4HARA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4harA00
4HBEA 4HARA 4HBOA
chains in the Genus database with same CATH superfamily
2DSVA 4JFKA 4WKAA 3ODKA 2DSWA 4W9QA 1UR9A 3H9RB 3IK8A 1LJYA 2YBTA 1FKIA 2RUQA 4HARA 4C02B 5HW7A 4MNLA 2F23A 3KAHA 3WIJA 4ODNA 3UQBA 3UF8A 1CTNA 2G8ZA 3WL0A 2FKEA 4QZVB 2F4EA 3NTPA 5GPRA 3CZ8A 3B9DA 3ARVA 1E6ZA 2XP6A 2F2DA 3B8SA 3WKZA 4FAPA 1GOIA 2RUCA 2ZR5A 1FKHA 1HKMA 2RUDA 4W5UA 1LL6A 4ZPWR 1FFQA 1GUVA 2DSZA 2PV1A 5D75A 3RMEA 1FAPA 2KO7A 2ZR4A 2F21A 1HKJA 2O9OA 4J4OA 4TNSA 4L3NA 2A3BA 1U79A 2RSEA 1N1AA 1HKIA 4G50A 1P5QA 1FKLA 3NRKA 1FKGA 1TCOC 3RFWA 3UI6A 4ODPA 1LQ0A 4HBEA 4S3KA 4U86A 1NWUA 3CHDA 4DRIA 3NI6A 3JXVA 4Z2KA 2MLZA 1WNOA 1ZB5A 5J6EA 3GU0A 1HKKA 3AROA 2KR7A 4GIVA 1Y0OA 1LL7A 3WL1A 1E9LA 2PPNA 4QT3A 2DG3A 3WH0A 2ZR6A 3ARQA 3O5RA 3KACA 2K8IA 3CH9A 1WB0A 1FKSA 1BKFA 3CHFA 1FJDA 4DWSA 1VF8A 4P8XA 1LL4A 4MNKA 4Z2IA 1B6CA 1R9HA 4O2TA 1GRJA 4U85A 1FKJA 1NMWA 5GQBA 4WIWA 2WLZA 3WD2A 2B5UB 4ODLA 1PINA 2MPHA 2P4VA 4R0XA 4Z2HA 3FAPA 1ZBVA 2KE0A 4DZ2A 2DT3A 1SYTA 4ODRA 3KAGA 1XRVA 4DRHA 1W9UA 1E15A 3B9AA 2PPOA 4ODQA 1ZBWA 4ODMA 4L72B 4DRPA 2PV2A 2PBCA 1FKBA 4LGXA 4TW8A 5HBFA 1T11A 3RM8A 4MSPA 1ZCNA 4DIPA 3UQIA 3KAIA 1NWRA 3AS2A 1ITXA 3OOBA 3ARTA 1OGGA 2IUZA 4ML4A 1O6IA 3WQWA 4DT4A 4P8UA 5B8IC 4HBOA 1E6NA 2RQSA 1W1YA 2WM0A 2AWGA 4DRJA 3ALGA 3UI4A 4ZS6A 3PR9A 2ZQVA 1FKTA 4FN2A 1HJXA 3PA7A 4MNJA 1TFVA 2XP9A 5HUAA 4BF8A 2D9FA 1JCHB 4Z2LA 3O5QA 1FKDA 4IT4A 4JFIA 3LUOA 2OFNA 1NWTA 4PTMA 3KCEA 4NSBA 5HWBA 1D7IA 4IT6A 4P8VA 2QF8A 1LG1A 2KFWA 3VAWA 1Q6IA 1W1TA 3ARPA 3KADA 2ZQTA 4ZPTR 2RURA 1BL4A 1EQ3A 1L1PA 1Q6HA 4N19A 4TW6A 1FKFA 1OGBA 1ZK6A 3KABA 1QZ2A 4QIBA 3BXWA 3MDYB 1X6LA 3O5EA 2ESCA 2DSUA 3B9EA 1J4IA 4TYOA 4IQCA 1NWSA 5BXJA 1J4RA 1RD6A 5HT1A 1C9HA 1IX5A 3O5JA 3I6CA 1ROTA 1EDQA 1EIBA 3G6MA 5DITA 2IF4A 4R5EA 3ARSA 3RM4A 4DROA 3O5OA 2VCDA 4ODOA 4DH0A 3PRDA 2G41A 1J4HA 1NH6A 2ZQSA 3O5DA 4GGQA 3UI5A 3IHZA 1FD9A 2VN1A 4J4NA 4MNMA 4W9OA 2Y78A 1D2KA 3GPKA 3RGCA 3PRAA 2PPPA 1J6YA 2FDMA 2A3EA 2FAPA 3IKDA 3AQUA 