4HARA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4harA00
4HBEA 4HBOA 4HARA
chains in the Genus database with same CATH superfamily
4DRQA 5BXJA 2RQSA 1TCOC 3ARVA 5HWCA 3CH9A 1L1PA 4DWSA 3B9EA 3EY6A 1ZCNA 4W9QA 1BL4A 4DZ3A 2KFWA 1ZBKA 2DSUA 2DSZA 4JFJA 3UI4A 2IUZA 3NTPA 3G6MA 3ODKA 3KCEA 4N19A 1X6NA 2LPVA 1J4RA 4GIVA 5I98A 1HJXA 4HARA 4Z2LA 2PI6A 2DT0A 4ODMA 3IKDA 5DEZA 5HWBA 4U84A 4DRIA 2PPOA 1FFQA 4DIPA 4URIA 4G2PA 1RD6A 3ARZA 2VCDA 1E15A 4TYOA 3FAPA 4MPKA 1O6IA 2AOSA 3VAWA 4DRHA 1ZU8A 3O5PA 4QZVB 1GPFA 4J4NA 3EIPA 3GPKA 1NWTA 2ITKA 1N1AA 1J6YA 4DZ2A 4ODPA 4LAYA 1KT0A 4NZCA 4WKAA 2LGOA 4WKHA 1QPLA 2MLZA 1W9UA 3WIJA 4Q7NA 2RUDA 5HW8A 1FKKA 4QT3A 2ESCA 2KO7A 4TX0A 1F8AB 1GUVA 3JYMA 4WK9A 3ARRA 4G50A 1D7HA 3CHFA 4XAKA 1LQ0A 4ZPTR 3TC5A 4MNJA 2PV1A 3JXVA 1W9PA 5GQBA 4KQZA 3O5RA 1NWSA 3WL0A 4R5EA 1LL6A 2B5UB 2XP5A 1E6RA 3ARPA 3ALFA 1FKGA 1SR0A 3FXYA 4MSPA 1JVWA 4LAVA 1FKJA 4Z2JA 1P5QA 1EQ3A 2MF9A 3MDYB 3O5DA 2YBUA 4W9OA 4L72B 2G41A 1OGGA 5JH8A 3W4RA 2F4EA 5DIUA 5GPRA 1U79A 2PPPA 1WAWA 3RM8A 1LL7A 2L2SA 3CGMA 3RM4A 3O5LA 4ODRA 3LUOA 1EIBA 1FKFA 2ZQVA 2XP3A 4L3NA 4DT4A 2PV2A 4DRNA 4GGQA 1W1VA 2DSVA 3CHEA 4DWSC 1J4HA 4S3JA 3IHZA 2VN1A 1FKTA 1XHGA 5B8IC 4PTMA 1NWRA 3RGCA 2B31A 2ZR4A 4MNLA 1CTNA 3TDBA 3CHCA 3RMEA 4DRKA 4TW7A 4ML4A 4KR0B 1FKDA 1F40A 4P8VA 3B7XA 1HJWA 3O5FA 4QIBA 3AROA 4ODOA 4O2TA 2XPBA 2EULA 1UR9A 2LJ4A 3UQBA 3AS0A 2KR7A 2WM0A 1NSGA 3BMBA 3WD1A 2ETNA 3NRKA 1PINA 4TNSA 4HBOA 1D6OA 4Z2IA 3KAHA 2D9FA 3WD4A 1FJDA 1LJYA 4JFKA 1FKBA 4FN2A 1W1PA 2WK2A 4P8XA 3ARYA 1Q6HA 4DH0A 4Z2GA 5HBFA 1EHNA 1FAPA 4J4OA 3AQUA 1LG2A 1QZ2A 4IPXA 3GTYX 4MGVA 1FFRA 4WIWA 1HKIA 2FKEA 3WD0A 1XRVA 2PN0A 1H0IA 1HXVA 1JNTA 4ODQA 1OGBA 1PBKA 1WB0A 4AY1A 4LGXA 1HJVA 1YW5A 2M2AA 1WNOA 2A3BA 3O5EA 2PBCA 4W9PA 1FKSA 3UF8A 2JZVA 2RSEA 1KT1A 2LKNA 3B9DA 5HW7A 2IF4A 4IT4A 1TFVA 1LG1A 3KZ7A 4MTVA 4U85A 2PPNA 2MLXA 2DT3A 4HBEA 2OFNA 5GPGA 1ZL1A 3ARQA 4Z2HA 2DT1A 3WH0A 3UI6A 4MAVA 3UQAA 3CGNA 4ZPVR 2XP4A 2F2DA 3O5GA 1JNEA 1T11A 3IK8A 1NWUA 2KI3A 2XP7A 2XP6A 2Y78A 