4HARA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
b'EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4harA00
4HBEA 4HBOA 4HARA
chains in the Genus database with same CATH superfamily
1FKJA 4HARA 1W1PA 2D9FA 1WAWA 3WD3A 3CHCA 4ODRA 1W1VA 3AQUA 2MF9A 4ODKA 2DPEA 5HWBA 1JNTA 2PV1A 4LAWA 2FAPA 4JFKA 2DG3A 5B8IC 1LL7A 4QZVB 4LAVA 3IK8A 3ARSA 2KO7A 4DRKA 3B9DA 3O5PA 3KADA 4DROA 4QT3A 2JZVA 3NTPA 4FN2A 4Z2GA 2QF8A 2RURA 4S3KA 2RUCA 3O5GA 5HBFA 4J4NA 3ARWA 3PRBA 3QOKA 3TC5A 4WK9A 2ZR4A 4DRMA 1FKGA 3W4RA 1NWTA 2IUZA 4NZCA 1LL6A 3ALFA 3AS1A 2DT3A 1QZ2A 2MLXA 3ARPA 4Q7NA 4LAXA 1Q6HA 3WD1A 2PN0A 3AROA 3H9RB 3KAFA 4MNMA 4Z2JA 3GTYX 4MSPA 2O9OA 1J4IA 1N1AA 4DH0A 3RFWA 4Z2HA 2F21A 1F8AB 1TFVA 1ZK6A 3PRAA 4MNLA 4W5UA 4XAKA 2LPVA 3WQVA 2RQSA 1GOIA 1GUVA 3IKGA 3JYJA 1WNOA 1Q6UA 4WKHA 4KQZA 2K8IA 2PPNA 1FKSA 1QPLA 2YBUA 4U86A 2MPHA 4TW7A 4Z2IA 4TW8A 2ITKA 3GU0A 3ARUA 1Y0OA 4ZPWR 1L1PA 1W9PA 1FKLA 1ZU8A 2RSEA 1NSGA 1HJVA 1R9HA 2B5UB 2DSUA 4P8UA 4ZS6A 3O5JA 1LL4A 4DWSD 4N19A 1PINA 3CH9A 5DIVA 1IX5A 3NRKA 4Q22A 3CHFA 4KR0B 3JYMA 2ESCA 1HKKA 3IHZA 4Z2LA 1E15A 4WJXA 5HTGA 1HKMA 4DRQA 4ODQA 1M5YA 4R5EA 2MLZA 4ODNA 3JXVA 1D2KA 2WK2A 3KAGA 4ML4A 1W9VA 1SR0A 2F4EA 4JYSA 2WLYA 4DWSC 2XP7A 4MNJA 2XP9A 1FAPA 1TCOC 5HW8A 1H0GA 1FKIA 1E44A 1FFQA 3ARVA 5HW6A 2N87A 1OWQA 2P4VA 4DRHA 2MNTA 1LG1A 1CTNA 5HKGA 3ODKA 1E9LA 1D7JA 2UZ5A 3UI6A 4DZ3A 4C02B 1GPFA 3PA7A 2MLYA 5DIUA 1NWSA 1EHNA 3O5RA 3CGMA 1ROUA 3EY6A 5DF0A 2XP3A 4W9QA 1X6LA 2LKNA 2Y78A 3RM8A 1FKHA 4TW6A 1P5QA 4Z2KA 3UF8A 2YBTA 4L72B 1FKFA 1ZBWA 3OOBA 3ARYA 4IQ2A 2DSZA 2IF4A 1FJDA 3WKZA 1VF8A 1WB0A 1F40A 1ZL1A 4DRJA 3BMBA 5J6EA 1D6OA 1PBKA 5D75A 3UQBA 4WKAA 2RUDA 1GRJA 1EDQA 4U84A 3FAPA 2AWGA 3TCZA 1LJYA 1J4RA 3TDBA 3WIJA 3O5EA 2B31A 1ZBKA 2ZQUA 2M1IA 1Q1CA 3KZ7A 5GQBA 2DG9A 1NWUA 2O92A 1EIBA 1HJWA 4TYOA 2KE0A 3O5OA 3WD0A 3ARZA 3WL1A 4QT2A 3PR9A 2VN1A 1ZBCA 1JVWA 3PRDA 5HT1A 1W1YA 2RUQA 4ODMA 2WM0A 1K9TA 1FFRA 4LAYA 4DIPA 3BXWA 3UQAA 2EULA 2PBCA 1SYTA 4P8WA 3O5IA 2WLZA 3ARTA 4U85A 4PTMA 4MPKA 1J4HA 3FXYA 1FKKA 