2Q5AA 1FKKA 1LG2A 2PI6A 4NZCA 1E6RA 2LPVA 4IQ2A 3O5GA 1JNSA 3ARXA 1E6PA 3GTYX 3CGMA 4DRKA 1FKRA 4ODKA 2MLXA 2EULA 2KI3A 2XPBA 4Z2GA 3O5KA 2M08A 4MGVA 2A3AA 1HJWA 2MLYA 1D6OA 4QT2A 5GPGA 3EY6A 2XP7A 2ZQUA 4WJXA 2DG4A 2JZVA 5HW6A 4NNRA 4LAVA 1JNEA 3WD4A 4DWSD 4KQZA 1YATA 2ITKA 4IPXA 3FXYA 1H0IA 5DO2A 3TDBA 1EHNA 1KFWA 2M1IA 1X6NA 1Q1CA 4KR0B 1GPFA 3UQAA 5DIVA 5DEZA 1D7HA 4P8WA 1W9VA 4S3JA 4U84A 3W4RA 2KGJA 3KAFA 1D7JA 3WD0A 2XPAA 4DRQA 1ZBCA 2LJ4A 1PBKA 2OLHA 3KZ7A 3TC5A 3AS3A 4DWSC 4Q22A 4WKHA 3O5FA 3JYMA 1H0GA 1YW5A 1E44A 2PV3A 4Z2JA 3CGNA 2O92A 2PN0A 3CHEA 4DRMA 2LKNA 3OA5A 1W9PA 3ARYA 3FY1A 2LGOA 4DRNA 1F8AB 2WK2A 1KT1A 3PRBA 4DZ3A 3O5IA 4LAXA 4TX0A 4LAYA 2M2AA 5I98A 4AY1A 4WK9A 3G6LA 5HKGA 4JFLA 3QOKA 3AS0A 4MAVA 4WKFA 4ZPVR 1HXVA 4TW7A 2UZ5A 1XHGA 3JYJA 1Q6UA 1W1PA 1WAWA 2XP5A 1NMVA 1W26A 2YBUA 4LAWA 3WQVA 2DT1A 1ROUA 1SR0A 2MF9A 1JNDA 3AS1A 4URIA 1UR8A 5HW8A 2XP8A 3ALFA 2DT0A 2WLYA 2XP4A 1JVWA 4XAKA 4JFJA 2ETNA 3WD3A 1KT0A 3ARUA 1ZU8A 4MPKA 4MTVA 2N87A 5JH8A 2XP3A 1QPFA 4DWSB 3BMBA 2A3CA 2B31A 1ZBKA 3O5PA 1F40A 1ZL1A 3TCZA 3O5MA 3ARZA 4W9PA 1FFRA 4ITZA 4UDMA 1HJVA 1A7XA 2L2SA 5DIUA 1QPLA 1EYMA 4JYSA 3CHCA 3ARRA 3IKGA 1OWQA 2MNTA 3O5LA 4JFMA 2AOSA 3RM9A 1W1VA 4Q7NA 2DT2A 5HTGA 4G2PA 3WD1A 5DF0A 3ARWA 1K9TA 2DPEA 5HWCA 2DG9A 3B7XA 1M5YA 3EIPA 1NSGA 1JNTA
chains in the Genus database with same CATH topology
2DSVA 4JFKA 4WKAA 3ODKA 2DSWA 4W9QA 1UR9A 3H9RB 3IK8A 1LJYA 2YBTA 1FKIA 2RUQA 4HARA 4C02B 5HW7A 4MNLA 3KAHA 3WIJA 4ODNA 3UQBA 3UF8A 1CTNA 2G8ZA 3WL0A 2FKEA 4QZVB 2F4EA 3NTPA 5GPRA 3CZ8A 3B9DA 3ARVA 1E6ZA 2XP6A 2F2DA 3B8SA 3WKZA 4FAPA 1GOIA 2RUCA 2ZR5A 1FKHA 1HKMA 2RUDA 4W5UA 1LL6A 4ZPWR 1FFQA 1GUVA 2DSZA 2PV1A 5D75A 3RMEA 1FAPA 2KO7A 2ZR4A 2F21A 1HKJA 2O9OA 4J4OA 4TNSA 4L3NA 2A3BA 1U79A 2RSEA 1N1AA 1HKIA 4G50A 1P5QA 1FKLA 3NRKA 1FKGA 1TCOC 3RFWA 3UI6A 4ODPA 1LQ0A 4HBEA 4S3KA 4U86A 1NWUA 3CHDA 4DRIA 3NI6A 3JXVA 4Z2KA 2MLZA 1WNOA 1ZB5A 5J6EA 1HKKA 3AROA 2KR7A 4GIVA 1Y0OA 1LL7A 3WL1A 1E9LA 2PPNA 4QT3A 2DG3A 3WH0A 2ZR6A 3ARQA 3O5RA 