4HAVA

Crystal structure of crm1 inhibitor anguinomycin a in complex with crm1-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
196
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 196
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4havA00
4WAUA 1VG8A 2LKCA 3LD9A 4OI4A 2QT0A 4E22A 4FMDF 3REGA 3W9YA 1BMFD 2ZRBA 1W36D 5C1BA 1C9KA 2FFQA 1U2RA 2VQSA 1IXZA 1PLLA 2R6AA 3O8CA 5F9FA 3MLEA 1UBCA 4IJMA 1UBGA 1GUAA 1N5IA 1Q22A 5D3MA 1ZRHA 4NMMA 1MT0A 1SXJB 3PG5A 2XJ9A 3N70A 3FFBA 4G3XA 2QMUA 4RZ3A 3A1TA 1XDBA 2HUPA 4R71A 3ZS8A 2GJKA 2FEOA 4A0FA 1HT1E 3B8HA 3E70C 2C9OA 2VP2A 1YZNA 2PX0A 1OSNA 3DM5A 3NDBB 4QM7A 3HU3A 221PA 3TAUA 1FP7A 3OFND 4LBYA 1XD2B 1R8SA 3I72A 3GJ0A 4IDQA 3OESA 4PPQA 1AS0A 2OG2A 4JZKA 1TMKA 2OFOA 1XB2A 3T5DA 2D74A 1N6PA 4TN1A 2Z6VA 2GZDA 2W2TA 2WJVA 3LBIA 3QPWA 2IEZA 3FE2A 4GZMA 3SYNA 1M7GA 3QG5A 1V5WA 5L3VA 4XOIA 4OQFA 2JLUA 1WBBA 2Q0HA 4DT1A 1U0JA 4M9QA 3THYB 3K0AB 3SI7A 1QHSA 1TEVA 4KYIB 3GJ4A 1XEXB 3I3SR 3P27A 4O25A 1UFQA 1ZM9A 3VNVA 2J7KA 4HB0A 3GFPA 4B3DA 2FFHA 1NBME 2J1LA 3ZVNA 3FPAA 1UADA 1ONBA 3RYTC 1XU4A 4WZ6A 3QENA 1DOAA 1S1CA 4JMPA 4LYHA 5KU1A 2GBLA 3I5YA 1YR7A 1Z0AA 4GZLA 2C9YA 4XVRA 2QTVB 3LBNA 3GEIA 3Q9LA 4AK9A 1PLJA 2NO6A 1RFLA 3TRFA 3IBYA 1ZNWA 3QKTA 4KYUA 1KMHB 1BIFA 1E32A 5CB8A 4GP6A 3HYRA 3NHAA 4PSAA 1YHNA 3VKGA 1UPTA 5EXTA 3R9WA 5L8VA 3C15C 4D0LB 4D0NA 3BBPA 3TKLA 2ZU6A 1N25A 1HE1C 5EE9A 1DAGA 2FPLA 2GJ9A 2RGNA 1RZ3A 1UBEA 2QRZA 5JEDA 3WXMA 2PT7A 2Q3FA 1II9A 4TTRA 3BC1A 5AUPB 1KDTA 3B13B 4OHWA 1D9ZA 3PCRB 4KV9A 4RD2A 4Q7MB 1DAEA 1E96A 1PLKA 1E2JA 2ZE5A 1T3LA 2FWRA 3AVPA 1W5TA 3AQ4A 1OXUA 3EIHA 3LDAA 5C18A 2IUTA 1JQLB 3C7KA 1D2MA 4ZI2A 2ZJBA 2OBMA 1M2OB 2X19A 3PEYA 3B5JA 2IYTA 5IK2D 2Y8EA 3QVUA 2O8BA 1BO6A 3KTAA 4M8NE 1TPZA 3OEHA 4HB2A 2GJAA 2EYQA 2ANBA 2W6IA 4FCVA 4B74A 1XMIA 1Z6TA 4MKGA 4U5XA 1G3UA 2CLCX 2CNWA 3BB4A 1Z08A 4PSVA 3TW8B 4BLPA 5JFGA 4PANA 1E79A 1I4TD 1SVMA 2IXFA 1RRGA 2QTFA 4DVGA 1CEEA 2RGAA 3JVUA 1F2TA 4P4SB 1NN0A 2XNDD 4B43A 2FJUA 2DWPA 4GPTA 3A1VA 1S0UA 3DZDA 3V4FA 1TTTA 1TX4B 2G1KA 4I81A 2VF8A 4TQUS 2CL7X 1W36B 2WTUA 2W6JA 4C7OB 1JI0A 1TF2A 4N3NA 1ZCAA 1BKDR 2A9KA 2BJWA 3THOA 1GKUB 5FL7A 3RLFA 2MMGA 2C8VA 3CONA 2OAP1 4ARZA 1XXHB 5L3QA 1JALA 3IILA 1KDPA 3DEFA 3MCAA 4YMWA 1JBKA 2Z83A 2PH1A 4IFEA 2XJ4A 5DI3B 1YZUA 2ZVQX 3UK6A 2GF9A 4M0LA 2JLRA 1U99A 4K81B 4OHXA 5JHHB 3THXA 1IN5A 1G8YA 1ZBDA 3F5FA 1G6HA 2ZRKA 4M1KA 1R0WA 2GXUA 3K0SA 4PO1A 1LW7A 2ZRGA 4DB4A 3RRYA 3SQWA 2O8EB 1XEWY 1XTQA 4KVAA 3GEEA 5SZIA 2ZRLA 3GLIE 1G1MA 5JI3E 1AGPA 1WRBA 1IXSB 4LI0A 1I2MA 1E9AA 2JASA 4QBHA 4F7WA 5BN4A 1WMSA 3X1DA 1P2UA 3VX3A 3MAAC 4LBZA 3H1TA 2H16A 2ZSDA 4HYYA 5CB6A 3TH5A 1N6NA 1KJZA 2WKRA 2WPDD 3ADKA 4XSHA 2XTNA 3FHCB 2BKUA 4KBFA 5JZVA 1G17A 2O0HA 1KZGB 3PEUA 4LRWA 1IQPA 1HE8B 2WSSA 1AGRA 2MSEB 2ZI4A 4W9MC 5DIFA 4AWXA 4DEYA 1OYWA 3LLUA 4IEIA 1ETUA 1I2DA 1T5LA 2QI9C 1ZINA 3P20A 5J4HA 4WZAE 4DKXA 3CX7A 3AF2A 2PCJA 1VMAA 4MRNA 4GOXA 2YWGA 3A4MA 4R2IA 1E2FA 3W3AA 3P4YA 2CL0X 2CHGA 2WSMA 4A82A 5BYKA 1KJYA 1ZC4A 2ZE6A 3ASZA 1IXRC 1U9IC 4BPBA 3EA0A 4BASA 4BFYA 5FOSA 1NF3A 4PC3A 2HT6A 2OFWA 4HLUA 3AVQA 2FOLA 4TZ6A 4RD3A 2IS2A 3W34A 2IYYA 5BW8A 2J9RA 2FH5B 1R0ZA 3Q7QA 3RS2A 4F92B 4UXHA 5KYKA 3R20A 2GTPA 2WOJA 4Q4LA 2ATVA 3GQBA 3RAPR 1TADA 2LWIA 2ZVPX 2CE7A 3ICQB 4AURA 2AD5A 2CL6X 4HDOB 1NG9A 1CTQA 2JLYA 1Q1QA 2JA1A 2BM1A 2IS1A 2PEYA 4A6XA 2NQ2C 3LQRA 1DAFA 3O8DA 3R9XA 1OT3A 2JEOA 4NDZA 3CNLA 3TSWA 2WV9A 1N6OA 2XNSA 4OI0A 4KLNA 2UVQA 4RKEA 5EXSA 2KWIA 1Z5ZA 3RANA 5JSZA 5JWHA 3FMPB 4JLMA 1NY5A 4FI3C 4Q5IA 2G0TA 1OH8A 2L0XA 3LO5A 4O3MA 3ZYCA 4OYHA 2D3WA 2V6IA 4V0ME 3OE7D 1X1SA 4MKFA 1KYIA 3EXAA 4HZUB 4HATA 2JLWA 4LK2A 2GEUA 4D25A 4MH0R 2VIIA 2WWGA 2XOKD 4ESHA 2HCBA 2VSOA 4HB4A 3BH0A 3QUSA 4C0QC 2QAGA 4W5WA 2ZRDA 1E2QA 1ODFA 3W8NA 3L0IB 4K8OA 2E9SA 4D4KA 2OFXA 2DFTA 4OHVA 4URYR 2C77A 4WBSA 3AVYA 2V55B 3QEOA 1N5KA 3ZD6A 1KO1A 1RW4A 1Z29A 1Z6YA 2GJ8A 2XSZD 3KKQA 4XH9B 2V8OA 1EX7A 2Z4RA 1C4OA 3UG7A 4TLEA 3N2IA 4EUNA 1GAJA 3GLHE 3PV0A 4JLPA 4JVMA 3R7WB 4EFMA 1KI8A 2VSFA 621PA 2VPPA 2RHDA 4FINA 2RB4A 4W5JA 2CMKA 4DLRA 1FQJA 4Q1DA 1H8EA 1SVIA 2Z0MA 2P6NA 1KAGA 1MRSA 4V03A 1DEKA 5P21A 1SHZA 4PZZA 3W3ZB 2IYXA 3I92A 4M1TA 4UJ5A 1RC8A 3CZPA 4ZIRB 2R8RA 5K8TA 4KFTA 1Z0IA 1KDRA 1MO4A 3EZ2A 3W5JA 4ASUA 1QVRA 2AWNA 2QU8A 2FGKA 3GJ5A 5TB5A 4A4DA 1NIJA 4I99A 1EESA 1Z0KA 1ZM7A 1FZQA 3I1FA 3CNNA 2BV3A 4KJZA 1JEEA 2NGRA 3ASYA 1YZTA 1WQ1R 2VP5A 3C5CA 1NN5A 2X2EA 1NVUQ 1QHXA 3Q5DA 4Q9JA 4ESVA 4NYMR 1DG3A 1J2JA 3ZLJA 2DFLA 3SFVA 5KNBA 1KKMA 2AWOA 1SVKA 3AKYA 2GCOB 4CEHA 2CLDX 4NYIQ 4TTPA 3NH6A 4BECA 4BLQA 2VL7A 1DVRA 2B7BA 4LJ4A 3QJYA 2V1UA 3C41J 2F7SA 2DPXA 2IHBA 3CWQA 1NKSA 2OAQ1 4C4PA 1XXHE 2GZHA 4CEIA 1P2TA 4JT2A 2OCPA 2F9MA 5E4FA 4F91B 2WWYA 3MFYA 1Z06A 4B47A 4BLTA 1G41A 4MUBA 4B3FX 1XTIA 3IIMA 3X1ZA 1QG4A 1E69A 1GL7A 1XZPA 4ZKDA 2BBTA 1EFRD 2QQ0A 4H9GA 1AJEA 2E87A 1ZNYA 4PC1A 3M6AA 4YXWD 3A1SA 3FB4A 1CLUA 3SDZA 3THWA 5JJLA 5B57C 3A37A 5CDFE 3SBEA 2A3RA 1NBMA 2MSCB 1OH7A 3HYTA 2H8KA 