3CZ8A 5DO2A 4DWSA 2VCDA 3ARXA 3O5MA 2PV2A 1OGGA 3WD4A 4L3NA 2XP4A 1B6CA 3AS0A 4DRIA 3KAHA 1E6RA 1JNDA 2ZQTA 1XHGA 3O5LA 3RMEA 1YATA 1QPFA 4DRNA 1EYMA 3B7XA 2KFWA 4IT4A 4DRPA 4NNRA 2ZQVA 3KABA 5I98A 1H0IA 1EQ3A 4DWSB 3AS3A 4WIWA 5HWCA 2PPOA 1D7IA 1NMWA 2G41A 2KR7A 5GPGA 4GIVA 3O5FA 3ALGA 4LGXA 3RM4A 2DSVA 3IKDA 4G2PA 3RGCA 2A3EA 4MTVA 5DITA 1FKBA 2F23A 3G6LA 4IQCA 5HUAA 3WL0A 2XP5A 4JFMA 4URIA 4ODOA 3I6CA 4P8VA 3O5KA 1KT1A 4R0XA 4ZPTR 1FKRA 2OLHA 2DT1A 1ZCNA 3ARRA 3GPKA 2DT2A 4TNSA 4AY1A 4O2TA 2ZQSA 4DT4A 3B8SA 4DZ2A 2FDMA 3AS2A 3VAWA 4FAPA 1HKJA 1ITXA 3LUOA 1FD9A 1UR8A 3KACA 1JNEA 3UI5A 4HBEA 1NH6A 3CGNA 3B9EA 2OFNA 1KT0A 1UR9A 2G8ZA 2XPBA 1E6ZA 4S3JA 2KGJA 4TX0A 1NWRA 5BXJA 2XP8A 1HXVA 3EIPA 2PI6A 2PV3A 4QIBA 4G50A 3UQIA 2A3CA 4JFIA 2A3AA 4BF8A 4MNKA 3FY1A 4ODLA 2LGOA 1HKIA 5GPRA 1W1TA 1E6NA 3G6MA 4ITZA 4W9OA 1BKFA 4MGVA 1OGBA 1ROTA 1D7HA 2FKEA 1W26A 2M08A 1FKDA 1X6NA 4IT6A 1HJXA 4HBOA 1J6YA 1JNSA 1W9UA 4IPXA 3KCEA 3B9AA 3WQWA 2XP6A 2F2DA 1RD6A 2M2AA 3KAIA 3O5DA 1A7XA 3RM9A 5DEZA 1LG2A 3O5QA 1NMVA 1T11A 2L2SA 3CHDA 3NI6A 2PPPA 1YW5A 2LJ4A 4NSBA 1ZBVA 4P8XA 1ZB5A 1U79A 2AOSA 2DSWA 1FKTA 1Q6IA 1XRVA 3WH0A 2KI3A 2ZR6A 2ETNA 1E6PA 2XPAA 3OA5A 4MAVA 4GGQA 1JCHB 3UI4A 2A3BA 1O6IA 3ARQA 4JFLA 4J4OA 5HW7A 2ZR5A 4WKFA 4W9PA 2DT0A 4UDMA 2DG4A 3MDYB 2Q5AA 4JFJA 3WD2A 1C9HA 4ZPVR 1BL4A 5JH8A 1KFWA 4ODPA 3CHEA 1LQ0A
chains in the Genus database with same CATH topology
1FKJA 4HARA 1W1PA 2D9FA 1WAWA 3WD3A 3CHCA 4ODRA 1W1VA 3AQUA 2MF9A 4ODKA 2DPEA 5HWBA 1JNTA 2PV1A 4LAWA 2FAPA 4JFKA 2DG3A 5B8IC 1LL7A 4QZVB 4LAVA 3IK8A 3ARSA 2KO7A 4DRKA 3B9DA 3O5PA 3KADA 4DROA 4QT3A 2JZVA 3NTPA 4FN2A 4Z2GA 2QF8A 2RURA 4S3KA 2RUCA 3O5GA 5HBFA 4J4NA 3ARWA 3PRBA 3QOKA 3TC5A 4WK9A 2ZR4A 4DRMA 1FKGA 3W4RA 1NWTA 2IUZA 4NZCA 1LL6A 3ALFA 3AS1A 2DT3A 1QZ2A 2MLXA 3ARPA 4Q7NA 4LAXA 1Q6HA 3WD1A 3AROA 3H9RB 3KAFA 4MNMA 4Z2JA 4MSPA 2O9OA 1J4IA 1N1AA 4DH0A 3RFWA 4Z2HA 2F21A 1F8AB 1TFVA 1ZK6A 3PRAA 4MNLA 4W5UA 4XAKA 2LPVA 3WQVA 2RQSA 1GOIA 1GUVA 3IKGA 3JYJA 1WNOA 1Q6UA 4WKHA 4KQZA 2K8IA 