4HAUB

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1-ran-ranbp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 37
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hauB00
5HE1A 1NTYA 2DFKA 2DYQA 1KZ7A 1U27A 1GC6A 2J0MA 1FGZA 4A6FA 5D3XA 2PZ1A 4ZRIA 1TXDA 1UNRA 2COCA 1TJ6A 4GZUA 1MKEA 1SHCA 2G35A 3FM8C 4GXBA 1X86A 4PQ0A 2OQBA 2P0HA 3QBVB 4BBKA 1PLSA 1V5UA 1P5TA 1U29A 4KAXB 1U5GA 2JP2A 1ZC3B 5KQ1A 2V76A 2UZRA 1M7RA 2LG1A 1FHXA 2DHKA 3UZTA 1MAIA 2QKLA 3HW2B 2D9WA 1XODA 1WJ1A 4A6KA 1PMSA 1IRSA 2RLOA 5C5BA 1FHOA 3KZ1A 1XX0A 3GYPA 2K2JA 2L1CA 3U8ZA 2UZSA 3T06A 2Z0OA 1BTNA 2RSGA 3ODWA 3SNHA 1RJ2A 4XWXA 3PVWA 3F0WA 2DN6A 4F7HA 3G9WA 4GN1A 1ZC4B 2R0DA 4WJ7A 1AQCA 2YS3A 1I2HA 1WJMA 1WGQA 2KGXB 2D9YA 1U5EA 4F7UP 2ROZB 1K5DB 2FJLA 3F5RA 2YVCA 2D11A 2D9VA 3PVLA 3P7ZA 1DDVA 1UNQA 4HAVB 3FSSA 1QQGA 2DA0A 5L81A 4IOYX 1OMWA 4HAYB 2YS5A 1V5PA 2OTXA 3WYFB 1J19A 2YSZA 1EF1A 1FGYA 4F7GA 2KCJA 3SO6A 2W2XC 3X23A 3KY9A 4A6FB 3PSCA 2CRFA 4K2OA 3A98B 3N7CA 2YT1A 4K81A 2CODA 3D8FA 1MIXA 2J0JA 1BAKA 3PP2A 5DH9B 1WG7A 5GOWB 4K17A 2LOXA 5DHAB 4IFSA 3MDBC 1BTKA 2IFSA 3TCAA 2Y8GA 2HE7A 5D3WA 1I7AA 1KZGA 1V61A 2RVBB 2I5CA 2DKQA 2K00A 5HE3A 3DXEA 4HB2B 5KQ4A 1P3RA 3D8DA 2LOZA 3ULBA 5JHGA 3KSYA 1U2BA 2ADZA 4MT7A 1U5FA 2D9XA 2LYDA 1SGHA 5C5BB 1J0WA 4HDOA 2QKMA 4ZRJA 2R09A 2ELBA 3SUZA 4GPTB 1B55A 3ZDTA 4Z2MB 2RUKB 2YS1A 4CHMA 2J59M 4NSWA 3DXDA 2DHIA 1ZVRA 2NZ8B 5KCVA 1DYNA 3RCPA 1RRPB 2H7EA 3FEHA 4GMVA 2XQNM 1NTVA 1Q67A 5D3VA 1ISNA 2D4QA 3O96A 2GJYA 2CY4A 2N0YA 3SYXA 3WA0A 3D8EA 1GG3A 5DHFB 3V5WA 4HB3B 2P8VA 1PFJA 3HK0A 1FAOA 2ZPYA 3PZDA 3P6AA 1UEFA 1KI1B 4MK0A 3BJIA 2D2QA 4H8SA 1XKEA 2I1KA 2M14A 4HAZB 1K5GB 2EMSA 2EJ8A 4HB0B 4DX8A 2MDXA 3PVUA 3QWMA 1Y19B 2HTHB 1QC6A 2Z0PA 4B6HA 3A8PA 4WVFB 4HHVA 1ZSQA 2MKRA 5JP4A 5J3TA 3GYOA 2UVMA 1X1FA 5CLLB 4YONA 4DXAB 5FI0A 1MK9B 1X11A 3CXBB 3ULCA 2YRYA 1WI1A 2Y7BA 1P6SA 1V89A 4DX90 2NMBA 4ZRKA 2CY5A 1XCGA 4HAWB 3AU5A 2RNRB 5HE0A 3BINA 4C0AA 2X18A 2J0KA 2YT0A 1OY2A 2MFQA 2DTCA 2IYBA 4K2PA 2I5FA 3TFMA 4CHJA 2COAA 2VRWB 1GC7A 2D9ZA 4CYEA 5J3QA 2H7DA 3HQCA 5C79A 4HAUB 2BCJA 2YF0A 5CLQB 2L2IA 2EMTA 1WGUA 3NSUA 5HE2A 1XD4A 2P0DA 2E2XA 1NU2A 1FHWA 4HDQA 2DHJA 5DIFB 4A5KA 2DYNA 2DX1A 2DKPA 3KRWA 4TYZA 1LB1A 5FI1A 3TW1A 4D0NB 1V5MA 4DBBA 1MIZB 1V88A 3U7DA 2Q13A 2LULA 3PEGA 2Z0QA 2COFA 1W1GA 1UPRA 2N23A 2VSZA 4KHBB 5JHHA 1X1GA 3OANA 1DDMA 1XR0B 2ELAA 3TO1A 2KUPA 3CIKA 4Y94A 1MPHA 4WSFA 1W1HA 1MK7B 4YL8A 5D3YA 2RGNB 1DDWA 4KVGB 3ODXA 2M38A 3DXCA 1LW3A 2EC1A 3VOQA 1WVHA 2ROVA 2GS0A 4KHAA 2K2UA 2W2XD 4NY0A 4EMOA 2AEHA 1UNPA 1Y5OA 1X05A 5EFXA 1EVHA 3A8QA 3KRXA 1OQNA 1DBHA 3PG7A 4P7IA 4HB4B 3MPXA 2I1JA 1NI2A 1M7EA 3AJ4A 4GMXB 4KHOA 2D10A 1E5WA 2P0FA 4IAPA 2GCJA 2GCLA 3SV1A 1BWNA 1EGXA 4Z2NA 2CAYA 3AU4A 4HAXB 1EAZA 4TKNA 2W2WA 1TQZA 2MWNB 3ML4A 5C6RA 3TVVA 1ZM0A 1N3HA 2AL6A 1H4RA 2DLWA 5JLJB 5C16A 4L6EA 4A6HA 2DX5A 5DI9B 5J3YA 1Z87A 1FB8A 4PNKA 2VKIA 1UPQA 2LKOA 1FOEA 1U5DA 3QIJA 3IVFA 3ODOA 1AWEA 1W1DA 1H10A 5D27A 2Y8FA 4MY6A 4HATB 3LJUX 4EKUA 3M1IB 4EJNA 5LOPB 3VIAA 1DROA 3ZVRA 5LONB
