4HARA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4harA00
4HARA 4HBEA 4HBOA
chains in the Genus database with same CATH superfamily
1JNDA 1FKBA 4XAKA 3GTYX 4ZS6A 1FFRA 3ARVA 3G6LA 2MPHA 3B9EA 3O5IA 5B8IC 4TYOA 2ZR4A 1WB0A 1FKJA 4JFIA 2XP9A 5GPRA 2N87A 4Z2IA 2ZQTA 1E6ZA 1P5QA 1QPFA 1TFVA 3GU0A 4G50A 4MNLA 4N19A 3WL1A 4MGVA 3CH9A 4QT3A 2RUDA 2DG3A 2YBUA 4L3NA 4FAPA 4P8VA 1LL4A 2OFNA 1GOIA 4JFJA 1D6OA 2Y78A 4DT4A 2ETNA 4TNSA 2XP5A 1N1AA 2A3AA 1B6CA 2M1IA 2O9OA 4O2TA 4WJXA 1J4HA 1JNEA 2MNTA 1XHGA 1FKKA 2PBCA 3PRBA 5HW6A 4R5EA 4WKAA 2D9FA 2DSZA 3IKGA 1FFQA 2M08A 3WQWA 3WH0A 4QIBA 4U84A 5HW8A 4U85A 2DG9A 3TC5A 2DSVA 1GUVA 1KT1A 2PV2A 1HJWA 1CTNA 4HBEA 3EY6A 4DWSB 3ARWA 3ARXA 4DRPA 2WM0A 4G2PA 1K9TA 2PPPA 1TCOC 3WIJA 3IKDA 2KO7A 4DWSD 3NTPA 4ZPTR 4ODPA 3WD0A 2PV1A 3JYJA 2AWGA 1PBKA 1EYMA 2PN0A 5HKGA 3O5KA 4LGXA 4AY1A 3CGNA 1Q1CA 4ODOA 1EIBA 4JFLA 3FAPA 1ROUA 3ARYA 3ARUA 2PPNA 2IF4A 3H9RB 2ZQVA 1ITXA 3O5QA 1J4IA 1LG2A 1LL7A 2A3EA 4MSPA 1XRVA 3B8SA 3PRDA 4MPKA 3RMEA 2B31A 1KT0A 2MLYA 3LUOA 1KFWA 1W9VA 2DG4A 2LJ4A 3I6CA 2OLHA 3WD1A 3ARRA 1ZU8A 3AS1A 1JNTA 3O5DA 3W4RA 4DRNA 1O6IA 2WLYA 2DSUA 3AS0A 5BXJA 3JYMA 4LAXA 3RM4A 3O5MA 4ODNA 1HJXA 1FKTA 4TW7A 3KAFA 5I98A 1FKLA 4LAWA 4PTMA 3B9DA 3UQIA 1X6LA 4WKFA 4ODQA 2A3CA 2KR7A 4ZPVR 1ZBVA 5GQBA 1Q6UA 1WNOA 2WK2A 2B5UB 2RURA 4S3JA 1W9PA 2EULA 3ALFA 3O5GA 5DO2A 1EQ3A 1OGBA 5J6EA 2PI6A 2VCDA 5HWCA 2FDMA 4URIA 1Q6IA 3IHZA 1IX5A 1ZK6A 1FKIA 3KAIA 3KAGA 3WD3A 3RM8A 4P8XA 4ITZA 1J6YA 1W1PA 5HW7A 1D7JA 1FKGA 4KQZA 1WAWA 2F2DA 3PR9A 4Z2GA 1FJDA 1NWUA 4DRKA 2K8IA 1PINA 1SR0A 1HKIA 2DT2A 3ODKA 1R9HA 4LAYA 2JZVA 4HARA 3VAWA 2PV3A 1JNSA 4P8WA 1ZBCA 3AROA 1EDQA 4P8UA 4L72B 4MNMA 3CHEA 4IT6A 4DRQA 2XPAA 3AS2A 4TW8A 2F23A 1NSGA 2DPEA 2DT0A 1E44A 1NWTA 4KR0B 4ML4A 1Y0OA 4Q7NA 2L2SA 4UDMA 2G41A 4IPXA 4NNRA 1NWSA 4DIPA 1ZBWA 4DRIA 5HT1A 1QZ2A 3RGCA 3TDBA 3TCZA 1NMWA 2RSEA 2KFWA 5DEZA 3NI6A 4DRJA 4GIVA 5HBFA 3MDYB 1NWRA 4DROA 2UZ5A 1LL6A 1FKSA 3CGMA 3OA5A 2O92A 2RQSA 2ITKA 2IUZA 3RFWA 2XP6A 1E6RA 1F8AB 4MNKA 2KE0A 