4HAUB

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1-ran-ranbp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
121
structure length
121
Chain Sequence
b'EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 37
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hauB00
2DKPA 1J0WA 4HHVA 1QQGA 3QIJA 5JP4A 2D9VA 2K00A 1V5PA 1DDMA 2M38A 3D8DA 2J0JA 4HB4B 2GS0A 4TYZA 2AEHA 1XR0B 2Z0PA 4GXBA 5C79A 4KAXB 4DBBA 3M1IB 1U29A 3A8QA 4HAWB 2Q13A 4HB3B 2DTCA 5JHGA 1BTKA 4L6EA 4PQ0A 5JHHA 2N23A 5C5BB 4C0AA 2OQBA 2NMBA 4GPTB 2D4QA 4KVGB 2RSGA 4A6HA 1UNPA 1B55A 2W2WA 1FHOA 1SGHA 1ZSQA 3KSYA 1XD4A 3SNHA 1FAOA 4EMOA 4GN1A 2HE7A 2FJLA 5D27A 3FSSA 2ADZA 1FHWA 2R09A 1X86A 3TCAA 1ZVRA 2CRFA 2DFKA 1U5EA 1MKEA 2OTXA 5C5BA 1MPHA 5DHAB 3X23A 3OANA 5LONB 2Y7BA 1NU2A 3GYOA 1FGYA 1FGZA 1N3HA 2YS3A 2EJ8A 2IYBA 1GG3A 3U7DA 2ROZB 1ZC3B 3CIKA 1DROA 2CAYA 2YT0A 3P7ZA 2DHKA 3PSCA 1TJ6A 3ZDTA 5C16A 5DIFB 2D2QA 1K5GB 1V89A 2L2IA 2RNRB 3VOQA 2X18A 3ODXA 3SUZA 2LKOA 1MK9B 1V61A 3QWMA 1NTYA 2Z0OA 1UNQA 4GZUA 5J3QA 2P0DA 4ZRIA 2K2JA 2NZ8B 1K5DB 4A6FB 1XCGA 2LOZA 2V76A 5HE2A 4CHJA 2RVBB 2P8VA 3N7CA 3FM8C 5DH9B 2I1KA 3VIAA 2COCA 2QKMA 4BBKA 2CY4A 1V5MA 5KQ4A 4MT7A 4CYEA 1PFJA 2D10A 4HB2B 3PVLA 3KRWA 4A6FA 1IRSA 1XX0A 1QC6A 5J3YA 5J3TA 2COFA 3D8EA 4YL8A 4MK0A 2H7DA 2YS5A 5LOPB 3SYXA 2ELAA 3KY9A 2DA0A 1KI1B 4KHOA 1P3RA 3AU4A 5FI1A 4H8SA 2MDXA 2W2XD 1KZ7A 4TKNA 1H10A 5HE1A 4F7UP 2CY5A 2GJYA 1U27A 4A5KA 2RGNB 1W1GA 1PLSA 5CLLB 1OY2A 4K81A 1AWEA 3HW2B 1FOEA 4ZRKA 3NSUA 1Z87A 1U5GA 2D11A 3P6AA 2Y8GA 2J0MA 3KZ1A 1MIXA 3FEHA 5FI0A 2I5FA 2BCJA 5KQ1A 2D9ZA 1I2HA 2N0YA 2YF0A 3D8FA 2RLOA 3DXCA 5D3YA 1H4RA 3HK0A 1NI2A 4Z2MB 3MPXA 1PMSA 5D3VA 1XKEA 1NTVA 4WJ7A 4F7GA 2D9XA 2JP2A 1X11A 4K17A 2LULA 2L1CA 2DX1A 3LJUX 2VKIA 4DXAB 2J59M 3O96A 5JLJB 4ZRJA 1FB8A 2I1JA 3A8PA 4HAVB 1I7AA 3AJ4A 1V5UA 2COAA 4HATB 3PG7A 3PZDA 1DDVA 4KHAA 5HE0A 1DBHA 5L81A 3PEGA 2MKRA 4Z2NA 2DYQA 3ODWA 1MK7B 3TW1A 1GC6A 2LYDA 2EMTA 3KRXA 1EVHA 4WVFB 2DLWA 2KUPA 1V88A 1UNRA 2E2XA 4F7HA 3PVUA 1WJMA 4IAPA 2DN6A 4P7IA 5CLQB 1DYNA 2ELBA 4PNKA 2DX5A 3T06A 2PZ1A 2W2XC 5D3XA 2Z0QA 3F0WA 2EC1A 1ZC4B 3SO6A 1OMWA 2YSZA 1EGXA 4DX8A 2RUKB 2DYNA 3ULCA 4NY0A 3PVWA 2UZSA 4KHBB 5C6RA 3ULBA 4GMVA 1BTNA 5DHFB 1OQNA 1U5DA 2KGXB 4D0NB 2Y8FA 2MFQA 3TO1A 4YONA 3HQCA 3AU5A 1SHCA 3UZTA 4HAXB 3BINA 1X1GA 3A98B 2VSZA 1KZGA 4HAZB 1P5TA 1RJ2A 3PP2A 2DKQA 2MWNB 3MDBC 1WI1A 4K2PA 3TVVA 1LW3A 5D3WA 4HDQA 1Y19B 4HAUB 1ZM0A 4HDOA 4MY6A 5DI9B 3WYFB 1X05A 2KCJA 2YVCA 1U5FA 4DX90 3DXEA 1ISNA 2DHIA 2ROVA 2YT1A 5HE3A 2VRWB 3ODOA 2P0HA 3CXBB 2GCLA 1W1HA 1WGUA 4IFSA 4A6KA 2QKLA 2J0KA 3ML4A 2G35A 2R0DA 3RCPA 4HAYB 1W1DA 3GYPA 1M7RA 2IFSA 4CHMA 3WA0A 2ZPYA 1GC7A 3IVFA 2DHJA 2H7EA 2UZRA 3DXDA 2HTHB 1U2BA 4K2OA 4HB0B 2LG1A 3F5RA 1TXDA 1DDWA 3TFMA 3QBVB 4B6HA 1WG7A 4XWXA 2AL6A 1UPRA 1UPQA 1EF1A 3ZVRA 3BJIA 4IOYX 1WVHA 2K2UA 5EFXA 2CODA 2EMSA 1WJ1A 4EKUA 4GMXB 2I5CA 2XQNM 3U8ZA 2UVMA 4Y94A 1BAKA 4NSWA 1Y5OA 1E5WA 1MIZB 3SV1A 1Q67A 1AQCA 2D9YA 2LOXA 2M14A 2YRYA 2P0FA 1LB1A 3V5WA 1M7EA 1X1FA 5GOWB 1FHXA 1J19A 2GCJA 1RRPB 5KCVA 3G9WA 2D9WA 1TQZA 4WSFA 1MAIA 1EAZA 1BWNA 1UEFA 1P6SA 1XODA 2YS1A 4EJNA 1WGQA