1W1YA 3JYJA 1M5YA 2O92A 3ARWA 4DWSD 1ZK6A 4LAWA 1FKLA 1ITXA 2P4VA 3O5QA 1D7JA 1W1TA 2YBTA 3OA5A 2MPHA 4NSBA 4ODKA 1Q6UA 2A3CA 1B6CA 1E6ZA 3WD2A 1KFWA 2OLHA 2F21A 2DG3A 5DF0A 1FKIA 2A3EA 1IX5A 3I6CA 3KAGA 5HT1A 4FAPA 1D2KA 5HW6A 4TW6A 3WD3A 1W26A 2XP8A 2O9OA 2FAPA 5HUAA 1NMWA 1EDQA 4DRJA 4P8UA 4ITZA 2DSWA 1ROTA 2A3AA 2ZR6A 3G6LA 4DWSB 3CZ8A 2FDMA 4C02B 1A7XA 3O5JA 4QT2A 3UI5A 4JYSA 3OOBA 1Y0OA 2DG9A 4IT6A 1W9VA 3NI6A 2MLYA 3RM9A 3WKZA 3GU0A 3TCZA 2Q5AA 3AS3A 4JFMA 1D7IA 3KADA 1NMVA 4DROA 1FKRA 3WL1A 2N87A 3KABA 1SYTA 1ZBVA 3PRAA 1Q6IA 4R0XA 1ZBWA 3O5OA 3AS1A 4W5UA 1UR8A 1GOIA 4NNRA 3ARUA 1Q1CA 4ZS6A 1ZB5A 1HKMA 2DPEA 3O5IA 4ODNA 2G8ZA 1ZBCA 3PRBA 4UDMA 2XP9A 4U86A 3B8SA 5D75A 1E9LA 4IQ2A 1H0GA 1LL4A 2QF8A 3IKGA 2KE0A 4DRMA 2DG4A 3WQWA 3FY1A 5HKGA 3ARXA 2AWGA 1JNDA 1QPFA 2PV3A 3ARTA 2RUQA 2RURA 4ODLA 3PR9A 2XPAA 1E6PA 2WLZA 1X6LA 3CHDA 3KACA 4TW8A 3O5MA 1ROUA 2WLYA 3H9RB 4MNMA 1C9HA 4WKFA 1FD9A 1OWQA 2DT2A 4P8WA 1J4IA 2RUCA 3UQIA 3QOKA 4LAXA 1GRJA 1NH6A 1HKJA 2M08A 3BXWA 5DO2A 1YATA 3RFWA 4DRPA 4Q22A 2K8IA 3ARSA 2ZQUA 2F23A 1E44A 5HTGA 5DITA 3KAFA 5DIVA 3WQVA 1VF8A 4BF8A 2ZQSA 2MNTA 2ZQTA 1BKFA 3PRDA 3ALGA 2KGJA 2ZR5A 3PA7A 4MNKA 4IQCA 1HKKA 3AS2A 1JNSA 1K9TA 2UZ5A 4Z2KA 4ZPWR 3O5KA 4JFLA 4JFIA 1R9HA 4S3KA 1E6NA 1EYMA 3B9AA 1JCHB 1FKHA 5J6EA 3KAIA 4WJXA 2M1IA
chains in the Genus database with same CATH topology
4DRQA 5BXJA 2RQSA 1TCOC 3ARVA 5HWCA 3CH9A 1L1PA 4DWSA 3B9EA 3EY6A 1ZCNA 4W9QA 1BL4A 4DZ3A 2KFWA 1ZBKA 2DSUA 2DSZA 4JFJA 3UI4A 2IUZA 3NTPA 3G6MA 3ODKA 3KCEA 4N19A 1X6NA 2LPVA 1J4RA 4GIVA 5I98A 1HJXA 4HARA 4Z2LA 2PI6A 2DT0A 4ODMA 3IKDA 5DEZA 5HWBA 4U84A 4DRIA 2PPOA 1FFQA 4DIPA 4URIA 4G2PA 1RD6A 3ARZA 2VCDA 1E15A 4TYOA 3FAPA 4MPKA 1O6IA 2AOSA 3VAWA 4DRHA 1ZU8A 3O5PA 4QZVB 1GPFA 4J4NA 3GPKA 1NWTA 2ITKA 1N1AA 1J6YA 4DZ2A 4ODPA 4LAYA 1KT0A 4NZCA 4WKAA 2LGOA 4WKHA 1QPLA 2MLZA 1W9UA 3WIJA 4Q7NA 2RUDA 5HW8A 1FKKA 4QT3A 2ESCA 2KO7A 4TX0A 1F8AB 1GUVA 3JYMA 4WK9A 3ARRA 4G50A 1D7HA 3CHFA 4XAKA 1LQ0A 4ZPTR 3TC5A 4MNJA 2PV1A 3JXVA 1W9PA 5GQBA 