2BMEA 1ZD9A 2IEYA 2BCJQ 2XTZA 1PJRA 2C98A 4FWIB 5B30A 2ZI3A 4LZZA 5JS7A 821PA 2GBLC 2GF0A 2ZS8A 1XEFA 2NPFA 5CYPA 1E2LA 3UANA 2ASEA 3RWMB 2IYRA 4QL3A 5DGXA 4Q9LA 4C0BA 3AVTA 3TR0A 4EPWA 2ZUBA 4TT3A 4AKHA 1B23P 1LF0A 1MRNA 1W0KA 4L4UA 3ONWA 4M9ZA 1XRJA 3DOFA 1IY2A 4Y0VA 1OH5A 5EXXA 4JSTA 3UMFA 4CF7A 4C2UA 1UJ2A 2HJGA 5AJZA 2NO0A 4LJ7A 4EQ6A 3U60B 4A36A 1XTKA 4PAQA 3ZZTA 2BHRA 3TUJC 3CRQA 1E0JA 1TQ6A 2FNAA 4PXAA 1XWIA 1EFUA 4OHYA 1QHYA 5FOTA 3IBGA 1OJLA 3KXIA 3T34A 4IOJA 1T8UA 3ICEA 3U3JA 4FCTA 521PA 2WJIA 3BWDD 4B33A 1E2GA 1GP2A 2A78A 2FPKA 2CJWA 2KB0A 3I4LA 5FR2A 4A15A 3EX7C 4IOMA 4RD0A 2QZ4A 3K70C 2ECKA 2GDJA 4ZO4A 3VTKA 3BB1A 3U6KA 3O8RA 1Q1BA 2D7DA 1N0UA 3VR3A 3CO5A 3ZIAD 4LYJA 5FOVA 1E2DA 4LBWA 1NKTA 1PZNA 3K0FB 1ZUIA 2SHKA 1OHHA 3WMGA 3OAAD 1IOZA 3NH9A 2ZYUX 4KFUA 4POAA 4U02A 3T5GA 2CEAA 2G77B 1YE8A 3BXZA 3VR2A 2QGNA 5DI9A 1ZM4A 3W6PA 3VU9B 4GRAA 4LHWA 2EWVA 4Q1BA 3TAHA 5B58C 4DDWA 4FW9A 3K9HA 1CR4A 1YU9A 2MMCA 2I1VB 4TL9A 3BGWA 3KFVA 4Q19A 1T3HA 1SHKA 1UKZA 3FVQA 1ESMA 4DSNA 4F4IA 3AVVA 2B92A 2GVDC 1F3OA 5DLQC 1E9DA 5JBQA 4RZUA 4KODA 4Q1FA 1R4AA 4ZI3A 1XCPA 2IK8A 2AL7A 4IXNA 4PC7A 1OE0A 1XP8A 3TGPA 3IIJA 5A5GA 5TVKA 2GXAA 3L43A 2ZRHA 3B1YA 4QHTA 3ZVLA 1OFUX 4BFUA 2F1JA 2WVJA 1DADA 4KFRA 4RSGA 1AN0A 3PXGA 3W5IA 1QZXA 5EP4A 1GL6A 3AVUA 2IF2A 4V0KA 4R2HA 2QMOA 4DLVA 2GWHA 4BLOA 1S1MA 3OHMA 3GLIA 4EPRA 5KSOA 3U7FB 3EARA 1IJEA 4XIGS 4JJZA 2REOA 2CLSA 1R5OA 5FI1B 2QP4A 5DYGA 4OK6A 1MO5A 1GZSA 2D7CA 3D7MA 5DE3A 1YJ5A 1K5GA 2KBFA 4MYTA 4GDFA 4Q00A 1UKEA 1TU3A 4HAWA 4E07A 2R2AA 2WKPA 1EK0A 1SULA 2WKQA 4L8GA 1Z47A 4LJ5A 1R6BX 5KPDA 1W5SA 3QKRB 1NIPA 2XITA 2ZR0A 4LV8B 1S9DA 1G64A 4PPFA 5E7IA 4B32A 3QF4B 1FNMA 2ZRPA 3F3YA 3MWKA 1CBUA 1AA9A 1OXSC 2IXGA 2FGJA 3IHLA 5AR1A 4EJSB 2FE4A 2EYUA 2IWHA 5HCIA 1NNEA 2IW3A 1XD2A 2VBCA 3CNOA 1OKKA 2H18A 3OEEA 4TLCA 2ODBA 3DOEA 3VX4A 4Q4AA 1XTRA 4JBWA 4DLYA 3A1UA 4A0GA 4RFSB 3LWNA 3KXLA 3NBYC 4HLCA 4HLUC 4D80A 4OHZA 4G5GA 4Q4HB 2H1LA 1CRPA 2FA9A 2R9VA 4I1VA 1N6KA 1VHTA 5FTJA 4FD2A 2DCUA 2MSDB 1F48A 3THYA 3K0AA 3X1XA 4C0JA 1XEXA 4IHQA 4B3BA 3B82A 1T6NA 1JJ7A 4JLAA 1TF5A 5G3YA 5KSZA 1FQKA 3ADCA 4GOKA 1HURA 1E2EA 4LHVA 1IAQA 3C8UA 2QE7A 3W90A 3KKOA 1E98A 4MUAA 3GPLA 3KB2A 1KK3A 1PUJA 3B1ZA 3U3RA 1LY1A 3LVRE 3KJEA 1Z3IX 1KMHA 4RFVA 3WNCA 4V0MA 2GEDA 4EFLA 4Z8XA 2X77A 4G5SA 3WHLA 4XSGA 4IDNA 2KJQA 2B7CA 2ZXUA 4IFBA 3T12A 2YVUA 4WW0A 5K8LA 3QIAA 3B1WA 3CR7A 2I4IA 1R5NA 4X8LA 4B76A 1CJTC 3GJ6A 3ND8A 4DJTA 2BC9A 3W8RA 1KO8A 4KLZA 3V4RA 1VCMA 4IEEA 2KI5A 1G9XA 2QAGC 4BQSA 4P31A 1BOFA 1X8LA 5HPYB 4HDCA 4UJ3A 1R7RA 1QVAA 2HJVA 3TBKA 4CGZA 3I62A 2PEZA 4B3GA 2A2ZA 3AM1A 3PUWA 1GOTA 4Q03A 5FI0B 4LHZA 5KUTA 2HXSA 1JPNA 1Y3AA 3GLHA 1MH1A 3WRXC 2PT5A 2O8FB 1E2HA 3DPUA 4AKIA 3CZQA 2XXAB 3ECCA 2QENA 2QROA 3F8TA 5AJXA 2DYKA 4Q02A 2BIFA 3CBQA 5FBVB 2JJ2D 4G01B 3DM9B 2QL6A 4DSUA 3V00A 4QJ3A 1DO2A 1NL3A 2BJVA 3TQFA 4CEJB 1D5CA 4Z1MA 2D06A 1JAIA 2FEMA 2FMXA 4UNSA 4WIAA 3NEYA 3UG6A 1PV4A 1CR1A 3ZH9B 4A9AA 1G3MA 2ZRFA 4GBMA 2QAJA 4E5UA 1L2TA 4TMZA 3GLGB 5GADl 4P4SA 1U8ZA 1VKJA 2AKAB 4HUTA 2OILA 1JECA 2IYUA 4CT5A 4BEBA 2ZJAA 3A36A 1EFCA 1KI1A 1ESNA 2O8DB 4EAQA 3NBXX 1P62B 1YR8A 1S3GA 1S4QA 4PQYA 1XBTA 2QP3A 4KCGA 3VMFA 1Z2AA 4JLBA 1Q21A 3SYKA 3FHTA 1AQYA 4DCSA 3BH6A 2G88A 4JJKA 1OB2A 3P32A 1ZP6A 2VHTA 3L82B 4F4JA 1YR6A 2ONKA 3NWJA 2PLFA 5HZHA 1XMJA 1JPJA 1XXHA 1A82A 4NU0A 3K70D 1Z6GA 3MSXA 1W48A 3BJIC 4A2WA 3OEHD 1P73A 2F3RA 2W6ID 2WICA 2WM9B 1FTSA 3KL4A 3RC3A 2AFHE 3SHWA 1W4BA 3U4QB 4P3YA 3FYHA 2AN9A 2PJZA 3MD0A 2Q3HA 2RAPA 2IA5A 1Z28A 1U81A 4Q7KA 3RRZA 4EIWA 3EWSA 1AQUA 1YQTA 2VHCA 5HE9A 1A1VA 3EC2A 2IX3A 4XVQA 3DKPA 5CDFA 5CIQA 1H65A 5J40A 2O8EA 1UEIA 2REBA 5SZJA 4M9XA 5G40A 4R98A 5KNDA 2LCFA 3FDIA 1BYUA 3SR0A 4LWZA 2F55A 1CU1A 1VCNA 3E5HA 1Q3HA 2OLKA 2B8TA 4XWKA 2XB4A 1NVVQ 4TSFA 1KI9A 2R65A 5CK4A 5EE0A 4MRRA 1N6IA 2OUKA 2W6JD 2N1BA 3G0HA 4M1OA 1WB9A 1ZUHA 5FL7D 3ZVRA 1XNJA 2B6HA 2WMOB 1Z2CA 5F98A 4AG6A 5J4VA 4LJYA 2GEVA 3BIFA 5FUWA 1AM4D 3L2OB 4U00A 1W2HA 5H68A 2YNMA 5HKKA 1A2BA 1G8GA 1II8B 1KIMA 2C03A 2P65A 1VG1A 4TQAA 3B60A 2J3EA 3NC0C 4C2TA 3Q72A 2ZS7A 4MYCA 3U44B 3IO3A 4QBFA 1RPZA 3WBKA 5JRZA 1UAAA 1XD9A 1YZGA 1J8YF 1S96A 2QUZA 1KSGA 1XCMA 2ZJZA 4DEXA 2QMEA 3NXSA 2ODEA 2PX3A 3QEJA 2OCYC 2ZRIA 1LNZA 1QHIA 3CH4B 4KHZA 4R7ZA 3Q8XB 4JYBA 1G8HA 1W46A 3GFTA 1KJWA 5GJWC 3AGQA 2XZOA 1CJMA 3TLXA 1QG2A 2IF0A 2WJJA 4F4CA 2IHYA 5JJKA 1G18A 3P26A 2Q6TA 1YZKA 5FUXA 4BFXA 3GLFB 4B2PA 3VFDA 1X8JA 1VYUA 2FFAA 3P1JA 4AYXA 2JLXA 3TSZA 4AIIA 1GRQA 1WA5A 3FTQA 3CW2A 2ZETA 1ZM2A 5AUNB 4QKQA 4QNMA 1VG0B 2FZLA 1O87A 2IYZA 3I61A 1CJUC 2QM7A 1UKVY 3REFA 3UIEA 4G5OA 2YZ2A 2GKSA 5JRJA 3AVOA 1UKYA 5IF9A 1GWNA 4ON9A 1ZU4A 3QXJA 4LOAA 1E9FA 3A4LA 4P0TA 4HLDA 4JLNA 2JGNA 4LYFA 4TMXA 3WMEA 3EPJA 4MRVA 3B9PA 3B2EA 4HZUA 5TY0A 4B6FA 1DO0A 2NG1A 3A58B 3B78A 4FMCB 4P4UA 3HPRA 2XGJA 4BWYA 1Q44A 1NVWQ 1RRCA 3EA5A 2N46A 2NIPA 2PBRA 2PZFA 1US8B 1OLOA 2P3SA 1OYYA 4CIDA 1U94A 1YZQA 5C2JB 2D62A 1NN1A 2R6DA 1VDZA 2QPOA 1XTSA 