chains in the Genus database with same CATH superfamily
5HE1A 5IRSA 1NTYA 2DFKA 2DYQA 1KZ7A 1U27A 1GC6A 2J0MA 4QJ5B 1FGZA 4A6FA 5D3XA 2PZ1A 4ZRIA 1TXDA 1UNRA 2COCA 1TJ6A 4GZUA 1MKEA 1SHCA 2G35A 3FM8C 4GXBA 2Z13A 1X86A 4PQ0A 2OQBA 4D6WA 2P0HA 3QBVB 3NWFA 4BBKA 4GOUA 1PLSA 1V5UA 1P5TA 1U29A 4KAXB 1U5GA 2JP2A 1ZC3B 5KQ1A 2V76A 2UZRA 1M7RA 2LG1A 1FHXA 2DHKA 3UZTA 1MAIA 2QKLA 3HW2B 2D9WA 1XODA 1WJ1A 4A6KA 1PMSA 1IRSA 2RLOA 5C5BA 1FHOA 3KZ1A 1XX0A 3GYPA 2K2JA 2L1CA 3U8ZA 2UZSA 3T06A 2Z0OA 1BTNA 4KHBA 2RSGA 3ODWA 3SNHA 1RJ2A 4XWXA 3PVWA 3F0WA 2DN6A 4F7HA 3G9WA 4GN1A 1ZC4B 2R0DA 4WJ7A 1AQCA 2YS3A 1I2HA 1WJMA 1WGQA 2KGXB 3DCXA 2D9YA 1U5EA 4F7UP 2ROZB 1K5DB 2FJLA 3F5RA 2R2YA 4OSNA 2YVCA 2YT2A 2D11A 2D9VA 3PVLA 3P7ZA 1DDVA 1UNQA 4HAVB 3FSSA 1QQGA 2DA0A 5L81A 4IOYX 1OMWA 4HAYB 2YS5A 1V5PA 2OTXA 3WYFB 1J19A 2YSZA 1EF1A 1FGYA 4F7GA 2KCJA 3SO6A 2W2XC 3X23A 3KY9A 4A6FB 2K8EA 3PSCA 2CRFA 4K2OA 3A98B 3N7CA 2YT1A 4K81A 4DIXA 2CODA 3D8FA 1MIXA 2J0JA 1BAKA 3PP2A 5DH9B 1WG7A 3FVCA 5GOWB 4K17A 2LOXA 5DHAB 4IFSA 1ZYIA 3MDBC 1BTKA 2IFSA 3TCAA 2Y8GA 2HE7A 5D3WA 1I7AA 1KZGA 1V61A 2RVBB 2I5CA 2DKQA 2K00A 5HE3A 3DXEA 4HB2B 5KQ4A 1P3RA 3D8DA 2LOZA 3ULBA 5JHGA 3KSYA 1U2BA 2ADZA 4MT7A 1U5FA 2D9XA 2LYDA 1SGHA 2RRFA 5I2MA 5C5BB 1J0WA 5M4YB 3B77A 4HDOA 2QKMA 4ZRJA 2R09A 2ELBA 3SUZA 4GPTB 4QJ3B 1B55A 2NBVA 3ZDTA 4L1RA 4Z2MB 2RUKB 2YS1A 4CHMA 2J59M 3A58A 3DXDA 4NSWA 2DHIA 1ZVRA 2NZ8B 5KCVA 1DYNA 3RCPA 1RRPB 2H7EA 3FEHA 4GMVA 2XQNM 1NTVA 1Q67A 5D3VA 1ISNA 3NWAA 2D4QA 3O96A 2GJYA 2CY4A 2N0YA 3SYXA 3WA0A 4CSQA 3D8EA 3OHMB 1GG3A 5DHFB 3V5WA 4HB3B 2P8VA 1PFJA 3HK0A 1FAOA 2ZPYA 3PZDA 3P6AA 1UEFA 1KI1B 2Z59A 4MK0A 3BJIA 2D2QA 3NW8A 4H8SA 1XKEA 4QXAB 2I1KA 2M14A 4HSIA 4HAZB 1K5GB 2EMSA 2EJ8A 4HB0B 4DX8A 2KIGA 2MDXA 3PVUA 3QWMA 1Y19B 3HSAA 2HTHB 1MI1A 1QC6A 2Z4DA 3HIEA 2Z0PA 4B6HA 3A8PA 4WVFB 4HHVA 1ZSQA 2MKRA 5JP4A 5J3TA 3GYOA 2UVMA 1X1FA 5CLLB 2Z14A 4YONA 4DXAB 5FI0A 1MK9B 1X11A 3CXBB 3ULCA 2YRYA 1WI1A 2Y7BA 1P6SA 1V89A 4DX90 2NMBA 4ZRKA 2CY5A 1XCGA 4HAWB 3AU5A 2RNRB 5HE0A 3BINA 4C0AA 2X18A 2KR0A 2J0KA 2YT0A 1OY2A 2MFQA 2DTCA 2IYBA 4K2PA 2I5FA 3TFMA 4CHJA 2COAA 2VRWB 1GC7A 2D9ZA 4CYEA 5J3QA 2H7DA 3HQCA 5C79A 4HAUB 2BCJA 2YF0A 5CLQB 2K49A 2L2IA 2EMTA 1WGUA 3NSUA 5HE2A 1XD4A 2P0DA 2E2XA 1NU2A 1FHWA 4HDQA 2DHJA 2KUQA 5DIFB 4A5KA 2DYNA 2DX1A 2DKPA 3KRWA 4TYZA 1LB1A 5FI1A 3TW1A 4D0NB 1V5MA 3NWDA 4DBBA 1MIZB 1V88A 3U7DA 2Q13A 2LULA 3PEGA 2Z0QA 2COFA 1W1GA 1UPRA 2N23A 2VSZA 4KHBB 5JHHA 1X1GA 3OANA 1DDMA 1XR0B 2ELAA 3TO1A 2KUPA 3CIKA 4Y94A 1MPHA 4WSFA 1W1HA 1MK7B 4YL8A 5D3YA 2RGNB 1DDWA 4KVGB 2FJUB 3ODXA 2M38A 3DXCA 1LW3A 2EC1A 3VOQA 1WVHA 2ROVA 