4KQZA 3O5RA 1NWSA 3WL0A 4R5EA 1LL6A 2XP5A 1E6RA 3ARPA 3ALFA 1FKGA 1SR0A 3FXYA 4MSPA 1JVWA 4LAVA 1FKJA 4Z2JA 1P5QA 1EQ3A 2MF9A 3MDYB 3O5DA 2YBUA 4W9OA 4L72B 2G41A 1OGGA 5JH8A 3W4RA 2F4EA 5DIUA 5GPRA 1U79A 2PPPA 1WAWA 3RM8A 1LL7A 2L2SA 3CGMA 3RM4A 3O5LA 4ODRA 3LUOA 1EIBA 1FKFA 2ZQVA 2XP3A 4L3NA 4DT4A 2PV2A 4DRNA 4GGQA 1W1VA 2DSVA 3CHEA 4DWSC 1J4HA 4S3JA 3IHZA 2VN1A 1FKTA 1XHGA 5B8IC 4PTMA 1NWRA 3RGCA 2B31A 2ZR4A 4MNLA 1CTNA 3TDBA 3CHCA 3RMEA 4DRKA 4TW7A 4ML4A 4KR0B 1FKDA 1F40A 4P8VA 3B7XA 1HJWA 3O5FA 4QIBA 3AROA 4ODOA 4O2TA 2XPBA 1UR9A 2LJ4A 3UQBA 3AS0A 2KR7A 2WM0A 1NSGA 3WD1A 3NRKA 1PINA 4TNSA 4HBOA 1D6OA 4Z2IA 3KAHA 2D9FA 3WD4A 1FJDA 1LJYA 4JFKA 1FKBA 4FN2A 1W1PA 2WK2A 4P8XA 3ARYA 1Q6HA 4DH0A 4Z2GA 5HBFA 1EHNA 1FAPA 4J4OA 3AQUA 1LG2A 1QZ2A 4IPXA 4MGVA 1FFRA 4WIWA 1HKIA 2FKEA 3WD0A 1XRVA 1H0IA 1HXVA 1JNTA 4ODQA 1OGBA 1PBKA 1WB0A 4AY1A 4LGXA 1HJVA 1YW5A 2M2AA 1WNOA 2A3BA 3O5EA 2PBCA 4W9PA 1FKSA 3UF8A 2JZVA 2RSEA 1KT1A 2LKNA 3B9DA 5HW7A 2IF4A 4IT4A 1TFVA 1LG1A 3KZ7A 4MTVA 4U85A 2PPNA 2MLXA 2DT3A 4HBEA 2OFNA 5GPGA 1ZL1A 3ARQA 4Z2HA 2DT1A 3WH0A 3UI6A 4MAVA 3UQAA 3CGNA 4ZPVR 2XP4A 2F2DA 3O5GA 1JNEA 1T11A 3IK8A 1NWUA 2KI3A 2XP7A 2XP6A 2Y78A 1W1YA 3JYJA 1M5YA 2O92A 3ARWA 4DWSD 1ZK6A 4LAWA 1FKLA 1ITXA 3O5QA 1D7JA 1W1TA 2YBTA 3OA5A 2MPHA 4NSBA 4ODKA 1Q6UA 2A3CA 1B6CA 1E6ZA 3WD2A 1KFWA 2OLHA 2F21A 2DG3A 5DF0A 1FKIA 2A3EA 1IX5A 3I6CA 3KAGA 5HT1A 4FAPA 1D2KA 5HW6A 4TW6A 3WD3A 1W26A 2XP8A 2O9OA 2FAPA 5HUAA 1NMWA 1EDQA 4DRJA 4P8UA 4ITZA 2DSWA 1ROTA 2A3AA 2ZR6A 3G6LA 4DWSB 3CZ8A 2FDMA 4C02B 1A7XA 3O5JA 4QT2A 3UI5A 4JYSA 3OOBA 1Y0OA 2DG9A 4IT6A 1W9VA 3NI6A 2MLYA 3RM9A 3WKZA 3TCZA 2Q5AA 3AS3A 4JFMA 1D7IA 3KADA 1NMVA 4DROA 1FKRA 3WL1A 2N87A 3KABA 1SYTA 1ZBVA 3PRAA 1Q6IA 4R0XA 1ZBWA 3O5OA 3AS1A 4W5UA 1UR8A 1GOIA 4NNRA 3ARUA 1Q1CA 4ZS6A 1ZB5A 1HKMA 2DPEA 3O5IA 4ODNA 2G8ZA 1ZBCA 3PRBA 2XP9A 4U86A 3B8SA 5D75A 1E9LA 4IQ2A 1H0GA 1LL4A 2QF8A 3IKGA 2KE0A 4DRMA 2DG4A 3WQWA 3FY1A 5HKGA 3ARXA 2AWGA 1JNDA 1QPFA 2PV3A 3ARTA 2RUQA 2RURA 4ODLA 3PR9A 2XPAA 1E6PA 2WLZA 1X6LA 