1UR8A 3CZ8A 3KAHA 2XP3A 1U79A 2XP8A 2PPOA 4DRMA 4ZPWR 4Z2JA 4NSBA 2KGJA 1UR9A 3ALGA 4LAVA 3O5FA 1E15A 1FKRA 4W9OA 3ARSA 1W1TA 4J4NA 2A3BA 4DZ3A 2F21A 4DWSC 4TW6A 2F4EA 4ODKA 3PA7A 3O5EA 3BXWA 2ZQUA 1QPLA 2M2AA 2XP7A 1HKJA 1NH6A 5DF0A 3UQAA 1JCHB 2DSWA 3WKZA 3KCEA 5GPGA 1D7IA 3O5LA 1YW5A 3O5PA 2LKNA 3UQBA 1H0IA 2AOSA 3O5JA 1RD6A 1YATA 5HUAA 3FXYA 1OWQA 1E9LA 4Z2HA 3CHCA 4BF8A 2DT3A 1J4RA 2MLZA 2YBTA 2QF8A 4W9QA 1FKFA 4ODRA 1FD9A 1NMVA 2ZQSA 4QT2A 1JVWA 4DWSA 3B7XA 3ARPA 1W1YA 1A7XA 4WIWA 3OOBA 4IQCA 3JXVA 3EIPA 5HTGA 3ARQA 1Q6HA 4J4OA 2MLXA 3G6MA 4Z2LA 1HJVA 1FAPA 4HBOA 3WD2A 1F40A 4W9PA 3RM9A 2XP4A 1EHNA 1LJYA 1C9HA 1W9UA 4W5UA 4JFKA 4U86A 2FKEA 1SYTA 3PRAA 2G8ZA 5JH8A 1ZBKA 5DIUA 1ZL1A 1BKFA 1HKKA 3QOKA 2LGOA 1M5YA 1X6NA 4C02B 1D2KA 1E6NA 4S3KA 3ARZA 3AS3A 3WD4A 3FY1A 3KZ7A 4ODLA 4WK9A 2ZR6A 1H0GA 1LQ0A 4Z2KA 3CHDA 2MF9A 1GPFA 4MNJA 4ODMA 1HXVA 5D75A 2XPBA 1FKHA 4Q22A 3NRKA 2ZR5A 4IT4A 1ROTA 1W26A 3KACA 4TX0A 4NZCA 4R0XA 3GPKA 2LPVA 3WL0A 4FN2A 1VF8A 2WLZA 5HWBA 3UI4A 3ARTA 2FAPA 4DZ2A 3UF8A 1T11A 4IQ2A 1HKMA 1FKDA 1BL4A 1GRJA 2ESCA 4DRHA 2RUCA 3IK8A 1E6PA 4MAVA 3O5OA 4MTVA 1W1VA 4WKHA 1L1PA 2DT1A 4JYSA 4DH0A 3WQVA 2KI3A 2VN1A 1ZB5A 4GGQA 1LG1A 1ZCNA 3KABA 3O5RA 3CHFA 3B9AA 3AQUA 5DIVA 2Q5AA 3UI5A 4JFMA 2P4VA 4QZVB 2RUQA 3BMBA 1OGGA 3UI6A 3KADA 5DITA 1D7HA
chains in the Genus database with same CATH topology
1JNDA 1FKBA 4XAKA 4ZS6A 1FFRA 3ARVA 3G6LA 2MPHA 3B9EA 3O5IA 5B8IC 4TYOA 2ZR4A 1WB0A 1FKJA 4JFIA 2XP9A 5GPRA 2N87A 4Z2IA 2ZQTA 1E6ZA 1P5QA 1QPFA 1TFVA 4G50A 4MNLA 4N19A 3WL1A 4MGVA 3CH9A 4QT3A 2RUDA 2DG3A 2YBUA 4L3NA 4FAPA 4P8VA 1LL4A 2OFNA 1GOIA 4JFJA 1D6OA 2Y78A 4DT4A 4TNSA 2XP5A 1N1AA 2A3AA 1B6CA 2M1IA 2O9OA 4O2TA 4WJXA 1J4HA 1JNEA 2MNTA 1XHGA 1FKKA 2PBCA 3PRBA 5HW6A 4R5EA 4WKAA 2D9FA 2DSZA 3IKGA 1FFQA 2M08A 3WQWA 3WH0A 4QIBA 4U84A 5HW8A 4U85A 2DG9A 3TC5A 2DSVA 1GUVA 1KT1A 2PV2A 1HJWA 1CTNA 4HBEA 3EY6A 4DWSB 3ARWA 3ARXA 4DRPA 2WM0A 4G2PA 1K9TA 2PPPA 1TCOC 3WIJA 3IKDA 2KO7A 4DWSD 3NTPA 4ZPTR 4ODPA 3WD0A 2PV1A 3JYJA 2AWGA 1PBKA 