2GS0A 4KHAA 2K2UA 2W2XD 2GUMA 4NY0A 4EMOA 3U12A 2AEHA 1UNPA 1Y5OA 1X05A 5EFXA 1EVHA 3A8QA 3KRXA 1OQNA 1DBHA 3PG7A 4P7IA 4HB4B 3MPXA 2I1JA 1NI2A 1M7EA 3AJ4A 4GMXB 4KHOA 5I2SA 2D10A 4OT1A 1E5WA 2P0FA 4IAPA 2GCJA 2GCLA 3SV1A 1BWNA 1EGXA 4Z2NA 2CAYA 3AU4A 4HAXB 1EAZA 4TKNA 2W2WA 1TQZA 2MWNB 3ML4A 5C6RA 5LG4B 2KIEA 3TVVA 1ZM0A 1N3HA 2AL6A 1H4RA 2DLWA 5JLJB 5C16A 4L6EA 4QJ4B 4A6HA 2DX5A 5DI9B 5J3YA 1Z87A 1FB8A 4PNKA 2VKIA 1UPQA 2LKOA 1FOEA 2ZKMX 1U5DA 3QIJA 3IVFA 3ODOA 1AWEA 1W1DA 1H10A 5D27A 4GNKB 2Y8FA 4MY6A 1T77A 4HATB 3LJUX 4EKUA 3M1IB 4EJNA 5LOPB 3VIAA 1DROA 3ZVRA 5LONB
chains in the Genus database with same CATH topology
5HE1A 1NTYA 2DFKA 2DYQA 1KZ7A 1U27A 1GC6A 2J0MA 1FGZA 4A6FA 5D3XA 2PZ1A 4ZRIA 1TXDA 1UNRA 2COCA 1TJ6A 4GZUA 1MKEA 1SHCA 2G35A 3FM8C 4GXBA 1X86A 4PQ0A 2OQBA 2P0HA 3QBVB 4BBKA 1PLSA 1V5UA 1P5TA 1U29A 4KAXB 1U5GA 2JP2A 1ZC3B 5KQ1A 2V76A 2UZRA 1M7RA 2LG1A 1FHXA 2DHKA 3UZTA 1MAIA 2QKLA 3HW2B 2D9WA 1XODA 1WJ1A 4A6KA 1PMSA 1IRSA 2RLOA 5C5BA 1FHOA 3KZ1A 1XX0A 3GYPA 2K2JA 2L1CA 3U8ZA 2UZSA 3T06A 2Z0OA 1BTNA 2RSGA 3ODWA 3SNHA 1RJ2A 4XWXA 3PVWA 3F0WA 2DN6A 4F7HA 3G9WA 4GN1A 1ZC4B 2R0DA 4WJ7A 1AQCA 2YS3A 1I2HA 1WJMA 1WGQA 2KGXB 2D9YA 1U5EA 4F7UP 2ROZB 1K5DB 2FJLA 3F5RA 2YVCA 2D11A 2D9VA 3PVLA 3P7ZA 1DDVA 1UNQA 4HAVB 3FSSA 1QQGA 2DA0A 5L81A 4IOYX 1OMWA 4HAYB 2YS5A 1V5PA 2OTXA 3WYFB 1J19A 2YSZA 1EF1A 1FGYA 4F7GA 2KCJA 3SO6A 2W2XC 3X23A 3KY9A 4A6FB 3PSCA 2CRFA 4K2OA 3A98B 3N7CA 2YT1A 4K81A 2CODA 3D8FA 1MIXA 2J0JA 1BAKA 3PP2A 5DH9B 1WG7A 5GOWB 4K17A 2LOXA 5DHAB 4IFSA 3MDBC 1BTKA 2IFSA 3TCAA 2Y8GA 2HE7A 5D3WA 1I7AA 1KZGA 1V61A 2RVBB 2I5CA 2DKQA 2K00A 5HE3A 3DXEA 4HB2B 5KQ4A 1P3RA 3D8DA 2LOZA 3ULBA 5JHGA 3KSYA 1U2BA 2ADZA 4MT7A 1U5FA 2D9XA 2LYDA 1SGHA 5C5BB 1J0WA 4HDOA 2QKMA 4ZRJA 2R09A 2ELBA 3SUZA 4GPTB 1B55A 3ZDTA 4Z2MB 2RUKB 2YS1A 4CHMA 2J59M 4NSWA 3DXDA 2DHIA 1ZVRA 2NZ8B 5KCVA 1DYNA 3RCPA 1RRPB 2H7EA 3FEHA 4GMVA 2XQNM 1NTVA 1Q67A 5D3VA 1ISNA 2D4QA 3O96A 2GJYA 2CY4A 2N0YA 3SYXA 3WA0A 3D8EA 1GG3A 5DHFB 3V5WA 4HB3B 2P8VA 1PFJA 3HK0A 1FAOA 2ZPYA 3PZDA 3P6AA 1UEFA 1KI1B 4MK0A 3BJIA 2D2QA 4H8SA 1XKEA 2I1KA 2M14A 4HAZB 1K5GB 2EMSA 2EJ8A 4HB0B 4DX8A 2MDXA 3PVUA 3QWMA 1Y19B 2HTHB 1QC6A 2Z0PA 4B6HA 3A8PA 4WVFB 4HHVA 1ZSQA 2MKRA 5JP4A 5J3TA 3GYOA 2UVMA 1X1FA 5CLLB 4YONA 4DXAB 5FI0A 1MK9B 1X11A 3CXBB 3ULCA 2YRYA 1WI1A 2Y7BA 1P6SA 1V89A 4DX90 2NMBA 4ZRKA 2CY5A 1XCGA 4HAWB 3AU5A 2RNRB 5HE0A 3BINA 4C0AA 2X18A 2J0KA 2YT0A 1OY2A 2MFQA 2DTCA 2IYBA 4K2PA 2I5FA 3TFMA 4CHJA 2COAA 2VRWB 1GC7A 2D9ZA 4CYEA 5J3QA 2H7DA 3HQCA 5C79A 4HAUB 2BCJA 2YF0A 5CLQB 2L2IA 2EMTA 1WGUA 3NSUA 5HE2A 1XD4A 2P0DA 2E2XA 1NU2A 1FHWA 4HDQA 2DHJA 5DIFB 4A5KA 2DYNA 2DX1A 2DKPA 3KRWA 4TYZA 1LB1A 5FI1A 3TW1A 4D0NB 1V5MA 4DBBA 1MIZB 1V88A 3U7DA 2Q13A 2LULA 3PEGA 2Z0QA 2COFA 1W1GA 1UPRA 2N23A 2VSZA 4KHBB 5JHHA 1X1GA 3OANA 1DDMA 1XR0B 2ELAA 