1OV4A 3CB4A 4LJAA 3SFZA 1OPXA 1RYFA 2IYQA 3QE0A 4DCUA 4RVCA 4V0NA 3EPHA 2ERYA 4AI6A 2IYWA 3OF5A 3K9LA 1ZC3A 1SXJE 1COWA 4NCJA 1P60A 4R9UC 5CJ2A 5DN6A 1EWQA 5IRCD 3K0EA 5EE1A 4ZCMA 2XZPA 4G5RA 2YWEA 2G0NA 3CPHA 4L9WA 3UXMA 4OJKA 3R7WA 3L0OA 3CUEF 2W0SA 4CT4B 4PR0A 3EIEA 5JI2E 2WJHA 2G3YA 3R9IA 2JLSA 1W49A 3LBHA 4I4LA 4B44A 1VG9B 3QI2A 3TNFA 4ZIRA 1IM2A 2J7PA 2OO7A 1ZVQA 2ZREA 3GCGA 3TUIC 2ZM5A 3BE4A 4D26A 3GLGE 3ZQ6A 1MABB 2QG6A 3MWJA 1X3SA 3QKUA 3K9GA 4CW7A 4MDEA 5JWRA 3LFUA 2CDNA 2OLJA 2WWXA 4MKHA 1SXJC 1OW3B 1R5BA 5C4GB 1YKSA 5FTNA 2ZJYA 5BYJA 3H86A 4AG5A 3RSLA 1UF9A 4MQBA 2GCOA 1Q0UA 2ZI5A 2GK6A 4LBVA 4NCHA 3WP1B 4AYWA 4DIEA 1TF7A 3AKDA 1MO3A 4KU4A 3X2SA 3GJ7A 3SE0A 4HAVA 4BE7B 1A5TA 1E2NA 1YRBA 4BGDA 3KXKA 4KITB 3RC8A 2AK3A 1IN4A 1RYHA 4IXMA 1SVWA 2WPDA 1G7SA 2GK7A 3I8SA 4IOKA 1ZIPA 3AGPA 1NP6A 2EFDB 1G8FA 4QGHA 1QF9A 1JEDA 2OXRA 1JNYA 4BZQA 3NKVA 2QT1A 1SKQA 3GEHA 1G5PA 1T0HB 4QGFA 4QBGB 3T1VA 2YKGA 4OI1A 1AK2A 3PUZA 4KSBA 2TMKA 3FMOB 1IY0A 2W0MA 4ASUD 5FPYA 3IGFA 4JVNA 5FR1A 4YONB 2ONJA 1EWRA 3AVXA 3WYGA 4Q47A 1XPUA 1RJ9B 1Z6XA 1PVOA 2JIZD 2X1VA 4O2RA 3HJNA 1JR3E 1Z83A 2WBLC 4YLGA 4BEJA 1L4UA 1GG2A 2O8CB 2C04A 4HUQA 2H17A 3QG1A 1BS1A 2OHFA 1IJFA 3CKLA 1R2QA 3K0CA 3DMDA 2OEPA 4MGYR 4BLRA 5HE8A 4UKDA 1G3QA 3D6TB 2E1RA 2F43A 2AX4A 1E0KA 3MJRA 4K46A 1FUKA 1UDWA 4MITA 4IDHA 1NI3A 2ZJ8A 5FTLA 1P3JA 1OH6A 2W2XA 4KBGA 1P2SA 1N6RA 3EC1A 4Q01A 3B1XA 3WRYC 4IOLA 2C78A 4LPKA 2FX3A 1G21E 3HWSA 1L7VC 2AHOA 5G41A 5FPKA 4ERNA 5AJVB 1U8YA 1HT2E 1NBMD 2CBZA 4G5QA 2Q3MA 2XZLA 3PENA 4BZXA 2BEKA 3QKSB 3FWYA 3UKDA 4B34A 5C4MA 3KQUA 4EPYA 4DWJA 3Q7PA 1K6MA 3QXCA 3CRW1 1EGAA 4D0GA 2XTMA 4A2QA 5CM8B 2EFHB 3LX5A 2EFGA 1F2UB 4B3CA 1YR9A 1BH2A 3SNHA 2FU5C 2ZSFA 4A6PA 3GLFE 4PHGA 4TT3D 4RKFA 4D81A 1H8HD 2D2FA 3CLVA 3ZZ0A 1W0KD 2PCLA 4TLAA 2NOAA 2G6BA 5ANRB 3DKVA 2A5YB 3U3MA 4UQOA 1U90A 1TL7C 2XB2A 2Z5FA 4M1SA 1DTSA 5DSZA 1XMSA 1TEXA 4Q4JA 4V02A 1W7AA 1VYTA 3Q5EA 2BBWA 5E95A 3I32A 4LPSA 4OI2A 4Q66C 3QSYA 3L0SA 2V7QA 3WYFA 1W0JA 3L8ZA 4J0QA 4KAXA 1G4UR 2Z43A 2RMKA 4PSKA 5KTYA 2PMKA 5TXGA 2P6RA 1E0SA 1XMVA 3VU9A 5GVSA 3KQKA 2A5DA 2ERXA 4W7SA 2VYFA 1EXMA 2W83A 5BWMA 4PX9A 4WZBE 2DY1A 2EWWA 2BDTA 1FUUA 4Q7JB 1W36C 3A8TA 4JIMA 5CJPA 1T91A 4LHXA 2JLVA 2QBYB 3EZ6A 1NLFA 2OESA 1FFHA 1C1YA 1QHHB 4B2LA 2AK2A 4NCNA 2DR3A 1NY6A 5J5CA 1Z0DA 4H1UA 1QBKC 1NMZA 1RKBA 1XCGB 4HB3A 2CVHA 2VHJA 1P5ZB 1NMYA 4EDHA 4PC2A 5CITA 1OFIA 4Q1AA 4QBIA 1D6JA 3T35A 3GJ8A 5L3SB 4XJXA 4FMDB 4HAUA 2ZE7A 4JKYA 5AJWA 2J5XA 1CIPA 1N6LA 2QMHA 3MG9A 3G82C 2GZAA 1HTWA 4A1FA 1OXVA 3QVVA 4QJ5A 4C9BA 1IN8A 3A1WA 5IT5A 3HR8A 4PFSA 1KTVA 4NYJQ 2J0SA 3KZ1E 5EP1A 1EFRA 1G16A 2RGDA 2XX3A 4TZ0A 1TUIA 1XF9A 4HSEA 4YDSA 4NL4H 4QHSA 1W4RA 3EWAA 1P6XA 2GA8A 2BMDA 3DL0A 1ZW6A 1ZYUA 5EE3A 4C0KA 2PJRA 2A7QA 3QKRA 3WY9A 2G9NA 3V9PA 4DUGA 1FOEB 3AF0A 3RSOA 1J7KA 2NO7A 3TVDA 2P0EA 2R62A 2QSYA 3QF4A 3FFAA 1MO6A 2ZJ5A 3WNDA 3CH5A 4CVNA 2DWQA 4EJSA 4Q1CA 4ZCLA 4JLJA 2HT1A 1WE2A 2R6CA 3AF4A 1G7RA 2O0JA 3LY5A 1M6NA 3IIKA 3LLMA 2VTKA 1MKYA 4HAYA 4RFSA 3RS4A 1EFTA 2FN4A 2QEQA 1N3BA 1XJQA 3CM0A 2QRNA 1Q3TA 2P5TB 5JEEA 1U8AA 4Q4HA 5GJBA 1GKYA 1E1RA 4BRUA 2JDID 2H5EA 4YQFA 5FPHA 5DNYB 1AS3A 1KI6B 3SJCA 1I4DD 1KK1A 3EZ7A 3VHXA 3DDCA 5FBLB 1G19A 2VSXA 1CF4A 1LVGA 2NPIA 2V3CC 2YYZA 3QXSA 4MKIA 2JJ1A 5EP2A 2FSIA 3B9QA 4B48A 5LDDC 4NYIR 2HYIC 1LV7A 3PUYA 3VNUA 5DYIA 4Z51A 3PJRA 4X8HA 1Q57A 2W00A 4LC0A 1LFDB 4UXIA 4TLDA 3C5HA 4NZYA 1KHTA 1WDTA 1OKKD 2FF7A 3L0PA 3OEED 4GOJA 4WOPA 2XEXA 3SEAA 1DAHA 1EG7A 1JJVA 2DFKB 2IUUA 3GD7A 4M2LA 1J99A 1AZSC 1A2KC 2HF8A 5JCZA 4JLDA 2O0KA 2F3TA 3D8BA 2ZYVX 2GVZC 4XD7A 4NKRA 2BWJA 2A5FA 2NMVA 1CS4C 2V4ZA 2V6JA 3AUYA 5KSYA 1GRRA 2ZSBA 2C9CA 1P9RA 2DB3A 3RS7A 3OZXA 4QG7A 2P67A 3LVQE 2FSHA 3BERA 2JJ8A 3PIRA 3SBDA 4QC2A 2VP0A 3SU8A 1KO7A 1HV8A 1SXJA 4JL5A 1Q1EA 2EVWX 4Z54A 1P75A 3KUDA 5E3HA 3T1OA 1G3RA 4KXFB 3CF2A 2RGEA 4AYTA 4ZCIA 3KFXA 4EPXA 2VHUA 1M34E 1R8QA 2QE7D 1P7CA 2AXPA 1IY1A 2O8FA 4A8JB 2ORWA 1XEWX 2FPMA 2J0UB 2P5SA 2BVNA 2Q9CA 2UZIR 1E2IA 2Z4SA 3F0TA 5TDHA 3S1AB 2PL3A 4JT4A 2XXAA 1NG1A 2CCKA 1ZJ6A 3EIQA 4NE2A 3FGNA 3PR1A 2HDNB 2WZQA 5J4KA 1DBSA 5K8UA 3K09A 2X2FA 2RGGA 2QGZA 1KDOA 4CRWB 3EG5A 4JYCA 2FG5A 3GLGA 1VCIA 4GI7A 1RE0A 1T5IA 2ZYWX 1HA3A 3MWLA 4LHYA 1CP2A 2ZJOA 2W2VA 2GHIA 4Z8YA 1E94E 2ZE8A 2EU8A 4L9SA 4RY2A 3FMIA 3K53A 3IEVA 2O8DA 3LX8A 1DPFA 2VRWA 2OT3B 3LH5A 2O5VA 4L16A 1RIFA 1S8FA 2VHQA 1GL9B 2ZI6A 1PUIA 1Q1ZA 4LGMA 3RHFA 3NHBA 5FBRB 1UM8A 3IDQA 2YWFA 4DC9A 1GNRA 3NBFA 4RZXA 2OV2A 3C14C 4MGZR 1MOZA 1Q12A 2WIBA 3C16C 2GETA 4LYAA 3VAAA 2FSGA 2QQEA 4BFZA 1MR3F 5KOYA 1CXZA 3NIBA 4B71A 1VIYA 4US1R 1GIAA 4ACBA 5CLLA 3ZZUA 3D31A 3U4QA 1NJGA 1N5JA 2QPAA 3QPVA 4C0AC 3U2QA 4Z1MD 1LF5A 2IYSA 3SOPA 2HLDA 1CR0A 1J90A 2J41A 5LB4A 3X1YA 5LPNA 2CE2X 2H7VA 5A0FA 3RDPA 3FKSA 3FOZA 4MA4A 2JLZA 3AP2A 1E1QA 1SKYB 1VIAA 2GXSA 1Z8FA 5FBQB 3BH7A 2CCGA 1ZU5A 1JR3A 4PC6A 3RVBA 3ZGXA 4AC9A 3QXHA 1X8KA 4X8MA 1ZD8A 2CHQA 4Q21A 1E2PA 3H84A 4OK5A 3MMPA 4ZDJA 1JQJC 3FKQA 