3KACA 2K8IA 3CH9A 1WB0A 1FKSA 1BKFA 3CHFA 1FJDA 4DWSA 1VF8A 4P8XA 1LL4A 4MNKA 4Z2IA 1B6CA 1R9HA 4O2TA 4U85A 1FKJA 1NMWA 5GQBA 4WIWA 2WLZA 3WD2A 4ODLA 1PINA 2MPHA 4R0XA 4Z2HA 3FAPA 1ZBVA 2KE0A 4DZ2A 2DT3A 1SYTA 4ODRA 3KAGA 1XRVA 4DRHA 1W9UA 1E15A 3B9AA 2PPOA 4ODQA 1ZBWA 4ODMA 4L72B 4DRPA 2PV2A 2PBCA 1FKBA 4LGXA 4TW8A 5HBFA 1T11A 3RM8A 4MSPA 1ZCNA 4DIPA 3UQIA 3KAIA 1NWRA 3AS2A 1ITXA 3OOBA 3ARTA 1OGGA 2IUZA 4ML4A 1O6IA 3WQWA 4DT4A 4P8UA 5B8IC 4HBOA 1E6NA 2RQSA 1W1YA 2WM0A 2AWGA 4DRJA 3ALGA 3UI4A 4ZS6A 3PR9A 2ZQVA 1FKTA 4FN2A 1HJXA 3PA7A 4MNJA 1TFVA 2XP9A 5HUAA 4BF8A 2D9FA 4Z2LA 3O5QA 1FKDA 4IT4A 4JFIA 3LUOA 2OFNA 1NWTA 4PTMA 3KCEA 4NSBA 5HWBA 1D7IA 4IT6A 4P8VA 2QF8A 1LG1A 2KFWA 3VAWA 1Q6IA 1W1TA 3ARPA 3KADA 2ZQTA 4ZPTR 2RURA 1BL4A 1EQ3A 1L1PA 1Q6HA 4N19A 4TW6A 1FKFA 1OGBA 1ZK6A 3KABA 1QZ2A 4QIBA 3BXWA 3MDYB 1X6LA 3O5EA 2ESCA 2DSUA 3B9EA 1J4IA 4TYOA 4IQCA 1NWSA 5BXJA 1J4RA 1RD6A 5HT1A 1C9HA 1IX5A 3O5JA 3I6CA 1ROTA 1EDQA 1EIBA 3G6MA 5DITA 2IF4A 4R5EA 3ARSA 3RM4A 4DROA 3O5OA 2VCDA 4ODOA 4DH0A 3PRDA 2G41A 1J4HA 1NH6A 2ZQSA 3O5DA 4GGQA 3UI5A 3IHZA 1FD9A 2VN1A 4J4NA 4MNMA 4W9OA 2Y78A 1D2KA 3GPKA 3RGCA 3PRAA 2PPPA 1J6YA 2FDMA 2A3EA 2FAPA 3IKDA 3AQUA 2Q5AA 1FKKA 1LG2A 2PI6A 4NZCA 1E6RA 2LPVA 4IQ2A 3O5GA 1JNSA 3ARXA 1E6PA 3CGMA 4DRKA 1FKRA 4ODKA 2MLXA 2XPBA 2KI3A 4Z2GA 3O5KA 2M08A 4MGVA 2A3AA 1HJWA 2MLYA 1D6OA 4QT2A 5GPGA 3EY6A 2XP7A 2ZQUA 4WJXA 2DG4A 2JZVA 5HW6A 4NNRA 4LAVA 1JNEA 3WD4A 4DWSD 4KQZA 1YATA 2ITKA 4IPXA 3FXYA 1H0IA 5DO2A 3TDBA 1EHNA 1KFWA 2M1IA 1X6NA 1Q1CA 4KR0B 1GPFA 3UQAA 5DIVA 5DEZA 1D7HA 4P8WA 1W9VA 4S3JA 4U84A 3W4RA 2KGJA 3KAFA 1D7JA 3WD0A 2XPAA 4DRQA 1ZBCA 2LJ4A 1PBKA 2OLHA 3KZ7A 3TC5A 3AS3A 4DWSC 4Q22A 4WKHA 3O5FA 3JYMA 1H0GA 1YW5A 2PV3A 4Z2JA 3CGNA 2O92A 3CHEA 4DRMA 2LKNA 3OA5A 1W9PA 3ARYA 3FY1A 2LGOA 4DRNA 1F8AB 2WK2A 1KT1A 3PRBA 4DZ3A 3O5IA 4LAXA 4TX0A 4LAYA 2M2AA 5I98A 4AY1A 4WK9A 3G6LA 5HKGA 4JFLA 3QOKA 3AS0A 4MAVA 4WKFA 4ZPVR 1HXVA 4TW7A 2UZ5A 1XHGA 3JYJA 1Q6UA 1W1PA 1WAWA 2XP5A 1NMVA 1W26A 2YBUA 4LAWA 3WQVA 2DT1A 1ROUA 1SR0A 