2PPNA 1FKSA 1QPLA 2YBUA 4U86A 2MPHA 4TW7A 4Z2IA 4TW8A 2ITKA 3ARUA 1Y0OA 4ZPWR 1L1PA 1W9PA 1FKLA 1ZU8A 2RSEA 1NSGA 1HJVA 1R9HA 2DSUA 4P8UA 4ZS6A 3O5JA 1LL4A 4DWSD 4N19A 1PINA 3CH9A 5DIVA 1IX5A 3NRKA 4Q22A 3CHFA 4KR0B 3JYMA 2ESCA 1HKKA 3IHZA 4Z2LA 1E15A 4WJXA 5HTGA 1HKMA 4DRQA 4ODQA 1M5YA 4R5EA 2MLZA 4ODNA 3JXVA 1D2KA 2WK2A 3KAGA 4ML4A 1W9VA 1SR0A 2F4EA 4JYSA 2WLYA 4DWSC 2XP7A 4MNJA 2XP9A 1FAPA 1TCOC 5HW8A 1H0GA 1FKIA 1FFQA 3ARVA 5HW6A 2N87A 1OWQA 4DRHA 2MNTA 1LG1A 1CTNA 5HKGA 3ODKA 1E9LA 1D7JA 2UZ5A 3UI6A 4DZ3A 4C02B 1GPFA 3PA7A 2MLYA 5DIUA 1NWSA 1EHNA 3O5RA 3CGMA 1ROUA 3EY6A 5DF0A 2XP3A 4W9QA 1X6LA 2LKNA 2Y78A 3RM8A 1FKHA 4TW6A 1P5QA 4Z2KA 3UF8A 2YBTA 4L72B 1FKFA 1ZBWA 3OOBA 3ARYA 4IQ2A 2DSZA 2IF4A 1FJDA 3WKZA 1VF8A 1WB0A 1F40A 1ZL1A 4DRJA 5J6EA 1D6OA 1PBKA 5D75A 3UQBA 4WKAA 2RUDA 1EDQA 4U84A 3FAPA 2AWGA 3TCZA 1LJYA 1J4RA 3TDBA 3WIJA 3O5EA 2B31A 1ZBKA 2ZQUA 2M1IA 1Q1CA 3KZ7A 5GQBA 2DG9A 1NWUA 2O92A 1EIBA 1HJWA 4TYOA 2KE0A 3O5OA 3WD0A 3ARZA 3WL1A 4QT2A 3PR9A 2VN1A 1ZBCA 1JVWA 3PRDA 5HT1A 1W1YA 2RUQA 4ODMA 2WM0A 1K9TA 1FFRA 4LAYA 4DIPA 3BXWA 3UQAA 2PBCA 1SYTA 4P8WA 3O5IA 2WLZA 3ARTA 4U85A 4PTMA 4MPKA 1J4HA 3FXYA 1FKKA 3CZ8A 5DO2A 4DWSA 2VCDA 3ARXA 3O5MA 2PV2A 1OGGA 3WD4A 4L3NA 2XP4A 1B6CA 3AS0A 4DRIA 3KAHA 1E6RA 1JNDA 2ZQTA 1XHGA 3O5LA 3RMEA 1YATA 1QPFA 4DRNA 1EYMA 3B7XA 2KFWA 4IT4A 4DRPA 4NNRA 2ZQVA 3KABA 5I98A 1H0IA 1EQ3A 4DWSB 3AS3A 4WIWA 5HWCA 2PPOA 1D7IA 1NMWA 2G41A 2KR7A 5GPGA 4GIVA 3O5FA 3ALGA 4LGXA 3RM4A 2DSVA 3IKDA 4G2PA 3RGCA 2A3EA 4MTVA 5DITA 1FKBA 4IQCA 3G6LA 5HUAA 3WL0A 2XP5A 4JFMA 4URIA 4ODOA 3I6CA 4P8VA 3O5KA 1KT1A 4R0XA 4ZPTR 1FKRA 2OLHA 2DT1A 1ZCNA 3ARRA 3GPKA 2DT2A 4TNSA 4AY1A 4O2TA 2ZQSA 4DT4A 3B8SA 4DZ2A 2FDMA 3AS2A 3VAWA 4FAPA 1HKJA 1ITXA 3LUOA 1FD9A 1UR8A 3KACA 1JNEA 3UI5A 4HBEA 1NH6A 3CGNA 3B9EA 2OFNA 1KT0A 1UR9A 2G8ZA 2XPBA 1E6ZA 4S3JA 2KGJA 4TX0A 1NWRA 5BXJA 2XP8A 1HXVA 2PI6A 2PV3A 4QIBA 4G50A 3UQIA 2A3CA 4JFIA 2A3AA 4BF8A 4MNKA 3FY1A 4ODLA 2LGOA 1HKIA 5GPRA 1W1TA 1E6NA 3G6MA 4ITZA 4W9OA 1BKFA 4MGVA 1OGBA 1ROTA 1D7HA 2FKEA 