3TO1A 2KUPA 3CIKA 4Y94A 1MPHA 4WSFA 1W1HA 1MK7B 4YL8A 5D3YA 2RGNB 1DDWA 4KVGB 3ODXA 2M38A 3DXCA 1LW3A 2EC1A 3VOQA 1WVHA 2ROVA 2GS0A 4KHAA 2K2UA 2W2XD 4NY0A 4EMOA 2AEHA 1UNPA 1Y5OA 1X05A 5EFXA 1EVHA 3A8QA 3KRXA 1OQNA 1DBHA 3PG7A 4P7IA 4HB4B 3MPXA 2I1JA 1NI2A 1M7EA 3AJ4A 4GMXB 4KHOA 2D10A 1E5WA 2P0FA 4IAPA 2GCJA 2GCLA 3SV1A 1BWNA 1EGXA 4Z2NA 2CAYA 3AU4A 4HAXB 1EAZA 4TKNA 2W2WA 1TQZA 2MWNB 3ML4A 5C6RA 3TVVA 1ZM0A 1N3HA 2AL6A 1H4RA 2DLWA 5JLJB 5C16A 4L6EA 4A6HA 2DX5A 5DI9B 5J3YA 1Z87A 1FB8A 4PNKA 2VKIA 1UPQA 2LKOA 1FOEA 1U5DA 3QIJA 3IVFA 3ODOA 1AWEA 1W1DA 1H10A 5D27A 2Y8FA 4MY6A 4HATB 3LJUX 4EKUA 3M1IB 4EJNA 5LOPB 3VIAA 1DROA 3ZVRA 5LONB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE1 A;  1NTY A;  2DFK A;  2DYQ A;  1KZ7 A;  1U27 A;  1GC6 A;  2J0M A;  1FGZ A;  4A6F A;  5D3X A;  2PZ1 A;  4ZRI A;  1TXD A;  1UNR A;  2COC A;  1TJ6 A;  4GZU A;  1MKE A;  1SHC A;  2G35 A;  3FM8 C;  4GXB A;  1X86 A;  4PQ0 A;  2OQB A;  2P0H A;  3QBV B;  4BBK A;  1PLS A;  1V5U A;  1P5T A;  1U29 A;  4KAX B;  1U5G A;  2JP2 A;  1ZC3 B;  5KQ1 A;  2V76 A;  2UZR A;  1M7R A;  2LG1 A;  1FHX A;  2DHK A;  3UZT A;  1MAI A;  2QKL A;  3HW2 B;  2D9W A;  1XOD A;  1WJ1 A;  4A6K A;  1PMS A;  1IRS A;  2RLO A;  5C5B A;  1FHO A;  3KZ1 A;  1XX0 A;  3GYP A;  2K2J A;  2L1C A;  3U8Z A;  2UZS A;  3T06 A;  2Z0O A;  1BTN A;  2RSG A;  3ODW A;  3SNH A;  1RJ2 A;  4XWX A;  3PVW A;  3F0W A;  2DN6 A;  4F7H A;  3G9W A;  4GN1 A;  1ZC4 B;  2R0D A;  4WJ7 A;  1AQC A;  2YS3 A;  1I2H A;  1WJM A;  1WGQ A;  2KGX B;  2D9Y A;  1U5E A;  4F7U P;  2ROZ B;  1K5D B;  2FJL A;  3F5R A;  2YVC A;  2D11 A;  2D9V A;  3PVL A;  3P7Z A;  1DDV A;  1UNQ A;  4HAV B;  3FSS A;  1QQG A;  2DA0 A;  5L81 A;  4IOY X;  1OMW A;  4HAY B;  2YS5 A;  1V5P A;  2OTX A;  3WYF B;  1J19 A;  2YSZ A;  1EF1 A;  1FGY A;  4F7G A;  2KCJ A;  3SO6 A;  2W2X C;  3X23 A;  3KY9 A;  4A6F B;  3PSC A;  2CRF A;  4K2O A;  3A98 B;  3N7C A;  2YT1 A;  4K81 A;  2COD A;  3D8F A;  1MIX A;  2J0J A;  1BAK A;  3PP2 A;  5DH9 B;  1WG7 A;  5GOW B;  4K17 A;  2LOX A;  5DHA B;  4IFS A;  3MDB C;  1BTK A;  2IFS A;  3TCA A;  2Y8G A;  2HE7 A;  5D3W A;  1I7A A;  1KZG A;  1V61 A;  2RVB B;  2I5C A;  2DKQ A;  2K00 A;  5HE3 A;  3DXE A;  4HB2 B;  5KQ4 A;  1P3R A;  3D8D A;  2LOZ A;  3ULB A;  5JHG A;  3KSY A;  1U2B A;  2ADZ A;  4MT7 A;  1U5F A;  2D9X A;  2LYD A;  1SGH A;  5C5B B;  1J0W A;  4HDO A;  2QKM A;  4ZRJ A;  2R09 A;  2ELB A;  3SUZ A;  4GPT B;  1B55 A;  3ZDT A;  4Z2M B;  2RUK B;  2YS1 A;  4CHM A;  2J59 M;  4NSW A;  3DXD A;  2DHI A;  1ZVR A;  2NZ8 B;  5KCV A;  1DYN A;  3RCP A;  1RRP B;  2H7E A;  3FEH A;  4GMV A;  2XQN M;  1NTV A;  1Q67 A;  5D3V A;  1ISN A;  2D4Q A;  3O96 A;  2GJY A;  2CY4 A;  2N0Y A;  3SYX A;  3WA0 A;  3D8E A;  1GG3 A;  5DHF B;  3V5W A;  4HB3 B;  2P8V A;  1PFJ A;  3HK0 A;  1FAO A;  2ZPY A;  3PZD A;  3P6A A;  1UEF