1EYMA 5HKGA 3O5KA 4LGXA 4AY1A 3CGNA 1Q1CA 4ODOA 1EIBA 4JFLA 3FAPA 1ROUA 3ARYA 3ARUA 2PPNA 2IF4A 3H9RB 2ZQVA 1ITXA 3O5QA 1J4IA 1LG2A 1LL7A 2A3EA 4MSPA 1XRVA 3B8SA 3PRDA 4MPKA 3RMEA 2B31A 1KT0A 2MLYA 3LUOA 1KFWA 1W9VA 2DG4A 2LJ4A 3I6CA 2OLHA 3WD1A 3ARRA 1ZU8A 3AS1A 1JNTA 3O5DA 3W4RA 4DRNA 1O6IA 2WLYA 2DSUA 3AS0A 5BXJA 3JYMA 4LAXA 3RM4A 3O5MA 4ODNA 1HJXA 1FKTA 4TW7A 3KAFA 5I98A 1FKLA 4LAWA 4PTMA 3B9DA 3UQIA 1X6LA 4WKFA 4ODQA 2A3CA 2KR7A 4ZPVR 1ZBVA 5GQBA 1Q6UA 1WNOA 2WK2A 2RURA 4S3JA 1W9PA 3ALFA 3O5GA 5DO2A 1EQ3A 1OGBA 5J6EA 2PI6A 2VCDA 5HWCA 2FDMA 4URIA 1Q6IA 3IHZA 1IX5A 1ZK6A 1FKIA 3KAIA 3KAGA 3WD3A 3RM8A 4P8XA 4ITZA 1J6YA 1W1PA 5HW7A 1D7JA 1FKGA 4KQZA 1WAWA 2F2DA 3PR9A 4Z2GA 1FJDA 1NWUA 4DRKA 2K8IA 1PINA 1SR0A 1HKIA 2DT2A 3ODKA 1R9HA 4LAYA 2JZVA 4HARA 3VAWA 2PV3A 1JNSA 4P8WA 1ZBCA 3AROA 1EDQA 4P8UA 4L72B 4MNMA 3CHEA 4IT6A 4DRQA 2XPAA 3AS2A 4TW8A 1NSGA 2DPEA 2DT0A 1NWTA 4KR0B 4ML4A 1Y0OA 4Q7NA 2L2SA 2G41A 4IPXA 4NNRA 1NWSA 4DIPA 1ZBWA 4DRIA 5HT1A 1QZ2A 3RGCA 3TDBA 3TCZA 1NMWA 2RSEA 2KFWA 5DEZA 3NI6A 4DRJA 4GIVA 5HBFA 3MDYB 1NWRA 4DROA 2UZ5A 1LL6A 1FKSA 3CGMA 3OA5A 2O92A 2RQSA 2ITKA 2IUZA 3RFWA 2XP6A 1E6RA 1F8AB 4MNKA 2KE0A 1UR8A 3CZ8A 3KAHA 2XP3A 1U79A 2XP8A 2PPOA 4DRMA 4ZPWR 4Z2JA 4NSBA 2KGJA 1UR9A 3ALGA 4LAVA 3O5FA 1E15A 1FKRA 4W9OA 3ARSA 1W1TA 4J4NA 2A3BA 4DZ3A 2F21A 4DWSC 4TW6A 2F4EA 4ODKA 3PA7A 3O5EA 3BXWA 2ZQUA 1QPLA 2M2AA 2XP7A 1HKJA 1NH6A 5DF0A 3UQAA 2DSWA 3WKZA 3KCEA 5GPGA 1D7IA 3O5LA 1YW5A 3O5PA 2LKNA 3UQBA 1H0IA 2AOSA 3O5JA 1RD6A 1YATA 5HUAA 3FXYA 1OWQA 1E9LA 4Z2HA 3CHCA 4BF8A 2DT3A 1J4RA 2MLZA 2YBTA 2QF8A 4W9QA 1FKFA 4ODRA 1FD9A 1NMVA 2ZQSA 4QT2A 1JVWA 4DWSA 3B7XA 3ARPA 1W1YA 1A7XA 4WIWA 3OOBA 4IQCA 3JXVA 5HTGA 3ARQA 1Q6HA 4J4OA 2MLXA 3G6MA 4Z2LA 1HJVA 1FAPA 4HBOA 3WD2A 1F40A 4W9PA 3RM9A 2XP4A 1EHNA 1LJYA 1C9HA 1W9UA 4W5UA 4JFKA 4U86A 2FKEA 1SYTA 3PRAA 2G8ZA 5JH8A 1ZBKA 5DIUA 1ZL1A 1BKFA 1HKKA 3QOKA 2LGOA 1M5YA 1X6NA 4C02B 1D2KA 1E6NA 4S3KA 3ARZA 3AS3A 3WD4A 3FY1A 3KZ7A 4ODLA 4WK9A 2ZR6A 1H0GA 1LQ0A 4Z2KA 3CHDA 2MF9A 1GPFA 4MNJA 