1W26A 2M08A 1FKDA 1X6NA 4IT6A 1HJXA 4HBOA 1J6YA 1JNSA 1W9UA 4IPXA 3KCEA 3B9AA 3WQWA 2XP6A 2F2DA 1RD6A 2M2AA 3KAIA 3O5DA 1A7XA 3RM9A 5DEZA 1LG2A 3O5QA 1NMVA 1T11A 2L2SA 3CHDA 3NI6A 2PPPA 1YW5A 2LJ4A 4NSBA 1ZBVA 4P8XA 1ZB5A 1U79A 2AOSA 2DSWA 1FKTA 1Q6IA 1XRVA 3WH0A 2KI3A 2ZR6A 1E6PA 2XPAA 3OA5A 4MAVA 4GGQA 3UI4A 2A3BA 1O6IA 3ARQA 4JFLA 4J4OA 5HW7A 2ZR5A 4WKFA 4W9PA 2DT0A 2DG4A 3MDYB 2Q5AA 4JFJA 3WD2A 1C9HA 4ZPVR 1BL4A 5JH8A 1KFWA 4ODPA 3CHEA 1LQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBE A;  4HBO A;  4HAR A; 
#chains in the Genus database with same CATH topology
 1FKJ A;  4HAR A;  1W1P A;  2D9F A;  1WAW A;  3WD3 A;  3CHC A;  4ODR A;  1W1V A;  3AQU A;  2MF9 A;  4ODK A;  2DPE A;  5HWB A;  1JNT A;  2PV1 A;  4LAW A;  2FAP A;  4JFK A;  2DG3 A;  5B8I C;  1LL7 A;  4QZV B;  4LAV A;  3IK8 A;  3ARS A;  2KO7 A;  4DRK A;  3B9D A;  3O5P A;  3KAD A;  4DRO A;  4QT3 A;  2JZV A;  3NTP A;  4FN2 A;  4Z2G A;  2QF8 A;  2RUR A;  4S3K A;  2RUC A;  3O5G A;  5HBF A;  4J4N A;  3ARW A;  3PRB A;  3QOK A;  3TC5 A;  4WK9 A;  2ZR4 A;  4DRM A;  1FKG A;  3W4R A;  1NWT A;  2IUZ A;  4NZC A;  1LL6 A;  3ALF A;  3AS1 A;  2DT3 A;  1QZ2 A;  2MLX A;  3ARP A;  4Q7N A;  4LAX A;  1Q6H A;  3WD1 A;  2PN0 A;  3ARO A;  3H9R B;  3KAF A;  4MNM A;  4Z2J A;  3GTY X;  4MSP A;  2O9O A;  1J4I A;  1N1A A;  4DH0 A;  3RFW A;  4Z2H A;  2F21 A;  1F8A B;  1TFV A;  1ZK6 A;  3PRA A;  4MNL A;  4W5U A;  4XAK A;  2LPV A;  3WQV A;  2RQS A;  1GOI A;  1GUV A;  3IKG A;  3JYJ A;  1WNO A;  1Q6U A;  4WKH A;  4KQZ A;  2K8I A;  2PPN A;  1FKS A;  1QPL A;  2YBU A;  4U86 A;  2MPH A;  4TW7 A;  4Z2I A;  4TW8 A;  2ITK A;  3GU0 A;  3ARU A;  1Y0O A;  4ZPW R;  1L1P A;  1W9P A;  1FKL A;  1ZU8 A;  2RSE A;  1NSG A;  1HJV A;  1R9H A;  2B5U B;  2DSU A;  4P8U A;  4ZS6 A;  3O5J A;  1LL4 A;  4DWS D;  4N19 A;  1PIN A;  3CH9 A;  5DIV A;  1IX5 A;  3NRK A;  4Q22 A;  3CHF A;  4KR0 B;  3JYM A;  2ESC A;  1HKK A;  3IHZ A;  4Z2L A;  1E15 A;  4WJX A;  5HTG A;  1HKM A;  4DRQ A;  4ODQ A;  1M5Y A;  4R5E A;  2MLZ A;  4ODN A;  3JXV A;  