A;  1KI1 B;  4MK0 A;  3BJI A;  2D2Q A;  4H8S A;  1XKE A;  2I1K A;  2M14 A;  4HAZ B;  1K5G B;  2EMS A;  2EJ8 A;  4HB0 B;  4DX8 A;  2MDX A;  3PVU A;  3QWM A;  1Y19 B;  2HTH B;  1QC6 A;  2Z0P A;  4B6H A;  3A8P A;  4WVF B;  4HHV A;  1ZSQ A;  2MKR A;  5JP4 A;  5J3T A;  3GYO A;  2UVM A;  1X1F A;  5CLL B;  4YON A;  4DXA B;  5FI0 A;  1MK9 B;  1X11 A;  3CXB B;  3ULC A;  2YRY A;  1WI1 A;  2Y7B A;  1P6S A;  1V89 A;  4DX9 0;  2NMB A;  4ZRK A;  2CY5 A;  1XCG A;  4HAW B;  3AU5 A;  2RNR B;  5HE0 A;  3BIN A;  4C0A A;  2X18 A;  2J0K A;  2YT0 A;  1OY2 A;  2MFQ A;  2DTC A;  2IYB A;  4K2P A;  2I5F A;  3TFM A;  4CHJ A;  2COA A;  2VRW B;  1GC7 A;  2D9Z A;  4CYE A;  5J3Q A;  2H7D A;  3HQC A;  5C79 A;  4HAU B;  2BCJ A;  2YF0 A;  5CLQ B;  2L2I A;  2EMT A;  1WGU A;  3NSU A;  5HE2 A;  1XD4 A;  2P0D A;  2E2X A;  1NU2 A;  1FHW A;  4HDQ A;  2DHJ A;  5DIF B;  4A5K A;  2DYN A;  2DX1 A;  2DKP A;  3KRW A;  4TYZ A;  1LB1 A;  5FI1 A;  3TW1 A;  4D0N B;  1V5M A;  4DBB A;  1MIZ B;  1V88 A;  3U7D A;  2Q13 A;  2LUL A;  3PEG A;  2Z0Q A;  2COF A;  1W1G A;  1UPR A;  2N23 A;  2VSZ A;  4KHB B;  5JHH A;  1X1G A;  3OAN A;  1DDM A;  1XR0 B;  2ELA A;  3TO1 A;  2KUP A;  3CIK A;  4Y94 A;  1MPH A;  4WSF A;  1W1H A;  1MK7 B;  4YL8 A;  5D3Y A;  2RGN B;  1DDW A;  4KVG B;  3ODX A;  2M38 A;  3DXC A;  1LW3 A;  2EC1 A;  3VOQ A;  1WVH A;  2ROV A;  2GS0 A;  4KHA A;  2K2U A;  2W2X D;  4NY0 A;  4EMO A;  2AEH A;  1UNP A;  1Y5O A;  1X05 A;  5EFX A;  1EVH A;  3A8Q A;  3KRX A;  1OQN A;  1DBH A;  3PG7 A;  4P7I A;  4HB4 B;  3MPX A;  2I1J A;  1NI2 A;  1M7E A;  3AJ4 A;  4GMX B;  4KHO A;  2D10 A;  1E5W A;  2P0F A;  4IAP A;  2GCJ A;  2GCL A;  3SV1 A;  1BWN A;  1EGX A;  4Z2N A;  2CAY A;  3AU4 A;  4HAX B;  1EAZ A;  4TKN A;  2W2W A;  1TQZ A;  2MWN B;  3ML4 A;  5C6R A;  3TVV A;  1ZM0 A;  1N3H A;  2AL6 A;  1H4R A;  2DLW A;  5JLJ B;  5C16 A;  4L6E A;  4A6H A;  2DX5 A;  5DI9 B;  5J3Y A;  1Z87 A;  1FB8 A;  4PNK A;  2VKI A;  1UPQ A;  2LKO A;  1FOE A;  1U5D A;  3QIJ A;  3IVF A;  3ODO A;  1AWE A;  1W1D A;  1H10 A;  5D27 A;  2Y8F A;  4MY6 A;  4HAT B;  3LJU X;  4EKU A;  3M1I B;  4EJN A;  5LOP B;  3VIA A;  1DRO A;  3ZVR A;  5LON B; 
#chains in the Genus database with same CATH topology
 5HE1 A;  5IRS A;  1NTY A;  2DFK A;  2DYQ A;  1KZ7 A;  1U27 A;  1GC6 A;  2J0M A;  4QJ5 B;  1FGZ A;  4A6F A;  5D3X A;  2PZ1 A;  4ZRI A;  1TXD A;  1UNR A;  2COC A;  1TJ6 A;  4GZU A;  1MKE A;  1SHC A;  2G35 A;  3FM8 C;  4GXB A;  2Z13 A;  1X86 A;  4PQ0 A;  2OQB A;  4D6W A;  2P0H A;  3QBV B;  3NWF A;  4BBK A;  4GOU A;  1PLS A;  1V5U A;  1P5T A;  1U29 A;  4KAX B;  1U5G A;  2JP2 A;  1ZC3 B;  5KQ1 A;  2V76 A;  2UZR A;  1M7R A;  2LG1 A;  1FHX A;  2DHK A;  3UZT A;  1MAI A;  2QKL A;  3HW2 B;  2D9W A;  1XOD A;  1WJ1 A;  4A6K A;  1PMS A;  1IRS A;  2RLO A;  5C5B A;  1FHO A;  3KZ1 A;  1XX0 A;  3GYP A;  2K2J A;  