1I4LD 4NPHA 4OQLA 1LS6A 2IUSA 3IQXA 3U7HB 3ZVMA 3MUFA 2ODNA 3LV8A 4TMWA 3AKEA 4JKIA 3N5CA 5SZKB 1Z0JA 1ZMXA 3K0CC 5FPSA 3QXXA 5GJVC 5KDLA 4URXR 2OXCA 2ZU0C 4ZPXA 1LB1B 5JECA 2NO1A 1KI4A 4IW3B 3CR8A 4M9SA 1ANKA 2WIAA 4FXPA 1OF1A 4JS0A 1T3SA 4BFWA 4B73A 4Q9KA 2BCGY 2F1RA 1II8A 1P72A 2GRJA 1AKEA 2PLRA 4XTRA 3QF7A 4QNRA 4G0NA 4MGIR 2F9LA 2K5UA 2HF9A 1T4GA 3U44A 2VO1A 2EFCB 1FX0B 2CK3A 2VP6A 2GJSA 1YVDA 2OBNA 2C5LA 2WWWA 4BRWA 4FMBB 4Q4AB 5F3WB 2ZI9A 2OCAA 5FOXA 1HYQA 2ZUDA 1BMFA 4PHHA 4C7OA 4TSFD 1WCV1 1KZ7B 2ZSAA 1EFHA 3TE6A 5FBWB 3HU1A 3EZFA 3KKPA 5AJYA 3GLFA 1IN7A 2RH5A 4BFSA 3IUYA 3SQXA 2PMDA 3Q85A 2YJTD 5B64A 5FFMA 4L5BA 1LS1A 3LA6A 1E0AA 4TYNA 4L15A 5DI3A 3ZD7A 2N42A 2C95A 2CNWD 1E9RA 1D2NA 2IYVA 3KUCA 1VECA 4KI0A 3UMSA 1E79D 2WAYA 2WOOA 1NSFA 4WVFA 1VTKA 4D82A 5AWFC 5HKKD 2QP9X 4N1AA 5GVRA 4DSTA 4ZDKA 5TV2A 1KI3A 1XJCA 3OFNA 6Q21A 4MYUA 5JWOA 4HDQB 2ZEJA 1RVDA 3BFVA 4PZLA 2W58A 3CRVA 2JJ2A 3GJ3A 1XTJA 5JJIA 3U5ZB 3QY0A 3OIVA 4I1UA 4C0LA 3CWZA 3RWOA 2Q9BA 4XWOA 2YV5A 3CRRA 3JZAA 3G5UA 4UNQA 2GCPA 5BN3A 1JR6A 2YINC 3KKNA 5M04A 1K5DA 3C4JA 2ORVA 4AY2A 1US8A 4XVUA 1XFAA 1GM5A 1KNXA 1X86B 3E1SA 3AB3A 3MRSA 2ZR9A 3VR1A 5JCPA 4JLKA 4HI0E 4HAXA 4IVRA 2ZSEA 2GAAA 3UMRA 5D3MB 4URZR 3IHWA 2A5GA 3AH8A 3VR6A 4E03A 1GILA 4ACAA 4DZZA 5G53C 4ABYA 3H2YA 3KJGA 4IVQA 5TMPA 1JXMA 2ZAOA 3TMKA 4E09A 4X8OA 4YMTA 5JS8A 2ZAMA 2QNRA 5DISB 1HEIA 3CF6R 3GLHB 2BBOA 1LTQA 1P9NA 3T1TA 5BQ5A 4HZIA 1P9WA 1SQ5A 3PUXA 1DG1G 4URUR 1L8QA 3AF3A 4DCVA 3HPQA 2IL1A 3U3OA 1W44A 3J81k 3M1IA 3WHKA 2IBMA 1T0JB 4PO8A 5EP3A 3T15A 5J4LA 3RS3A 1VPLA 3N2EA 3SJBA 3GP8A 1MABA 3MWYW 4JLOA 1FMJA 1E2KA 1QHGA 1X6VA 3GMTA 3TVTA 4DT1B 5KHOC 1R10A 4QGGA 1CJKC 3IQWA 3EPLA 4AKGA 3K9NA 3FHOA 4IRUB 1G8PA 3LNCA 5FOWA 4W5HA 1WP9A 2WSSD 4NCIA 4PPNA 1COWD 3VR5A 1W4AA 4LV5B 3NBZC 5DN6D 1D2EA 3AV0B 3QBVA 4A8JC 1KY3A 4EJSC 3VKHA 1ZD1A 1W2GA 5IK2A 2VLIA 2WWHA 2G83A 4DLTA 3K8YA 2NZ8A 4ZKEA 5LD2B 4GL2A 5L3RA 3T1QA 4DSOA 2ZROA 1W1WA 2WJGA 4PHTA 2WMNB 3A4NA 2DHRA 1FPMA 4O0MA 4GNKA 3DO6A 2O52A 1ZIOA 2JCSA 4S35A 2DFNA 2OE2A 3BFKA 1E3MA 3PEVA 2J7PD 1HQCA 1G20E 1FP6A 2XNDA 4NHOA 2QTHA 1DAMA 3MJHA 1RJ9A 3UWKA 4I1SA 4Q7LA 4GT1A 4O2LA 1SKYE 1OIVA 1JXOA 5FOUA 3QBTA 4RCYA 3QNUA 5H70A 4CDGA 3I5XA 4LX0A 2VA8A 1S2MA 1OXXK 5EUMA 4NBSA 2FFBA 2NZJA 4B6EA 4EPTA 2O8CA 3B85A 3LW8A 1SGWA 4V0OA 1XJ0A 2I1QA 3PITA 2BMJA 3PQCA 4NYMQ 4QRHA 2P6UA 1KSFX 3KQNA 5AUQA 2F1IA 4FIDA 4OKSA 4DB2A 5JMTA 3M0EA 3QOFA 5J47A 2ZTSA 3FMFA 4Q1EA 4OK3A 2OZEA 4MRSA 3I8XA 3K70B 2O8BB 3CPEA 1M74A 4H1VA 2CVFA 3KTAB 4JVSB 5DHAA 2IWRA 4IVPA 2JLQA 4DCNA 4NONA 3SN6A 1OXTA 3L8YA 3KQLA 1KK2A 5EUQB 2R6GA 5JHGB 3ETLA 3BD9A 4EFNA 3CIOA 4C30A 5EE5B 5J4YA 4BFVA 2C2HA 2F6RA 3DHWC 4P32A 4EPVA 5KDDA 4MDFA 1GFIA 4OJQA 2VP9A 2J45A 1E4YA 4YMVA 1F2TB 4DLWA 4PO9A 5SZHB 3ND9A 2ZANA 1NRJB 4WXRA 3RNLA 4NP6A 3TR5A 3QKSA 1KSHA 4TYYA 1GTVA 1R0XA 1CRQA 1KI7A 1NVVR 1XPOA 1ZCBA 4TL8A 2IS6A 4QXAA 2ZR7A 2OBLA 1XZQA 2VF7A 2WWIA 4DLSA 2IXEA 4ZDIA 4RD4A 1E2MA 3UWOA 3SHFA 1GVNB 2HCJB 2JAQA 1F2UA 1ZNXA 1A4RA 4HEJA 1OFHA 2CXXA 2ZQ5A 1SVSA 3DZ8A 1ZM3A 4TYWA 4KO8A 3TK1A 4F93B 4PPGA 5E7JA 5AK0A 4WA7A 4ARZB 5L3QB 1FL9A 1M7HA 3K09C 2PZGA 1T9HA 3ZS9A 1H8ED 3BRWD 3TSOA 2ZUCA 1W4CA 1E99A 4YMSA 3O47A 4P33A 5HTKA 121PA 2YOHA 5EZ5A 5F9HA 3U61B 1NLZA 2Q21A 3NC1C 4G1UC 3THXB 2UZ3A 4RJLA 1U0LA 1IHUA 1N5LA 4WXPA 2IYLD 4OBEA 4TLBA 1KGDA 4MGKR 3BB3A 2BM0A 8OHMA 421PA 2FSFA 5KSPA 2FZ4A 3RABA 1AZTA 2YOFA 3B1VA 3BK7A 5B2ZA 1NSTA 2R6FA 1G291 4NH0A 5FTKA 4ZV4A 4YDHB 5A4JA 1SVOA 3CPJB 5EJEA 1UDXA 4NCKA 1AS2A 3ADDA 1E9BA 2A30A 2GESA 2QBYA 4DBLC 5F2EA 1Z0FA 4LUCA 3OIYA 3UPUA 3AP3A 4MYHA 1QHHA 1N6HA 5KNCA 5LB2A 3SJZA 5LBIA 3EAQA 1XPRA 4FCWA 2J0VA 3DVLA 3CRMA 2CHVA 1T8TA 1KNQA 5D3QA 4A2PA 1M8PA 2HYDA 4BFTA 4PAMA 1Z07A 4D6PA 2GILA 3BORA 4FN5A 4UXJA 4LJ9A 3PFIA 3D3QA 3KKMA 4PZYA 5G3ZA 4QGAA 3WBJA 1F60A 1KOFA 1SVLA 2ZS9A 1ELOA 2BMFA 3EW9A 5L3SA 1AIPA 4GSYA 4GMDA 1P4SA 4US0R 3BS4A 2V7QD 1WXQA 1W0JD 4Q9IA 4EKDA 4M1YA 5K8IA 2V1XA 3RRNA 3OE7A 4GMXA 4DCTA 1DAKA 2RHMA 5DHFA 2NO9A 1XX6A 2OSBA 1G4AE 1QHNA 4A0RA 5EZ6B 3TQCA 3O8BA 2C96A 2XOKA 2Q9AA 2H57A 2V9PA 3E2IA 4JLVA 3TW4A 3DMNA 1DARA 2QN6A 4C0SA 1GNPA 3X1WA 2JIZA 4UNRA 1GDDA 5CIWA 5CM9C 1IBRA 4IDPA 4IDOA 2ZJ2A 2XSZA 4DXAA 3KX2A 2ORIA 2IS4A 3K0FA 2IT1A 1CULC 1NJFA 3IPYA 4OQNA 3HP1A 1HY3A 2ZIAA 2UKDA 2I3BA 5HCNA 1HQYE 4JSYA 1E6CA 1KSJA 4QFMA 5FH9A 5JSZB 2QY9A 3GFOA 3TJZA 3U3KA 4F38A 1W47A 1JB1A 3U7EB 4II7A 1G7TA 2KE5A 1ZNZA 4DLUA 1YZLA 4NTZA 4RCZA 3QQ5A 4TMKA 2CCJA 5EQTA 2FDCA 3AVWA 4D4JA 1Z63A 3SC3A 1KY2A 1KI6A 1GRNA 5DO9A 5FUVA 1D9XA 2P2LA 3SYLA 4QM6A 2QM8A 3HU2A 1FNNA 4M4SA 4FMCF 3U6BA 3TUZC 1Q20A 1Z22A 4YMUA 1RRPA 1E9SA 2QAGB 3CX6A 4JBYA 2WWFA 3RRMA 4IKEA 2REXB 2D2EA 2F1HA 3TIFA 4DUGD 2GAOA 1NVXQ 1XD8A 1WBDA 2J46A 4DDUA 4HUQB 4JL6A 3JVVA 4LV6A 4BUJA 2YOGA 1YRAA 1OHHD 2YHSA 2BBSA 3W6OA 3LXXA 1II0A 2V54A 2AD1A 5LD2C 3P4XA 3IO5A 3AP1A 1P61B 5IDVA 4GFDA 4OL0A 1H8HA 2YC4C 3NDPA 1OB5A 1GNQA 5CYOA 2ANCA 2F43B 2ZPTX 3WNBA 3EPKA 2ZITA 4KSCA 