3CHDA 3KACA 4TW8A 3O5MA 1ROUA 2WLYA 3H9RB 4MNMA 1C9HA 4WKFA 1FD9A 1OWQA 2DT2A 4P8WA 1J4IA 2RUCA 3UQIA 3QOKA 4LAXA 1NH6A 1HKJA 2M08A 3BXWA 5DO2A 1YATA 3RFWA 4DRPA 4Q22A 2K8IA 3ARSA 2ZQUA 5HTGA 5DITA 3KAFA 5DIVA 3WQVA 1VF8A 4BF8A 2ZQSA 2MNTA 2ZQTA 1BKFA 3PRDA 3ALGA 2KGJA 2ZR5A 3PA7A 4MNKA 4IQCA 1HKKA 3AS2A 1JNSA 1K9TA 2UZ5A 4Z2KA 4ZPWR 3O5KA 4JFLA 4JFIA 1R9HA 4S3KA 1E6NA 1EYMA 3B9AA 1FKHA 5J6EA 3KAIA 4WJXA 2M1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBE A;  4HBO A;  4HAR A; 
#chains in the Genus database with same CATH topology
 4DRQ A;  5BXJ A;  2RQS A;  1TCO C;  3ARV A;  5HWC A;  3CH9 A;  1L1P A;  4DWS A;  3B9E A;  3EY6 A;  1ZCN A;  4W9Q A;  1BL4 A;  4DZ3 A;  2KFW A;  1ZBK A;  2DSU A;  2DSZ A;  4JFJ A;  3UI4 A;  2IUZ A;  3NTP A;  3G6M A;  3ODK A;  3KCE A;  4N19 A;  1X6N A;  2LPV A;  1J4R A;  4GIV A;  5I98 A;  1HJX A;  4HAR A;  4Z2L A;  2PI6 A;  2DT0 A;  4ODM A;  3IKD A;  5DEZ A;  5HWB A;  4U84 A;  4DRI A;  2PPO A;  1FFQ A;  4DIP A;  4URI A;  4G2P A;  1RD6 A;  3ARZ A;  2VCD A;  1E15 A;  4TYO A;  3FAP A;  4MPK A;  1O6I A;  2AOS A;  3VAW A;  4DRH A;  1ZU8 A;  3O5P A;  4QZV B;  1GPF A;  4J4N A;  3EIP A;  3GPK A;  1NWT A;  2ITK A;  1N1A A;  1J6Y A;  4DZ2 A;  4ODP A;  4LAY A;  1KT0 A;  4NZC A;  4WKA A;  2LGO A;  4WKH A;  1QPL A;  2MLZ A;  1W9U A;  3WIJ A;  4Q7N A;  2RUD A;  5HW8 A;  1FKK A;  4QT3 A;  2ESC A;  2KO7 A;  4TX0 A;  1F8A B;  1GUV A;  3JYM A;  4WK9 A;  3ARR A;  4G50 A;  1D7H A;  3CHF A;  4XAK A;  1LQ0 A;  4ZPT R;  3TC5 A;  4MNJ A;  2PV1 A;  3JXV A;  1W9P A;  5GQB A;  4KQZ A;  3O5R A;  1NWS A;  3WL0 A;  4R5E A;  1LL6 A;  2B5U B;  2XP5 A;  1E6R A;  3ARP A;  3ALF A;  1FKG A;  1SR0 A;  3FXY A;  4MSP A;  1JVW A;  4LAV A;  1FKJ A;  4Z2J A;  1P5Q A;  1EQ3 A;  2MF9 A;  3MDY B;  3O5D A;  2YBU A;  4W9O A;  4L72 B;  2G41 A;  1OGG A;  5JH8 A;  3W4R A;  2F4E A;  5DIU A;  5GPR A;  1U79 A;  2PPP A;  1WAW A;  3RM8 A;  1LL7 A;  2L2S A;  3CGM A;  3RM4 A;  3O5L A;  4ODR A;  3LUO A;  1EIB A;  1FKF A;  2ZQV A;  2XP3 A;  4L3N A;  4DT4 A;  