2L1C A;  3U8Z A;  2UZS A;  3T06 A;  2Z0O A;  1BTN A;  4KHB A;  2RSG A;  3ODW A;  3SNH A;  1RJ2 A;  4XWX A;  3PVW A;  3F0W A;  2DN6 A;  4F7H A;  3G9W A;  4GN1 A;  1ZC4 B;  2R0D A;  4WJ7 A;  1AQC A;  2YS3 A;  1I2H A;  1WJM A;  1WGQ A;  2KGX B;  3DCX A;  2D9Y A;  1U5E A;  4F7U P;  2ROZ B;  1K5D B;  2FJL A;  3F5R A;  2R2Y A;  4OSN A;  2YVC A;  2YT2 A;  2D11 A;  2D9V A;  3PVL A;  3P7Z A;  1DDV A;  1UNQ A;  4HAV B;  3FSS A;  1QQG A;  2DA0 A;  5L81 A;  4IOY X;  1OMW A;  4HAY B;  2YS5 A;  1V5P A;  2OTX A;  3WYF B;  1J19 A;  2YSZ A;  1EF1 A;  1FGY A;  4F7G A;  2KCJ A;  3SO6 A;  2W2X C;  3X23 A;  3KY9 A;  4A6F B;  2K8E A;  3PSC A;  2CRF A;  4K2O A;  3A98 B;  3N7C A;  2YT1 A;  4K81 A;  4DIX A;  2COD A;  3D8F A;  1MIX A;  2J0J A;  1BAK A;  3PP2 A;  5DH9 B;  1WG7 A;  3FVC A;  5GOW B;  4K17 A;  2LOX A;  5DHA B;  4IFS A;  1ZYI A;  3MDB C;  1BTK A;  2IFS A;  3TCA A;  2Y8G A;  2HE7 A;  5D3W A;  1I7A A;  1KZG A;  1V61 A;  2RVB B;  2I5C A;  2DKQ A;  2K00 A;  5HE3 A;  3DXE A;  4HB2 B;  5KQ4 A;  1P3R A;  3D8D A;  2LOZ A;  3ULB A;  5JHG A;  3KSY A;  1U2B A;  2ADZ A;  4MT7 A;  1U5F A;  2D9X A;  2LYD A;  1SGH A;  2RRF A;  5I2M A;  5C5B B;  1J0W A;  5M4Y B;  3B77 A;  4HDO A;  2QKM A;  4ZRJ A;  2R09 A;  2ELB A;  3SUZ A;  4GPT B;  4QJ3 B;  1B55 A;  2NBV A;  3ZDT A;  4L1R A;  4Z2M B;  2RUK B;  2YS1 A;  4CHM A;  2J59 M;  3A58 A;  3DXD A;  4NSW A;  2DHI A;  1ZVR A;  2NZ8 B;  5KCV A;  1DYN A;  3RCP A;  1RRP B;  2H7E A;  3FEH A;  4GMV A;  2XQN M;  1NTV A;  1Q67 A;  5D3V A;  1ISN A;  3NWA A;  2D4Q A;  3O96 A;  2GJY A;  2CY4 A;  2N0Y A;  3SYX A;  3WA0 A;  4CSQ A;  3D8E A;  3OHM B;  1GG3 A;  5DHF B;  3V5W A;  4HB3 B;  2P8V A;  1PFJ A;  3HK0 A;  1FAO A;  2ZPY A;  3PZD A;  3P6A A;  1UEF A;  1KI1 B;  2Z59 A;  4MK0 A;  3BJI A;  2D2Q A;  3NW8 A;  4H8S A;  1XKE A;  4QXA B;  2I1K A;  2M14 A;  4HSI A;  4HAZ B;  1K5G B;  2EMS A;  2EJ8 A;  4HB0 B;  4DX8 A;  2KIG A;  2MDX A;  3PVU A;  3QWM A;  1Y19 B;  3HSA A;  2HTH B;  1MI1 A;  1QC6 A;  2Z4D A;  3HIE A;  2Z0P A;  4B6H A;  3A8P A;  4WVF B;  4HHV A;  1ZSQ A;  2MKR A;  5JP4 A;  5J3T A;  3GYO A;  2UVM A;  1X1F A;  5CLL B;  2Z14 A;  4YON A;  4DXA B;  5FI0 A;  1MK9 B;  1X11 A;  3CXB B;  3ULC A;  2YRY A;  1WI1 A;  2Y7B A;  1P6S A;  1V89 A;  4DX9 0;  2NMB A;  4ZRK A;  2CY5 A;  1XCG A;  4HAW B;  3AU5 A;  2RNR B;  5HE0 A;  3BIN A;  4C0A A;  2X18 A;  2KR0 A;  2J0K A;  2YT0 A;  1OY2 A;  2MFQ A;  2DTC A;  2IYB A;  4K2P A;  2I5F A;  3TFM A;  4CHJ A;  2COA A;  2VRW B;  1GC7 A;  2D9Z A;  4CYE A;  5J3Q A;  2H7D A;  3HQC A;  5C79 A;  4HAU B;  2BCJ A;  2YF0 A;  5CLQ B;  2K49 A;  2L2I A;  2EMT A;  1WGU A;  3NSU A;  5HE2 A;  1XD4 A;  2P0D A;  2E2X A;  1NU2 A;  1FHW A;  4HDQ A;  2DHJ A;  2KUQ A;  5DIF B;  4A5K A;  2DYN A;  2DX1 A;  2DKP A;  3KRW A;  4TYZ A;  1LB1 A;  5FI1 A;  3TW1 A;  4D0N B;  1V5M A;  3NWD A;  