4D4MA 2ZRCA 4BZPA 1K8RA 1MV5A 1X1RA 4Y0AA 4PQFA 3VR4A 2KSQA 3EASA 4UNNA 3GJXC 5DH9A 1E1RD 4TL6A 5ELXA 2X8AA 4QHYA 3SS8A 2OM2A 4YXWA 1N0VC 4OQMA 3SZRA 3VKWA 2RGNC 5JLJA 5BN5A 1OIXA 1U0HC 5KPJA 1Z6AA 4M1WA 1B0UA 4TL7A 5E7MA 4OQXA 1QRAA 5IHPA 2JJ1D 3IEUA 4LSGA 1GSIA 1E9CA 5UKDA 4LJ8A 3UATA 4BLSA 4HAZA 4A8JA 3WP0A 2AFIE 2J0UA 3S1AA 4CEHB 3B7GA 3KJHA 3LQQA 2EW1A 4PHFA 4I1OA 1KK0A 3NTUA 4DLZA 4B2IA 3BAFA 1F5NA 2EQBA 2VP4A 3H0KA 3OIWA 1UEJA 2VEDA 3I73A 2ZYTX 4DDTA 1NN3A 1IONA 4LJ6A 2YC2C 4PAOA 2RKOA 2B21A 4CEIB 2G1JA 4GP7A 1WF3A 3KJIA 4QOSA 3ZJYA 2GNOA 1KKLA 5C46F 2OCBA 2XAUA 2ODWA 2VH5R 1CKEA 3JZMA 4URWR 1KAOA 1QDEA 1FW6A 721PA 2DBYA 1ZAKA 3IPXA 1S3SA 2QPTA 4XD7D 3T06B 3KB1A 4A0HA 4XTCS 4Q4JB 4TTQA 3HDTA 4DRZA 3RS0A 1UBFA 2D4HA 4TMVA 4M1MA 3THWB 1GITA 1DE0A 4ZDWA 2C99A 1DS6A 2YWHA 1F6BA 1SXJD 4M22A 2KBEA 4Q48A 3VQTA 4M21A 5HZKA 4C3ZA 1GKIA 1OFTA 5BXQC 1N0WA 1G7CA 4Q18A 2AR7A 3KQHA 4A92A 2RGXA 1R0YA 2HEIA 2AXNA 5KDOA 5CLQA 3AEZA 1E4VA 4URVR 1TQ2A 1TU4A 4TWZA 5GJCA 3T61A 5AUOB 2FV8A 4U7DA 4HLQB 3B6EA 4PTLA 1OIWA 3ZIAA 2A5JA 3EZ9A 1TUEA 2HV8A 1ZUNB 4S2EA 1BYIA 4ILEA 4JBXA 3AUXA 4B75A 4TYPA 3R8FA 3ZQJA 2GCNA 4MRPA 3KDSE 4EQ6B 3LRPA 4RZ2A 3PEWA 3RS5A 4DDVA 1V43A 3M4YA 3OAAA 1KO5A 1SZPA 4M53A 4CZ2A 3A6PC 2QORA 1FTNA 4JL8A 1CJVC 4D2IA 4XWAA 2LKDA 4AD8A 2B8WA 4ITRC 4LCBA 5HR5A 1U9IA 2QA5A 3Q3JB 4PQRA 1G6OA 2ZRJA 1E9EA 1G5RA 3K1JA 1TQDA 3IKJA 2ZRMA 1DELA 3AF1A 1NLYA 4P4TA 2QSZA 4KVGA 2JDIA 2BOVA 2WJYA 3SJAA 4QJ4A 1D8TA 4N0DA 5EXPA 1U98A 2CJWB 3OIUA 3W6NA 4KFSA 3ZDQA 4YC7A 4US2R 2GXQA 2R44A 1N2CE 2HXYA 4CEJA 4LDJA 1M7BA 3NVAA 5FPTA 4DHEA 3WYAA 3ADBA 2IC5A 4Q9HA 5KO2A 3VHLB 1J8MF 2EFEB 1VYVA 3BFXA 2RCNA 4JVLA 1M1YE 4B35A 4RD1A 2HLDD 3WMFA 1FX0A 1L4YA 1EX6A 5FL3A 2J59A 1G3IA 1DAIA 1TQ4A 3FKSD 4DIDA 3NG1A 2ATXA 1E1QD 2AKYA 1S9HA 3MGCA 2PZEA 1NMXA 4B3XA 1JR3D 3BOSA 3QPUA 2NTYC 4TQ9A 3R8CA 5FTMA 2JATA 4C0HA 1IN6A 4NYJR 3U7GA 4FWTA 2RGBA 3HR7A 4TMTA 4D4LA 3AKCA 4AKEA 5TARA 1A7JA 5H8WA 3NEJA 2H92A 1RRFA 1O3YA 4CYMA 2J87A 1G5TA 1AKYA 5CK5A 1CR2A 1P2VA 3PUVA 1VCOA 2BEJA 4LC1A 5H1YA 2DWOA 5FUYA 4LY6A 1HH4A 1KI2A 1J70A 4DLXA 1VHLA 3CX8A 2J0QA 2WAXA 3LW7A 2WHXA 3CF0A 3LXRA 1KMQA 2ZRAA 1TAGA 3LAWA 4TYQA 1JAHA 4N0EA 2CK3D 2ZI7A 3PVSA 1HUQA 2BKEA 3H4MA 2RGCA 1KO4A 1TNDA 3GLIB 4UNPA 4RD6A 2ZRNA 4V0LA 1Y63A 1FMLA
chains in the Genus database with same CATH superfamily
1LK7A 2QJTA 1VG8A 1GR0A 2LKCA 3C7CB 3D6VA 3F97A 1Q2UA 2JGFA 3GZ4A 4K2HA 4QPJC 4LXIA 4RL6A 4E22A 2V5AA 2PSJA 1D2AA 1WUHS 5BT8A 1U2RA 4NZOA 5FWAA 3EW7A 1IXZA 1MW9X 2R6AA 1F12A 4AWXA 3I83A 1LTHR 3LL4A 5FHQA 2R79A 3CLKA 5F9FA 1LX7A 3FDFA 4JA0A 4IJMA 2O7NA 5E2BA 5HRAA 1I4OA 2K2WA 2Y66A 1H4TA 3BQNB 1DXQA 5JPCA 1ZRHA 2VK2A 3ZBTA 1SXJB 4ILKA 3N70A 3HCRA 3P0EA 1C2YA 2QMUA 4MCJA 6PFKA 3D8NA 3U7RA 1DKMA 1XDBA 3A1TA 1LRJA 2GJKA 1F0NA 2FEOA 1Y82A 2JFZA 2YIDA 2PKQP 4AY4A 1LPBB 2C9OA 4G0MA 4C4TA 2V6MA 1PR3A 3DZFA 1KFEB 2Z8YA 3EOBI 4QM7A 3C3CA 1Y6ZA 2FZ5A 3HU3A 3PGJA 4JQOA 1FP7A 3TAUA 4G4JA 4GIBA 5MN4A 2UUBB 5DM70 2HL6A 2VJLA 2E4YA 3GJ0A 3OESA 3RAGA 1N77A 5CVTA 3OZUA 2I2CA 1N6PA 3RU2A 3STXA 1QG0A 4HTFA 1U63A 2B69A 3SYNA 1FMTA 3JTEA 1UBMS 5E1DA 3G8BA 2FOXA 2O06A 4U7HA 2FSSA 4N3BA 2JLUA 4G37A 5B7NA 3LVBA 4YJFA 4BS9A 5DXAA 3M8KA 2Q0HA 1PR5A 4Y7DA 4FIZA 4M9QA 4F8JA 3U3DA 3FOWA 4KYIB 2DQKA 3GJ4A 2WUFA 5ICGA 3I3SR 4UUAA 1C3VA 3P27A 2QOEA 1UFQA 1RJGA 1S2LA 2M9MA 3ZDDA 3WJ7A 4BMZA 1E64A 4HGPA 3ZTWA 5CA0B 2F1OA 1UADA 2YHBA 3F3KA 4HWOA 3DKKA 4B5LA 4YJDA 1LDEA 1JDBC 1LZLA 2C4WA 3VVLA 3RU7A 1XMXA 1LDMA 3I52A 2GBLA 2MSLA 2WYWA 2ACKA 1UCFA 4ZT6A 3I5YA 1Z0AA 2Q6OA 5C3MA 1JS1X 2AC7A 1CQIB 1IG3A 2QTVB 3EEFA 3LBNA 3L79A 3Q9LA 3ROTA 3OMLA 3UC9A 1M0EA 2BFCA 3A6JA 4E6PA 1FFYA 3MXOA 4LXHA 3UFXA 5F12A 3TRFA 4EENA 5TGZA 1EWYA 3QKTA 4YRNA 2NZWA 3IV7A 3KJFA 1I0ZA 3KKEA 3L8MA 1PZFA 4I6EA 1C2TA 4IG9A 3AHGA 2QD2A 4AMBA 1YHNA 4F7DA 2WZBA 4W63A 3PQEA 1P3Y1 4UULA 3M6VA 3H9QA 2R7AA 4INZA 1A7AA 4D0NA 1GGVA 1Z33A 3CZMA 3K5HA 3BZUA 5BMVF 1N25A 3GRKA 4ED9A 2AYXA 1HE1C 2BHSA 1DAGA 3D59A 1NVFA 1TCAA 3OQOA 2NUTA 3AEQA 5AKLA 4E5YA 5TQVA 4I14A 2Y9PB 1PWEA 1ZK4A 4TTRA 1SH7A 3ELUA 4HDMA 1HDZA 1D9ZA 1ZH2A 1YMVA 4I66A 5E6RA 1E2JA 1T3LA 3AVPA 1KQPA 1W5TA 1GUDA 3EIHA 3LDAA 1GSAA 3VR5D 3C7KA 1JQLB 5JQWA 5JO0A 1NI4A 2OBMA 1ULTA 2IE0A 1DOZA 2X19A 3WYBA 4GH5A 3B5JA 3ETGA 5DX1A 2O8BA 3CR3C 2D0PB 4MUKA 3OEHA 2XBUA 2EYQA 4UFOA 5ENZA 4IJVA 3I09A 4NESA 1Q0ZA 4A8TA 4DLKA 1JE1A 1G3UA 3ORHA 3QEBZ 2CNWA 4B8YA 4E4YA 4IL5A 1TTHA 3TW8B 1DFIA 2I4OA 3QLUA 1EP3B 4ID9A 2VS1A 5F4ZA 3VISA 2G71A 4FOSA 4EW1A 2A3NA 4Q3CA 1IYZA 2IXFA 2NPOA 3G5TA 2DT8A 5EHNA 1XZFA 2CDAA 2Z58A 3DAGA 1O96B 1Z56C 3W8FA 3EGXA 1X39A 4JGIA 4HK4A 4FFLA 2FJUA 3EC7A 4UBLA 3RK1A 3STWA 2QRLA 4EEXA 3PWSA 3A1VA 3CVYA 2AEEA 1Q95A 1S0UA 3OCVA 4AQDA 2VP3A 5K20A 4BJHB 3OQVA 4EI2A 1N5MA 3HRHA 1DAOA 3DEZA 5AW3A 4QWMA 2FMHA 1P39A 3TEJA 4TQUS 3SYTA 5CLHA 2IX9A 1W36B 1JI0A 1RM0A 1ZCAA 4DIFA 1ESEA 2CXHA 3QUBA 3G8YA 4RVHA 5FIUA 2YXEA 2AOWA 4MR7A 3M6MD 3RLFA 5FL7A 2AUTA 3CX4A 2P7IA 2NQTA 4FDVA 