2PV2 A;  4DRN A;  4GGQ A;  1W1V A;  2DSV A;  3CHE A;  4DWS C;  1J4H A;  4S3J A;  3IHZ A;  2VN1 A;  1FKT A;  1XHG A;  5B8I C;  4PTM A;  1NWR A;  3RGC A;  2B31 A;  2ZR4 A;  4MNL A;  1CTN A;  3TDB A;  3CHC A;  3RME A;  4DRK A;  4TW7 A;  4ML4 A;  4KR0 B;  1FKD A;  1F40 A;  4P8V A;  3B7X A;  1HJW A;  3O5F A;  4QIB A;  3ARO A;  4ODO A;  4O2T A;  2XPB A;  2EUL A;  1UR9 A;  2LJ4 A;  3UQB A;  3AS0 A;  2KR7 A;  2WM0 A;  1NSG A;  3BMB A;  3WD1 A;  2ETN A;  3NRK A;  1PIN A;  4TNS A;  4HBO A;  1D6O A;  4Z2I A;  3KAH A;  2D9F A;  3WD4 A;  1FJD A;  1LJY A;  4JFK A;  1FKB A;  4FN2 A;  1W1P A;  2WK2 A;  4P8X A;  3ARY A;  1Q6H A;  4DH0 A;  4Z2G A;  5HBF A;  1EHN A;  1FAP A;  4J4O A;  3AQU A;  1LG2 A;  1QZ2 A;  4IPX A;  3GTY X;  4MGV A;  1FFR A;  4WIW A;  1HKI A;  2FKE A;  3WD0 A;  1XRV A;  2PN0 A;  1H0I A;  1HXV A;  1JNT A;  4ODQ A;  1OGB A;  1PBK A;  1WB0 A;  4AY1 A;  4LGX A;  1HJV A;  1YW5 A;  2M2A A;  1WNO A;  2A3B A;  3O5E A;  2PBC A;  4W9P A;  1FKS A;  3UF8 A;  2JZV A;  2RSE A;  1KT1 A;  2LKN A;  3B9D A;  5HW7 A;  2IF4 A;  4IT4 A;  1TFV A;  1LG1 A;  3KZ7 A;  4MTV A;  4U85 A;  2PPN A;  2MLX A;  2DT3 A;  4HBE A;  2OFN A;  5GPG A;  1ZL1 A;  3ARQ A;  4Z2H A;  2DT1 A;  3WH0 A;  3UI6 A;  4MAV A;  3UQA A;  3CGN A;  4ZPV R;  2XP4 A;  2F2D A;  3O5G A;  1JNE A;  1T11 A;  3IK8 A;  1NWU A;  2KI3 A;  2XP7 A;  2XP6 A;  2Y78 A;  1W1Y A;  3JYJ A;  1M5Y A;  2O92 A;  3ARW A;  4DWS D;  1ZK6 A;  4LAW A;  1FKL A;  1ITX A;  2P4V A;  3O5Q A;  1D7J A;  1W1T A;  2YBT A;  3OA5 A;  2MPH A;  4NSB A;  4ODK A;  1Q6U A;  2A3C A;  1B6C A;  1E6Z A;  3WD2 A;  1KFW A;  2OLH A;  2F21 A;  2DG3 A;  5DF0 A;  1FKI A;  2A3E A;  1IX5 A;  3I6C A;  3KAG A;  5HT1 A;  4FAP A;  1D2K A;  5HW6 A;  4TW6 A;  3WD3 A;  1W26 A;  2XP8 A;  2O9O A;  2FAP A;  5HUA A;  1NMW A;  1EDQ A;  4DRJ A;  4P8U A;  4ITZ A;  2DSW A;  1ROT A;  2A3A A;  2ZR6 A;  3G6L A;  4DWS B;  3CZ8 A;  2FDM A;  4C02 B;  1A7X A;  3O5J A;  4QT2 A;  3UI5 A;  4JYS A;  3OOB A;  1Y0O A;  2DG9 A;  4IT6 A;  1W9V A;  3NI6 A;  2MLY A;  3RM9 A;  