4DBB A;  1MIZ B;  1V88 A;  3U7D A;  2Q13 A;  2LUL A;  3PEG A;  2Z0Q A;  2COF A;  1W1G A;  1UPR A;  2N23 A;  2VSZ A;  4KHB B;  5JHH A;  1X1G A;  3OAN A;  1DDM A;  1XR0 B;  2ELA A;  3TO1 A;  2KUP A;  3CIK A;  4Y94 A;  1MPH A;  4WSF A;  1W1H A;  1MK7 B;  4YL8 A;  5D3Y A;  2RGN B;  1DDW A;  4KVG B;  2FJU B;  3ODX A;  2M38 A;  3DXC A;  1LW3 A;  2EC1 A;  3VOQ A;  1WVH A;  2ROV A;  2GS0 A;  4KHA A;  2K2U A;  2W2X D;  2GUM A;  4NY0 A;  4EMO A;  3U12 A;  2AEH A;  1UNP A;  1Y5O A;  1X05 A;  5EFX A;  1EVH A;  3A8Q A;  3KRX A;  1OQN A;  1DBH A;  3PG7 A;  4P7I A;  4HB4 B;  3MPX A;  2I1J A;  1NI2 A;  1M7E A;  3AJ4 A;  4GMX B;  4KHO A;  5I2S A;  2D10 A;  4OT1 A;  1E5W A;  2P0F A;  4IAP A;  2GCJ A;  2GCL A;  3SV1 A;  1BWN A;  1EGX A;  4Z2N A;  2CAY A;  3AU4 A;  4HAX B;  1EAZ A;  4TKN A;  2W2W A;  1TQZ A;  2MWN B;  3ML4 A;  5C6R A;  5LG4 B;  2KIE A;  3TVV A;  1ZM0 A;  1N3H A;  2AL6 A;  1H4R A;  2DLW A;  5JLJ B;  5C16 A;  4L6E A;  4QJ4 B;  4A6H A;  2DX5 A;  5DI9 B;  5J3Y A;  1Z87 A;  1FB8 A;  4PNK A;  2VKI A;  1UPQ A;  2LKO A;  1FOE A;  2ZKM X;  1U5D A;  3QIJ A;  3IVF A;  3ODO A;  1AWE A;  1W1D A;  1H10 A;  5D27 A;  4GNK B;  2Y8F A;  4MY6 A;  1T77 A;  4HAT B;  3LJU X;  4EKU A;  3M1I B;  4EJN A;  5LOP B;  3VIA A;  1DRO A;  3ZVR A;  5LON B; 
#chains in the Genus database with same CATH homology
 5HE1 A;  1NTY A;  2DFK A;  2DYQ A;  1KZ7 A;  1U27 A;  1GC6 A;  2J0M A;  1FGZ A;  4A6F A;  5D3X A;  2PZ1 A;  4ZRI A;  1TXD A;  1UNR A;  2COC A;  1TJ6 A;  4GZU A;  1MKE A;  1SHC A;  2G35 A;  3FM8 C;  4GXB A;  1X86 A;  4PQ0 A;  2OQB A;  2P0H A;  3QBV B;  4BBK A;  1PLS A;  1V5U A;  1P5T A;  1U29 A;  4KAX B;  1U5G A;  2JP2 A;  1ZC3 B;  5KQ1 A;  2V76 A;  2UZR A;  1M7R A;  2LG1 A;  1FHX A;  2DHK A;  3UZT A;  1MAI A;  2QKL A;  3HW2 B;  2D9W A;  1XOD A;  1WJ1 A;  4A6K A;  1PMS A;  1IRS A;  2RLO A;  5C5B A;  1FHO A;  3KZ1 A;  1XX0 A;  3GYP A;  2K2J A;  2L1C A;  3U8Z A;  2UZS A;  3T06 A;  2Z0O A;  1BTN A;  2RSG A;  3ODW A;  3SNH A;  1RJ2 A;  4XWX A;  3PVW A;  3F0W A;  2DN6 A;  4F7H A;  3G9W A;  4GN1 A;  1ZC4 B;  2R0D A;  4WJ7 A;  1AQC A;  2YS3 A;  1I2H A;  1WJM A;  1WGQ A;  2KGX B;  2D9Y A;  1U5E A;  4F7U P;  2ROZ B;  1K5D B;  2FJL A;  3F5R A;  2YVC A;  2D11 A;  2D9V A;  3PVL A;  3P7Z A;  1DDV A;  1UNQ A;  4HAV B;  3FSS A;  1QQG A;  2DA0 A;  5L81 A;  4IOY X;  1OMW A;  4HAY B;  2YS5 A;  1V5P A;  2OTX A;  3WYF B;  1J19 A;  2YSZ A;  1EF1 A;  1FGY A;  4F7G A;  2KCJ A;  3SO6 A;  2W2X C;  3X23 A;  3KY9 A;  4A6F B;  3PSC A;  2CRF A;  4K2O A;  3A98 B;  3N7C A;  2YT1 A;  4K81 A;  2COD A;  3D8F A;  1MIX A;  2J0J A;  1BAK A;  3PP2 A;  5DH9 B;  1WG7 A;  5GOW B;  4K17 A;  2LOX A;  5DHA B;  4IFS A;  3MDB C;  1BTK A;  2IFS A;  3TCA A;  2Y8G A;  2HE7 A;  5D3W A;  1I7A A;  1KZG A;  1V61 A;  2RVB B;  2I5C A;  2DKQ A;  2K00 A;  5HE3 A;  3DXE A;  4HB2 