chains in the Genus database with same CATH superfamily
2DKPA 1J0WA 4HHVA 1QQGA 3QIJA 2RRFA 5JP4A 2D9VA 2K00A 1V5PA 1DDMA 2M38A 3D8DA 2J0JA 4HB4B 2GS0A 4TYZA 2AEHA 1XR0B 2R2YA 2Z0PA 4GXBA 5C79A 4KAXB 4DBBA 3M1IB 1U29A 3A8QA 4HAWB 2Q13A 4HB3B 2DTCA 5JHGA 1BTKA 2ZKMX 4L6EA 4PQ0A 5JHHA 2N23A 4OSNA 5C5BB 2OQBA 4C0AA 2NMBA 4GPTB 2D4QA 4KVGB 2RSGA 4QXAB 4A6HA 1UNPA 1B55A 4HSIA 2W2WA 1FHOA 1SGHA 1ZSQA 3KSYA 1XD4A 3SNHA 1FAOA 4EMOA 4GN1A 2HE7A 2FJLA 1T77A 3FSSA 5D27A 2ADZA 1FHWA 2R09A 1X86A 3TCAA 1ZVRA 2CRFA 2DFKA 1U5EA 1MKEA 2OTXA 5C5BA 1MPHA 5DHAB 3X23A 3OANA 5LONB 2Y7BA 1NU2A 3GYOA 1FGYA 1FGZA 1N3HA 2YS3A 2EJ8A 2IYBA 1GG3A 3U7DA 2ROZB 1ZC3B 3CIKA 1DROA 2CAYA 2YT0A 3P7ZA 2DHKA 3PSCA 1TJ6A 3ZDTA 5C16A 5DIFB 2D2QA 1K5GB 1V89A 2L2IA 2RNRB 3VOQA 2X18A 3ODXA 3SUZA 2LKOA 1MK9B 1V61A 3QWMA 1NTYA 2Z0OA 1UNQA 4GZUA 5J3QA 2P0DA 4ZRIA 4QJ5B 2K2JA 2NZ8B 3FVCA 1K5DB 4A6FB 1XCGA 1MI1A 2LOZA 2V76A 5HE2A 4CHJA 3OHMB 2RVBB 2P8VA 3N7CA 3FM8C 5DH9B 2I1KA 3VIAA 2COCA 2QKMA 3U12A 4BBKA 2CY4A 1V5MA 5KQ4A 4MT7A 4CYEA 1PFJA 4GOUA 2D10A 4HB2B 3PVLA 3KRWA 4A6FA 1IRSA 4L1RA 1XX0A 1QC6A 5J3YA 5J3TA 2COFA 3D8EA 4YL8A 4MK0A 5M4YB 2H7DA 2YS5A 5LOPB 3SYXA 2ELAA 2Z4DA 3KY9A 2DA0A 1KI1B 3NWAA 4KHOA 1P3RA 3AU4A 5FI1A 4H8SA 2MDXA 2W2XD 1KZ7A 4QJ3B 1H10A 4TKNA 2Z59A 5HE1A 4F7UP 2CY5A 2GJYA 1U27A 4A5KA 2RGNB 1W1GA 1PLSA 5CLLB 1OY2A 2KIEA 4K81A 1AWEA 3HW2B 1FOEA 4ZRKA 3NSUA 1Z87A 1U5GA 2D11A 3P6AA 2Y8GA 2J0MA 3KZ1A 1MIXA 3FEHA 5FI0A 2I5FA 2BCJA 5KQ1A 2D9ZA 1I2HA 4CSQA 2N0YA 2YF0A 3D8FA 2RLOA 3DXCA 5D3YA 1H4RA 3HK0A 1NI2A 4Z2MB 3MPXA 1PMSA 5D3VA 1XKEA 1NTVA 3HSAA 4WJ7A 4F7GA 5IRSA 2D9XA 2JP2A 1X11A 4K17A 2LULA 2L1CA 2DX1A 3LJUX 2VKIA 4DXAB 2J59M 3O96A 5JLJB 3HIEA 4ZRJA 1FB8A 2I1JA 3A8PA 4HAVB 1I7AA 3AJ4A 1V5UA 2COAA 4HATB 3PG7A 3PZDA 1DDVA 4KHAA 5HE0A 1DBHA 5L81A 3PEGA 2MKRA 4Z2NA 2DYQA 3ODWA 1MK7B 3TW1A 1GC6A 2LYDA 2EMTA 3KRXA 1EVHA 4WVFB 2DLWA 2KUPA 1V88A 3B77A 2K8EA 1UNRA 2E2XA 4F7HA 2KIGA 1WJMA 3PVUA 2DN6A 3NWFA 4IAPA 4P7IA 5CLQB 1DYNA 2ELBA 4PNKA 2DX5A 5LG4B 3T06A 2GUMA 2PZ1A 2W2XC 5I2MA 5D3XA 2Z0QA 3F0WA 2EC1A 1ZC4B 3SO6A 1OMWA 2YSZA 1EGXA 4DX8A 2RUKB 2DYNA 4D6WA 3ULCA 4NY0A 3PVWA 2UZSA 4KHBB 5C6RA 3ULBA 2YT2A 4GMVA 1BTNA 3NW8A 5DHFB 1OQNA 1U5DA 4QJ4B 2KGXB 4D0NB 2Y8FA 2MFQA 3TO1A 4YONA 3HQCA 3AU5A 1SHCA 3UZTA 4HAXB 4KHBA 3BINA 1X1GA 3A98B 2VSZA 1KZGA 4HAZB 1P5TA 1RJ2A 3PP2A 2DKQA 2MWNB 3MDBC 2K49A 1WI1A 4K2PA 3TVVA 1LW3A 5D3WA 4HDQA 1Y19B 4HAUB 1ZM0A 4HDOA 4MY6A 5DI9B 3WYFB 1X05A 2KCJA 2YVCA 1U5FA 4DX90 3DXEA 1ISNA 2DHIA 2KR0A 2FJUB 2ROVA 2YT1A 5HE3A 2VRWB 3A58A 