4HAUB

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1-ran-ranbp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 37
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hauB00
1KZ7A 5D27A 2ADZA 2KUPA 3ZVRA 2K2UA 3A8QA 4PNKA 4F7GA 1X05A 1OMWA 1X1FA 2DTCA 3F0WA 2EJ8A 4HAUB 2W2WA 4GN1A 2RUKB 1U5EA 2W2XC 2XQNM 4TKNA 3ULBA 3D8EA 2GJYA 1UPRA 2YRYA 2P8VA 2PZ1A 1M7EA 3U8ZA 1X86A 3NSUA 1Y5OA 1TXDA 2DX1A 2CODA 4K17A 2COFA 2DA0A 1B55A 1OQNA 1MK7B 2RVBB 1XX0A 2N0YA 2EMSA 3V5WA 2L2IA 2DYQA 1V5PA 2LYDA 3ODXA 2LULA 4YL8A 2VKIA 4A6FB 4DBBA 5JHHA 3WA0A 2OTXA 1TQZA 2P0FA 3ODOA 3D8DA 2I1KA 3GYPA 3AU4A 1XR0B 5JP4A 2LOZA 3MDBC 2LG1A 1WGUA 1P5TA 5FI1A 1N3HA 2IYBA 3KSYA 3VIAA 1RJ2A 1EVHA 1V5MA 1AQCA 1IRSA 4DXAB 2AEHA 5KQ4A 4L6EA 5J3YA 3ZDTA 2D10A 5KCVA 4HAYB 2GS0A 3PP2A 2DHIA 1FAOA 2DHKA 1I7AA 2VSZA 2LOXA 2D9ZA 3AJ4A 2ROZB 4A6KA 2I5CA 4MK0A 1BWNA 3FEHA 1K5DB 4Z2NA 3PVLA 4IAPA 4KHAA 1M7RA 4TYZA 5DH9B 1UNRA 2DLWA 2P0DA 3TW1A 3FM8C 2X18A 2DYNA 3BINA 2UVMA 2H7DA 5EFXA 5J3TA 1FGZA 2AL6A 1PFJA 3KRXA 2Z0PA 4HAWB 2MFQA 1K5GB 2YF0A 2ZPYA 1V5UA 5L81A 1NI2A 5KQ1A 3CIKA 4KAXB 2RSGA 1H10A 4WSFA 2N23A 5HE0A 3KRWA 4KHOA 3HW2B 1ZC4B 1QQGA 1XD4A 1H4RA 4KHBB 1GC6A 1LB1A 1ZSQA 3TFMA 4HHVA 3FSSA 3LJUX 4ZRIA 1XODA 2RNRB 1MAIA 2D11A 2Z0QA 4GPTB 1DROA 2BCJA 1J19A 1MIXA 5CLLB 2ELBA 2R0DA 1U5FA 4DX90 1BAKA 4H8SA 4K81A 4HAZB 2D9VA 2CAYA 2J0JA 3SV1A 5JHGA 1E5WA 4MT7A 3PG7A 1ZM0A 3TO1A 1W1DA 3IVFA 2QKMA 4HB2B 1Z87A 4IFSA 2D9WA 1BTKA 3KY9A 2GCLA 3AU5A 1EF1A 5D3XA 1DDVA 3SO6A 3SUZA 4EMOA 1DYNA 4F7UP 3RCPA 1GC7A 4HB0B 1V89A 1P3RA 3D8FA 1WG7A 2YS5A 2W2XD 5LONB 1WVHA 5HE1A 1UNQA 2L1CA 4WJ7A 2YVCA 4A5KA 2VRWB 2MDXA 4GZUA 3N7CA 3O96A 2D9YA 3QIJA 1PLSA 4XWXA 2K00A 4P7IA 3SYXA 1TJ6A 1DBHA 2M14A 1FHOA 2ROVA 1U2BA 1W1HA 1UNPA 3UZTA 1P6SA 2DFKA 5C6RA 4GMXB 2Y8GA 4GXBA 2NZ8B 2M38A 1KZGA 2DX5A 2H7EA 2LKOA 1AWEA 5DIFB 1Q67A 4K2PA 2DKQA 4HAXB 4Y94A 2RGNB 3PZDA 2CY5A 3TVVA 1FGYA 2D4QA 5GOWB 1DDWA 3DXCA 3DXEA 1MK9B 1J0WA 1WGQA 1X11A 4HATB 2P0HA 3U7DA 2Q13A 4C0AA 2COCA 1U5GA 2MWNB 2CY4A 3CXBB 1SHCA 2ELAA 2G35A 4NSWA 2I1JA 5DI9B 2HTHB 3A8PA 1XCGA 1XKEA 2NMBA 3ML4A 1NTVA 1V61A 2YS3A 5DHAB 3F5RA 5C16A 3ODWA 1OY2A 1BTNA 3T06A 5FI0A 4HB3B 2EC1A 2J59M 4GMVA 3ULCA 1KI1B 1U29A 3DXDA 2EMTA 2Z0OA 1U5DA 4WVFB 5C5BA 2JP2A 1EGXA 1MPHA 5CLQB 1WI1A 3OANA 3BJIA 1NTYA 1FHXA 4CYEA 5HE3A 3SNHA 1LW3A 1ISNA 2YT0A 1X1GA 3M1IB 4HDQA 3HQCA 4PQ0A 3GYOA 1W1GA 2QKLA 2DHJA 2DKPA 4B6HA 4A6FA 4IOYX 2I5FA 2J0KA 3PVUA 4CHJA 5D3WA 5D3VA 2K2JA 1MIZB 4EKUA 3A98B 3G9WA 4HDOA 1GG3A 3PEGA 4F7HA 2D2QA 1V88A 2YT1A 4Z2MB 2R09A 2IFSA 2D9XA 2V76A 2J0MA 1UPQA 5HE2A 1MKEA 1QC6A 5JLJB 2KGXB 2DN6A 1UEFA 4ZRJA 2YSZA 1EAZA 3WYFB 2E2XA 4KVGB 5C5BB 1SGHA 1ZVRA 5D3YA 2Y8FA 1ZC3B 1WJMA 3PVWA 2UZRA 1I2HA 2CRFA 4BBKA 4D0NB 1WJ1A 3QWMA 4DX8A 5DHFB 2OQBA 5J3QA 2GCJA 1PMSA 4YONA 2FJLA 1DDMA 4EJNA 3KZ1A 3PSCA 3TCAA 3P6AA 4K2OA 4HB4B 1Y19B 3P7ZA 2KCJA 5LOPB 5C79A 1NU2A 3HK0A 3X23A 4CHMA 4A6HA 2RLOA 2UZSA 4ZRKA 1FHWA 3QBVB 4MY6A 2YS1A 3VOQA 1RRPB 4HAVB 4NY0A 2MKRA 1U27A 2Y7BA 1FB8A 1FOEA 3MPXA 2COAA 2HE7A
