4HAVA

Crystal structure of crm1 inhibitor anguinomycin a in complex with crm1-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
196
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 58
structure length 196
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4havA00
1Q21A 4DLUA 1GP2A 3K9NA 4V0KA 4B3DA 1HUQA 5HE8A 2WKQA 3BFKA 2D06A 1VYVA 4TTRA 4JL8A 2JLXA 1YR9A 1ZNZA 1JJ7A 3K09C 4HZIA 4G01B 1VYTA 4WW0A 4AK9A 3Q7QA 2QPAA 2ZIAA 2ZJZA 5TDHA 4TL8A 4DC9A 2V6JA 4BQSA 3PIRA 1DG3A 1XJCA 3CZPA 2FF7A 1GITA 2BBTA 4MRRA 1OIWA 3GLHB 2BM1A 4QGGA 4WBSA 5LD2B 2R2AA 2FA9A 4F4CA 3TW8B 4US2R 1J8YF 2ZSEA 4QJ3A 4D26A 2ZANA 3E1SA 1XWIA 3VMFA 5IT5A 3TSZA 4IVQA 1FP6A 4TMXA 4UJ5A 5FI0B 5DO9A 5TB5A 1IN6A 5FTLA 4DIDA 2CLSA 5LPNA 1CF4A 1YHNA 1AKEA 1D8TA 4AKGA 1PV4A 3KQNA 4B3CA 2NZJA 4KODA 4RFSB 1T3SA 1YR6A 4XVRA 2O0HA 4G3XA 1E9DA 2ZJBA 3NEJA 4C0HA 2GILA 1XMJA 4IDQA 3GLHE 4QOSA 4YMWA 4Q7LA 2Z0MA 4NHOA 1KDPA 1ZP6A 2KSQA 1XEXA 2ZI3A 1H65A 3FMFA 4BUJA 4CGZA 4ASUD 4Q7JB 2QU8A 1K5DA 2N46A 2ZITA 4NU0A 1E1RD 2C04A 3ZGXA 4FWTA 2WWXA 2WPDD 2QZ4A 2FSHA 1NN0A 5E3HA 4GPTA 2PEYA 2DFTA 2ZU0C 4JT4A 3FKSD 4L9WA 5FPYA 1MABA 2ZSBA 1W4CA 4ZCIA 1UAAA 1E0SA 4F4IA 4EQ6A 4UNSA 3CW2A 4ZKDA 3QBTA 1E9EA 1F2UA 1QZXA 2GJKA 1KMHA 4B71A 3DKVA 1E99A 4P4TA 2R6CA 4A6PA 1Z0DA 2VHUA 1CR4A 1E2HA 3TBKA 1RYFA 1J2JA 3FMIA 4EKDA 3KKNA 4RFVA 2ZQ5A 1P3JA 121PA 2IF2A 3A1TA 4ZI3A 4U5XA 3AVQA 3RABA 1W5TA 2W6JD 3RAPR 4QHYA 1G7CA 4EPRA 2J59A 1II0A 1ZCBA 2DFLA 2DY1A 5CJPA 1II9A 3ZD6A 3SZRA 5EP4A 1Z22A 4N0EA 2JJ2D 3WBKA 2CHQA 5FUXA 2WMOB 5BQ5A 4DWJA 5LD2C 4A9AA 1G18A 4JJZA 2DB3A 1UKZA 5K8IA 2FPLA 2REOA 4DLXA 3AVTA 2XZLA 2GXSA 5B2ZA 4QNRA 3TLXA 2R9VA 2QBYB 3TR5A 2HF8A 1R4AA 4FMBB 1SVOA 1WCV1 3SHFA 1T8TA 5B58C 1G5RA 1OJLA 4JSTA 5DHAA 2VSOA 3HYTA 4B2LA 3A37A 1JR6A 2RGDA 1CJKC 1QVAA 3OE7D 4NYIR 3WMEA 4M9XA 4EIWA 2B6HA 2Q9AA 2WAXA 4TT3A 4UQOA 1XZPA 1O3YA 2CEAA 2XXAA 4E07A 1P2TA 2HDNB 4JVLA 5LB2A 2GXAA 4MKGA 2D3WA 3KKPA 3TGPA 1DG1G 