2MF9A 1JNDA 3AS1A 4URIA 1UR8A 5HW8A 2XP8A 3ALFA 2DT0A 2WLYA 2XP4A 1JVWA 4XAKA 4JFJA 3WD3A 1KT0A 3ARUA 4MPKA 4MTVA 2N87A 5JH8A 2XP3A 1QPFA 4DWSB 2A3CA 2B31A 1ZBKA 3O5PA 1F40A 1ZL1A 3TCZA 3O5MA 3ARZA 4W9PA 1FFRA 4ITZA 1HJVA 1A7XA 2L2SA 5DIUA 1QPLA 1EYMA 4JYSA 3CHCA 3ARRA 3IKGA 1OWQA 2MNTA 3O5LA 4JFMA 2AOSA 3RM9A 1W1VA 4Q7NA 2DT2A 5HTGA 4G2PA 3WD1A 5DF0A 3ARWA 1K9TA 2DPEA 5HWCA 2DG9A 3B7XA 1M5YA 1ZU8A 1NSGA 1JNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBE A;  4HAR A;  4HBO A; 
#chains in the Genus database with same CATH topology
 2DSV A;  4JFK A;  4WKA A;  3ODK A;  2DSW A;  4W9Q A;  1UR9 A;  3H9R B;  3IK8 A;  1LJY A;  2YBT A;  1FKI A;  2RUQ A;  4HAR A;  4C02 B;  5HW7 A;  4MNL A;  2F23 A;  3KAH A;  3WIJ A;  4ODN A;  3UQB A;  3UF8 A;  1CTN A;  2G8Z A;  3WL0 A;  2FKE A;  4QZV B;  2F4E A;  3NTP A;  5GPR A;  3CZ8 A;  3B9D A;  3ARV A;  1E6Z A;  2XP6 A;  2F2D A;  3B8S A;  3WKZ A;  4FAP A;  1GOI A;  2RUC A;  2ZR5 A;  1FKH A;  1HKM A;  2RUD A;  4W5U A;  1LL6 A;  4ZPW R;  1FFQ A;  1GUV A;  2DSZ A;  2PV1 A;  5D75 A;  3RME A;  1FAP A;  2KO7 A;  2ZR4 A;  2F21 A;  1HKJ A;  2O9O A;  4J4O A;  4TNS A;  4L3N A;  2A3B A;  1U79 A;  2RSE A;  1N1A A;  1HKI A;  4G50 A;  1P5Q A;  1FKL A;  3NRK A;  1FKG A;  1TCO C;  3RFW A;  3UI6 A;  4ODP A;  1LQ0 A;  4HBE A;  4S3K A;  4U86 A;  1NWU A;  3CHD A;  4DRI A;  3NI6 A;  3JXV A;  4Z2K A;  2MLZ A;  1WNO A;  1ZB5 A;  5J6E A;  3GU0 A;  1HKK A;  3ARO A;  2KR7 A;  4GIV A;  1Y0O A;  1LL7 A;  3WL1 A;  1E9L A;  2PPN A;  4QT3 A;  2DG3 A;  3WH0 A;  2ZR6 A;  3ARQ A;  3O5R A;  3KAC A;  2K8I A;  3CH9 A;  1WB0 A;  1FKS A;  1BKF A;  3CHF A;  1FJD A;  4DWS A;  1VF8 A;  4P8X A;  1LL4 A;  4MNK A;  4Z2I A;  1B6C A;  1R9H A;  4O2T A;  1GRJ A;  4U85 A;  1FKJ A;  1NMW A;  5GQB A;  4WIW A;  2WLZ A;  3WD2 A;  2B5U B;  4ODL A;  1PIN A;  2MPH A;  2P4V A;  4R0X A;  4Z2H A;  3FAP A;  1ZBV A;  2KE0 A;  4DZ2 A;  2DT3 A;  1SYT A;  4ODR A;  3KAG A;  1XRV A;  4DRH A;  1W9U A;  1E15 A;  3B9A A;  2PPO A;  4ODQ A;  1ZBW A;  4ODM A;  4L72 B;  