3ODOA 2P0HA 3CXBB 2GCLA 1W1HA 1WGUA 4IFSA 4A6KA 3DCXA 2QKLA 2J0KA 3ML4A 2G35A 2R0DA 3RCPA 4HAYB 4GNKB 1W1DA 3GYPA 1M7RA 2IFSA 4CHMA 3WA0A 2ZPYA 1GC7A 3IVFA 2DHJA 2H7EA 2UZRA 2NBVA 3DXDA 2HTHB 1U2BA 4K2OA 4HB0B 2LG1A 3F5RA 1TXDA 1DDWA 3TFMA 3QBVB 4B6HA 1WG7A 4XWXA 2AL6A 1UPRA 1UPQA 4DIXA 1EF1A 4OT1A 3ZVRA 3BJIA 4IOYX 1WVHA 2K2UA 5EFXA 2CODA 2EMSA 2KUQA 1WJ1A 4EKUA 4GMXB 2I5CA 2XQNM 3U8ZA 2UVMA 4Y94A 1BAKA 3NWDA 4NSWA 1Y5OA 2Z14A 1E5WA 1MIZB 5I2SA 3SV1A 1ZYIA 1Q67A 1AQCA 2D9YA 2LOXA 2M14A 2Z13A 2YRYA 2P0FA 1LB1A 3V5WA 1M7EA 1X1FA 5GOWB 1FHXA 1J19A 2GCJA 1RRPB 5KCVA 3G9WA 2D9WA 1TQZA 4WSFA 1MAIA 1EAZA 1BWNA 1UEFA 1P6SA 1XODA 2YS1A 4EJNA 1WGQA
chains in the Genus database with same CATH topology
2DKPA 1J0WA 4HHVA 1QQGA 3QIJA 5JP4A 2D9VA 2K00A 1V5PA 1DDMA 2M38A 3D8DA 2J0JA 4HB4B 2GS0A 4TYZA 2AEHA 1XR0B 2Z0PA 4GXBA 5C79A 4KAXB 4DBBA 3M1IB 1U29A 3A8QA 4HAWB 2Q13A 4HB3B 2DTCA 5JHGA 1BTKA 4L6EA 4PQ0A 5JHHA 2N23A 5C5BB 4C0AA 2OQBA 2NMBA 4GPTB 2D4QA 4KVGB 2RSGA 4A6HA 1UNPA 1B55A 2W2WA 1FHOA 1SGHA 1ZSQA 3KSYA 1XD4A 3SNHA 1FAOA 4EMOA 4GN1A 2HE7A 2FJLA 5D27A 3FSSA 2ADZA 1FHWA 2R09A 1X86A 3TCAA 1ZVRA 2CRFA 2DFKA 1U5EA 1MKEA 2OTXA 5C5BA 1MPHA 5DHAB 3X23A 3OANA 5LONB 2Y7BA 1NU2A 3GYOA 1FGYA 1FGZA 1N3HA 2YS3A 2EJ8A 2IYBA 1GG3A 3U7DA 2ROZB 1ZC3B 3CIKA 1DROA 2CAYA 2YT0A 3P7ZA 2DHKA 3PSCA 1TJ6A 3ZDTA 5C16A 5DIFB 2D2QA 1K5GB 1V89A 2L2IA 2RNRB 3VOQA 2X18A 3ODXA 3SUZA 2LKOA 1MK9B 1V61A 3QWMA 1NTYA 2Z0OA 1UNQA 4GZUA 5J3QA 2P0DA 4ZRIA 2K2JA 2NZ8B 1K5DB 4A6FB 1XCGA 2LOZA 2V76A 5HE2A 4CHJA 2RVBB 2P8VA 3N7CA 3FM8C 5DH9B 2I1KA 3VIAA 2COCA 2QKMA 4BBKA 2CY4A 1V5MA 5KQ4A 4MT7A 4CYEA 1PFJA 2D10A 4HB2B 3PVLA 3KRWA 4A6FA 1IRSA 1XX0A 1QC6A 5J3YA 5J3TA 2COFA 3D8EA 4YL8A 4MK0A 2H7DA 2YS5A 5LOPB 3SYXA 2ELAA 3KY9A 2DA0A 1KI1B 4KHOA 1P3RA 3AU4A 5FI1A 4H8SA 2MDXA 2W2XD 1KZ7A 4TKNA 1H10A 5HE1A 4F7UP 2CY5A 2GJYA 1U27A 4A5KA 2RGNB 1W1GA 1PLSA 5CLLB 1OY2A 4K81A 1AWEA 3HW2B 1FOEA 4ZRKA 3NSUA 1Z87A 1U5GA 2D11A 3P6AA 2Y8GA 2J0MA 3KZ1A 1MIXA 3FEHA 5FI0A 2I5FA 2BCJA 5KQ1A 2D9ZA 1I2HA 2N0YA 2YF0A 3D8FA 2RLOA 3DXCA 5D3YA 1H4RA 3HK0A 1NI2A 4Z2MB 3MPXA 1PMSA 5D3VA 1XKEA 1NTVA 4WJ7A 4F7GA 2D9XA 2JP2A 1X11A 4K17A 2LULA 2L1CA 2DX1A 3LJUX 2VKIA 4DXAB 2J59M 3O96A 5JLJB 4ZRJA 1FB8A 2I1JA 3A8PA 4HAVB 1I7AA 3AJ4A 1V5UA 2COAA 4HATB 3PG7A 3PZDA 1DDVA 4KHAA 5HE0A 1DBHA 5L81A 3PEGA 2MKRA 4Z2NA 2DYQA 3ODWA 1MK7B 3TW1A 1GC6A 2LYDA 2EMTA 3KRXA 1EVHA 4WVFB 2DLWA 2KUPA 1V88A 1UNRA 2E2XA 4F7HA 3PVUA 1WJMA 4IAPA 2DN6A 4P7IA 5CLQB 1DYNA 2ELBA 4PNKA 2DX5A 3T06A 2PZ1A 2W2XC 5D3XA 2Z0QA 3F0WA 2EC1A 1ZC4B 3SO6A 1OMWA 2YSZA 1EGXA 4DX8A 2RUKB 2DYNA 3ULCA 4NY0A 3PVWA 2UZSA 4KHBB 5C6RA 3ULBA 4GMVA 1BTNA 5DHFB 1OQNA 1U5DA 2KGXB 4D0NB 2Y8FA 2MFQA 3TO1A 4YONA 3HQCA 3AU5A 1SHCA 3UZTA 4HAXB 3BINA 1X1GA 3A98B 2VSZA 1KZGA 4HAZB 1P5TA 1RJ2A 3PP2A 2DKQA 2MWNB 3MDBC 1WI1A 4K2PA 3TVVA 1LW3A 5D3WA 