5T7BA 2MMGA 1VJ0A 2C8VA 2OAP1 3ZZNA 4CM9A 1XXHB 1JIKA 4OKIA 1JALA 3HJTA 5BSVA 4WLFA 4DBZA 1NP7A 1KDPA 2R60A 1NYTA 3C70A 1E6KA 4OIFA 4L2IB 4AMUA 5FX2A 4IFEA 2X6TA 2XJ4A 2XQGA 3E18A 4W1QA 5DI3B 4CDRA 5EHZA 2AOVA 4LCEA 3ZDEA 4BJ6A 3QEMA 4CHGA 2PZBA 3EY9A 2GF9A 4PW0A 3BDVA 1EB8A 2FG7C 3PYMA 4M0LA 3UK6A 1U99A 2D5BA 2XMPA 4BBZA 1A9PA 5JHHB 2BGWA 1W5AA 1ZBDA 2B0JA 4N54A 1L6RA 5I3ZA 5LXTB 2ZRKA 1M10A 2J4FA 1EH5A 1NPYA 4BP1A 5BVGB 4UC0A 2ZUSA 3N76A 4C4AA 3A26A 3CT6A 4WFQA 1CY0A 2ZTHA 1XEWY 3H5OA 4OJYA 3GBPA 5A9RA 4Y1RB 2IYEA 2QI9F 3GEEA 4MEAA 5JT1A 3GLIE 4X3PA 5JI3E 4LI0A 1WRBA 1IXSB 2I8CA 5FEMA 1I2MA 3P2KA 4QBHA 4HQFA 4WZBB 5KYXB 1AU9A 1XSEA 2I4NA 4D57A 1N75A 1P2UA 3VX3A 1V37A 2YZMA 1DJMA 3UY4A 3VXKA 2YWDA 3H1TA 1HDGO 4H08A 4MYRA 5EWMB 1DI0A 1XWFA 3NHZA 4GC5A 6GPBA 5I7SA 2J8ZA 4LOHA 5EJ4A 3GRZA 1N6NA 1KJZA 4XSHA 5AO9A 3TH5A 4EO7A 4DMRA 1QGOA 3PSHA 4HPXB 2BKUA 1TK9A 1MJFA 1G17A 3PHHA 3DBVO 4PAWA 2O0HA 5BUZA 4I1PA 1KZGB 3PEUA 2GMWA 1NJ1A 4U6QA 1IQPA 3Q1LA 1AZWA 2P62A 2ZTVA 1AGRA 2MSEB 3CURA 3PXBA 3R41A 3QUTA 4K6OA 4Y67A 5DIFA 1EQAA 1OYWA 4QU5A 3T7RA 2WNHA 5B2EA 4NLLA 2JNWA 2O2IA 3PXCX 2QI9C 1ZINA 2V58A 2FSVC 4ZCPA 5BNFA 1ZX1A 1U9ZA 5K0LA 3M5CA 3AF2A 2BR3A 1FTGA 3HVKA 1N7HA 2A1TR 4CMEC 3GIDA 1C3JA 4YJ3B 2H5LA 3D02A 1CUCA 3DBLB 8ADHA 2F90A 3ASZA 5DNAA 2Y93A 4N7MA 1U7HA 4O4IB 1IMJA 4BASA 3M4ZA 4PGHA 3OPQA 3TRIA 5JS6A 3EFOB 2GERA 3BRCA 4HN4B 4HLUA 1Q0HA 2E5WA 2LZ0A 2FOLA 2R1TB 3AVQA 3AW8A 3AY6A 2OM6A 3CUYA 3EN0A 4JEMA 5AI0A 4Z5XA 5TIIA 2C58A 2J9RA 4FFPA 1R4NA 1RPJA 5TMDA 2FH5B 4FYWA 5JCXA 5CW2A 3NNNA 2VPZA 4IGKA 3RS2A 5CVCA 3R20A 1RP7A 1YS9A 1EJ0A 4TWAA 3QX7A 4JQYA 4Q4LA 1N2CA 1WWKA 2A5LA 2ATVA 3ME5A 5EEHA 1TADA 2LWIA 4RFLA 5C32A 4O2BF 1KYQA 1UBLS 5KJEA 2D5LA 1EK1A 5JR3A 1JWLA 1USWA 4RV9A 3ICQB 3DEHA 5JW6A 2PGXA 2QVCA 3KO8A 1LQ2A 1UK8A 2JA1A 5TSDA 2PEYA 2NQ2C 1JJAA 2DPLA 1YAJA 1PL7A 4M7PA 2FZCA 4NDZA 1L5OA 4KPFC 2XNSA 4GKJB 4KLNA 5I6DA 5EXSA 2KWIA 3PL1A 3RANA 5JSZA 1PVVA 1HI9A 1BXGB 2ZK7A 4JLMA 5C0OE 4Z7NB 5KTPA 5KREA 3I8OA 3W04A 3GUVA 4RPCA 4TV8A 1SB9A 2CN1A 3IMKA 5IT4A 1HF3A 1X1QA 1USUA 2VBIA 3CXRA 3VNAA 1MAVA 1CE8A 3O90A 5TEWA 2JLWA 2DUUA 3GT4A 4HMQA 4D25A 1QKKA 2AYZA 4DC1A 2VFAA 5LQSA 1UR5A 4P54A 3WL4A 3BHMA 3U7QA 5CDTA 2XOKD 1GG9A 3SS7X 1HE5A 2FB9A 2HCBA 3CN9A 4L3WA 2VSOA 4UMFA 2PZAA 3WIVA 4FNMA 4BLUA 1W1IA 2C2WA 4W5WA 3VH3A 2I4MA 4NAUA 1ST2A 1YAHA 2Q41A 2PLNA 3NGMA 2CWDA 4LXTA 5BV2P 4W5OA 2IDKA 1C80A 3MGKA 3IAHA 4D4KA 1OVMA 2DFTA 2OFXA 1JEQA 4K6MA 5AKIA 2C77A 2R6R1 2ZT8A 3WDMA 1SG0A 1T15A 2QD3A 2V55B 3ZD6A 1XCJA 3KCNA 1KO1A 1RW4A 1YD7A 2GJ8A 2MJLA 4W7HA 4J07A 1E66A 1PQ4A 4JODA 2H06A 2FRDC 2QNIA 4R2MA 2V7EA 2R87A 3AC0A 3WRXA 1C4OA 1VGQA 3N2IA 4TLEA 1Y3CE 2VC2B 4ODIA 4EUNA 2AOUA 1KVQA 4JVMA 3R7WB 4GO1A 1RVV1 4MW6A 4OH1A 5I4BA 2VSFA 4OLBA 5AUOB 5BW4A 4AP9A 3PGA1 3R3ZA 3ZWKA 2O1XA 3VC3A 1FQJA 4ZMBA 4Q1DA 1H8EA 2H1FA 1EJ6A 2I29A 2MINB 2Z0MA 3I30X 5HS6A 5ES4B 4V03A 5K3FB 2EERA 3CLSC 1Y1RA 1K7CA 1L8XA 1SKUA 5P21A 4I9FA 1C7FA 4UJ5A 2FP4A 1K08A 4MX8A 1YB6A 1RAAA 3HA5A 4NARA 4DTIA 3BILA 3T7AA 3WIBA 3A3YA 5EPUA 4ASUA 2XDWA 2AWNA 4L50A 3GJ5A 5TB5A 3V2GA 5K0CA 1PBNA 1Z0KA 1E3IA 1FZQA 1Z17A 2B99A 1FDUA 3CW9A 3QWIA 3SQNA 1Z45A 5A04A 3N8GA 4F06A 2JVJA 4ZK6A 5JROA 3C5CA 2X2EA 1NVUQ 1QHXA 2YFYA 3MAJA 4Q9JA 3DSRA 3OECA 1KS9A 1DG3A 2J07A 1J2JA 3DCIA 4NYMR 3EH1A 4DAEA 4UM9D 1DIHA 1CSEE 4XFKA 1D1PA 1XMOB 4DXHA 4BLQA 1VHDA 2XYQA 1DVRA 2HLPA 3OZDA 3QJYA 3LTNC 3ENQA 4P53A 4YCBA 1T9CA 2CLIB 2W8BA 2PSHA 3OZ7A 1XRPA 3KM0A 4JP3A 1ZISA 4FHCA 4RVNA 1XXHE 1GGMA 1GPDG 2I6FA 5DCLA 4ZVQA 1MTZA 3FW1A 1PAUA 3HXLA 4MVJD 1PJ3A 2PS1A 1QH1A 4CKXA 4K3UA 5K0ZA 2VQ6A 1MORA 1QFJA 4LMAA 2Q4TA 4N65A 3BL5A 1VJ1A 2C1XA 4ZZ2A 2C84A 1RZVA 3LP8A 1LI4A 1XTIA 1NMSA 1ZIDA 3IIMA 4MUBA 4BXOB 1IK4A 1W88B 2PD6A 1GGNA 2HR1A 4DMLA 2QQ0A 1BMTA 1H6AA 3D0RA 4O8CA 5EMNA 4CMKA 5F7OA 1OBHA 1XNRB 1K98A 1ZGCA 1X2EA 5LMUB 4BEWA 4LYGA 4NWIA 3ZQ4A 2BZ1A 1CLUA 5CYFA 3IE2A 1UPXA 1QV7A 5JJLA 3E7WA 3TLAA 2JJYA 2B4KA 4X65B 1OH7A 5DU2A 2K4MA 3IDOA 1LJLA 2VLBA 5C1PA 2H8KA 1C0PA 2XVZA 2IIVA 4P7KA 1ZD9A 2IEYA 1P1IA 3CVJA 4RLQA 2BCJQ 3DW3X 1RYMA 4KE8A 1PJRA 2C98A 1DQNA 4DF3A 1YH3A 4IDDA 3TS1A 3K1ZA 1XQXA 1Z5NA 2ZVJA 1YDEA 1NF8A 3RS8A 3OLWA 3CCFA 5DGXA 4Q9LA 3AVTA 2EQ5A 3TR0A 1QS0A 2ZUBA 1B23P 1ZLYA 4FQ8A 4M9ZA 4Y0VA 5EXXA 4JSTA 4C2UA 3FDZB 4UREA 2BTQA 2PRYA 5K3CA 4CF7A 5IF9A 5JZBA 1YCDA 3AESB 3GROA 3QLVC 4LJ7A 3SKXA 4EQ6A 1Y6JA 4G0ZA 2QJRA 1T34A 3P94A 2BHRA 1MIOA 2V96A 5SV2A 3P2OA 4IY1A 1SOUA 2O2JA 1GCAA 1F6WA 3IUQA 3AFIA 1TQ6A 3P19A 2P3QA 1XWIA 1E3SA 1FCJA 1QHYA 4O08A 4XKJA 5FOTA 4WJZA 1U5CA 3BJEA 1QVZA 1JHUA 4MVJG 1T8UA 3F9RA 3F3MA 1G8MA 2VK1A 2OAGA 2A9OA 3K1AA 3QSGA 4KNWA 3K5WA 1LVUA 1I3LA 3T9FA 5HEKA 2FZWA 4XYBA 2ZJ6A 4H6PA 1JW9B 4OAQA 5FR2A 1J2UA 2QR2A 2QN1A 2GH1A 3KK0A 4RXTA 4X62B 3U9SA 4NH4A 3DZGA 4PVDA 4AZ0A 5L4NA 2D7DA 5D3KA 5F3DA 5E2AA 3CO5A 2OP0A 3FNFA 1V96A 2ACWA 4ITVA 2XMGA 2Z2XA 4R31A 5DTMA 3ZN2A 5CBPA 1E2DA 3ML1A 1NKTA 3H2JA 1CUIA 2G7MC 4ZWNA 4R1TA 4C07A 5IDQA 1HYBA 