chains in the Genus database with same CATH superfamily
1KZ7A 5D27A 2ADZA 2KUPA 3ZVRA 2RRFA 2K2UA 3A8QA 4PNKA 4F7GA 1X05A 1OMWA 1X1FA 2DTCA 3F0WA 4KHBA 2EJ8A 4HAUB 2W2WA 4GN1A 2RUKB 1U5EA 2W2XC 2XQNM 4TKNA 3ULBA 3D8EA 2GJYA 1UPRA 1MI1A 2Z14A 2YRYA 2P8VA 2K49A 2PZ1A 1M7EA 3U8ZA 1X86A 3NSUA 3OHMB 1Y5OA 1ZYIA 1TXDA 2DX1A 2CODA 4K17A 2COFA 2DA0A 1B55A 1OQNA 2NBVA 1MK7B 2RVBB 1XX0A 2N0YA 2EMSA 3V5WA 2L2IA 2DYQA 1V5PA 2LYDA 3ODXA 2LULA 4YL8A 2VKIA 4A6FB 4DBBA 5JHHA 3WA0A 2OTXA 1TQZA 2P0FA 3ODOA 3D8DA 2I1KA 3GYPA 3AU4A 3HIEA 1XR0B 5JP4A 2LOZA 3MDBC 2LG1A 1WGUA 1P5TA 5FI1A 1N3HA 2IYBA 3KSYA 3VIAA 1RJ2A 1EVHA 1V5MA 1AQCA 1IRSA 4DXAB 2AEHA 5KQ4A 4L6EA 5J3YA 3ZDTA 2D10A 5KCVA 4HAYB 2GS0A 3PP2A 2DHIA 1FAOA 2DHKA 1I7AA 2VSZA 2LOXA 2D9ZA 3AJ4A 2ROZB 4A6KA 2I5CA 4MK0A 1BWNA 3FEHA 1K5DB 4Z2NA 3PVLA 4IAPA 3B77A 2KIGA 4KHAA 1M7RA 4TYZA 5DH9B 1UNRA 2DLWA 2P0DA 3TW1A 4HSIA 3FM8C 2X18A 2DYNA 3BINA 2UVMA 2R2YA 2H7DA 5EFXA 5J3TA 1FGZA 2AL6A 1PFJA 3KRXA 2Z0PA 2Z4DA 4HAWB 2MFQA 1K5GB 2YF0A 3NWFA 2ZPYA 1V5UA 5L81A 4QJ4B 1NI2A 5KQ1A 3FVCA 3CIKA 5I2SA 4KAXB 2RSGA 1H10A 3NWDA 4WSFA 2N23A 5HE0A 2KUQA 3KRWA 4KHOA 3HW2B 1ZC4B 1QQGA 1XD4A 1H4RA 4KHBB 1GC6A 1LB1A 1ZSQA 3TFMA 4HHVA 3FSSA 3LJUX 4ZRIA 5IRSA 1XODA 2RNRB 1MAIA 2D11A 2Z0QA 4GPTB 1DROA 2BCJA 1J19A 1MIXA 5CLLB 2ELBA 2R0DA 4L1RA 1U5FA 4DX90 1BAKA 4H8SA 4K81A 4HAZB 4QXAB 2D9VA 2CAYA 2J0JA 3SV1A 5JHGA 1E5WA 3NWAA 2Z13A 4MT7A 3PG7A 1ZM0A 3TO1A 1W1DA 2KIEA 3IVFA 2Z59A 2QKMA 4HB2B 1Z87A 4IFSA 2D9WA 1BTKA 3KY9A 2GCLA 3AU5A 1EF1A 4OSNA 5D3XA 1DDVA 3SO6A 3SUZA 4EMOA 1DYNA 4F7UP 3RCPA 1GC7A 3A58A 4HB0B 1V89A 1P3RA 3D8FA 1WG7A 2YS5A 2W2XD 5LONB 1WVHA 5HE1A 1UNQA 2L1CA 4WJ7A 2YVCA 4A5KA 2VRWB 2MDXA 4GZUA 3N7CA 3O96A 2D9YA 3QIJA 1PLSA 4XWXA 2K00A 4P7IA 3SYXA 4CSQA 1TJ6A 4QJ5B 1DBHA 2M14A 3NW8A 1FHOA 2ROVA 1U2BA 1W1HA 1UNPA 3UZTA 1P6SA 2DFKA 5C6RA 4GMXB 2Y8GA 4GXBA 5I2MA 2NZ8B 2M38A 1KZGA 2DX5A 2H7EA 2LKOA 1AWEA 5DIFB 1Q67A 4K2PA 2DKQA 4HAXB 4Y94A 2RGNB 3PZDA 5M4YB 2CY5A 3TVVA 1FGYA 2D4QA 1T77A 5GOWB 1DDWA 3DXCA 3DXEA 1MK9B 1J0WA 1WGQA 1X11A 4HATB 2P0HA 3U7DA 2Q13A 4OT1A 4C0AA 2COCA 1U5GA 2MWNB 2CY4A 3CXBB 1SHCA 2ELAA 2G35A 4NSWA 2I1JA 5DI9B 2HTHB 3A8PA 1XCGA 1XKEA 2NMBA 3ML4A 1NTVA 1V61A 2YS3A 5DHAB 3F5RA 5C16A 3ODWA 1OY2A 3HSAA 1BTNA 3T06A 5FI0A 4HB3B 2EC1A 2J59M 4GMVA 3ULCA 2GUMA 1KI1B 1U29A 3DXDA 2EMTA 2Z0OA 1U5DA 4WVFB 5C5BA 2K8EA 2JP2A 1EGXA 1MPHA 5CLQB 1WI1A 2KR0A 4QJ3B 3OANA 4GOUA 3BJIA 1NTYA 1FHXA 4CYEA 5HE3A 3SNHA 1LW3A 1ISNA 2YT0A 1X1GA 3M1IB 4HDQA 3HQCA 4PQ0A 3GYOA 1W1GA 2QKLA 2DHJA 2DKPA 4B6HA 4A6FA 4IOYX 2I5FA 2J0KA 3PVUA 4CHJA 2YT2A 5D3WA 5D3VA 2K2JA 1MIZB 4EKUA 3A98B 