4ODMA 1HXVA 5D75A 2XPBA 1FKHA 4Q22A 3NRKA 2ZR5A 4IT4A 1ROTA 1W26A 3KACA 4TX0A 4NZCA 4R0XA 3GPKA 2LPVA 3WL0A 4FN2A 1VF8A 2WLZA 5HWBA 3UI4A 3ARTA 2FAPA 4DZ2A 3UF8A 1T11A 4IQ2A 1HKMA 1FKDA 1BL4A 2ESCA 4DRHA 2RUCA 3IK8A 1E6PA 4MAVA 3O5OA 4MTVA 1W1VA 4WKHA 1L1PA 2DT1A 4JYSA 4DH0A 3WQVA 2KI3A 2VN1A 1ZB5A 4GGQA 1LG1A 1ZCNA 3KABA 3O5RA 3CHFA 3B9AA 3AQUA 5DIVA 2Q5AA 3UI5A 4JFMA 4QZVB 2RUQA 1OGGA 3UI6A 3KADA 5DITA 1D7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAR A;  4HBE A;  4HBO A; 
#chains in the Genus database with same CATH topology
 1JND A;  1FKB A;  4XAK A;  3GTY X;  4ZS6 A;  1FFR A;  3ARV A;  3G6L A;  2MPH A;  3B9E A;  3O5I A;  5B8I C;  4TYO A;  2ZR4 A;  1WB0 A;  1FKJ A;  4JFI A;  2XP9 A;  5GPR A;  2N87 A;  4Z2I A;  2ZQT A;  1E6Z A;  1P5Q A;  1QPF A;  1TFV A;  3GU0 A;  4G50 A;  4MNL A;  4N19 A;  3WL1 A;  4MGV A;  3CH9 A;  4QT3 A;  2RUD A;  2DG3 A;  2YBU A;  4L3N A;  4FAP A;  4P8V A;  1LL4 A;  2OFN A;  1GOI A;  4JFJ A;  1D6O A;  2Y78 A;  4DT4 A;  2ETN A;  4TNS A;  2XP5 A;  1N1A A;  2A3A A;  1B6C A;  2M1I A;  2O9O A;  4O2T A;  4WJX A;  1J4H A;  1JNE A;  2MNT A;  1XHG A;  1FKK A;  2PBC A;  3PRB A;  5HW6 A;  4R5E A;  4WKA A;  2D9F A;  2DSZ A;  3IKG A;  1FFQ A;  2M08 A;  3WQW A;  3WH0 A;  4QIB A;  4U84 A;  5HW8 A;  4U85 A;  2DG9 A;  3TC5 A;  2DSV A;  1GUV A;  1KT1 A;  2PV2 A;  1HJW A;  1CTN A;  4HBE A;  3EY6 A;  4DWS B;  3ARW A;  3ARX A;  4DRP A;  2WM0 A;  4G2P A;  1K9T A;  2PPP A;  1TCO C;  3WIJ A;  3IKD A;  2KO7 A;  4DWS D;  3NTP A;  4ZPT R;  4ODP A;  3WD0 A;  2PV1 A;  3JYJ A;  2AWG A;  1PBK A;  1EYM A;  2PN0 A;  5HKG A;  3O5K A;  4LGX A;  4AY1 A;  3CGN A;  1Q1C A;  4ODO A;  1EIB A;  4JFL A;  3FAP A;  1ROU A;  3ARY A;  3ARU A;  2PPN A;  2IF4 A;  3H9R B;  2ZQV A;  1ITX A;  3O5Q A;  1J4I A;  1LG2 A;  1LL7 A;  2A3E A;  4MSP A;  1XRV A;  3B8S A;  3PRD A;  4MPK A;  3RME A;  2B31 A;  1KT0 A;  2MLY A;  3LUO A;  1KFW A;  1W9V A;  2DG4 A;  2LJ4 A;  3I6C A;  2OLH A;  3WD1 A;  3ARR A;  1ZU8 A;  3AS1 A;  1JNT A;  3O5D A;  3W4R A;  4DRN A;  