3WKZ A;  3GU0 A;  3TCZ A;  2Q5A A;  3AS3 A;  4JFM A;  1D7I A;  3KAD A;  1NMV A;  4DRO A;  1FKR A;  3WL1 A;  2N87 A;  3KAB A;  1SYT A;  1ZBV A;  3PRA A;  1Q6I A;  4R0X A;  1ZBW A;  3O5O A;  3AS1 A;  4W5U A;  1UR8 A;  1GOI A;  4NNR A;  3ARU A;  1Q1C A;  4ZS6 A;  1ZB5 A;  1HKM A;  2DPE A;  3O5I A;  4ODN A;  2G8Z A;  1ZBC A;  3PRB A;  4UDM A;  2XP9 A;  4U86 A;  3B8S A;  5D75 A;  1E9L A;  4IQ2 A;  1H0G A;  1LL4 A;  2QF8 A;  3IKG A;  2KE0 A;  4DRM A;  2DG4 A;  3WQW A;  3FY1 A;  5HKG A;  3ARX A;  2AWG A;  1JND A;  1QPF A;  2PV3 A;  3ART A;  2RUQ A;  2RUR A;  4ODL A;  3PR9 A;  2XPA A;  1E6P A;  2WLZ A;  1X6L A;  3CHD A;  3KAC A;  4TW8 A;  3O5M A;  1ROU A;  2WLY A;  3H9R B;  4MNM A;  1C9H A;  4WKF A;  1FD9 A;  1OWQ A;  2DT2 A;  4P8W A;  1J4I A;  2RUC A;  3UQI A;  3QOK A;  4LAX A;  1GRJ A;  1NH6 A;  1HKJ A;  2M08 A;  3BXW A;  5DO2 A;  1YAT A;  3RFW A;  4DRP A;  4Q22 A;  2K8I A;  3ARS A;  2ZQU A;  2F23 A;  1E44 A;  5HTG A;  5DIT A;  3KAF A;  5DIV A;  3WQV A;  1VF8 A;  4BF8 A;  2ZQS A;  2MNT A;  2ZQT A;  1BKF A;  3PRD A;  3ALG A;  2KGJ A;  2ZR5 A;  3PA7 A;  4MNK A;  4IQC A;  1HKK A;  3AS2 A;  1JNS A;  1K9T A;  2UZ5 A;  4Z2K A;  4ZPW R;  3O5K A;  4JFL A;  4JFI A;  1R9H A;  4S3K A;  1E6N A;  1EYM A;  3B9A A;  1JCH B;  1FKH A;  5J6E A;  3KAI A;  4WJX A;  2M1I A; 
#chains in the Genus database with same CATH homology
 4DRQ A;  5BXJ A;  2RQS A;  1TCO C;  3ARV A;  5HWC A;  3CH9 A;  1L1P A;  4DWS A;  3B9E A;  3EY6 A;  1ZCN A;  4W9Q A;  1BL4 A;  4DZ3 A;  2KFW A;  1ZBK A;  2DSU A;  2DSZ A;  4JFJ A;  3UI4 A;  2IUZ A;  3NTP A;  3G6M A;  3ODK A;  3KCE A;  4N19 A;  1X6N A;  2LPV A;  1J4R A;  4GIV A;  5I98 A;  1HJX A;  4HAR A;  4Z2L A;  2PI6 A;  2DT0 A;  4ODM A;  3IKD A;  5DEZ A;  5HWB A;  4U84 A;  4DRI A;  2PPO A;  1FFQ A;  4DIP A;  4URI A;  4G2P A;  1RD6 A;  3ARZ A;  2VCD A;  1E15 A;  4TYO A;  3FAP A;  4MPK A;  1O6I A;  2AOS A;  3VAW A;  4DRH A;  1ZU8 A;  3O5P A;  4QZV B;  1GPF A;  4J4N A;  3GPK A;  1NWT A;  2ITK A;  1N1A A;  1J6Y A;  4DZ2 A;  4ODP A;  4LAY A;  