3PEGA 3G9WA 1GG3A 4HDOA 4F7HA 5LG4B 2D2QA 1V88A 2YT1A 4Z2MB 2R09A 2IFSA 2D9XA 2V76A 2J0MA 1UPQA 3DCXA 5HE2A 1MKEA 1QC6A 5JLJB 2KGXB 2DN6A 1UEFA 4DIXA 4ZRJA 2YSZA 1EAZA 3WYFB 2E2XA 4KVGB 5C5BB 1SGHA 1ZVRA 5D3YA 2Y8FA 1ZC3B 1WJMA 3PVWA 2UZRA 1I2HA 2CRFA 4BBKA 4D0NB 1WJ1A 3QWMA 4DX8A 5DHFB 2OQBA 5J3QA 2GCJA 1PMSA 4YONA 2FJUB 2FJLA 1DDMA 4EJNA 3KZ1A 3PSCA 3TCAA 3P6AA 4K2OA 2ZKMX 4HB4B 1Y19B 3P7ZA 2KCJA 5LOPB 5C79A 1NU2A 3HK0A 3X23A 4CHMA 4A6HA 2RLOA 2UZSA 4ZRKA 1FHWA 3QBVB 4MY6A 2YS1A 3VOQA 1RRPB 4HAVB 4NY0A 2MKRA 1U27A 2Y7BA 4D6WA 1FB8A 1FOEA 4GNKB 3U12A 3MPXA 2COAA 2HE7A
chains in the Genus database with same CATH topology
1KZ7A 5D27A 2ADZA 2KUPA 3ZVRA 2K2UA 3A8QA 4PNKA 4F7GA 1X05A 1OMWA 1X1FA 2DTCA 3F0WA 2EJ8A 4HAUB 2W2WA 4GN1A 2RUKB 1U5EA 2W2XC 2XQNM 4TKNA 3ULBA 3D8EA 2GJYA 1UPRA 2YRYA 2P8VA 2PZ1A 1M7EA 3U8ZA 1X86A 3NSUA 1Y5OA 1TXDA 2DX1A 2CODA 4K17A 2COFA 2DA0A 1B55A 1OQNA 1MK7B 2RVBB 1XX0A 2N0YA 2EMSA 3V5WA 2L2IA 2DYQA 1V5PA 2LYDA 3ODXA 2LULA 4YL8A 2VKIA 4A6FB 4DBBA 5JHHA 3WA0A 2OTXA 1TQZA 2P0FA 3ODOA 3D8DA 2I1KA 3GYPA 3AU4A 1XR0B 5JP4A 2LOZA 3MDBC 2LG1A 1WGUA 1P5TA 5FI1A 1N3HA 2IYBA 3KSYA 3VIAA 1RJ2A 1EVHA 1V5MA 1AQCA 1IRSA 4DXAB 2AEHA 5KQ4A 4L6EA 5J3YA 3ZDTA 2D10A 5KCVA 4HAYB 2GS0A 3PP2A 2DHIA 1FAOA 2DHKA 1I7AA 2VSZA 2LOXA 2D9ZA 3AJ4A 2ROZB 4A6KA 2I5CA 4MK0A 1BWNA 3FEHA 1K5DB 4Z2NA 3PVLA 4IAPA 4KHAA 1M7RA 4TYZA 5DH9B 1UNRA 2DLWA 2P0DA 3TW1A 3FM8C 2X18A 2DYNA 3BINA 2UVMA 2H7DA 5EFXA 5J3TA 1FGZA 2AL6A 1PFJA 3KRXA 2Z0PA 4HAWB 2MFQA 1K5GB 2YF0A 2ZPYA 1V5UA 5L81A 1NI2A 5KQ1A 3CIKA 4KAXB 2RSGA 1H10A 4WSFA 2N23A 5HE0A 3KRWA 4KHOA 3HW2B 1ZC4B 1QQGA 1XD4A 1H4RA 4KHBB 1GC6A 1LB1A 1ZSQA 3TFMA 4HHVA 3FSSA 3LJUX 4ZRIA 1XODA 2RNRB 1MAIA 2D11A 2Z0QA 4GPTB 1DROA 2BCJA 1J19A 1MIXA 5CLLB 2ELBA 2R0DA 1U5FA 4DX90 1BAKA 4H8SA 4K81A 4HAZB 2D9VA 2CAYA 2J0JA 3SV1A 5JHGA 1E5WA 4MT7A 3PG7A 1ZM0A 3TO1A 1W1DA 3IVFA 2QKMA 4HB2B 1Z87A 4IFSA 2D9WA 1BTKA 3KY9A 2GCLA 3AU5A 1EF1A 5D3XA 1DDVA 3SO6A 3SUZA 4EMOA 1DYNA 4F7UP 3RCPA 1GC7A 4HB0B 1V89A 1P3RA 3D8FA 1WG7A 2YS5A 2W2XD 5LONB 1WVHA 5HE1A 1UNQA 2L1CA 4WJ7A 2YVCA 4A5KA 2VRWB 2MDXA 4GZUA 3N7CA 3O96A 2D9YA 3QIJA 1PLSA 4XWXA 2K00A 4P7IA 3SYXA 1TJ6A 1DBHA 2M14A 1FHOA 2ROVA 1U2BA 1W1HA 1UNPA 3UZTA 1P6SA 2DFKA 5C6RA 4GMXB 2Y8GA 4GXBA 2NZ8B 2M38A 1KZGA 2DX5A 2H7EA 2LKOA 1AWEA 5DIFB 1Q67A 4K2PA 2DKQA 4HAXB 4Y94A 2RGNB 3PZDA 2CY5A 3TVVA 1FGYA 2D4QA 5GOWB 1DDWA 3DXCA 3DXEA 1MK9B 1J0WA 1WGQA 1X11A 4HATB 2P0HA 3U7DA 2Q13A 4C0AA 2COCA 1U5GA 2MWNB 2CY4A 3CXBB 1SHCA 2ELAA 2G35A 4NSWA 2I1JA 5DI9B 2HTHB 3A8PA 1XCGA 1XKEA 2NMBA 3ML4A 1NTVA 1V61A 2YS3A 5DHAB 3F5RA 5C16A 3ODWA 1OY2A 1BTNA 3T06A 5FI0A 4HB3B 2EC1A 2J59M 4GMVA 3ULCA 1KI1B 1U29A 3DXDA 2EMTA 2Z0OA 1U5DA 4WVFB 5C5BA 2JP2A 1EGXA 1MPHA 5CLQB 1WI1A 3OANA 3BJIA 1NTYA 1FHXA 4CYEA 5HE3A 3SNHA 1LW3A 1ISNA 2YT0A 1X1GA 3M1IB 4HDQA 