;  3U1W A;  1UGH I;  1I0X A;  4FCJ A;  2P0M A;  1VQP 3;  1ROA A;  1B3S A;  3GRD A;  1JBR A;  1PYL A;  3DMC A;  1IVV A;  4J8T A;  1FA3 A;  1STF I;  1IVU A;  3S28 A;  1EA2 A;  2F4Y A;  2P0X A;  1IV9 A;  2LYX A;  3CCJ 3;  3FSD A;  5IW9 A;  1A2V A;  2INX A;  2KF5 A;  1YGW A;  3MPH A;  1QAK A;  5JBS A;  1W7C A;  1VQM 3;  5I97 A;  1UCK A;  1N9J A;  4FCM A;  1D6Z A;  3K0Z A;  3KCH A;  1W5Z A;  3JVC A;  1CH0 A;  3CC4 3;  2E2T A;  4HZB B;  2CFL A;  4HZ9 B;  1NDO B;  2BMQ B;  4H61 A;  4EV5 A;  1L5G B;  4I4K A;  1UW1 A;  2CX1 A;  3WOF B;  1KD1 4;  3CC7 3;  3KFQ C;  2C4B A;  2QIY A;  4EC6 A;  5M1A A;  3ZFZ A;  4LGQ A;  2P09 A;  3NBJ A;  2MF7 A;  1UI8 A;  1S5A A;  1OGX A;  2ZDJ A;  4KT3 B;  1IK3 A;  3FKA A;  3LML A;  2KF6 A;  4HKV B;  1NB5 I;  1ULJ B;  4DKI A;  5EQL A;  5IEN A;  1VQO 3;  3F14 A;  1FZU A;  3OWS A;  3LTA A;  1BNE A;  1BSB A;  1X1W A;  2RNT A;  1IV7 A;  2XFT A;  4NRE A;  3T8N A;  3ZG0 A;  3CCV 3;  3NUV A;  2CIU A;  3JUO A;  3EN1 B;  1DMQ A;  2SAR A;  3O8Y A;  3S29 A;  1C54 A;  1WNH A;  2H0H A;  2GBX B;  1ASK A;  3HK4 A;  3URP A;  4WFO A;  5AII A;  2WGQ A;  1LOY A;  5JPP A;  1KC8 4;  1EUI C;  1C7H A;  1Y4K A;  1A2K A;  1BOX A;  3FG4 A;  1T2H A;  1W4N A;  4WYK B;  3MG3 A;  1V74 A;  4ZM8 A;  5CF1 A;  1FUS A;  3CCS 3;  3G71 3;  4O8S A;  2L1S A;  3DM8 A;  1N8Q A;  3F7X A;  3EN8 A;  4STD A;  3CXC 2;  1TFK A;  4R80 A;  3DGY A;  1GS3 A;  3N54 B;  1UCI A;  3X3Y A;  1JB2 A;  3NV0 B;  1IT8 A;  5CF2 A;  3MYT A;  4QWT A;  4MMY B;  2F98 A;  3V92 A;  5M18 A;  1RRH A;  3I56 3;  1TJD A;  3RGR A;  3WHO A;  1JV2 B;  2XRX B;  3OWU A;  3N9H A;  2Q07 A;  4XBX A;  1LVN A;  3JUM A;  3UL6 A;  1LNH A;  3VGN A;  4BTW A;  2QEX 3;  1VQK 3;  1EQK A;  2OTL 3;  3PYJ A;  4FCZ A;  1FGR A;  1U5O A;  2BIR A;  4MEI A;  3S67 A;  1CEW I;  2ZHX B;  3T8U A;  1I3I A;  3K7C A; 
#chains in the Genus database with same CATH homology
 8RNT A;  4J5K A;  1JBT A;  4HAA A;  4GSP A;  1GMR A;  1LOW A;  1A2P A;  1BNS A;  1RNB A;  6GSP A;  2HOH A;  2KF3 A;  1LRA A;  1GMP A;  1RGG A;  1BNJ A;  3AGO A;  1B21 A;  1BRH A;  3AHW A;  4BU4 A;  1RGC A;  3Q3F A;  1BVI A;  1RN1 A;  3D5I A;  4BIR A;  1GSP A;  5HOH A;  1B2M A;  1BGS A;  1I0X A;  2KF4 A;  1LNI A;  1YNV X;  1JBS A;  1B2S A;  1BSE A;  1I8V A;  1B3S A;  1JBR A;  3AGN A;  1PYL A;  2F5M A;  1B20 A;  1AY7 A;  1BRN L;  1I2E A;  1G02 A;  1MGW A;  1T2I A;  2GSP A;  1RNT A;  2F4Y A;  1TTO A;  2F5W A;  1RGE A;  1MGR A;  2KF5 A;  1YGW A;  9RNT A;  1HZ1 A;  1BRJ A;  1FUT A;  1I0V A;  3RNT A;  3SYU A;  1RDS A;  3GSP A;  1UCK A;  4GHO A;  2ZA4 A;  1FW7 A;  1GOU A;  1X1U A;  3KCH A;  3HOH A;  1CH0 A;  1YVS A;  2AAD A;  1RN4 A;  1BRS A;  5RNT A;  3A5E A;  7GSP A;  1BIR A;  6RNT A;  1TRQ A;  2C4B A;  1UCJ A;  7RNT A;  1X1Y A;  1GMQ A;  1UCL A;  1BSC A;  3BU4 A;  1BNF A;  1BNI A;  1B2Z A;  2BU4 A;  1BAO A;  2KF6 A;  1HYF A;  4J5G A;  3BIR A;  4HOH A;  5BU4 A;  1FZU A;  1RCK A;  1BSD A;  2F56 A;  1BNE A;  1BSB A;  1X1W A;  2RNT A;  1C54 A;  2SAR A;  1BSA A;  3AHS A;  1BNR A;  1ZGX A;  1R4Y A;  1BU4 A;  3URP A;  1LOY A;  1SAR A;  1PY3 A;  1BOX A;  1BRK A;  1T2H A;  3D4A A;  1I2G A;  1FUS A;  5BIR A;  1DE3 A;  1RGL A;  1RLS A;  1B2X A;  2AAE A;  1FYS A;  1DET A;  3DH2 A;  3DGY A;  1GOV A;  1RHL A;  1UCI A;  1I2F A;  1RSN A;  1RGK A;  1RCL A;  1BUJ A;  1AQZ A;  1RMS A;  1RGF A;  1RTU A;  4RNT A;  3D5G A;  1RGA A;  1I70 A;  3WHO A;  1BRG A;  1LOV A;  1BNG A;  3WR2 A;  1BAN A;  1BRI A;  5GSP A;  1X1X A;  2RBI A;  2KAA A;  1IYY A;  1B27 A;  1B2U A;  2BIR A;  1TRP A;  1RGH A;  1I3F A;  1GOY A;  1Q9E A;  1I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...