1DV2A 2JH9A 3K0FB 1AA6A 1ZUIA 1LDYA 4NV1A 1OHHA 1W4ZA 1Y7TA 3GZTB 1K3UB 1E3LA 4ZVNA 4YQYA 3OAAD 2ZYUX 3HA7A 4U02A 3T5GA 3UJ9A 2XVMA 1CB7A 2H1WA 3CT4A 4U2CA 1QB7A 5AJUA 4L3OA 3BXZA 3HE3A 1Y0BA 3TLJA 2QGNA 5JD4A 3GG2A 1EIZA 3VU9B 1ND6A 1TO6A 3EOZA 4LHWA 3GJSA 4B6GA 1P1HA 3UENA 1UOPA 3C5WP 4S1PA 3MTBA 1T4MA 3TTWA 5SYAA 4TL9A 1J1IA 2DSNA 3JV7A 5I7RA 3FVQA 4DSNA 1ESMA 2ZYGA 3RVDA 2GVDC 2OKGA 3HA3A 3LQYA 4QBTA 2P6MA 3U31A 4RZUA 3HVIA 4KHPB 1Y8AA 1C1DA 1FP2A 4MARA 2ZGVA 3AEKB 4D0RA 2FQWA 1PD1A 4ZI3A 3K6SA 5F1PA 5HNKA 3JAWA 1O4VA 2IK8A 4YWHA 3PX7A 1WU7A 5HDBB 3RHZA 4BQQA 2GA9A 4Z9BA 5A5GA 4FEEA 2VDLB 3B6ZA 3ZDYB 2CBXA 3I64A 3L43A 2ET6A 3VSBA 2HIAA 4G07A 1WSWA 4BX9A 5HJ7A 3U4CA 1DADA 3FLEA 4DKJA 3SZGA 4RSGA 3PXGA 4C22A 2QTMA 4CMEA 2FEWB 5DOVA 3C1AA 1A71A 2PPVA 4R2HA 4E12A 3KSBC 4DLVA 3C6YA 4XQEA 3RIGA 3ZK9A 3AHCA 4BDTA 2EF0A 5T67A 5EFZA 3QW4B 2CXUA 5JNWA 1E1YA 1KDYA 2GO1A 1NQ5A 1ODKA 3H1EA 1QTQA 5HP4A 1WKVA 4UVGA 4A6EA 3GAMA 2ZWAA 4ZO9A 1EEXB 1Q2XA 1Z5WA 3SK0A 5DYGA 1MO5A 1E1NA 1KJIA 3ESAA 3M4XA 4Q3BA 1MQ8B 2D7CA 3UHPA 1P17A 1J5XA 5C5DA 5FUBA 1CHNA 2XVXA 5JC1A 2KBFA 4MYTA 4V0RA 2R1ZA 2W48A 4RKWA 2JFNA 2C29D 3KD3A 1SRRA 2DQZA 2MYUA 3M9XA 4E07A 4E1VA 1YMQA 5B7QA 2IZ6A 1U7OA 1P74A 1YDGA 1H85A 2QTAA 4FNOA 4IUYA 4RIGA 2XI4A 4TWRA 1W5SA 4ZHQB 4LRYA 5MHTA 3ET5A 3WAGA 4B32A 3UWPA 3BF7A 3QF4B 1NUSA 2ZRPA 1P7ZA 4WZAA 1XA0A 1CBUA 1MHPA 2ZBVA 1R8YA 2IXGA 4C1BA 1VPVA 1HWYA 1L4MA 1L6IA 4K9KA 1SC9A 4N7BA 4J90A 3I6ZA 3BXEA 1C7JA 4W1RA 1HOTA 4XYMA 5AHKA 5FEUA 4KQFA 4E5MA 1Y9JA 2VBCA 3PUIA 4GM1A 1OKKA 2A0YA 2DPYA 3G2OA 1EJ2A 1JIIA 1RJWA 3ORSA 4NZPA 3SSAA 2V7WA 3AJ9A 4JBWA 4DLYA 5B3LA 4H31A 3UXHA 4EFDA 1FU8A 5FYDA 3LWNA 2CLFB 3NBYC 5IUKC 2B78A 2YWRA 1I1HA 4GEKA 3N28A 1UPAA 4YJ2B 4Q4HB 4O2BA 1WKBA 4YO7A 4QUHA 1CRPA 2Q6LA 5A4MS 1A9OA 4I1VA 2ZWMA 4C5AA 2JIDA 1OI7A 4FR0A 3THYA 3K0AA 1NC3A 1Y5NA 4C08A 4RTMA 5EY5B 1WW2A 4B3BA 3Q87B 5JY1A 1TF5A 5DRYA 5G3YA 4ZYVA 5C8YF 1EWTA 3SNKA 2WLTA 2B37A 3L8DA 3WK8A 5HUJA 4UAVA 4GOKA 2NNLD 2NM0A 1C9JA 1E2EA 3G5LA 5B55A 5M29A 1U65A 1L3IA 3NBMA 2FRDA 2P68A 1A7UA 3MT0A 5H0IA 3A4YA 3KB2A 3R5JA 5F33A 1XVAA 3E22A 1PUJA 2KW5A 4G4GA 3AIKA 1R3DA 3F74A 1J49A 1TYBE 4YUXA 3OICA 3QJGA 3QRWA 4BQOA 2ZT6A 1NMQA 2C0QA 2ST1A 2CMHA 4JD5A 4Z8XA 3N2KB 2I55A 5CXSA 4ZREA 1JEYB 2GI4A 2C9DA 2ZXUA 2ZLBA 5K8LA 5IANA 1QGAA 1CFJA 4RQUA 1Y4ZA 1VGVA 4F0JA 1R5NA 2GHTA 4V2IA 1CQPA 3WRYA 1Z4QA 1E1CA 4NOLA 4AUEA 5BR7A 5KHAA 2YL2A 2OTCA 2P2NA 1YOVA 3G3EA 4IEEA 2Q1TA 2BDEA 4D4IA 2QAGC 4PYRA 3GRFA 4H15A 1PFUA 1X8LA 2F3UA 5HPYB 4HDCA 4BVFA 4KR7A 2HJVA 3TBKA 3NOVA 1WMFA 3I62A 2PEZA 1AVTA 3OO1A 3PUWA 2BRUC 1B15A 2HF2A 4GI3A 2J5KA 4YT2A 4UOEA 1QG6A 4LG1A 5KUTA 3L6UA 2HXSA 4G8JA 3B3GA 1M2OA 3MJ4A 3QY9A 3U81A 3K96A 2R1VB 1ZNQO 1E2HA 2NVUA 3DPUA 2PRZA 4MUEA 3CZQA 2K7FA 4CDMA 3ECCA 5ICMA 4DJDC 2QROA 3R7NA 3BA1A 1ZKDA 3CBQA 4RH1A 5FBVB 1GTSA 2JAXA 3R23A 2CFIA 4DSUA 4J1TC 2IEAA 1K4YA 1E5QA 2V0NA 1RKVA 3D8TA 2BJVA 3H2GA 3ITEA 4J9UE 4KTVE 3RJMA 2QV7A 5NULA 1MW8X 4YRQA 2D06A 2FEMA 4WIAA 3TMYA 4UNSA 1Q15A 3NEYA 3DZHA 1CR1A 5TMBA 3QLJA 1BZYA 3M2TA 4GBMA 3OURA 3VH4A 5GADl 4LWOA 3QUQA 4P4SA 3ZWPA 4DDMA 4I5EA 1F9EA 3CW8X 1JECA 1DIRA 4LA4A 3I42A 4ZRMA 3UFBA 2CNNA 3WK5A 3ZY5A 1CDDA 1QOQB 2ZJAA 2Z8XA 5EYPB 5IJ9B 1N2SA 3KRTA 1VLVA 1YR8A 4RWEA 1RADA 1S3GA 1OI4A 1S4QA 1IQUA 3REQA 1RI1A 3MTIA 4KCGA 3VR6D 4Y6SA 2NXCA 3VMFA 3SYRA 4EHBA 1Z2AA 1ZEJA 1Q21A 2Q4RA 4CLRB 3K73O 2G70A 3HR4A 4RPKA 3BH6A 2GPWA 2DSTA 4JJKA 1JIUA 3P32A 3EWNA 3Q98A 1UODA 4F4JA 3L82B 4P8RA 4F11A 2FR1A 2IZ1A 1E7QA 2ONKA 3HKBA 3CNHA 3NWJA 3SC4A 5BRJA 5HZHA 5JNVA 1A82A 4LN1A 1ZA1A 5IF3A 1ZHFA 2Q5FA 3N7UA 2ISSD 4D9FA 1RI4A 1W48A 4A2WA 3OEHD 1P73A 3IQZA 3FB1A 4E33A 1WZEA 3L7NA 3SJ7A 4DQ0A 5L6MB 16PKA 4MHOA 3RJ5A 1ZI8A 4RC9A 3WL5A 1W4BA 5EHIA 2HBRA 4P3YA 5DTEA 2AN9A 5NLLA 2RARA 3U4QB 1I32A 5DNEA 4PLGA 2PUCA 4YRCA 4OGFA 3PJFA 2DQSA 1LDBA 2VHCA 1DZ3A 5HE9A 1A1VA 5JVDF 3M3HA 2RSLA 3TLGA 5CTJA 1JG6A 3KZVA 5E7QA 4D9HA 1XO1A 2Z56A 1H65A 1GPYA 5KVSA 4OA5A 1UEIA 2H9IA 4WXYB 1T9DA 5CA1B 5SZJA 4M9XA 5KNDA 1B16A 1J97A 2VPQA 4GOMD 4C87A 4MR9B 2PD3A 1JBQA 1OASA 2CZGA 3LS2A 4MIYA 2WLSA 3E5HA 2OLKA 2DX7A 4QBKA 2R8ZA 3NFRA 4HQNA 4IH1A 5B1HA 4X6UA 4JP1A 4XFJA 5KCZA 3VVBA 2BYTA 4W9NA 3AYZB 3FNEA 1EU1A 1QIGA 2R65A 5CK4A 1X7WB 4HADA 4P4GA 1U0SY 2A6PA 4E14A 3VC1A 1V1RB 2HHJA 3A1CA 4CM8B 2AFVA 3DDSA 3JVEA 1AD2A 5FL7D 1JLMA 1FTYA 4QYMA 2VUSA 4CM9D 1Z2CA 2OOSA 1TAHA 2I2WA 1UQRA 4BO6A 1FVHA 2P4QA 1XHEA 1FFCA 2LDXA 3HFJA 4HDAA 3BIFA 1EIWA 4QVKA 1JTVA 1AM4D 4N0PA 4YIHA 3IQHX 2ZWOA 5H68A 3ZW7A 3PFFA 4HNAB 4RV5A 3SHVA 1UIRA 2QTLA 1II8B 4FFRA 2C03A 2P65A 5D1NA 1VG1A 2RHJA 3G9ZA 3NC0C 2GB4A 1VE5A 5K3SA 2XCLA 3BMCA 4OSPA 4U2BA 3PIIA 1SC4A 5AXAA 2CNKA 5JRZA 3SR4A 1W30A 1XD9A 1J0EA 1J8YF 1JPVA 1HNNA 1U2ZA 1FEZA 2AOTB 2OXTA 4X7BA 3QU2A 1F6DA 2WF5A 3NXSA 1PGQA 3BFPA 1IU9A 3ITDA 4JJGA 4RGBA 3FOFC 1QANA 1JLKA 2OCYC 1LNZA 3CH4B 3MBKA 4KHZA 4R7ZA 2IOFA 2Q5JA 1W9MA 4RENA 4J0CA 4U7GA 5DBOA 4QFDA 4DL9A 4JYBA 2HIHA 4ZTBA 1W46A 3GFTA 