3HQCA 4PQ0A 3GYOA 1W1GA 2QKLA 2DHJA 2DKPA 4B6HA 4A6FA 4IOYX 2I5FA 2J0KA 3PVUA 4CHJA 5D3WA 5D3VA 2K2JA 1MIZB 4EKUA 3A98B 3G9WA 4HDOA 1GG3A 3PEGA 4F7HA 2D2QA 1V88A 2YT1A 4Z2MB 2R09A 2IFSA 2D9XA 2V76A 2J0MA 1UPQA 5HE2A 1MKEA 1QC6A 5JLJB 2KGXB 2DN6A 1UEFA 4ZRJA 2YSZA 1EAZA 3WYFB 2E2XA 4KVGB 5C5BB 1SGHA 1ZVRA 5D3YA 2Y8FA 1ZC3B 1WJMA 3PVWA 2UZRA 1I2HA 2CRFA 4BBKA 4D0NB 1WJ1A 3QWMA 4DX8A 5DHFB 2OQBA 5J3QA 2GCJA 1PMSA 4YONA 2FJLA 1DDMA 4EJNA 3KZ1A 3PSCA 3TCAA 3P6AA 4K2OA 4HB4B 1Y19B 3P7ZA 2KCJA 5LOPB 5C79A 1NU2A 3HK0A 3X23A 4CHMA 4A6HA 2RLOA 2UZSA 4ZRKA 1FHWA 3QBVB 4MY6A 2YS1A 3VOQA 1RRPB 4HAVB 4NY0A 2MKRA 1U27A 2Y7BA 1FB8A 1FOEA 3MPXA 2COAA 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZ7 A;  5D27 A;  2ADZ A;  2KUP A;  3ZVR A;  2K2U A;  3A8Q A;  4PNK A;  4F7G A;  1X05 A;  1OMW A;  1X1F A;  2DTC A;  3F0W A;  2EJ8 A;  4HAU B;  2W2W A;  4GN1 A;  2RUK B;  1U5E A;  2W2X C;  2XQN M;  4TKN A;  3ULB A;  3D8E A;  2GJY A;  1UPR A;  2YRY A;  2P8V A;  2PZ1 A;  1M7E A;  3U8Z A;  1X86 A;  3NSU A;  1Y5O A;  1TXD A;  2DX1 A;  2COD A;  4K17 A;  2COF A;  2DA0 A;  1B55 A;  1OQN A;  1MK7 B;  2RVB B;  1XX0 A;  2N0Y A;  2EMS A;  3V5W A;  2L2I A;  2DYQ A;  1V5P A;  2LYD A;  3ODX A;  2LUL A;  4YL8 A;  2VKI A;  4A6F B;  4DBB A;  5JHH A;  3WA0 A;  2OTX A;  1TQZ A;  2P0F A;  3ODO A;  3D8D A;  2I1K A;  3GYP A;  3AU4 A;  1XR0 B;  5JP4 A;  2LOZ A;  3MDB C;  2LG1 A;  1WGU A;  1P5T A;  5FI1 A;  1N3H A;  2IYB A;  3KSY A;  3VIA A;  1RJ2 A;  1EVH A;  1V5M A;  1AQC A;  1IRS A;  4DXA B;  2AEH A;  5KQ4 A;  4L6E A;  5J3Y A;  3ZDT A;  2D10 A;  5KCV A;  4HAY B;  2GS0 A;  3PP2 A;  2DHI A;  1FAO A;  2DHK A;  1I7A A;  2VSZ A;  2LOX A;  2D9Z A;  3AJ4 A;  2ROZ B;  4A6K A;  2I5C A;  4MK0 A;  1BWN A;  3FEH A;  1K5D B;  4Z2N A;  3PVL A;  4IAP A;  4KHA A;  1M7R A;  4TYZ A;  5DH9 B;  1UNR A;  2DLW A;  2P0D A;  3TW1 A;  3FM8 C;  2X18 A;  2DYN A;  3BIN A;  2UVM A;  2H7D A;  5EFX A;  5J3T A;  1FGZ A;  2AL6 A;  1PFJ A;  3KRX A;  2Z0P A;  4HAW B;  2MFQ A;  1K5G B;  2YF0 A;  2ZPY A;  1V5U A;  5L81 A;  1NI2 A;  5KQ1 A;  3CIK A;  4KAX B;  2RSG A;  1H10 A;  4WSF A;  2N23 A;  5HE0 A;  3KRW A;  4KHO A;  3HW2 B;  1ZC4 B;  1QQG A;  1XD4 A;  1H4R A;  4KHB B;  1GC6 A;  1LB1 A;  1ZSQ A;  3TFM A;  4HHV A;  3FSS A;  3LJU X;  4ZRI A;  1XOD A;  2RNR B;  1MAI A;  2D11 A;  2Z0Q A;  4GPT B;  1DRO A;  2BCJ A;  1J19 A;  1MIX A;  5CLL B;  2ELB A;  2R0D A;  1U5F A;  4DX9 0;  1BAK A;  4H8S A;  4K81 A;  4HAZ B;  2D9V A;  2CAY A;  2J0J A;  3SV1 A;  5JHG A;  1E5W A;  4MT7 A;  3PG7 A;  1ZM0 A;  3TO1 A;  1W1D A;  3IVF A;  2QKM A;  4HB2 B;  1Z87 A;  4IFS A;  2D9W A;  1BTK A;  3KY9 A;  2GCL A;  3AU5 A;  1EF1 A;  5D3X A;  1DDV A;  3SO6 A;  3SUZ A;  4EMO A;  1DYN A;  4F7U P;  3RCP A;  1GC7 A;  4HB0 B;  1V89 A;  1P3R A;  3D8F A;  1WG7 A;  2YS5 A;  2W2X D;  5LON B;  1WVH A;  5HE1 