1D2K A;  2WK2 A;  3KAG A;  4ML4 A;  1W9V A;  1SR0 A;  2F4E A;  4JYS A;  2WLY A;  4DWS C;  2XP7 A;  4MNJ A;  2XP9 A;  1FAP A;  1TCO C;  5HW8 A;  1H0G A;  1FKI A;  1E44 A;  1FFQ A;  3ARV A;  5HW6 A;  2N87 A;  1OWQ A;  2P4V A;  4DRH A;  2MNT A;  1LG1 A;  1CTN A;  5HKG A;  3ODK A;  1E9L A;  1D7J A;  2UZ5 A;  3UI6 A;  4DZ3 A;  4C02 B;  1GPF A;  3PA7 A;  2MLY A;  5DIU A;  1NWS A;  1EHN A;  3O5R A;  3CGM A;  1ROU A;  3EY6 A;  5DF0 A;  2XP3 A;  4W9Q A;  1X6L A;  2LKN A;  2Y78 A;  3RM8 A;  1FKH A;  4TW6 A;  1P5Q A;  4Z2K A;  3UF8 A;  2YBT A;  4L72 B;  1FKF A;  1ZBW A;  3OOB A;  3ARY A;  4IQ2 A;  2DSZ A;  2IF4 A;  1FJD A;  3WKZ A;  1VF8 A;  1WB0 A;  1F40 A;  1ZL1 A;  4DRJ A;  3BMB A;  5J6E A;  1D6O A;  1PBK A;  5D75 A;  3UQB A;  4WKA A;  2RUD A;  1GRJ A;  1EDQ A;  4U84 A;  3FAP A;  2AWG A;  3TCZ A;  1LJY A;  1J4R A;  3TDB A;  3WIJ A;  3O5E A;  2B31 A;  1ZBK A;  2ZQU A;  2M1I A;  1Q1C A;  3KZ7 A;  5GQB A;  2DG9 A;  1NWU A;  2O92 A;  1EIB A;  1HJW A;  4TYO A;  2KE0 A;  3O5O A;  3WD0 A;  3ARZ A;  3WL1 A;  4QT2 A;  3PR9 A;  2VN1 A;  1ZBC A;  1JVW A;  3PRD A;  5HT1 A;  1W1Y A;  2RUQ A;  4ODM A;  2WM0 A;  1K9T A;  1FFR A;  4LAY A;  4DIP A;  3BXW A;  3UQA A;  2EUL A;  2PBC A;  1SYT A;  4P8W A;  3O5I A;  2WLZ A;  3ART A;  4U85 A;  4PTM A;  4MPK A;  1J4H A;  3FXY A;  1FKK A;  3CZ8 A;  5DO2 A;  4DWS A;  2VCD A;  3ARX A;  3O5M A;  2PV2 A;  1OGG A;  3WD4 A;  4L3N A;  2XP4 A;  1B6C A;  3AS0 A;  4DRI A;  3KAH A;  1E6R A;  1JND A;  2ZQT A;  1XHG A;  3O5L A;  3RME A;  1YAT A;  1QPF A;  4DRN A;  1EYM A;  3B7X A;  2KFW A;  4IT4 A;  4DRP A;  4NNR A;  2ZQV A;  3KAB A;  5I98 A;  1H0I A;  1EQ3 A;  4DWS B;  3AS3 A;  4WIW A;  5HWC A;  2PPO A;  1D7I A;  1NMW A;  2G41 A;  2KR7 A;  5GPG A;  4GIV A;  3O5F A;  3ALG A;  4LGX A;  3RM4 A;  2DSV A;  3IKD A;  4G2P A;  3RGC A;  2A3E A;  4MTV A;  5DIT A;  1FKB A;  2F23 A;  3G6L A;  4IQC A;  5HUA A;  3WL0 A;  2XP5 A;  4JFM A;  4URI A;  4ODO A;  3I6C A;  4P8V A;  3O5K A;  1KT1 A;  4R0X A;  4ZPT R;  1FKR A;  2OLH A;  2DT1 A;  1ZCN A;  3ARR