4DRP A;  2PV2 A;  2PBC A;  1FKB A;  4LGX A;  4TW8 A;  5HBF A;  1T11 A;  3RM8 A;  4MSP A;  1ZCN A;  4DIP A;  3UQI A;  3KAI A;  1NWR A;  3AS2 A;  1ITX A;  3OOB A;  3ART A;  1OGG A;  2IUZ A;  4ML4 A;  1O6I A;  3WQW A;  4DT4 A;  4P8U A;  5B8I C;  4HBO A;  1E6N A;  2RQS A;  1W1Y A;  2WM0 A;  2AWG A;  4DRJ A;  3ALG A;  3UI4 A;  4ZS6 A;  3PR9 A;  2ZQV A;  1FKT A;  4FN2 A;  1HJX A;  3PA7 A;  4MNJ A;  1TFV A;  2XP9 A;  5HUA A;  4BF8 A;  2D9F A;  1JCH B;  4Z2L A;  3O5Q A;  1FKD A;  4IT4 A;  4JFI A;  3LUO A;  2OFN A;  1NWT A;  4PTM A;  3KCE A;  4NSB A;  5HWB A;  1D7I A;  4IT6 A;  4P8V A;  2QF8 A;  1LG1 A;  2KFW A;  3VAW A;  1Q6I A;  1W1T A;  3ARP A;  3KAD A;  2ZQT A;  4ZPT R;  2RUR A;  1BL4 A;  1EQ3 A;  1L1P A;  1Q6H A;  4N19 A;  4TW6 A;  1FKF A;  1OGB A;  1ZK6 A;  3KAB A;  1QZ2 A;  4QIB A;  3BXW A;  3MDY B;  1X6L A;  3O5E A;  2ESC A;  2DSU A;  3B9E A;  1J4I A;  4TYO A;  4IQC A;  1NWS A;  5BXJ A;  1J4R A;  1RD6 A;  5HT1 A;  1C9H A;  1IX5 A;  3O5J A;  3I6C A;  1ROT A;  1EDQ A;  1EIB A;  3G6M A;  5DIT A;  2IF4 A;  4R5E A;  3ARS A;  3RM4 A;  4DRO A;  3O5O A;  2VCD A;  4ODO A;  4DH0 A;  3PRD A;  2G41 A;  1J4H A;  1NH6 A;  2ZQS A;  3O5D A;  4GGQ A;  3UI5 A;  3IHZ A;  1FD9 A;  2VN1 A;  4J4N A;  4MNM A;  4W9O A;  2Y78 A;  1D2K A;  3GPK A;  3RGC A;  3PRA A;  2PPP A;  1J6Y A;  2FDM A;  2A3E A;  2FAP A;  3IKD A;  3AQU A;  2Q5A A;  1FKK A;  1LG2 A;  2PI6 A;  4NZC A;  1E6R A;  2LPV A;  4IQ2 A;  3O5G A;  1JNS A;  3ARX A;  1E6P A;  3GTY X;  3CGM A;  4DRK A;  1FKR A;  4ODK A;  2MLX A;  2EUL A;  2KI3 A;  2XPB A;  4Z2G A;  3O5K A;  2M08 A;  4MGV A;  2A3A A;  1HJW A;  2MLY A;  1D6O A;  4QT2 A;  5GPG A;  3EY6 A;  2XP7 A;  2ZQU A;  4WJX A;  2DG4 A;  2JZV A;  5HW6 A;  4NNR A;  4LAV A;  1JNE A;  3WD4 A;  4DWS D;  4KQZ A;  1YAT A;  2ITK A;  4IPX A;  3FXY A;  1H0I A;  5DO2 A;  3TDB A;  1EHN A;  1KFW A;  2M1I A;  1X6N A;  1Q1C A;  4KR0 B;  1GPF A;  3UQA A;  5DIV A;  5DEZ A;  1D7H A;  4P8W A;  1W9V A;  4S3J A;  4U84 A;  3W4R A;  2KGJ A;  3KAF A;  1D7J A;  3WD0 A;  2XPA A;  