A;  1UNQ A;  2L1C A;  4WJ7 A;  2YVC A;  4A5K A;  2VRW B;  2MDX A;  4GZU A;  3N7C A;  3O96 A;  2D9Y A;  3QIJ A;  1PLS A;  4XWX A;  2K00 A;  4P7I A;  3SYX A;  1TJ6 A;  1DBH A;  2M14 A;  1FHO A;  2ROV A;  1U2B A;  1W1H A;  1UNP A;  3UZT A;  1P6S A;  2DFK A;  5C6R A;  4GMX B;  2Y8G A;  4GXB A;  2NZ8 B;  2M38 A;  1KZG A;  2DX5 A;  2H7E A;  2LKO A;  1AWE A;  5DIF B;  1Q67 A;  4K2P A;  2DKQ A;  4HAX B;  4Y94 A;  2RGN B;  3PZD A;  2CY5 A;  3TVV A;  1FGY A;  2D4Q A;  5GOW B;  1DDW A;  3DXC A;  3DXE A;  1MK9 B;  1J0W A;  1WGQ A;  1X11 A;  4HAT B;  2P0H A;  3U7D A;  2Q13 A;  4C0A A;  2COC A;  1U5G A;  2MWN B;  2CY4 A;  3CXB B;  1SHC A;  2ELA A;  2G35 A;  4NSW A;  2I1J A;  5DI9 B;  2HTH B;  3A8P A;  1XCG A;  1XKE A;  2NMB A;  3ML4 A;  1NTV A;  1V61 A;  2YS3 A;  5DHA B;  3F5R A;  5C16 A;  3ODW A;  1OY2 A;  1BTN A;  3T06 A;  5FI0 A;  4HB3 B;  2EC1 A;  2J59 M;  4GMV A;  3ULC A;  1KI1 B;  1U29 A;  3DXD A;  2EMT A;  2Z0O A;  1U5D A;  4WVF B;  5C5B A;  2JP2 A;  1EGX A;  1MPH A;  5CLQ B;  1WI1 A;  3OAN A;  3BJI A;  1NTY A;  1FHX A;  4CYE A;  5HE3 A;  3SNH A;  1LW3 A;  1ISN A;  2YT0 A;  1X1G A;  3M1I B;  4HDQ A;  3HQC A;  4PQ0 A;  3GYO A;  1W1G A;  2QKL A;  2DHJ A;  2DKP A;  4B6H A;  4A6F A;  4IOY X;  2I5F A;  2J0K A;  3PVU A;  4CHJ A;  5D3W A;  5D3V A;  2K2J A;  1MIZ B;  4EKU A;  3A98 B;  3G9W A;  4HDO A;  1GG3 A;  3PEG A;  4F7H A;  2D2Q A;  1V88 A;  2YT1 A;  4Z2M B;  2R09 A;  2IFS A;  2D9X A;  2V76 A;  2J0M A;  1UPQ A;  5HE2 A;  1MKE A;  1QC6 A;  5JLJ B;  2KGX B;  2DN6 A;  1UEF A;  4ZRJ A;  2YSZ A;  1EAZ A;  3WYF B;  2E2X A;  4KVG B;  5C5B B;  1SGH A;  1ZVR A;  5D3Y A;  2Y8F A;  1ZC3 B;  1WJM A;  3PVW A;  2UZR A;  1I2H A;  2CRF A;  4BBK A;  4D0N B;  1WJ1 A;  3QWM A;  4DX8 A;  5DHF B;  2OQB A;  5J3Q A;  2GCJ A;  1PMS A;  4YON A;  2FJL A;  1DDM A;  4EJN A;  3KZ1 A;  3PSC A;  3TCA A;  3P6A A;  4K2O A;  4HB4 B;  1Y19 B;  3P7Z A;  2KCJ A;  5LOP B;  5C79 A;  1NU2 A;  3HK0 A;  3X23 A;  4CHM A;  4A6H A;  2RLO A;  2UZS A;  4ZRK A;  1FHW A;  3QBV B;  4MY6 A;  2YS1 A;  3VOQ A;  1RRP B;  4HAV B;  4NY0 A;  2MKR A;  1U27 A;  2Y7B A;  1FB8 A;  1FOE A;  3MPX A;  2COA A;  2HE7 A; 
#chains in the Genus database with same CATH topology
 1KZ7 A;  5D27 A;  2ADZ A;  2KUP A;  3ZVR A;  2RRF A;  2K2U A;  3A8Q A;  4PNK A;  4F7G A;  1X05 A;  1OMW A;  1X1F A;  2DTC A;  3F0W A;  4KHB A;  2EJ8 A;  4HAU B;  2W2W A;  4GN1 A;  2RUK B;  1U5E A;  2W2X C;  2XQN M;  4TKN A;  3ULB A;  3D8E A;  2GJY A;  1UPR A;  1MI1 A;  2Z14 A;  2YRY A;  2P8V A;  2K49 A;  2PZ1 A;  1M7E A;  3U8Z A;  1X86 A;  3NSU A;  3OHM B;  1Y5O A;  1ZYI A;  1TXD A;  2DX1 A;  2COD A;  4K17 A;  2COF A;  2DA0 A;  1B55 A;  1OQN A;  2NBV A;  1MK7 B;  2RVB B;  1XX0 A;  2N0Y A;  2EMS A;  3V5W A;  2L2I A;  2DYQ A;  1V5P A;  2LYD A;  3ODX A;  2LUL A;  4YL8 A;  2VKI A;  4A6F B;  4DBB A;  