4HDQA 1Y19B 4HAUB 1ZM0A 4HDOA 4MY6A 5DI9B 3WYFB 1X05A 2KCJA 2YVCA 1U5FA 4DX90 3DXEA 1ISNA 2DHIA 2ROVA 2YT1A 5HE3A 2VRWB 3ODOA 2P0HA 3CXBB 2GCLA 1W1HA 1WGUA 4IFSA 4A6KA 2QKLA 2J0KA 3ML4A 2G35A 2R0DA 3RCPA 4HAYB 1W1DA 3GYPA 1M7RA 2IFSA 4CHMA 3WA0A 2ZPYA 1GC7A 3IVFA 2DHJA 2H7EA 2UZRA 3DXDA 2HTHB 1U2BA 4K2OA 4HB0B 2LG1A 3F5RA 1TXDA 1DDWA 3TFMA 3QBVB 4B6HA 1WG7A 4XWXA 2AL6A 1UPRA 1UPQA 1EF1A 3ZVRA 3BJIA 4IOYX 1WVHA 2K2UA 5EFXA 2CODA 2EMSA 1WJ1A 4EKUA 4GMXB 2I5CA 2XQNM 3U8ZA 2UVMA 4Y94A 1BAKA 4NSWA 1Y5OA 1E5WA 1MIZB 3SV1A 1Q67A 1AQCA 2D9YA 2LOXA 2M14A 2YRYA 2P0FA 1LB1A 3V5WA 1M7EA 1X1FA 5GOWB 1FHXA 1J19A 2GCJA 1RRPB 5KCVA 3G9WA 2D9WA 1TQZA 4WSFA 1MAIA 1EAZA 1BWNA 1UEFA 1P6SA 1XODA 2YS1A 4EJNA 1WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKP A;  1J0W A;  4HHV A;  1QQG A;  3QIJ A;  5JP4 A;  2D9V A;  2K00 A;  1V5P A;  1DDM A;  2M38 A;  3D8D A;  2J0J A;  4HB4 B;  2GS0 A;  4TYZ A;  2AEH A;  1XR0 B;  2Z0P A;  4GXB A;  5C79 A;  4KAX B;  4DBB A;  3M1I B;  1U29 A;  3A8Q A;  4HAW B;  2Q13 A;  4HB3 B;  2DTC A;  5JHG A;  1BTK A;  4L6E A;  4PQ0 A;  5JHH A;  2N23 A;  5C5B B;  4C0A A;  2OQB A;  2NMB A;  4GPT B;  2D4Q A;  4KVG B;  2RSG A;  4A6H A;  1UNP A;  1B55 A;  2W2W A;  1FHO A;  1SGH A;  1ZSQ A;  3KSY A;  1XD4 A;  3SNH A;  1FAO A;  4EMO A;  4GN1 A;  2HE7 A;  2FJL A;  5D27 A;  3FSS A;  2ADZ A;  1FHW A;  2R09 A;  1X86 A;  3TCA A;  1ZVR A;  2CRF A;  2DFK A;  1U5E A;  1MKE A;  2OTX A;  5C5B A;  1MPH A;  5DHA B;  3X23 A;  3OAN A;  5LON B;  2Y7B A;  1NU2 A;  3GYO A;  1FGY A;  1FGZ A;  1N3H A;  2YS3 A;  2EJ8 A;  2IYB A;  1GG3 A;  3U7D A;  2ROZ B;  1ZC3 B;  3CIK A;  1DRO A;  2CAY A;  2YT0 A;  3P7Z A;  2DHK A;  3PSC A;  1TJ6 A;  3ZDT A;  5C16 A;  5DIF B;  2D2Q A;  1K5G B;  1V89 A;  2L2I A;  2RNR B;  3VOQ A;  2X18 A;  3ODX A;  3SUZ A;  2LKO A;  1MK9 B;  1V61 A;  3QWM A;  1NTY A;  2Z0O A;  1UNQ A;  4GZU A;  5J3Q A;  2P0D A;  4ZRI A;  2K2J A;  2NZ8 B;  1K5D B;  4A6F B;  1XCG A;  2LOZ A;  2V76 A;  5HE2 A;  4CHJ A;  2RVB B;  2P8V A;  3N7C A;  3FM8 C;  5DH9 B;  2I1K A;  3VIA A;  2COC A;  2QKM A;  4BBK A;  2CY4 A;  1V5M A;  5KQ4 A;  4MT7 A;  4CYE A;  1PFJ A;  2D10 A;  4HB2 B;  3PVL A;  3KRW A;  4A6F A;  1IRS A;  1XX0 A;  1QC6 A;  5J3Y A;  5J3T A;  2COF A;  3D8E A;  4YL8 A;  4MK0 A;  2H7D A;  2YS5 A;  5LOP B;  3SYX A;  2ELA A;  3KY9 A;  2DA0 A;  1KI1 B;  4KHO A;  1P3R A;  3AU4 A;  5FI1 A;  4H8S A;  2MDX A;  2W2X D;  1KZ7 A;  4TKN A;  1H10 A;  5HE1 A;  4F7U P;  2CY5 A;  2GJY A;  1U27 A;  4A5K A;  2RGN B;  1W1G A;  1PLS A;  5CLL B;  1OY2 A;  4K81 A;  1AWE A;  3HW2 B;  1FOE A;  4ZRK A;  3NSU A;  1Z87 A;  1U5G A;  2D11 A;  3P6A A;  2Y8G A;  2J0M A;  3KZ1 A;  1MIX A;  3FEH A;  5FI0 A;  2I5F A;  2BCJ A;  5KQ1 A;  2D9Z A;  1I2H A;  2N0Y A;  2YF0 A;  3D8F A;  2RLO A;  3DXC A;  5D3Y A;  1H4R A;  3HK0 A;  1NI2 A;  4Z2M B;  3MPX A;  1PMS