A;  3GPK A;  2DT2 A;  4TNS A;  4AY1 A;  4O2T A;  2ZQS A;  4DT4 A;  3B8S A;  4DZ2 A;  2FDM A;  3AS2 A;  3VAW A;  4FAP A;  1HKJ A;  1ITX A;  3LUO A;  1FD9 A;  1UR8 A;  3KAC A;  1JNE A;  3UI5 A;  4HBE A;  1NH6 A;  3CGN A;  3B9E A;  2OFN A;  1KT0 A;  1UR9 A;  2G8Z A;  2XPB A;  1E6Z A;  4S3J A;  2KGJ A;  4TX0 A;  1NWR A;  5BXJ A;  2XP8 A;  1HXV A;  3EIP A;  2PI6 A;  2PV3 A;  4QIB A;  4G50 A;  3UQI A;  2A3C A;  4JFI A;  2A3A A;  4BF8 A;  4MNK A;  3FY1 A;  4ODL A;  2LGO A;  1HKI A;  5GPR A;  1W1T A;  1E6N A;  3G6M A;  4ITZ A;  4W9O A;  1BKF A;  4MGV A;  1OGB A;  1ROT A;  1D7H A;  2FKE A;  1W26 A;  2M08 A;  1FKD A;  1X6N A;  4IT6 A;  1HJX A;  4HBO A;  1J6Y A;  1JNS A;  1W9U A;  4IPX A;  3KCE A;  3B9A A;  3WQW A;  2XP6 A;  2F2D A;  1RD6 A;  2M2A A;  3KAI A;  3O5D A;  1A7X A;  3RM9 A;  5DEZ A;  1LG2 A;  3O5Q A;  1NMV A;  1T11 A;  2L2S A;  3CHD A;  3NI6 A;  2PPP A;  1YW5 A;  2LJ4 A;  4NSB A;  1ZBV A;  4P8X A;  1ZB5 A;  1U79 A;  2AOS A;  2DSW A;  1FKT A;  1Q6I A;  1XRV A;  3WH0 A;  2KI3 A;  2ZR6 A;  2ETN A;  1E6P A;  2XPA A;  3OA5 A;  4MAV A;  4GGQ A;  1JCH B;  3UI4 A;  2A3B A;  1O6I A;  3ARQ A;  4JFL A;  4J4O A;  5HW7 A;  2ZR5 A;  4WKF A;  4W9P A;  2DT0 A;  4UDM A;  2DG4 A;  3MDY B;  2Q5A A;  4JFJ A;  3WD2 A;  1C9H A;  4ZPV R;  1BL4 A;  5JH8 A;  1KFW A;  4ODP A;  3CHE A;  1LQ0 A; 
#chains in the Genus database with same CATH homology
 1FKJ A;  4HAR A;  1W1P A;  2D9F A;  1WAW A;  3WD3 A;  3CHC A;  4ODR A;  1W1V A;  3AQU A;  2MF9 A;  4ODK A;  2DPE A;  5HWB A;  1JNT A;  2PV1 A;  4LAW A;  2FAP A;  4JFK A;  2DG3 A;  5B8I C;  1LL7 A;  4QZV B;  4LAV A;  3IK8 A;  3ARS A;  2KO7 A;  4DRK A;  3B9D A;  3O5P A;  3KAD A;  4DRO A;  4QT3 A;  2JZV A;  3NTP A;  4FN2 A;  4Z2G A;  2QF8 A;  2RUR A;  4S3K A;  2RUC A;  3O5G A;  5HBF A;  4J4N A;  3ARW A;  3PRB A;  3QOK A;  3TC5 A;  4WK9 A;  2ZR4 A;  4DRM A;  1FKG A;  3W4R A;  1NWT A;  2IUZ A;  4NZC A;  1LL6 A;  3ALF A;  3AS1 A;  2DT3 A;  1QZ2 A;  2MLX A;  3ARP A;  4Q7N A;  4LAX A;  1Q6H A;  3WD1 A;  3ARO A;  3H9R B;  3KAF A;  