5JHH A;  3WA0 A;  2OTX A;  1TQZ A;  2P0F A;  3ODO A;  3D8D A;  2I1K A;  3GYP A;  3AU4 A;  3HIE A;  1XR0 B;  5JP4 A;  2LOZ A;  3MDB C;  2LG1 A;  1WGU A;  1P5T A;  5FI1 A;  1N3H A;  2IYB A;  3KSY A;  3VIA A;  1RJ2 A;  1EVH A;  1V5M A;  1AQC A;  1IRS A;  4DXA B;  2AEH A;  5KQ4 A;  4L6E A;  5J3Y A;  3ZDT A;  2D10 A;  5KCV A;  4HAY B;  2GS0 A;  3PP2 A;  2DHI A;  1FAO A;  2DHK A;  1I7A A;  2VSZ A;  2LOX A;  2D9Z A;  3AJ4 A;  2ROZ B;  4A6K A;  2I5C A;  4MK0 A;  1BWN A;  3FEH A;  1K5D B;  4Z2N A;  3PVL A;  4IAP A;  3B77 A;  2KIG A;  4KHA A;  1M7R A;  4TYZ A;  5DH9 B;  1UNR A;  2DLW A;  2P0D A;  3TW1 A;  4HSI A;  3FM8 C;  2X18 A;  2DYN A;  3BIN A;  2UVM A;  2R2Y A;  2H7D A;  5EFX A;  5J3T A;  1FGZ A;  2AL6 A;  1PFJ A;  3KRX A;  2Z0P A;  2Z4D A;  4HAW B;  2MFQ A;  1K5G B;  2YF0 A;  3NWF A;  2ZPY A;  1V5U A;  5L81 A;  4QJ4 B;  1NI2 A;  5KQ1 A;  3FVC A;  3CIK A;  5I2S A;  4KAX B;  2RSG A;  1H10 A;  3NWD A;  4WSF A;  2N23 A;  5HE0 A;  2KUQ A;  3KRW A;  4KHO A;  3HW2 B;  1ZC4 B;  1QQG A;  1XD4 A;  1H4R A;  4KHB B;  1GC6 A;  1LB1 A;  1ZSQ A;  3TFM A;  4HHV A;  3FSS A;  3LJU X;  4ZRI A;  5IRS A;  1XOD A;  2RNR B;  1MAI A;  2D11 A;  2Z0Q A;  4GPT B;  1DRO A;  2BCJ A;  1J19 A;  1MIX A;  5CLL B;  2ELB A;  2R0D A;  4L1R A;  1U5F A;  4DX9 0;  1BAK A;  4H8S A;  4K81 A;  4HAZ B;  4QXA B;  2D9V A;  2CAY A;  2J0J A;  3SV1 A;  5JHG A;  1E5W A;  3NWA A;  2Z13 A;  4MT7 A;  3PG7 A;  1ZM0 A;  3TO1 A;  1W1D A;  2KIE A;  3IVF A;  2Z59 A;  2QKM A;  4HB2 B;  1Z87 A;  4IFS A;  2D9W A;  1BTK A;  3KY9 A;  2GCL A;  3AU5 A;  1EF1 A;  4OSN A;  5D3X A;  1DDV A;  3SO6 A;  3SUZ A;  4EMO A;  1DYN A;  4F7U P;  3RCP A;  1GC7 A;  3A58 A;  4HB0 B;  1V89 A;  1P3R A;  3D8F A;  1WG7 A;  2YS5 A;  2W2X D;  5LON B;  1WVH A;  5HE1 A;  1UNQ A;  2L1C A;  4WJ7 A;  2YVC A;  4A5K A;  2VRW B;  2MDX A;  4GZU A;  3N7C A;  3O96 A;  2D9Y A;  3QIJ A;  1PLS A;  4XWX A;  2K00 A;  4P7I A;  3SYX A;  4CSQ A;  1TJ6 A;  4QJ5 B;  1DBH A;  2M14 A;  3NW8 A;  1FHO A;  2ROV A;  1U2B A;  1W1H A;  1UNP A;  3UZT A;  1P6S A;  2DFK A;  5C6R A;  4GMX B;  2Y8G A;  4GXB A;  5I2M A;  2NZ8 B;  2M38 A;  1KZG A;  2DX5 A;  2H7E A;  2LKO A;  1AWE A;  5DIF B;  1Q67 A;  4K2P A;  2DKQ A;  4HAX B;  4Y94 A;  2RGN B;  3PZD A;  5M4Y B;  2CY5 A;  3TVV A;  1FGY A;  2D4Q A;  1T77 A;  5GOW B;  1DDW A;  3DXC A;  3DXE A;  1MK9 B;  1J0W A;  1WGQ A;  1X11 A;  4HAT B;  2P0H A;  3U7D A;  2Q13 A;  4OT1 A;  4C0A A;  2COC A;  1U5G A;  2MWN B;  2CY4 A;  3CXB B;  1SHC A;  2ELA A;  2G35 A;  4NSW A;  2I1J A;  5DI9 B;  2HTH B;  3A8P A;  1XCG A;  1XKE A;  2NMB A;  3ML4 A;  1NTV A;  1V61 A;  2YS3 A;  5DHA B;  3F5R A;  5C16 A;  3ODW A;  1OY2 A;  3HSA A;  1BTN A;  3T06 A;  5FI0 A;  4HB3 B;  2EC1 A;  2J59 M;  4GMV A;  3ULC A;  2GUM A;  1KI1 B;  1U29 A;  3DXD A;  2EMT A;  2Z0O A;  1U5D A;  4WVF B;  5C5B A;  2K8E