4DRQ A;  1ZBC A;  2LJ4 A;  1PBK A;  2OLH A;  3KZ7 A;  3TC5 A;  3AS3 A;  4DWS C;  4Q22 A;  4WKH A;  3O5F A;  3JYM A;  1H0G A;  1YW5 A;  1E44 A;  2PV3 A;  4Z2J A;  3CGN A;  2O92 A;  2PN0 A;  3CHE A;  4DRM A;  2LKN A;  3OA5 A;  1W9P A;  3ARY A;  3FY1 A;  2LGO A;  4DRN A;  1F8A B;  2WK2 A;  1KT1 A;  3PRB A;  4DZ3 A;  3O5I A;  4LAX A;  4TX0 A;  4LAY A;  2M2A A;  5I98 A;  4AY1 A;  4WK9 A;  3G6L A;  5HKG A;  4JFL A;  3QOK A;  3AS0 A;  4MAV A;  4WKF A;  4ZPV R;  1HXV A;  4TW7 A;  2UZ5 A;  1XHG A;  3JYJ A;  1Q6U A;  1W1P A;  1WAW A;  2XP5 A;  1NMV A;  1W26 A;  2YBU A;  4LAW A;  3WQV A;  2DT1 A;  1ROU A;  1SR0 A;  2MF9 A;  1JND A;  3AS1 A;  4URI A;  1UR8 A;  5HW8 A;  2XP8 A;  3ALF A;  2DT0 A;  2WLY A;  2XP4 A;  1JVW A;  4XAK A;  4JFJ A;  2ETN A;  3WD3 A;  1KT0 A;  3ARU A;  1ZU8 A;  4MPK A;  4MTV A;  2N87 A;  5JH8 A;  2XP3 A;  1QPF A;  4DWS B;  3BMB A;  2A3C A;  2B31 A;  1ZBK A;  3O5P A;  1F40 A;  1ZL1 A;  3TCZ A;  3O5M A;  3ARZ A;  4W9P A;  1FFR A;  4ITZ A;  4UDM A;  1HJV A;  1A7X A;  2L2S A;  5DIU A;  1QPL A;  1EYM A;  4JYS A;  3CHC A;  3ARR A;  3IKG A;  1OWQ A;  2MNT A;  3O5L A;  4JFM A;  2AOS A;  3RM9 A;  1W1V A;  4Q7N A;  2DT2 A;  5HTG A;  4G2P A;  3WD1 A;  5DF0 A;  3ARW A;  1K9T A;  2DPE A;  5HWC A;  2DG9 A;  3B7X A;  1M5Y A;  3EIP A;  1NSG A;  1JNT A; 
#chains in the Genus database with same CATH homology
 2DSV A;  4JFK A;  4WKA A;  3ODK A;  2DSW A;  4W9Q A;  1UR9 A;  3H9R B;  3IK8 A;  1LJY A;  2YBT A;  1FKI A;  2RUQ A;  4HAR A;  4C02 B;  5HW7 A;  4MNL A;  3KAH A;  3WIJ A;  4ODN A;  3UQB A;  3UF8 A;  1CTN A;  2G8Z A;  3WL0 A;  2FKE A;  4QZV B;  2F4E A;  3NTP A;  5GPR A;  3CZ8 A;  3B9D A;  3ARV A;  1E6Z A;  2XP6 A;  2F2D A;  3B8S A;  3WKZ A;  4FAP A;  1GOI A;  2RUC A;  2ZR5 A;  1FKH A;  1HKM A;  2RUD A;  4W5U A;  1LL6 A;  4ZPW R;  1FFQ A;  1GUV A;  2DSZ A;  2PV1 A;  5D75 A;  3RME A;  1FAP A;  2KO7 A;  2ZR4 A;  2F21 A;  1HKJ A;  2O9O A;  4J4O A;  4TNS A;  4L3N A;  2A3B A;  1U79 A;  2RSE A;  1N1A A;  1HKI A;  4G50 A;  1P5Q A;  1FKL A;  3NRK A;  