1KT0 A;  4NZC A;  4WKA A;  2LGO A;  4WKH A;  1QPL A;  2MLZ A;  1W9U A;  3WIJ A;  4Q7N A;  2RUD A;  5HW8 A;  1FKK A;  4QT3 A;  2ESC A;  2KO7 A;  4TX0 A;  1F8A B;  1GUV A;  3JYM A;  4WK9 A;  3ARR A;  4G50 A;  1D7H A;  3CHF A;  4XAK A;  1LQ0 A;  4ZPT R;  3TC5 A;  4MNJ A;  2PV1 A;  3JXV A;  1W9P A;  5GQB A;  4KQZ A;  3O5R A;  1NWS A;  3WL0 A;  4R5E A;  1LL6 A;  2XP5 A;  1E6R A;  3ARP A;  3ALF A;  1FKG A;  1SR0 A;  3FXY A;  4MSP A;  1JVW A;  4LAV A;  1FKJ A;  4Z2J A;  1P5Q A;  1EQ3 A;  2MF9 A;  3MDY B;  3O5D A;  2YBU A;  4W9O A;  4L72 B;  2G41 A;  1OGG A;  5JH8 A;  3W4R A;  2F4E A;  5DIU A;  5GPR A;  1U79 A;  2PPP A;  1WAW A;  3RM8 A;  1LL7 A;  2L2S A;  3CGM A;  3RM4 A;  3O5L A;  4ODR A;  3LUO A;  1EIB A;  1FKF A;  2ZQV A;  2XP3 A;  4L3N A;  4DT4 A;  2PV2 A;  4DRN A;  4GGQ A;  1W1V A;  2DSV A;  3CHE A;  4DWS C;  1J4H A;  4S3J A;  3IHZ A;  2VN1 A;  1FKT A;  1XHG A;  5B8I C;  4PTM A;  1NWR A;  3RGC A;  2B31 A;  2ZR4 A;  4MNL A;  1CTN A;  3TDB A;  3CHC A;  3RME A;  4DRK A;  4TW7 A;  4ML4 A;  4KR0 B;  1FKD A;  1F40 A;  4P8V A;  3B7X A;  1HJW A;  3O5F A;  4QIB A;  3ARO A;  4ODO A;  4O2T A;  2XPB A;  1UR9 A;  2LJ4 A;  3UQB A;  3AS0 A;  2KR7 A;  2WM0 A;  1NSG A;  3WD1 A;  3NRK A;  1PIN A;  4TNS A;  4HBO A;  1D6O A;  4Z2I A;  3KAH A;  2D9F A;  3WD4 A;  1FJD A;  1LJY A;  4JFK A;  1FKB A;  4FN2 A;  1W1P A;  2WK2 A;  4P8X A;  3ARY A;  1Q6H A;  4DH0 A;  4Z2G A;  5HBF A;  1EHN A;  1FAP A;  4J4O A;  3AQU A;  1LG2 A;  1QZ2 A;  4IPX A;  4MGV A;  1FFR A;  4WIW A;  1HKI A;  2FKE A;  3WD0 A;  1XRV A;  1H0I A;  1HXV A;  1JNT A;  4ODQ A;  1OGB A;  1PBK A;  1WB0 A;  4AY1 A;  4LGX A;  1HJV A;  1YW5 A;  2M2A A;  1WNO A;  2A3B A;  3O5E A;  2PBC A;  4W9P A;  1FKS A;  3UF8 A;  2JZV A;  2RSE A;  1KT1 A;  2LKN A;  3B9D A;  5HW7 A;  2IF4 A;  4IT4 A;  1TFV A;  1LG1 A;  3KZ7 A;  4MTV A;  4U85 A;  2PPN A;  2MLX A;  2DT3 A;  4HBE A;  2OFN A;  5GPG A;  1ZL1 A;  3ARQ A;  4Z2H A;  2DT1 A;  3WH0 A;  3UI6 A;  4MAV A;  3UQA A;  3CGN A;  4ZPV R;  2XP4 A;  2F2D A;  3O5G A;  1JNE