A;  5D3V A;  1XKE A;  1NTV A;  4WJ7 A;  4F7G A;  2D9X A;  2JP2 A;  1X11 A;  4K17 A;  2LUL A;  2L1C A;  2DX1 A;  3LJU X;  2VKI A;  4DXA B;  2J59 M;  3O96 A;  5JLJ B;  4ZRJ A;  1FB8 A;  2I1J A;  3A8P A;  4HAV B;  1I7A A;  3AJ4 A;  1V5U A;  2COA A;  4HAT B;  3PG7 A;  3PZD A;  1DDV A;  4KHA A;  5HE0 A;  1DBH A;  5L81 A;  3PEG A;  2MKR A;  4Z2N A;  2DYQ A;  3ODW A;  1MK7 B;  3TW1 A;  1GC6 A;  2LYD A;  2EMT A;  3KRX A;  1EVH A;  4WVF B;  2DLW A;  2KUP A;  1V88 A;  1UNR A;  2E2X A;  4F7H A;  3PVU A;  1WJM A;  4IAP A;  2DN6 A;  4P7I A;  5CLQ B;  1DYN A;  2ELB A;  4PNK A;  2DX5 A;  3T06 A;  2PZ1 A;  2W2X C;  5D3X A;  2Z0Q A;  3F0W A;  2EC1 A;  1ZC4 B;  3SO6 A;  1OMW A;  2YSZ A;  1EGX A;  4DX8 A;  2RUK B;  2DYN A;  3ULC A;  4NY0 A;  3PVW A;  2UZS A;  4KHB B;  5C6R A;  3ULB A;  4GMV A;  1BTN A;  5DHF B;  1OQN A;  1U5D A;  2KGX B;  4D0N B;  2Y8F A;  2MFQ A;  3TO1 A;  4YON A;  3HQC A;  3AU5 A;  1SHC A;  3UZT A;  4HAX B;  3BIN A;  1X1G A;  3A98 B;  2VSZ A;  1KZG A;  4HAZ B;  1P5T A;  1RJ2 A;  3PP2 A;  2DKQ A;  2MWN B;  3MDB C;  1WI1 A;  4K2P A;  3TVV A;  1LW3 A;  5D3W A;  4HDQ A;  1Y19 B;  4HAU B;  1ZM0 A;  4HDO A;  4MY6 A;  5DI9 B;  3WYF B;  1X05 A;  2KCJ A;  2YVC A;  1U5F A;  4DX9 0;  3DXE A;  1ISN A;  2DHI A;  2ROV A;  2YT1 A;  5HE3 A;  2VRW B;  3ODO A;  2P0H A;  3CXB B;  2GCL A;  1W1H A;  1WGU A;  4IFS A;  4A6K A;  2QKL A;  2J0K A;  3ML4 A;  2G35 A;  2R0D A;  3RCP A;  4HAY B;  1W1D A;  3GYP A;  1M7R A;  2IFS A;  4CHM A;  3WA0 A;  2ZPY A;  1GC7 A;  3IVF A;  2DHJ A;  2H7E A;  2UZR A;  3DXD A;  2HTH B;  1U2B A;  4K2O A;  4HB0 B;  2LG1 A;  3F5R A;  1TXD A;  1DDW A;  3TFM A;  3QBV B;  4B6H A;  1WG7 A;  4XWX A;  2AL6 A;  1UPR A;  1UPQ A;  1EF1 A;  3ZVR A;  3BJI A;  4IOY X;  1WVH A;  2K2U A;  5EFX A;  2COD A;  2EMS A;  1WJ1 A;  4EKU A;  4GMX B;  2I5C A;  2XQN M;  3U8Z A;  2UVM A;  4Y94 A;  1BAK A;  4NSW A;  1Y5O A;  1E5W A;  1MIZ B;  3SV1 A;  1Q67 A;  1AQC A;  2D9Y A;  2LOX A;  2M14 A;  2YRY A;  2P0F A;  1LB1 A;  3V5W A;  1M7E A;  1X1F A;  5GOW B;  1FHX A;  1J19 A;  2GCJ A;  1RRP B;  5KCV A;  3G9W A;  2D9W A;  1TQZ A;  4WSF A;  1MAI A;  1EAZ A;  1BWN A;  1UEF A;  1P6S A;  1XOD A;  2YS1 A;  4EJN A;  1WGQ A; 
#chains in the Genus database with same CATH topology
 2DKP A;  1J0W A;  4HHV A;  1QQG A;  3QIJ A;  2RRF A;  5JP4 A;  2D9V A;  2K00 A;  1V5P A;  1DDM A;  2M38 A;  3D8D A;  2J0J A;  4HB4 B;  2GS0 A;  4TYZ A;  2AEH A;  1XR0 B;  2R2Y A;  2Z0P A;  4GXB A;  5C79 A;  4KAX B;  4DBB A;  3M1I B;  1U29 A;  3A8Q A;  4HAW B;  2Q13 A;  4HB3 B;  2DTC A;  5JHG A;  1BTK A;  2ZKM X;  4L6E A;  4PQ0 A;  5JHH A;  2N23 A;  4OSN A;  5C5B B;  2OQB A;  4C0A A;  2NMB A;  4GPT B;  2D4Q A;  4KVG B;  2RSG A;  4QXA B;  4A6H A;  1UNP A;  1B55 A;  4HSI A;  2W2W A;  1FHO A;  1SGH A;  1ZSQ A;  3KSY A;  1XD4 A;  3SNH A;  1FAO A;  4EMO A;  4GN1 A;  