4MNM A;  4Z2J A;  4MSP A;  2O9O A;  1J4I A;  1N1A A;  4DH0 A;  3RFW A;  4Z2H A;  2F21 A;  1F8A B;  1TFV A;  1ZK6 A;  3PRA A;  4MNL A;  4W5U A;  4XAK A;  2LPV A;  3WQV A;  2RQS A;  1GOI A;  1GUV A;  3IKG A;  3JYJ A;  1WNO A;  1Q6U A;  4WKH A;  4KQZ A;  2K8I A;  2PPN A;  1FKS A;  1QPL A;  2YBU A;  4U86 A;  2MPH A;  4TW7 A;  4Z2I A;  4TW8 A;  2ITK A;  3ARU A;  1Y0O A;  4ZPW R;  1L1P A;  1W9P A;  1FKL A;  1ZU8 A;  2RSE A;  1NSG A;  1HJV A;  1R9H A;  2DSU A;  4P8U A;  4ZS6 A;  3O5J A;  1LL4 A;  4DWS D;  4N19 A;  1PIN A;  3CH9 A;  5DIV A;  1IX5 A;  3NRK A;  4Q22 A;  3CHF A;  4KR0 B;  3JYM A;  2ESC A;  1HKK A;  3IHZ A;  4Z2L A;  1E15 A;  4WJX A;  5HTG A;  1HKM A;  4DRQ A;  4ODQ A;  1M5Y A;  4R5E A;  2MLZ A;  4ODN A;  3JXV A;  1D2K A;  2WK2 A;  3KAG A;  4ML4 A;  1W9V A;  1SR0 A;  2F4E A;  4JYS A;  2WLY A;  4DWS C;  2XP7 A;  4MNJ A;  2XP9 A;  1FAP A;  1TCO C;  5HW8 A;  1H0G A;  1FKI A;  1FFQ A;  3ARV A;  5HW6 A;  2N87 A;  1OWQ A;  4DRH A;  2MNT A;  1LG1 A;  1CTN A;  5HKG A;  3ODK A;  1E9L A;  1D7J A;  2UZ5 A;  3UI6 A;  4DZ3 A;  4C02 B;  1GPF A;  3PA7 A;  2MLY A;  5DIU A;  1NWS A;  1EHN A;  3O5R A;  3CGM A;  1ROU A;  3EY6 A;  5DF0 A;  2XP3 A;  4W9Q A;  1X6L A;  2LKN A;  2Y78 A;  3RM8 A;  1FKH A;  4TW6 A;  1P5Q A;  4Z2K A;  3UF8 A;  2YBT A;  4L72 B;  1FKF A;  1ZBW A;  3OOB A;  3ARY A;  4IQ2 A;  2DSZ A;  2IF4 A;  1FJD A;  3WKZ A;  1VF8 A;  1WB0 A;  1F40 A;  1ZL1 A;  4DRJ A;  5J6E A;  1D6O A;  1PBK A;  5D75 A;  3UQB A;  4WKA A;  2RUD A;  1EDQ A;  4U84 A;  3FAP A;  2AWG A;  3TCZ A;  1LJY A;  1J4R A;  3TDB A;  3WIJ A;  3O5E A;  2B31 A;  1ZBK A;  2ZQU A;  2M1I A;  1Q1C A;  3KZ7 A;  5GQB A;  2DG9 A;  1NWU A;  2O92 A;  1EIB A;  1HJW A;  4TYO A;  2KE0 A;  3O5O A;  3WD0 A;  3ARZ A;  3WL1 A;  4QT2 A;  3PR9 A;  2VN1 A;  1ZBC A;  1JVW A;  3PRD A;  5HT1 A;  1W1Y A;  2RUQ A;  4ODM A;  2WM0 A;  1K9T A;  1FFR A;  4LAY A;  4DIP A;  3BXW A;  3UQA A;  2PBC A;  1SYT A;  4P8W A;  3O5I A;  2WLZ A;  3ART A;  4U85 A;  4PTM A;  4MPK A;  1J4H A;  3FXY A;  1FKK A;  3CZ8 A;  5DO2 A;  