1O6I A;  2WLY A;  2DSU A;  3AS0 A;  5BXJ A;  3JYM A;  4LAX A;  3RM4 A;  3O5M A;  4ODN A;  1HJX A;  1FKT A;  4TW7 A;  3KAF A;  5I98 A;  1FKL A;  4LAW A;  4PTM A;  3B9D A;  3UQI A;  1X6L A;  4WKF A;  4ODQ A;  2A3C A;  2KR7 A;  4ZPV R;  1ZBV A;  5GQB A;  1Q6U A;  1WNO A;  2WK2 A;  2B5U B;  2RUR A;  4S3J A;  1W9P A;  2EUL A;  3ALF A;  3O5G A;  5DO2 A;  1EQ3 A;  1OGB A;  5J6E A;  2PI6 A;  2VCD A;  5HWC A;  2FDM A;  4URI A;  1Q6I A;  3IHZ A;  1IX5 A;  1ZK6 A;  1FKI A;  3KAI A;  3KAG A;  3WD3 A;  3RM8 A;  4P8X A;  4ITZ A;  1J6Y A;  1W1P A;  5HW7 A;  1D7J A;  1FKG A;  4KQZ A;  1WAW A;  2F2D A;  3PR9 A;  4Z2G A;  1FJD A;  1NWU A;  4DRK A;  2K8I A;  1PIN A;  1SR0 A;  1HKI A;  2DT2 A;  3ODK A;  1R9H A;  4LAY A;  2JZV A;  4HAR A;  3VAW A;  2PV3 A;  1JNS A;  4P8W A;  1ZBC A;  3ARO A;  1EDQ A;  4P8U A;  4L72 B;  4MNM A;  3CHE A;  4IT6 A;  4DRQ A;  2XPA A;  3AS2 A;  4TW8 A;  2F23 A;  1NSG A;  2DPE A;  2DT0 A;  1E44 A;  1NWT A;  4KR0 B;  4ML4 A;  1Y0O A;  4Q7N A;  2L2S A;  4UDM A;  2G41 A;  4IPX A;  4NNR A;  1NWS A;  4DIP A;  1ZBW A;  4DRI A;  5HT1 A;  1QZ2 A;  3RGC A;  3TDB A;  3TCZ A;  1NMW A;  2RSE A;  2KFW A;  5DEZ A;  3NI6 A;  4DRJ A;  4GIV A;  5HBF A;  3MDY B;  1NWR A;  4DRO A;  2UZ5 A;  1LL6 A;  1FKS A;  3CGM A;  3OA5 A;  2O92 A;  2RQS A;  2ITK A;  2IUZ A;  3RFW A;  2XP6 A;  1E6R A;  1F8A B;  4MNK A;  2KE0 A;  1UR8 A;  3CZ8 A;  3KAH A;  2XP3 A;  1U79 A;  2XP8 A;  2PPO A;  4DRM A;  4ZPW R;  4Z2J A;  4NSB A;  2KGJ A;  1UR9 A;  3ALG A;  4LAV A;  3O5F A;  1E15 A;  1FKR A;  4W9O A;  3ARS A;  1W1T A;  4J4N A;  2A3B A;  4DZ3 A;  2F21 A;  4DWS C;  4TW6 A;  2F4E A;  4ODK A;  3PA7 A;  3O5E A;  3BXW A;  2ZQU A;  1QPL A;  2M2A A;  2XP7 A;  1HKJ A;  1NH6 A;  5DF0 A;  3UQA A;  1JCH B;  2DSW A;  3WKZ A;  3KCE A;  5GPG A;  1D7I A;  3O5L A;  1YW5 A;  3O5P A;  2LKN A;  3UQB A;  1H0I A;  2AOS A;  3O5J A;  1RD6 A;  1YAT A;  5HUA A;  3FXY A;  1OWQ A;  1E9L A;  4Z2H A;  3CHC A;  4BF8 A;  2DT3 A;  1J4R A;  2MLZ A;  2YBT A;  2QF8 A;  4W9Q A;  1FKF A;  4ODR A;  1FD9 A;  