1FKG A;  1TCO C;  3RFW A;  3UI6 A;  4ODP A;  1LQ0 A;  4HBE A;  4S3K A;  4U86 A;  1NWU A;  3CHD A;  4DRI A;  3NI6 A;  3JXV A;  4Z2K A;  2MLZ A;  1WNO A;  1ZB5 A;  5J6E A;  1HKK A;  3ARO A;  2KR7 A;  4GIV A;  1Y0O A;  1LL7 A;  3WL1 A;  1E9L A;  2PPN A;  4QT3 A;  2DG3 A;  3WH0 A;  2ZR6 A;  3ARQ A;  3O5R A;  3KAC A;  2K8I A;  3CH9 A;  1WB0 A;  1FKS A;  1BKF A;  3CHF A;  1FJD A;  4DWS A;  1VF8 A;  4P8X A;  1LL4 A;  4MNK A;  4Z2I A;  1B6C A;  1R9H A;  4O2T A;  4U85 A;  1FKJ A;  1NMW A;  5GQB A;  4WIW A;  2WLZ A;  3WD2 A;  4ODL A;  1PIN A;  2MPH A;  4R0X A;  4Z2H A;  3FAP A;  1ZBV A;  2KE0 A;  4DZ2 A;  2DT3 A;  1SYT A;  4ODR A;  3KAG A;  1XRV A;  4DRH A;  1W9U A;  1E15 A;  3B9A A;  2PPO A;  4ODQ A;  1ZBW A;  4ODM A;  4L72 B;  4DRP A;  2PV2 A;  2PBC A;  1FKB A;  4LGX A;  4TW8 A;  5HBF A;  1T11 A;  3RM8 A;  4MSP A;  1ZCN A;  4DIP A;  3UQI A;  3KAI A;  1NWR A;  3AS2 A;  1ITX A;  3OOB A;  3ART A;  1OGG A;  2IUZ A;  4ML4 A;  1O6I A;  3WQW A;  4DT4 A;  4P8U A;  5B8I C;  4HBO A;  1E6N A;  2RQS A;  1W1Y A;  2WM0 A;  2AWG A;  4DRJ A;  3ALG A;  3UI4 A;  4ZS6 A;  3PR9 A;  2ZQV A;  1FKT A;  4FN2 A;  1HJX A;  3PA7 A;  4MNJ A;  1TFV A;  2XP9 A;  5HUA A;  4BF8 A;  2D9F A;  4Z2L A;  3O5Q A;  1FKD A;  4IT4 A;  4JFI A;  3LUO A;  2OFN A;  1NWT A;  4PTM A;  3KCE A;  4NSB A;  5HWB A;  1D7I A;  4IT6 A;  4P8V A;  2QF8 A;  1LG1 A;  2KFW A;  3VAW A;  1Q6I A;  1W1T A;  3ARP A;  3KAD A;  2ZQT A;  4ZPT R;  2RUR A;  1BL4 A;  1EQ3 A;  1L1P A;  1Q6H A;  4N19 A;  4TW6 A;  1FKF A;  1OGB A;  1ZK6 A;  3KAB A;  1QZ2 A;  4QIB A;  3BXW A;  3MDY B;  1X6L A;  3O5E A;  2ESC A;  2DSU A;  3B9E A;  1J4I A;  4TYO A;  4IQC A;  1NWS A;  5BXJ A;  1J4R A;  1RD6 A;  5HT1 A;  1C9H A;  1IX5 A;  3O5J A;  3I6C A;  1ROT A;  1EDQ A;  1EIB A;  3G6M A;  5DIT A;  2IF4 A;  4R5E A;  3ARS A;  3RM4 A;  4DRO A;  3O5O A;  2VCD A;  4ODO A;  4DH0 A;  3PRD A;  2G41 A;  1J4H A;  1NH6 A;  2ZQS A;  3O5D A;  4GGQ A;  3UI5 A;  3IHZ A;  1FD9 A;  2VN1 A;  4J4N A;  4MNM A;  4W9O A;  2Y78 A;  1D2K A;  3GPK A;  3RGC