2HE7 A;  2FJL A;  1T77 A;  3FSS A;  5D27 A;  2ADZ A;  1FHW A;  2R09 A;  1X86 A;  3TCA A;  1ZVR A;  2CRF A;  2DFK A;  1U5E A;  1MKE A;  2OTX A;  5C5B A;  1MPH A;  5DHA B;  3X23 A;  3OAN A;  5LON B;  2Y7B A;  1NU2 A;  3GYO A;  1FGY A;  1FGZ A;  1N3H A;  2YS3 A;  2EJ8 A;  2IYB A;  1GG3 A;  3U7D A;  2ROZ B;  1ZC3 B;  3CIK A;  1DRO A;  2CAY A;  2YT0 A;  3P7Z A;  2DHK A;  3PSC A;  1TJ6 A;  3ZDT A;  5C16 A;  5DIF B;  2D2Q A;  1K5G B;  1V89 A;  2L2I A;  2RNR B;  3VOQ A;  2X18 A;  3ODX A;  3SUZ A;  2LKO A;  1MK9 B;  1V61 A;  3QWM A;  1NTY A;  2Z0O A;  1UNQ A;  4GZU A;  5J3Q A;  2P0D A;  4ZRI A;  4QJ5 B;  2K2J A;  2NZ8 B;  3FVC A;  1K5D B;  4A6F B;  1XCG A;  1MI1 A;  2LOZ A;  2V76 A;  5HE2 A;  4CHJ A;  3OHM B;  2RVB B;  2P8V A;  3N7C A;  3FM8 C;  5DH9 B;  2I1K A;  3VIA A;  2COC A;  2QKM A;  3U12 A;  4BBK A;  2CY4 A;  1V5M A;  5KQ4 A;  4MT7 A;  4CYE A;  1PFJ A;  4GOU A;  2D10 A;  4HB2 B;  3PVL A;  3KRW A;  4A6F A;  1IRS A;  4L1R A;  1XX0 A;  1QC6 A;  5J3Y A;  5J3T A;  2COF A;  3D8E A;  4YL8 A;  4MK0 A;  5M4Y B;  2H7D A;  2YS5 A;  5LOP B;  3SYX A;  2ELA A;  2Z4D A;  3KY9 A;  2DA0 A;  1KI1 B;  3NWA A;  4KHO A;  1P3R A;  3AU4 A;  5FI1 A;  4H8S A;  2MDX A;  2W2X D;  1KZ7 A;  4QJ3 B;  1H10 A;  4TKN A;  2Z59 A;  5HE1 A;  4F7U P;  2CY5 A;  2GJY A;  1U27 A;  4A5K A;  2RGN B;  1W1G A;  1PLS A;  5CLL B;  1OY2 A;  2KIE A;  4K81 A;  1AWE A;  3HW2 B;  1FOE A;  4ZRK A;  3NSU A;  1Z87 A;  1U5G A;  2D11 A;  3P6A A;  2Y8G A;  2J0M A;  3KZ1 A;  1MIX A;  3FEH A;  5FI0 A;  2I5F A;  2BCJ A;  5KQ1 A;  2D9Z A;  1I2H A;  4CSQ A;  2N0Y A;  2YF0 A;  3D8F A;  2RLO A;  3DXC A;  5D3Y A;  1H4R A;  3HK0 A;  1NI2 A;  4Z2M B;  3MPX A;  1PMS A;  5D3V A;  1XKE A;  1NTV A;  3HSA A;  4WJ7 A;  4F7G A;  5IRS A;  2D9X A;  2JP2 A;  1X11 A;  4K17 A;  2LUL A;  2L1C A;  2DX1 A;  3LJU X;  2VKI A;  4DXA B;  2J59 M;  3O96 A;  5JLJ B;  3HIE A;  4ZRJ A;  1FB8 A;  2I1J A;  3A8P A;  4HAV B;  1I7A A;  3AJ4 A;  1V5U A;  2COA A;  4HAT B;  3PG7 A;  3PZD A;  1DDV A;  4KHA A;  5HE0 A;  1DBH A;  5L81 A;  3PEG A;  2MKR A;  4Z2N A;  2DYQ A;  3ODW A;  1MK7 B;  3TW1 A;  1GC6 A;  2LYD A;  2EMT A;  3KRX A;  1EVH A;  4WVF B;  2DLW A;  2KUP A;  1V88 A;  3B77 A;  2K8E A;  1UNR A;  2E2X A;  4F7H A;  2KIG A;  1WJM A;  3PVU A;  2DN6 A;  3NWF A;  4IAP A;  4P7I A;  5CLQ B;  1DYN A;  2ELB A;  4PNK A;  2DX5 A;  5LG4 B;  3T06 A;  2GUM A;  2PZ1 A;  2W2X C;  5I2M A;  5D3X A;  2Z0Q A;  3F0W A;  2EC1 A;  1ZC4 B;  3SO6 A;  1OMW A;  2YSZ A;  1EGX A;  4DX8 A;  2RUK B;  2DYN A;  4D6W A;  3ULC A;  4NY0 A;  3PVW A;  2UZS A;  4KHB B;  5C6R A;  3ULB A;  2YT2 A;  4GMV A;  1BTN A;  3NW8 A;  5DHF B;  1OQN A;  1U5D A;  4QJ4 B;  2KGX B;  4D0N B;  2Y8F A;  2MFQ A;  3TO1 A;  4YON A;  3HQC A;  3AU5 A;  1SHC A;  3UZT A;  4HAX B;  4KHB A;  3BIN A;  1X1G A;  3A98 B;  2VSZ A;  1KZG A;  4HAZ B;  1P5T A;  1RJ2 A;  