1NMV A;  2ZQS A;  4QT2 A;  1JVW A;  4DWS A;  3B7X A;  3ARP A;  1W1Y A;  1A7X A;  4WIW A;  3OOB A;  4IQC A;  3JXV A;  3EIP A;  5HTG A;  3ARQ A;  1Q6H A;  4J4O A;  2MLX A;  3G6M A;  4Z2L A;  1HJV A;  1FAP A;  4HBO A;  3WD2 A;  1F40 A;  4W9P A;  3RM9 A;  2XP4 A;  1EHN A;  1LJY A;  1C9H A;  1W9U A;  4W5U A;  4JFK A;  4U86 A;  2FKE A;  1SYT A;  3PRA A;  2G8Z A;  5JH8 A;  1ZBK A;  5DIU A;  1ZL1 A;  1BKF A;  1HKK A;  3QOK A;  2LGO A;  1M5Y A;  1X6N A;  4C02 B;  1D2K A;  1E6N A;  4S3K A;  3ARZ A;  3AS3 A;  3WD4 A;  3FY1 A;  3KZ7 A;  4ODL A;  4WK9 A;  2ZR6 A;  1H0G A;  1LQ0 A;  4Z2K A;  3CHD A;  2MF9 A;  1GPF A;  4MNJ A;  4ODM A;  1HXV A;  5D75 A;  2XPB A;  1FKH A;  4Q22 A;  3NRK A;  2ZR5 A;  4IT4 A;  1ROT A;  1W26 A;  3KAC A;  4TX0 A;  4NZC A;  4R0X A;  3GPK A;  2LPV A;  3WL0 A;  4FN2 A;  1VF8 A;  2WLZ A;  5HWB A;  3UI4 A;  3ART A;  2FAP A;  4DZ2 A;  3UF8 A;  1T11 A;  4IQ2 A;  1HKM A;  1FKD A;  1BL4 A;  1GRJ A;  2ESC A;  4DRH A;  2RUC A;  3IK8 A;  1E6P A;  4MAV A;  3O5O A;  4MTV A;  1W1V A;  4WKH A;  1L1P A;  2DT1 A;  4JYS A;  4DH0 A;  3WQV A;  2KI3 A;  2VN1 A;  1ZB5 A;  4GGQ A;  1LG1 A;  1ZCN A;  3KAB A;  3O5R A;  3CHF A;  3B9A A;  3AQU A;  5DIV A;  2Q5A A;  3UI5 A;  4JFM A;  2P4V A;  4QZV B;  2RUQ A;  3BMB A;  1OGG A;  3UI6 A;  3KAD A;  5DIT A;  1D7H A; 
#chains in the Genus database with same CATH homology
 1JND A;  1FKB A;  4XAK A;  4ZS6 A;  1FFR A;  3ARV A;  3G6L A;  2MPH A;  3B9E A;  3O5I A;  5B8I C;  4TYO A;  2ZR4 A;  1WB0 A;  1FKJ A;  4JFI A;  2XP9 A;  5GPR A;  2N87 A;  4Z2I A;  2ZQT A;  1E6Z A;  1P5Q A;  1QPF A;  1TFV A;  4G50 A;  4MNL A;  4N19 A;  3WL1 A;  4MGV A;  3CH9 A;  4QT3 A;  2RUD A;  2DG3 A;  2YBU A;  4L3N A;  4FAP A;  4P8V A;  1LL4 A;  2OFN A;  1GOI A;  4JFJ A;  1D6O A;  2Y78 A;  4DT4 A;  4TNS A;  2XP5 A;  1N1A A;  2A3A A;  1B6C A;  2M1I A;  2O9O A;  4O2T A;  4WJX A;  1J4H A;  1JNE A;  2MNT A;  1XHG A;  1FKK A;  2PBC A;  3PRB A;  5HW6 A;  4R5E A;  4WKA A;  2D9F A;  2DSZ A;  3IKG A;  1FFQ A;  2M08 A;  3WQW A;  3WH0 A;  4QIB A;  