4DWS A;  2VCD A;  3ARX A;  3O5M A;  2PV2 A;  1OGG A;  3WD4 A;  4L3N A;  2XP4 A;  1B6C A;  3AS0 A;  4DRI A;  3KAH A;  1E6R A;  1JND A;  2ZQT A;  1XHG A;  3O5L A;  3RME A;  1YAT A;  1QPF A;  4DRN A;  1EYM A;  3B7X A;  2KFW A;  4IT4 A;  4DRP A;  4NNR A;  2ZQV A;  3KAB A;  5I98 A;  1H0I A;  1EQ3 A;  4DWS B;  3AS3 A;  4WIW A;  5HWC A;  2PPO A;  1D7I A;  1NMW A;  2G41 A;  2KR7 A;  5GPG A;  4GIV A;  3O5F A;  3ALG A;  4LGX A;  3RM4 A;  2DSV A;  3IKD A;  4G2P A;  3RGC A;  2A3E A;  4MTV A;  5DIT A;  1FKB A;  4IQC A;  3G6L A;  5HUA A;  3WL0 A;  2XP5 A;  4JFM A;  4URI A;  4ODO A;  3I6C A;  4P8V A;  3O5K A;  1KT1 A;  4R0X A;  4ZPT R;  1FKR A;  2OLH A;  2DT1 A;  1ZCN A;  3ARR A;  3GPK A;  2DT2 A;  4TNS A;  4AY1 A;  4O2T A;  2ZQS A;  4DT4 A;  3B8S A;  4DZ2 A;  2FDM A;  3AS2 A;  3VAW A;  4FAP A;  1HKJ A;  1ITX A;  3LUO A;  1FD9 A;  1UR8 A;  3KAC A;  1JNE A;  3UI5 A;  4HBE A;  1NH6 A;  3CGN A;  3B9E A;  2OFN A;  1KT0 A;  1UR9 A;  2G8Z A;  2XPB A;  1E6Z A;  4S3J A;  2KGJ A;  4TX0 A;  1NWR A;  5BXJ A;  2XP8 A;  1HXV A;  2PI6 A;  2PV3 A;  4QIB A;  4G50 A;  3UQI A;  2A3C A;  4JFI A;  2A3A A;  4BF8 A;  4MNK A;  3FY1 A;  4ODL A;  2LGO A;  1HKI A;  5GPR A;  1W1T A;  1E6N A;  3G6M A;  4ITZ A;  4W9O A;  1BKF A;  4MGV A;  1OGB A;  1ROT A;  1D7H A;  2FKE A;  1W26 A;  2M08 A;  1FKD A;  1X6N A;  4IT6 A;  1HJX A;  4HBO A;  1J6Y A;  1JNS A;  1W9U A;  4IPX A;  3KCE A;  3B9A A;  3WQW A;  2XP6 A;  2F2D A;  1RD6 A;  2M2A A;  3KAI A;  3O5D A;  1A7X A;  3RM9 A;  5DEZ A;  1LG2 A;  3O5Q A;  1NMV A;  1T11 A;  2L2S A;  3CHD A;  3NI6 A;  2PPP A;  1YW5 A;  2LJ4 A;  4NSB A;  1ZBV A;  4P8X A;  1ZB5 A;  1U79 A;  2AOS A;  2DSW A;  1FKT A;  1Q6I A;  1XRV A;  3WH0 A;  2KI3 A;  2ZR6 A;  1E6P A;  2XPA A;  3OA5 A;  4MAV A;  4GGQ A;  3UI4 A;  2A3B A;  1O6I A;  3ARQ A;  4JFL A;  4J4O A;  5HW7 A;  2ZR5 A;  4WKF A;  4W9P A;  2DT0 A;  2DG4 A;  3MDY B;  2Q5A A;  4JFJ A;  3WD2 A;  1C9H A;  4ZPV R;  1BL4 A;  5JH8 A;  1KFW A;  4ODP A;  3CHE A;  1LQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...