3PP2 A;  2DKQ A;  2MWN B;  3MDB C;  2K49 A;  1WI1 A;  4K2P A;  3TVV A;  1LW3 A;  5D3W A;  4HDQ A;  1Y19 B;  4HAU B;  1ZM0 A;  4HDO A;  4MY6 A;  5DI9 B;  3WYF B;  1X05 A;  2KCJ A;  2YVC A;  1U5F A;  4DX9 0;  3DXE A;  1ISN A;  2DHI A;  2KR0 A;  2FJU B;  2ROV A;  2YT1 A;  5HE3 A;  2VRW B;  3A58 A;  3ODO A;  2P0H A;  3CXB B;  2GCL A;  1W1H A;  1WGU A;  4IFS A;  4A6K A;  3DCX A;  2QKL A;  2J0K A;  3ML4 A;  2G35 A;  2R0D A;  3RCP A;  4HAY B;  4GNK B;  1W1D A;  3GYP A;  1M7R A;  2IFS A;  4CHM A;  3WA0 A;  2ZPY A;  1GC7 A;  3IVF A;  2DHJ A;  2H7E A;  2UZR A;  2NBV A;  3DXD A;  2HTH B;  1U2B A;  4K2O A;  4HB0 B;  2LG1 A;  3F5R A;  1TXD A;  1DDW A;  3TFM A;  3QBV B;  4B6H A;  1WG7 A;  4XWX A;  2AL6 A;  1UPR A;  1UPQ A;  4DIX A;  1EF1 A;  4OT1 A;  3ZVR A;  3BJI A;  4IOY X;  1WVH A;  2K2U A;  5EFX A;  2COD A;  2EMS A;  2KUQ A;  1WJ1 A;  4EKU A;  4GMX B;  2I5C A;  2XQN M;  3U8Z A;  2UVM A;  4Y94 A;  1BAK A;  3NWD A;  4NSW A;  1Y5O A;  2Z14 A;  1E5W A;  1MIZ B;  5I2S A;  3SV1 A;  1ZYI A;  1Q67 A;  1AQC A;  2D9Y A;  2LOX A;  2M14 A;  2Z13 A;  2YRY A;  2P0F A;  1LB1 A;  3V5W A;  1M7E A;  1X1F A;  5GOW B;  1FHX A;  1J19 A;  2GCJ A;  1RRP B;  5KCV A;  3G9W A;  2D9W A;  1TQZ A;  4WSF A;  1MAI A;  1EAZ A;  1BWN A;  1UEF A;  1P6S A;  1XOD A;  2YS1 A;  4EJN A;  1WGQ A; 
#chains in the Genus database with same CATH homology
 2DKP A;  1J0W A;  4HHV A;  1QQG A;  3QIJ A;  5JP4 A;  2D9V A;  2K00 A;  1V5P A;  1DDM A;  2M38 A;  3D8D A;  2J0J A;  4HB4 B;  2GS0 A;  4TYZ A;  2AEH A;  1XR0 B;  2Z0P A;  4GXB A;  5C79 A;  4KAX B;  4DBB A;  3M1I B;  1U29 A;  3A8Q A;  4HAW B;  2Q13 A;  4HB3 B;  2DTC A;  5JHG A;  1BTK A;  4L6E A;  4PQ0 A;  5JHH A;  2N23 A;  5C5B B;  4C0A A;  2OQB A;  2NMB A;  4GPT B;  2D4Q A;  4KVG B;  2RSG A;  4A6H A;  1UNP A;  1B55 A;  2W2W A;  1FHO A;  1SGH A;  1ZSQ A;  3KSY A;  1XD4 A;  3SNH A;  1FAO A;  4EMO A;  4GN1 A;  2HE7 A;  2FJL A;  5D27 A;  3FSS A;  2ADZ A;  1FHW A;  2R09 A;  1X86 A;  3TCA A;  1ZVR A;  2CRF A;  2DFK A;  1U5E A;  1MKE A;  2OTX A;  5C5B A;  1MPH A;  5DHA B;  3X23 A;  3OAN A;  5LON B;  2Y7B A;  1NU2 A;  3GYO A;  1FGY A;  1FGZ A;  1N3H A;  2YS3 A;  2EJ8 A;  2IYB A;  1GG3 A;  3U7D A;  2ROZ B;  1ZC3 B;  3CIK A;  1DRO A;  2CAY A;  2YT0 A;  3P7Z A;  2DHK A;  3PSC A;  1TJ6 A;  3ZDT A;  5C16 A;  5DIF B;  2D2Q A;  1K5G B;  1V89 A;  2L2I A;  2RNR B;  3VOQ A;  2X18 A;  3ODX A;  3SUZ A;  2LKO A;  1MK9 B;  1V61 A;  3QWM A;  1NTY A;  2Z0O A;  1UNQ A;  4GZU A;  5J3Q A;  2P0D A;  4ZRI A;  2K2J A;  2NZ8 B;  1K5D B;  4A6F B;  1XCG A;  2LOZ A;  2V76 A;  5HE2 A;  4CHJ A;  2RVB B;  2P8V A;  3N7C A;  3FM8 C;  5DH9 B;  2I1K A;  3VIA A;  2COC A;  2QKM A;  4BBK A;  2CY4 A;  1V5M A;  5KQ4 A;  4MT7 A;  4CYE A;  1PFJ A;  2D10 A;  4HB2 B;  3PVL A;  3KRW A;  4A6F A;  1IRS A;  1XX0 A;  1QC6 A;  5J3Y A;  5J3T A;  2COF A;  3D8E