4U84 A;  5HW8 A;  4U85 A;  2DG9 A;  3TC5 A;  2DSV A;  1GUV A;  1KT1 A;  2PV2 A;  1HJW A;  1CTN A;  4HBE A;  3EY6 A;  4DWS B;  3ARW A;  3ARX A;  4DRP A;  2WM0 A;  4G2P A;  1K9T A;  2PPP A;  1TCO C;  3WIJ A;  3IKD A;  2KO7 A;  4DWS D;  3NTP A;  4ZPT R;  4ODP A;  3WD0 A;  2PV1 A;  3JYJ A;  2AWG A;  1PBK A;  1EYM A;  5HKG A;  3O5K A;  4LGX A;  4AY1 A;  3CGN A;  1Q1C A;  4ODO A;  1EIB A;  4JFL A;  3FAP A;  1ROU A;  3ARY A;  3ARU A;  2PPN A;  2IF4 A;  3H9R B;  2ZQV A;  1ITX A;  3O5Q A;  1J4I A;  1LG2 A;  1LL7 A;  2A3E A;  4MSP A;  1XRV A;  3B8S A;  3PRD A;  4MPK A;  3RME A;  2B31 A;  1KT0 A;  2MLY A;  3LUO A;  1KFW A;  1W9V A;  2DG4 A;  2LJ4 A;  3I6C A;  2OLH A;  3WD1 A;  3ARR A;  1ZU8 A;  3AS1 A;  1JNT A;  3O5D A;  3W4R A;  4DRN A;  1O6I A;  2WLY A;  2DSU A;  3AS0 A;  5BXJ A;  3JYM A;  4LAX A;  3RM4 A;  3O5M A;  4ODN A;  1HJX A;  1FKT A;  4TW7 A;  3KAF A;  5I98 A;  1FKL A;  4LAW A;  4PTM A;  3B9D A;  3UQI A;  1X6L A;  4WKF A;  4ODQ A;  2A3C A;  2KR7 A;  4ZPV R;  1ZBV A;  5GQB A;  1Q6U A;  1WNO A;  2WK2 A;  2RUR A;  4S3J A;  1W9P A;  3ALF A;  3O5G A;  5DO2 A;  1EQ3 A;  1OGB A;  5J6E A;  2PI6 A;  2VCD A;  5HWC A;  2FDM A;  4URI A;  1Q6I A;  3IHZ A;  1IX5 A;  1ZK6 A;  1FKI A;  3KAI A;  3KAG A;  3WD3 A;  3RM8 A;  4P8X A;  4ITZ A;  1J6Y A;  1W1P A;  5HW7 A;  1D7J A;  1FKG A;  4KQZ A;  1WAW A;  2F2D A;  3PR9 A;  4Z2G A;  1FJD A;  1NWU A;  4DRK A;  2K8I A;  1PIN A;  1SR0 A;  1HKI A;  2DT2 A;  3ODK A;  1R9H A;  4LAY A;  2JZV A;  4HAR A;  3VAW A;  2PV3 A;  1JNS A;  4P8W A;  1ZBC A;  3ARO A;  1EDQ A;  4P8U A;  4L72 B;  4MNM A;  3CHE A;  4IT6 A;  4DRQ A;  2XPA A;  3AS2 A;  4TW8 A;  1NSG A;  2DPE A;  2DT0 A;  1NWT A;  4KR0 B;  4ML4 A;  1Y0O A;  4Q7N A;  2L2S A;  2G41 A;  4IPX A;  4NNR A;  1NWS A;  4DIP A;  1ZBW A;  4DRI A;  5HT1 A;  1QZ2 A;  3RGC A;  3TDB A;  3TCZ A;  1NMW A;  2RSE A;  2KFW A;  5DEZ A;  3NI6 A;  4DRJ A;  4GIV A;  5HBF A;  3MDY B;  1NWR A;  4DRO A;  2UZ5 A;  1LL6 A;  1FKS A;  3CGM A;  3OA5 A;  2O92 A;  2RQS A;  2ITK A;  2IUZ A;  3RFW