2DFKB 1DAHA 1FNNA 1KI8A 4LC1A 4HYYA 4MKFA 2XX3A 3TAHA 5KNCA 1OXTA 2EWWA 3RS0A 4Q7MB 4TLAA 2IYSA 1OF1A 5CDFA 4URXR 3QKSA 3QVVA 4KFRA 4QJ5A 3U3JA 1DARA 3LLUA 4I99A 3A36A 3QXXA 1KTVA 5SZJA 4B3XA 4CVNA 1M8PA 2F3RA 2NG1A 3PXGA 1TL7C 2P6NA 1QF9A 4TMWA 4B6FA 3IIKA 4Q4HA 2CCKA 4Q00A 2G0NA 2GBLC 3SFZA 5EP3A 2AWNA 3GQBA 1T91A 3NTUA 1E0AA 1ZNWA 2FOLA 4RKFA 1CU1A 3BB1A 2AKYA 4NYJQ 5C4GB 1FTNA 2F9LA 1SXJE 4H9GA 4HZUB 4XSHA 2ORIA 3OAAD 3FB4A 4G5RA 3SEAA 4F7WA 2G77B 2I3BA 1F60A 3MRSA 2ODWA 4M1KA 3UG6A 2QMHA 1R8QA 3KZ1E 1W2HA 2R6DA 4DJTA 1FP7A 1NY5A 4FMDB 2WZQA 3SBEA 1GZSA 3PUWA 2V4ZA 3Q8XB 4PXAA 3VHLB 1M6NA 621PA 4CEHB 2XNSA 3LVRE 2ZI4A 5CB6A 1AZTA 4A1FA 4C7OB 4Q1DA 2GJ9A 3ND9A 4QGFA 2GTPA 5AUQA 3IEUA 5TARA 3RRZA 2AFIE 4RD2A 4QBIA 5L3VA 1FZQA 1KI6B 4PSKA 3A4MA 3IUYA 4DDTA 3NDBB 4B35A 4D2IA 1Z0AA 1E2GA 3L82B 3PR1A 4NMMA 4KBGA 1U2RA 2CXXA 4C9BA 2C9YA 1G291 1QHSA 5TY0A 4ASUA 1E9AA 3I61A 1E9FA 3CR7A 2WPDA 2W83A 1E96A 1OSNA 3NIBA 2ZI5A 4LV6A 4IOLA 3J81k 4RZXA 1OV4A 5CYPA 5KNDA 2ZRFA 1ZIPA 2OUKA 3FDIA 4LPSA 1SXJC 1Q44A 2A5DA 2SHKA 3AQ4A 3BB3A 1OB2A 821PA 1GRNA 1OE0A 1TU3A 3NKVA 3HWSA 3TJZA 2Z83A 2D62A 4ZIRB 1ESNA 3TKLA 2WVJA 3H0KA 2G88A 2ERYA 4OYHA 4B75A 2C96A 1P2SA 3W3AA 4IHQA 1KSGA 1OB5A 2WWIA 2AFHE 3SI7A 1KOFA 4A0RA 2YWHA 4M1WA 4TYPA 5FPHA 4F92B 1D5CA 3B5JA 4MQBA 3R9WA 5H70A 3CH5A 3W5IA 2PH1A 2ZS7A 3GJ6A 2JJ2A 3FVQA 4C0SA 1Z06A 2YOFA 1LTQA 1T3HA 2QM8A 3RWOA 4LHXA 3K0FA 1X8LA 2OILA 1NBME 5CIQA 4A92A 3WP0A 3KL4A 4Z51A 4E09A 2I4IA 3F3YA 2P65A 1BYUA 2JLQA 3R7WB 2XNDD 4Q9LA 1R5BA 1E2EA 4DBLC 2DHRA 1VYUA 2OAP1 1NN5A 3H1TA 4ACAA 2BBWA 3GEIA 4XSGA 5A5GA 1AS2A 4TMKA 1GKIA 3RNLA 5J4LA 2GZAA 2OLKA 4IDOA 1M7GA 4NH0A 3TSWA 1BO6A 3L0SA 3GFTA 4JLJA 5L3QB 2JLVA 2HLDD 3Q72A 1FMLA 4LYJA 1NJGA 3OE7A 3DM9B 1IJEA 2IS6A 5JWOA 2IS1A 5BN4A 4PC3A 1KSJA 2GF0A 5HPYB 4JMPA 4XTCS 4V0ME 3TUZC 1UKYA 1N6PA 4HUQA 1QG4A 4KHZA 1L4UA 5FOSA 2VP4A 4ZDWA 1F2TB 3K0CA 3CH4B 2A30A 4TLBA 1YR8A 4Q1AA 4HAUA 3VKHA 1KI3A 