B;  5KQ4 A;  1P3R A;  3D8D A;  2LOZ A;  3ULB A;  5JHG A;  3KSY A;  1U2B A;  2ADZ A;  4MT7 A;  1U5F A;  2D9X A;  2LYD A;  1SGH A;  5C5B B;  1J0W A;  4HDO A;  2QKM A;  4ZRJ A;  2R09 A;  2ELB A;  3SUZ A;  4GPT B;  1B55 A;  3ZDT A;  4Z2M B;  2RUK B;  2YS1 A;  4CHM A;  2J59 M;  4NSW A;  3DXD A;  2DHI A;  1ZVR A;  2NZ8 B;  5KCV A;  1DYN A;  3RCP A;  1RRP B;  2H7E A;  3FEH A;  4GMV A;  2XQN M;  1NTV A;  1Q67 A;  5D3V A;  1ISN A;  2D4Q A;  3O96 A;  2GJY A;  2CY4 A;  2N0Y A;  3SYX A;  3WA0 A;  3D8E A;  1GG3 A;  5DHF B;  3V5W A;  4HB3 B;  2P8V A;  1PFJ A;  3HK0 A;  1FAO A;  2ZPY A;  3PZD A;  3P6A A;  1UEF A;  1KI1 B;  4MK0 A;  3BJI A;  2D2Q A;  4H8S A;  1XKE A;  2I1K A;  2M14 A;  4HAZ B;  1K5G B;  2EMS A;  2EJ8 A;  4HB0 B;  4DX8 A;  2MDX A;  3PVU A;  3QWM A;  1Y19 B;  2HTH B;  1QC6 A;  2Z0P A;  4B6H A;  3A8P A;  4WVF B;  4HHV A;  1ZSQ A;  2MKR A;  5JP4 A;  5J3T A;  3GYO A;  2UVM A;  1X1F A;  5CLL B;  4YON A;  4DXA B;  5FI0 A;  1MK9 B;  1X11 A;  3CXB B;  3ULC A;  2YRY A;  1WI1 A;  2Y7B A;  1P6S A;  1V89 A;  4DX9 0;  2NMB A;  4ZRK A;  2CY5 A;  1XCG A;  4HAW B;  3AU5 A;  2RNR B;  5HE0 A;  3BIN A;  4C0A A;  2X18 A;  2J0K A;  2YT0 A;  1OY2 A;  2MFQ A;  2DTC A;  2IYB A;  4K2P A;  2I5F A;  3TFM A;  4CHJ A;  2COA A;  2VRW B;  1GC7 A;  2D9Z A;  4CYE A;  5J3Q A;  2H7D A;  3HQC A;  5C79 A;  4HAU B;  2BCJ A;  2YF0 A;  5CLQ B;  2L2I A;  2EMT A;  1WGU A;  3NSU A;  5HE2 A;  1XD4 A;  2P0D A;  2E2X A;  1NU2 A;  1FHW A;  4HDQ A;  2DHJ A;  5DIF B;  4A5K A;  2DYN A;  2DX1 A;  2DKP A;  3KRW A;  4TYZ A;  1LB1 A;  5FI1 A;  3TW1 A;  4D0N B;  1V5M A;  4DBB A;  1MIZ B;  1V88 A;  3U7D A;  2Q13 A;  2LUL A;  3PEG A;  2Z0Q A;  2COF A;  1W1G A;  1UPR A;  2N23 A;  2VSZ A;  4KHB B;  5JHH A;  1X1G A;  3OAN A;  1DDM A;  1XR0 B;  2ELA A;  3TO1 A;  2KUP A;  3CIK A;  4Y94 A;  1MPH A;  4WSF A;  1W1H A;  1MK7 B;  4YL8 A;  5D3Y A;  2RGN B;  1DDW A;  4KVG B;  3ODX A;  2M38 A;  3DXC A;  1LW3 A;  2EC1 A;  3VOQ A;  1WVH A;  2ROV A;  2GS0 A;  4KHA A;  2K2U A;  2W2X D;  4NY0 A;  4EMO A;  2AEH A;  1UNP A;  1Y5O A;  1X05 A;  5EFX A;  1EVH A;  3A8Q A;  3KRX A;  1OQN A;  1DBH A;  3PG7 A;  4P7I A;  4HB4 B;  3MPX A;  2I1J A;  1NI2 A;  1M7E A;  3AJ4 A;  4GMX B;  4KHO A;  2D10 A;  1E5W A;  2P0F A;  4IAP A;  2GCJ A;  2GCL A;  3SV1 A;  1BWN A;  1EGX A;  4Z2N A;  2CAY A;  3AU4 A;  4HAX B;  1EAZ A;  4TKN A;  2W2W A;  1TQZ A;  2MWN B;  3ML4 A;  5C6R A;  3TVV A;  1ZM0 A;  1N3H A;  2AL6 A;  1H4R A;  2DLW A;  5JLJ B;  5C16 A;  4L6E A;  4A6H A;  2DX5 A;  5DI9 B;  5J3Y A;  1Z87 A;  1FB8 A;  4PNK A;  2VKI A;  1UPQ A;  2LKO A;  1FOE A;  1U5D A;  3QIJ A;  3IVF A;  3ODO A;  1AWE A;  1W1D A;  1H10 A;  5D27 A;  2Y8F A;  4MY6 A;  4HAT B;  3LJU X;  4EKU A;  3M1I B;  4EJN A;  5LOP B;  3VIA A;  1DRO A;  3ZVR A;  5LON B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...