A;  2JP2 A;  1EGX A;  1MPH A;  5CLQ B;  1WI1 A;  2KR0 A;  4QJ3 B;  3OAN A;  4GOU A;  3BJI A;  1NTY A;  1FHX A;  4CYE A;  5HE3 A;  3SNH A;  1LW3 A;  1ISN A;  2YT0 A;  1X1G A;  3M1I B;  4HDQ A;  3HQC A;  4PQ0 A;  3GYO A;  1W1G A;  2QKL A;  2DHJ A;  2DKP A;  4B6H A;  4A6F A;  4IOY X;  2I5F A;  2J0K A;  3PVU A;  4CHJ A;  2YT2 A;  5D3W A;  5D3V A;  2K2J A;  1MIZ B;  4EKU A;  3A98 B;  3PEG A;  3G9W A;  1GG3 A;  4HDO A;  4F7H A;  5LG4 B;  2D2Q A;  1V88 A;  2YT1 A;  4Z2M B;  2R09 A;  2IFS A;  2D9X A;  2V76 A;  2J0M A;  1UPQ A;  3DCX A;  5HE2 A;  1MKE A;  1QC6 A;  5JLJ B;  2KGX B;  2DN6 A;  1UEF A;  4DIX A;  4ZRJ A;  2YSZ A;  1EAZ A;  3WYF B;  2E2X A;  4KVG B;  5C5B B;  1SGH A;  1ZVR A;  5D3Y A;  2Y8F A;  1ZC3 B;  1WJM A;  3PVW A;  2UZR A;  1I2H A;  2CRF A;  4BBK A;  4D0N B;  1WJ1 A;  3QWM A;  4DX8 A;  5DHF B;  2OQB A;  5J3Q A;  2GCJ A;  1PMS A;  4YON A;  2FJU B;  2FJL A;  1DDM A;  4EJN A;  3KZ1 A;  3PSC A;  3TCA A;  3P6A A;  4K2O A;  2ZKM X;  4HB4 B;  1Y19 B;  3P7Z A;  2KCJ A;  5LOP B;  5C79 A;  1NU2 A;  3HK0 A;  3X23 A;  4CHM A;  4A6H A;  2RLO A;  2UZS A;  4ZRK A;  1FHW A;  3QBV B;  4MY6 A;  2YS1 A;  3VOQ A;  1RRP B;  4HAV B;  4NY0 A;  2MKR A;  1U27 A;  2Y7B A;  4D6W A;  1FB8 A;  1FOE A;  4GNK B;  3U12 A;  3MPX A;  2COA A;  2HE7 A; 
#chains in the Genus database with same CATH homology
 1KZ7 A;  5D27 A;  2ADZ A;  2KUP A;  3ZVR A;  2K2U A;  3A8Q A;  4PNK A;  4F7G A;  1X05 A;  1OMW A;  1X1F A;  2DTC A;  3F0W A;  2EJ8 A;  4HAU B;  2W2W A;  4GN1 A;  2RUK B;  1U5E A;  2W2X C;  2XQN M;  4TKN A;  3ULB A;  3D8E A;  2GJY A;  1UPR A;  2YRY A;  2P8V A;  2PZ1 A;  1M7E A;  3U8Z A;  1X86 A;  3NSU A;  1Y5O A;  1TXD A;  2DX1 A;  2COD A;  4K17 A;  2COF A;  2DA0 A;  1B55 A;  1OQN A;  1MK7 B;  2RVB B;  1XX0 A;  2N0Y A;  2EMS A;  3V5W A;  2L2I A;  2DYQ A;  1V5P A;  2LYD A;  3ODX A;  2LUL A;  4YL8 A;  2VKI A;  4A6F B;  4DBB A;  5JHH A;  3WA0 A;  2OTX A;  1TQZ A;  2P0F A;  3ODO A;  3D8D A;  2I1K A;  3GYP A;  3AU4 A;  1XR0 B;  5JP4 A;  2LOZ A;  3MDB C;  2LG1 A;  1WGU A;  1P5T A;  5FI1 A;  1N3H A;  2IYB A;  3KSY A;  3VIA A;  1RJ2 A;  1EVH A;  1V5M A;  1AQC A;  1IRS A;  4DXA B;  2AEH A;  5KQ4 A;  4L6E A;  5J3Y A;  3ZDT A;  2D10 A;  5KCV A;  4HAY B;  2GS0 A;  3PP2 A;  2DHI A;  1FAO A;  2DHK A;  1I7A A;  2VSZ A;  2LOX A;  2D9Z A;  3AJ4 A;  2ROZ B;  4A6K A;  2I5C A;  4MK0 A;  1BWN A;  3FEH A;  1K5D B;  4Z2N A;  3PVL A;  4IAP A;  4KHA A;  1M7R A;  4TYZ A;  5DH9 B;  1UNR A;  2DLW A;  2P0D A;  3TW1 A;  3FM8 C;  2X18 A;  2DYN A;  3BIN A;  2UVM A;  2H7D A;  5EFX A;  5J3T A;  1FGZ A;  2AL6 A;  1PFJ A;  3KRX A;  2Z0P A;  4HAW B;  2MFQ A;  1K5G B;  2YF0 A;  2ZPY A;  1V5U A;  5L81 A;  1NI2 A;  5KQ1 A;  3CIK A;  4KAX B;  2RSG A;  1H10 A;  4WSF A;  2N23 A;  5HE0 A;  3KRW A;  4KHO A;  3HW2 B;  1ZC4 B;  1QQG A;  1XD4 A;  1H4R A;  4KHB