A;  4YL8 A;  4MK0 A;  2H7D A;  2YS5 A;  5LOP B;  3SYX A;  2ELA A;  3KY9 A;  2DA0 A;  1KI1 B;  4KHO A;  1P3R A;  3AU4 A;  5FI1 A;  4H8S A;  2MDX A;  2W2X D;  1KZ7 A;  4TKN A;  1H10 A;  5HE1 A;  4F7U P;  2CY5 A;  2GJY A;  1U27 A;  4A5K A;  2RGN B;  1W1G A;  1PLS A;  5CLL B;  1OY2 A;  4K81 A;  1AWE A;  3HW2 B;  1FOE A;  4ZRK A;  3NSU A;  1Z87 A;  1U5G A;  2D11 A;  3P6A A;  2Y8G A;  2J0M A;  3KZ1 A;  1MIX A;  3FEH A;  5FI0 A;  2I5F A;  2BCJ A;  5KQ1 A;  2D9Z A;  1I2H A;  2N0Y A;  2YF0 A;  3D8F A;  2RLO A;  3DXC A;  5D3Y A;  1H4R A;  3HK0 A;  1NI2 A;  4Z2M B;  3MPX A;  1PMS A;  5D3V A;  1XKE A;  1NTV A;  4WJ7 A;  4F7G A;  2D9X A;  2JP2 A;  1X11 A;  4K17 A;  2LUL A;  2L1C A;  2DX1 A;  3LJU X;  2VKI A;  4DXA B;  2J59 M;  3O96 A;  5JLJ B;  4ZRJ A;  1FB8 A;  2I1J A;  3A8P A;  4HAV B;  1I7A A;  3AJ4 A;  1V5U A;  2COA A;  4HAT B;  3PG7 A;  3PZD A;  1DDV A;  4KHA A;  5HE0 A;  1DBH A;  5L81 A;  3PEG A;  2MKR A;  4Z2N A;  2DYQ A;  3ODW A;  1MK7 B;  3TW1 A;  1GC6 A;  2LYD A;  2EMT A;  3KRX A;  1EVH A;  4WVF B;  2DLW A;  2KUP A;  1V88 A;  1UNR A;  2E2X A;  4F7H A;  3PVU A;  1WJM A;  4IAP A;  2DN6 A;  4P7I A;  5CLQ B;  1DYN A;  2ELB A;  4PNK A;  2DX5 A;  3T06 A;  2PZ1 A;  2W2X C;  5D3X A;  2Z0Q A;  3F0W A;  2EC1 A;  1ZC4 B;  3SO6 A;  1OMW A;  2YSZ A;  1EGX A;  4DX8 A;  2RUK B;  2DYN A;  3ULC A;  4NY0 A;  3PVW A;  2UZS A;  4KHB B;  5C6R A;  3ULB A;  4GMV A;  1BTN A;  5DHF B;  1OQN A;  1U5D A;  2KGX B;  4D0N B;  2Y8F A;  2MFQ A;  3TO1 A;  4YON A;  3HQC A;  3AU5 A;  1SHC A;  3UZT A;  4HAX B;  3BIN A;  1X1G A;  3A98 B;  2VSZ A;  1KZG A;  4HAZ B;  1P5T A;  1RJ2 A;  3PP2 A;  2DKQ A;  2MWN B;  3MDB C;  1WI1 A;  4K2P A;  3TVV A;  1LW3 A;  5D3W A;  4HDQ A;  1Y19 B;  4HAU B;  1ZM0 A;  4HDO A;  4MY6 A;  5DI9 B;  3WYF B;  1X05 A;  2KCJ A;  2YVC A;  1U5F A;  4DX9 0;  3DXE A;  1ISN A;  2DHI A;  2ROV A;  2YT1 A;  5HE3 A;  2VRW B;  3ODO A;  2P0H A;  3CXB B;  2GCL A;  1W1H A;  1WGU A;  4IFS A;  4A6K A;  2QKL A;  2J0K A;  3ML4 A;  2G35 A;  2R0D A;  3RCP A;  4HAY B;  1W1D A;  3GYP A;  1M7R A;  2IFS A;  4CHM A;  3WA0 A;  2ZPY A;  1GC7 A;  3IVF A;  2DHJ A;  2H7E A;  2UZR A;  3DXD A;  2HTH B;  1U2B A;  4K2O A;  4HB0 B;  2LG1 A;  3F5R A;  1TXD A;  1DDW A;  3TFM A;  3QBV B;  4B6H A;  1WG7 A;  4XWX A;  2AL6 A;  1UPR A;  1UPQ A;  1EF1 A;  3ZVR A;  3BJI A;  4IOY X;  1WVH A;  2K2U A;  5EFX A;  2COD A;  2EMS A;  1WJ1 A;  4EKU A;  4GMX B;  2I5C A;  2XQN M;  3U8Z A;  2UVM A;  4Y94 A;  1BAK A;  4NSW A;  1Y5O A;  1E5W A;  1MIZ B;  3SV1 A;  1Q67 A;  1AQC A;  2D9Y A;  2LOX A;  2M14 A;  2YRY A;  2P0F A;  1LB1 A;  3V5W A;  1M7E A;  1X1F A;  5GOW B;  1FHX A;  1J19 A;  2GCJ A;  1RRP B;  5KCV A;  3G9W A;  2D9W A;  1TQZ A;  4WSF A;  1MAI A;  1EAZ A;  1BWN A;  1UEF A;  1P6S A;  1XOD A;  2YS1 A;  4EJN A;  1WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...