A;  2XP6 A;  1E6R A;  1F8A B;  4MNK A;  2KE0 A;  1UR8 A;  3CZ8 A;  3KAH A;  2XP3 A;  1U79 A;  2XP8 A;  2PPO A;  4DRM A;  4ZPW R;  4Z2J A;  4NSB A;  2KGJ A;  1UR9 A;  3ALG A;  4LAV A;  3O5F A;  1E15 A;  1FKR A;  4W9O A;  3ARS A;  1W1T A;  4J4N A;  2A3B A;  4DZ3 A;  2F21 A;  4DWS C;  4TW6 A;  2F4E A;  4ODK A;  3PA7 A;  3O5E A;  3BXW A;  2ZQU A;  1QPL A;  2M2A A;  2XP7 A;  1HKJ A;  1NH6 A;  5DF0 A;  3UQA A;  2DSW A;  3WKZ A;  3KCE A;  5GPG A;  1D7I A;  3O5L A;  1YW5 A;  3O5P A;  2LKN A;  3UQB A;  1H0I A;  2AOS A;  3O5J A;  1RD6 A;  1YAT A;  5HUA A;  3FXY A;  1OWQ A;  1E9L A;  4Z2H A;  3CHC A;  4BF8 A;  2DT3 A;  1J4R A;  2MLZ A;  2YBT A;  2QF8 A;  4W9Q A;  1FKF A;  4ODR A;  1FD9 A;  1NMV A;  2ZQS A;  4QT2 A;  1JVW A;  4DWS A;  3B7X A;  3ARP A;  1W1Y A;  1A7X A;  4WIW A;  3OOB A;  4IQC A;  3JXV A;  5HTG A;  3ARQ A;  1Q6H A;  4J4O A;  2MLX A;  3G6M A;  4Z2L A;  1HJV A;  1FAP A;  4HBO A;  3WD2 A;  1F40 A;  4W9P A;  3RM9 A;  2XP4 A;  1EHN A;  1LJY A;  1C9H A;  1W9U A;  4W5U A;  4JFK A;  4U86 A;  2FKE A;  1SYT A;  3PRA A;  2G8Z A;  5JH8 A;  1ZBK A;  5DIU A;  1ZL1 A;  1BKF A;  1HKK A;  3QOK A;  2LGO A;  1M5Y A;  1X6N A;  4C02 B;  1D2K A;  1E6N A;  4S3K A;  3ARZ A;  3AS3 A;  3WD4 A;  3FY1 A;  3KZ7 A;  4ODL A;  4WK9 A;  2ZR6 A;  1H0G A;  1LQ0 A;  4Z2K A;  3CHD A;  2MF9 A;  1GPF A;  4MNJ A;  4ODM A;  1HXV A;  5D75 A;  2XPB A;  1FKH A;  4Q22 A;  3NRK A;  2ZR5 A;  4IT4 A;  1ROT A;  1W26 A;  3KAC A;  4TX0 A;  4NZC A;  4R0X A;  3GPK A;  2LPV A;  3WL0 A;  4FN2 A;  1VF8 A;  2WLZ A;  5HWB A;  3UI4 A;  3ART A;  2FAP A;  4DZ2 A;  3UF8 A;  1T11 A;  4IQ2 A;  1HKM A;  1FKD A;  1BL4 A;  2ESC A;  4DRH A;  2RUC A;  3IK8 A;  1E6P A;  4MAV A;  3O5O A;  4MTV A;  1W1V A;  4WKH A;  1L1P A;  2DT1 A;  4JYS A;  4DH0 A;  3WQV A;  2KI3 A;  2VN1 A;  1ZB5 A;  4GGQ A;  1LG1 A;  1ZCN A;  3KAB A;  3O5R A;  3CHF A;  3B9A A;  3AQU A;  5DIV A;  2Q5A A;  3UI5 A;  4JFM A;  4QZV B;  2RUQ A;  1OGG A;  3UI6 A;  3KAD A;  5DIT A;  1D7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...