B;  1GC6 A;  1LB1 A;  1ZSQ A;  3TFM A;  4HHV A;  3FSS A;  3LJU X;  4ZRI A;  1XOD A;  2RNR B;  1MAI A;  2D11 A;  2Z0Q A;  4GPT B;  1DRO A;  2BCJ A;  1J19 A;  1MIX A;  5CLL B;  2ELB A;  2R0D A;  1U5F A;  4DX9 0;  1BAK A;  4H8S A;  4K81 A;  4HAZ B;  2D9V A;  2CAY A;  2J0J A;  3SV1 A;  5JHG A;  1E5W A;  4MT7 A;  3PG7 A;  1ZM0 A;  3TO1 A;  1W1D A;  3IVF A;  2QKM A;  4HB2 B;  1Z87 A;  4IFS A;  2D9W A;  1BTK A;  3KY9 A;  2GCL A;  3AU5 A;  1EF1 A;  5D3X A;  1DDV A;  3SO6 A;  3SUZ A;  4EMO A;  1DYN A;  4F7U P;  3RCP A;  1GC7 A;  4HB0 B;  1V89 A;  1P3R A;  3D8F A;  1WG7 A;  2YS5 A;  2W2X D;  5LON B;  1WVH A;  5HE1 A;  1UNQ A;  2L1C A;  4WJ7 A;  2YVC A;  4A5K A;  2VRW B;  2MDX A;  4GZU A;  3N7C A;  3O96 A;  2D9Y A;  3QIJ A;  1PLS A;  4XWX A;  2K00 A;  4P7I A;  3SYX A;  1TJ6 A;  1DBH A;  2M14 A;  1FHO A;  2ROV A;  1U2B A;  1W1H A;  1UNP A;  3UZT A;  1P6S A;  2DFK A;  5C6R A;  4GMX B;  2Y8G A;  4GXB A;  2NZ8 B;  2M38 A;  1KZG A;  2DX5 A;  2H7E A;  2LKO A;  1AWE A;  5DIF B;  1Q67 A;  4K2P A;  2DKQ A;  4HAX B;  4Y94 A;  2RGN B;  3PZD A;  2CY5 A;  3TVV A;  1FGY A;  2D4Q A;  5GOW B;  1DDW A;  3DXC A;  3DXE A;  1MK9 B;  1J0W A;  1WGQ A;  1X11 A;  4HAT B;  2P0H A;  3U7D A;  2Q13 A;  4C0A A;  2COC A;  1U5G A;  2MWN B;  2CY4 A;  3CXB B;  1SHC A;  2ELA A;  2G35 A;  4NSW A;  2I1J A;  5DI9 B;  2HTH B;  3A8P A;  1XCG A;  1XKE A;  2NMB A;  3ML4 A;  1NTV A;  1V61 A;  2YS3 A;  5DHA B;  3F5R A;  5C16 A;  3ODW A;  1OY2 A;  1BTN A;  3T06 A;  5FI0 A;  4HB3 B;  2EC1 A;  2J59 M;  4GMV A;  3ULC A;  1KI1 B;  1U29 A;  3DXD A;  2EMT A;  2Z0O A;  1U5D A;  4WVF B;  5C5B A;  2JP2 A;  1EGX A;  1MPH A;  5CLQ B;  1WI1 A;  3OAN A;  3BJI A;  1NTY A;  1FHX A;  4CYE A;  5HE3 A;  3SNH A;  1LW3 A;  1ISN A;  2YT0 A;  1X1G A;  3M1I B;  4HDQ A;  3HQC A;  4PQ0 A;  3GYO A;  1W1G A;  2QKL A;  2DHJ A;  2DKP A;  4B6H A;  4A6F A;  4IOY X;  2I5F A;  2J0K A;  3PVU A;  4CHJ A;  5D3W A;  5D3V A;  2K2J A;  1MIZ B;  4EKU A;  3A98 B;  3G9W A;  4HDO A;  1GG3 A;  3PEG A;  4F7H A;  2D2Q A;  1V88 A;  2YT1 A;  4Z2M B;  2R09 A;  2IFS A;  2D9X A;  2V76 A;  2J0M A;  1UPQ A;  5HE2 A;  1MKE A;  1QC6 A;  5JLJ B;  2KGX B;  2DN6 A;  1UEF A;  4ZRJ A;  2YSZ A;  1EAZ A;  3WYF B;  2E2X A;  4KVG B;  5C5B B;  1SGH A;  1ZVR A;  5D3Y A;  2Y8F A;  1ZC3 B;  1WJM A;  3PVW A;  2UZR A;  1I2H A;  2CRF A;  4BBK A;  4D0N B;  1WJ1 A;  3QWM A;  4DX8 A;  5DHF B;  2OQB A;  5J3Q A;  2GCJ A;  1PMS A;  4YON A;  2FJL A;  1DDM A;  4EJN A;  3KZ1 A;  3PSC A;  3TCA A;  3P6A A;  4K2O A;  4HB4 B;  1Y19 B;  3P7Z A;  2KCJ A;  5LOP B;  5C79 A;  1NU2 A;  3HK0 A;  3X23 A;  4CHM A;  4A6H A;  2RLO A;  2UZS A;  4ZRK A;  1FHW A;  3QBV B;  4MY6 A;  2YS1 A;  3VOQ A;  1RRP B;  4HAV B;  4NY0 A;  2MKR A;  1U27 A;  2Y7B A;  1FB8 A;  1FOE A;  3MPX A;  2COA A;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...