3RODA 1XDZA 3M6WA 2XZOA 4CQLB 1CJMA 3AR8A 3D4OA 2DBVO 1QG2A 4LNHA 4FK8A 1GRCA 4B1FA 1T4DA 3KZXA 3VFDA 1X8JA 3GDWA 1VYUA 2FFAA 1WV1A 4X3CA 4LYYA 4JLUA 3H5LA 4QO8A 1TCUA 1IBCA 4AJIA 4PYJA 2JLXA 1YJQA 3T7IA 1GRQA 2G8NA 4Q7QA 1X74A 2C00A 2XCSB 1DBRA 1ZONA 1Y8RB 3CSSA 4QKQA 1VG0B 2WR8A 4GWKA 4XLZA 5FLYA 3F6RA 3OFJA 4Y9RA 1CJUC 4I55B 2D0OB 3IDZA 4B8WA 4M7WA 1IZZA 5IMBA 2XUOA 2HK6A 3VR5H 4JNKA 1YFLA 3GT0A 1DUIA 1WSBA 1YRYE 3OLQA 5SYMA 4LY0A 5FDFA 4P0TA 4YIKA 1OTHA 1YA8A 2NT3A 4TMXA 4YJHA 3CMCO 4ZGBA 2QTNA 4G9BA 4MRVA 1R4MA 1ULBA 4AB1A 1QUEA 2P9GA 2CUKA 2PFGA 4OXRA 3RWMB 5J2TB 4Z99A 4C88A 1QZ3A 2NG1A 1FF9A 4M86A 3B78A 4P4UA 4X20B 5LVAA 4KR6A 2WT4A 1XG5A 3B6KA 3UB4A 1NVWQ 3C7TA 3EA5A 3TZQA 1DXHA 2NIPA 2PKXA 3UOWA 2FSUA 2P3SA 3LT5A 2I6QA 1AHIA 1YZQA 5FAXA 3UAYA 3H13A 5C2JB 2R6DA 2CB9A 5DSTA 1VDZA 4M0PA 2DXIA 5CH3A 3QX8A 4I2NA 4EA9A 1G4HA 1RYFA 2IYQA 3QE0A 4DCUA 4GPEA 4BVKA 1NYRA 5ALKA 3RUPA 5JRDS 3K9LA 3D7KA 1XKXA 3CG0A 4EYEA 4IFTA 2XD4A 1COWA 4R9UC 2DPMA 2Q3EA 1TYEB 4FLFA 3QBEA 4B83A 4V1CB 4UDOA 4GG1A 4P3OA 1NYLA 2QVXX 3COVA 5BWLA 1FFXB 2XZPA 1ENOA 4DJFC 3WIOA 5TLSA 3CPHA 4BB6A 3PFGA 5DBEX 1QRUA 3TNDA 1QYDA 2W42A 3L0OA 3RSQA 2ZOSA 4E5VA 4B85A 1SBTA 4AUKA 2YX1A 3DJFA 2E4WA 3MOSA 3GVPA 3HUDA 4NABA 5F2OA 2H2HA 2WJHA 3UCEA 4AJJA 1Y7PA 4P84A 2JLSA 2OORA 2FQ1A 4TGLA 2WJZB 4K5QA 1YB2A 2CW5A 3IT3A 5F7XA 1WEKA 3W06A 1J2YA 4RMGA 3L7BA 1I2ZA 3O4FA 2BGIA 5CVVA 2Q62A 2BKAA 3EYWA 4MXDA 4WVLA 3TD2A 2UDPA 3CEPB 5A3VA 2FW9A 4AN4A 3GCGA 5C7LO 2ZM5A 1IUKA 3ZQ6A 3FNIA 3GJQA 1TJ5A 3A9CA 2W90A 3Q40A 4FJ1A 4S1OA 3RNOA 3AG5A 1HEYA 3JASA 3QKUA 1RP1A 3SMQA 4CW7A 4TXHA 1V6CA 3RSZA 4G86A 2OLJA 2WWXA 1SXJC 1OW3B 1ZK0A 2YV1A 3Q9SA 3RVQA 1O97C 5FTNA 1WMEA 4JLWA 4N4AA 4LGYA 4AG5A 3RPEA 3RSLA 1PJZA 3PQ5A 1IZ8A 3RAEC 2GPAA 3L0ZA 2ZUUA 3DKIA 3E5NA 4J43A 4DIEA 3GJ7A 3W7VA 2JFVA 3U80A 1JA0A 3SE0A 4MYDA 4BE7B 4WOBA 2FP3A 1QIMA 3G8AA 4RMHA 3TCNA 1TUBB 4IXMA 4LMRA 2WPDA 1NFFA 1M6VB 3F98A 4OU5A 2OBXA 1ZIPA 4IOKA 3AGPA 4KWCA 1S01A 4QGHA 2PRKA 4YAKA 3MJTA 3DDNA 1KAQA 2OXRA 3SKYA 1JNYA 5C8YA 3NKVA 4E2XA 1SKQA 2OD9A 4BY9E 1T0HB 3G0BA 2DLNA 4QBGB 4B6JA 2BONA 3L18A 2GPSA 4IRXA 1AK2A 1M0TA 1XQ1A 3I9NA 1YC5A 2TMKA 1YHYA 3FMOB 3KPYA 2ZSHA 4RJ2A 3R74A 1ONPA 4ASUD 4DLZA 3AVXA 3IGFA 2R86A 5FR1A 3JARB 5IZ4A 3WYGA 1Z6XA 4KQEA 4FFMA 1RHMA 1P8JA 5BSRA 4ND8A 2JIZD 2Z3WA 3ZU6A 2X1VA 5I8ZA 3CVXA 2WBLC 7REQA 4YLGA 1PV1A 1VBFA 4GPZA 1ZY2A 2BRUA 4HUQA 3KT3A 3BDAA 2FWIA 4YCAA 4Y18A 4XX0A 5KYWA 1RYEA 1QP0A 1H42A 2YN0A 1S2IA 2SNIE 3CKLA 4HH4A 1JHRA 2G28A 1I7PA 1TPYA 2E4AA 4BLRA 4ZCTA 5JQGF 1Y7HA 4DILA 2QYHA 3W5UA 1A9SA 4PEVA 3ZNPA 4YDRA 2WQ7A 2F43A 5JDIC 8ABPA 5IVIA 4J1TA 3IT1A 3NIDB 2GQ0A 3MJRA 1M6EX 4GYJA 1ZOIA 5IKXA 1SMKA 2QW1A 2NYRA 3KYDA 3L41A 4MITA 5BQOA 5AVXA 2Q99A 3LVFO 3CEJA 3H2ZA 3PHJA 4ZEWA 1UBSB 2K87A 1C8VB 5LQCA 5LZ4A 4UBIA 2CXTA 3R44A 4KE6A 1RQLA 3N05A 2C78A 1Q50A 1RU3A 4K9MA 3QZUA 4Y1FA 3OLYA 2Z2IA 2QU7A 4Y2TA 4M0CA 4ERNA 2IYNA 2H0RA 3F7TA 3QWHA 4YYZA 5ALMA 4I3FA 3RC1A 2BEKA 4J76A 2R4QA 3FWYA 1WDWB 1NQUA 3GMSA 4IGIA 4C6TA 1MZVA 1UUFA 3G59A 3DE3X 5C4MA 1B0AA 3UV3A 4HX9A 1S6YA 2P9HA 5CVUA 1YK0A 1YZVA 4YRLA 3ZIDA 1DC3A 4B3HA 4DWJA 5JZ9A 3H19A 4W5RA 4NCAA 4D0GA 2DVMA 3E7DA 3UBMA 3LL7A 3LX5A 3DUFB 2VPTA 2NUAA 5TF4A 1F2UB 1NBHA 3TQRA 3SNHA 3TR6A 1UP4A 3C45A 3MT9A 4AZTA 4MUYA 1I94B 3N0WA 2G5GX 3CN7A 1ECBA 5DTQA 1EFVB 2P1ZA 3DWGA 3TGLA 5I4CA 4TLAA 1NOJA 2E85A 3DKVA 3U3MA 4UQOA 3UH0A 2PWPA 1WNFA 1DTSA 4FHEA 4M1SA 4QG3A 1W7AA 3GJYA 4TXJA 3N74A 1J8FA 2OENG 5FLXA 3FRJA 3D4IA 2JFYA 1MDBA 1KR2A 5BW5A 2VJQA 3N1UA 2WUDA 1JHOA 1JIVA 1MH9A 2HU5A 3FJOA 3OPNA 3ANSA 2QIOA 4L0DA 4PF1A 3FMVA 3E6AA 2O8NA 1EXNA 3NHUA 2INGX 2RMKA 5HFAA 5KTYA 1GDHA 4JB8A 3ZHRA 1XMVA 1X0VA 2Y92A 4FE3A 2AQ8A 4X54A 5PNTA 5GVSA 3DWEX 5EOVA 4C6HA 4PSUA 2VYFA 5F64A 2QAIA 1MA0A 4GR5A 5LBTA 5BWMA 5IN4A 3AR9A 4KXYA 1X7DA 4LRSB 1ARZA 2NSHA 2XMRA 4G26A 4R1SA 4RMNA 1VYHA 1W36C 4JIMA 1F2VA 2C54A 2D1TA 3DDHA 4LHXA 1N34B 3L8GA 4KO3S 4KMRA 2GASA 1NLFA 2OESA 1BXKA 1KOJA 1BAPA 2G5CA 3CMMA 4OM8A 1T5OA 3AJ8A 2AK2A 1LH0A 2DR3A 2WSBA 3H1GA 4M99A 5EKDA 4JXXA 4K9DA 4BE4A 1JMKC 4H1UA 4EMBA 2WQ6A 3LGAA 5JVDA 4KPGA 1TAQA 4ANFA 5GONF 5H5JA 4AL4A 4LZLA 1NV8A 3A6FA 1HK7A 2UAGA 1K6IA 2CVHA 2FN3A 4NEGA 4FS3A 3RYHB 2PZLA 3EEQA 3HY4A 1EE1A 3H3JA 4P80A 2VAXA 3T1HB 2OGTA 3GJ8A 7MHTA 2ID7A 3SZUA 4RTOA 1H2EA 3UANA 3MTDA 3EMBA 2X7HA 4LVNA 4HAUA 3WKEA 5AJWA 3NANA 3MG9A 3O03A 3PIDA 4KO2S 2C1ZA 3CYFA 1HTWA 1R9NA 3MWEA 4A1FA 1G8JA 3QVVA 2CNLA 3S2YA 4C9BA 1Y6QA 1GQ2A 1SOAA 4HWTA 3M1YA 1PJCA 4YJ3F 3RFUA 4EELA 4AP6A 4MWCA 5CW1A 2AMYA 3ROFA 2RGDA 1PYOA 1IC6A 1U9CA 1YRLA 2BFNA 4O4IF 1TUIA 2DR2A 4HSEA 4HQRA 4PINA 1NVKA 4OLHA 3U4MA 4NL4H 4PTZA 5HIJA 3TPCA 3GC6A 1LWOA 5FWXB 1EVJA 1ZW6A 2GZ1A 3DPSA 1KRXA 2FPSA 3C0KA 3FBWA 1GSHA 2QRUA 3WY9A 2EEPA 1TDJA 1BG6A 1FOEB 1H5QA 3RSOA 3VDMA 3W2FA 1J7KA 2EX0A 1XNGA 1NX9A 2QSYA 2R62A 1MO6A 4UE3S 2ZJ5A 5F2KA 4DLNA 3CH5A 1IZ9A 3IP6A 1NOKA 3MZ0A 5BYBA 1C3OB 2I87A 4Q1CA 4EJSA 4ZCLA 2HT1A 4QPNA 1WE2A 2R6CA 1JKIA 4WK6A