A;  1T11 A;  3IK8 A;  1NWU A;  2KI3 A;  2XP7 A;  2XP6 A;  2Y78 A;  1W1Y A;  3JYJ A;  1M5Y A;  2O92 A;  3ARW A;  4DWS D;  1ZK6 A;  4LAW A;  1FKL A;  1ITX A;  3O5Q A;  1D7J A;  1W1T A;  2YBT A;  3OA5 A;  2MPH A;  4NSB A;  4ODK A;  1Q6U A;  2A3C A;  1B6C A;  1E6Z A;  3WD2 A;  1KFW A;  2OLH A;  2F21 A;  2DG3 A;  5DF0 A;  1FKI A;  2A3E A;  1IX5 A;  3I6C A;  3KAG A;  5HT1 A;  4FAP A;  1D2K A;  5HW6 A;  4TW6 A;  3WD3 A;  1W26 A;  2XP8 A;  2O9O A;  2FAP A;  5HUA A;  1NMW A;  1EDQ A;  4DRJ A;  4P8U A;  4ITZ A;  2DSW A;  1ROT A;  2A3A A;  2ZR6 A;  3G6L A;  4DWS B;  3CZ8 A;  2FDM A;  4C02 B;  1A7X A;  3O5J A;  4QT2 A;  3UI5 A;  4JYS A;  3OOB A;  1Y0O A;  2DG9 A;  4IT6 A;  1W9V A;  3NI6 A;  2MLY A;  3RM9 A;  3WKZ A;  3TCZ A;  2Q5A A;  3AS3 A;  4JFM A;  1D7I A;  3KAD A;  1NMV A;  4DRO A;  1FKR A;  3WL1 A;  2N87 A;  3KAB A;  1SYT A;  1ZBV A;  3PRA A;  1Q6I A;  4R0X A;  1ZBW A;  3O5O A;  3AS1 A;  4W5U A;  1UR8 A;  1GOI A;  4NNR A;  3ARU A;  1Q1C A;  4ZS6 A;  1ZB5 A;  1HKM A;  2DPE A;  3O5I A;  4ODN A;  2G8Z A;  1ZBC A;  3PRB A;  2XP9 A;  4U86 A;  3B8S A;  5D75 A;  1E9L A;  4IQ2 A;  1H0G A;  1LL4 A;  2QF8 A;  3IKG A;  2KE0 A;  4DRM A;  2DG4 A;  3WQW A;  3FY1 A;  5HKG A;  3ARX A;  2AWG A;  1JND A;  1QPF A;  2PV3 A;  3ART A;  2RUQ A;  2RUR A;  4ODL A;  3PR9 A;  2XPA A;  1E6P A;  2WLZ A;  1X6L A;  3CHD A;  3KAC A;  4TW8 A;  3O5M A;  1ROU A;  2WLY A;  3H9R B;  4MNM A;  1C9H A;  4WKF A;  1FD9 A;  1OWQ A;  2DT2 A;  4P8W A;  1J4I A;  2RUC A;  3UQI A;  3QOK A;  4LAX A;  1NH6 A;  1HKJ A;  2M08 A;  3BXW A;  5DO2 A;  1YAT A;  3RFW A;  4DRP A;  4Q22 A;  2K8I A;  3ARS A;  2ZQU A;  5HTG A;  5DIT A;  3KAF A;  5DIV A;  3WQV A;  1VF8 A;  4BF8 A;  2ZQS A;  2MNT A;  2ZQT A;  1BKF A;  3PRD A;  3ALG A;  2KGJ A;  2ZR5 A;  3PA7 A;  4MNK A;  4IQC A;  1HKK A;  3AS2 A;  1JNS A;  1K9T A;  2UZ5 A;  4Z2K A;  4ZPW R;  3O5K A;  4JFL A;  4JFI A;  1R9H A;  4S3K A;  1E6N A;  1EYM A;  3B9A A;  1FKH A;  5J6E A;  3KAI A;  4WJX A;  2M1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...