A;  3PRA A;  2PPP A;  1J6Y A;  2FDM A;  2A3E A;  2FAP A;  3IKD A;  3AQU A;  2Q5A A;  1FKK A;  1LG2 A;  2PI6 A;  4NZC A;  1E6R A;  2LPV A;  4IQ2 A;  3O5G A;  1JNS A;  3ARX A;  1E6P A;  3CGM A;  4DRK A;  1FKR A;  4ODK A;  2MLX A;  2XPB A;  2KI3 A;  4Z2G A;  3O5K A;  2M08 A;  4MGV A;  2A3A A;  1HJW A;  2MLY A;  1D6O A;  4QT2 A;  5GPG A;  3EY6 A;  2XP7 A;  2ZQU A;  4WJX A;  2DG4 A;  2JZV A;  5HW6 A;  4NNR A;  4LAV A;  1JNE A;  3WD4 A;  4DWS D;  4KQZ A;  1YAT A;  2ITK A;  4IPX A;  3FXY A;  1H0I A;  5DO2 A;  3TDB A;  1EHN A;  1KFW A;  2M1I A;  1X6N A;  1Q1C A;  4KR0 B;  1GPF A;  3UQA A;  5DIV A;  5DEZ A;  1D7H A;  4P8W A;  1W9V A;  4S3J A;  4U84 A;  3W4R A;  2KGJ A;  3KAF A;  1D7J A;  3WD0 A;  2XPA A;  4DRQ A;  1ZBC A;  2LJ4 A;  1PBK A;  2OLH A;  3KZ7 A;  3TC5 A;  3AS3 A;  4DWS C;  4Q22 A;  4WKH A;  3O5F A;  3JYM A;  1H0G A;  1YW5 A;  2PV3 A;  4Z2J A;  3CGN A;  2O92 A;  3CHE A;  4DRM A;  2LKN A;  3OA5 A;  1W9P A;  3ARY A;  3FY1 A;  2LGO A;  4DRN A;  1F8A B;  2WK2 A;  1KT1 A;  3PRB A;  4DZ3 A;  3O5I A;  4LAX A;  4TX0 A;  4LAY A;  2M2A A;  5I98 A;  4AY1 A;  4WK9 A;  3G6L A;  5HKG A;  4JFL A;  3QOK A;  3AS0 A;  4MAV A;  4WKF A;  4ZPV R;  1HXV A;  4TW7 A;  2UZ5 A;  1XHG A;  3JYJ A;  1Q6U A;  1W1P A;  1WAW A;  2XP5 A;  1NMV A;  1W26 A;  2YBU A;  4LAW A;  3WQV A;  2DT1 A;  1ROU A;  1SR0 A;  2MF9 A;  1JND A;  3AS1 A;  4URI A;  1UR8 A;  5HW8 A;  2XP8 A;  3ALF A;  2DT0 A;  2WLY A;  2XP4 A;  1JVW A;  4XAK A;  4JFJ A;  3WD3 A;  1KT0 A;  3ARU A;  4MPK A;  4MTV A;  2N87 A;  5JH8 A;  2XP3 A;  1QPF A;  4DWS B;  2A3C A;  2B31 A;  1ZBK A;  3O5P A;  1F40 A;  1ZL1 A;  3TCZ A;  3O5M A;  3ARZ A;  4W9P A;  1FFR A;  4ITZ A;  1HJV A;  1A7X A;  2L2S A;  5DIU A;  1QPL A;  1EYM A;  4JYS A;  3CHC A;  3ARR A;  3IKG A;  1OWQ A;  2MNT A;  3O5L A;  4JFM A;  2AOS A;  3RM9 A;  1W1V A;  4Q7N A;  2DT2 A;  5HTG A;  4G2P A;  3WD1 A;  5DF0 A;  3ARW A;  1K9T A;  2DPE A;  5HWC A;  2DG9 A;  3B7X A;  1M5Y A;  1ZU8 A;  1NSG A;  1JNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...