1XPUA 1SVKA 1QDEA 1IAQA 2E1RA 4F4JA 3AF2A 2AD1A 3ZJYA 2EQBA 4PC7A 3F0TA 4CIDA 4XWOA 1G8HA 2I1QA 2A5JA 2ZSAA 2KJQA 3LWNA 1Q20A 2VH5R 1COWD 4QXAA 3WMGA 1KZ7B 3CPHA 3HU3A 3IQWA 2VP5A 5JECA 2J87A 2LKCA 3EXAA 4NCKA 1F3OA 2W6IA 4Q01A 4UNQA 1CEEA 4Q9HA 3QKRA 4IOJA 1KO1A 4V0NA 3V4FA 4C0QC 5SZIA 2B21A 3ZIAA 3MWJA 3D3QA 4XVUA 2ANCA 1U81A 4GL2A 1HQCA 2HT1A 4NCHA 3OAAA 3NH6A 3UMSA 1HE8B 2BDTA 3I1FA 4QFMA 2Z43A 3BH0A 4UXHA 5D3QA 3FE2A 1QBKC 3EA5A 3S1AA 1ZM3A 1KJYA 4Q4JB 2IL1A 2ZU6A 3WHLA 4RD0A 1VG1A 5FOWA 3FPAA 1JXMA 2FPKA 3QENA 3IEVA 1Z83A 3EW9A 4LBYA 2Q6TA 5B30A 1ZC4A 2BKUA 3IBGA 5E7JA 4TYNA 2QE7D 4A2WA 1UPTA 1QHHA 3RS7A 2PMKA 4P31A 4JYBA 1CULC 2Q3MA 3RVBA 3C5CA 1W47A 3CONA 1P5ZB 4LJAA 4RJLA 2MMGA 3EARA 4BE7B 3EPHA 3DO6A 4OBEA 2F7SA 4HAZA 2IUUA 2BMJA 3AF0A 3AF4A 4KI0A 4PZZA 3I92A 5FI1B 4TL7A 4A0GA 4LK2A 2YWGA 2WJIA 1RRFA 1A2BA 2WWWA 4LZZA 3ZVNA 2QBYA 1EWQA 1RJ9B 2D4HA 1NVUQ 2XZPA 1XEWX 4LHVA 2JLWA 3GFPA 4I1OA 4DDUA 1XD2A 2GVDC 2WWYA 2RAPA 3I8SA 1BH2A 1AQYA 3CWZA 1VTKA 1W5SA 5D3MA 3U60B 3GMTA 1JB1A 3V00A 1VCOA 2QG6A 4V02A 3L43A 4LHYA 3A1SA 3NBFA 5BWMA 2AXPA 2OXRA 5GJVC 3WP1B 1IN4A 1XU4A 2JDIA 4GSYA 2ZJAA 2XZOA 4QKQA 1TNDA 2W0MA 2KBEA 4QNMA 3THWA 2VHJA 3MSXA 4LUCA 1G8GA 2HXSA 4LI0A 4DZZA 3IO5A 1SGWA 1E6CA 3OIWA 3Q5EA 2H18A 3RS5A 2ZE7A 5EUMA 1I2MA 4BRWA 2IS4A 2XGJA 2XNDA 1OH6A 2O0JA 1YE8A 1DAFA 4D25A 3FKQA 4ZDJA 4PC2A 4CDGA 2YWEA 2IUSA 5EE9A 1ZM4A 5JS7A 3NH9A 2X2FA 1N3BA 4C30A 4B3GA 1OKKD 1ZCAA 3CNNA 4OQFA 2FSFA 4N0DA 3WNDA 2CLDX 2DR3A 2OHFA 5AK0A 3VR5A 1Z0IA 2RGEA 3E2IA 4FCWA 1CR2A 3B82A 2OG2A 1G1MA 4WZ6A 1OH8A 5F9HA 2RB4A 4KO8A 2OBMA 1D2NA 5FPTA 3U2QA 5JS8A 5DISB 2A5YB 2PL3A 3LLMA 1LVGA 2ODBA 4TN1A 1KK2A 3MD0A 5KDDA 5L3SA 1CP2A 3UATA 4MDEA 3LO5A 3PCRB 4KXFB 3NEYA 5ANRB 3REGA 3O8DA 2O52A 4K81B 4N3NA 4HB3A 3WYAA 2IBMA 4TL6A 1T3LA 1TF2A 3M4YA 4AURA 4CT5A 4QM6A 2QSZA 3B6EA 5DI3B 2ZJ8A 1COWA 4LV8B 2D2EA 1CRPA 2FZLA 2CJWA 1GNQA 4M53A 5IHPA 4DCTA 1X3SA 4PHTA 4J0QA 3PEWA 3CNOA 4M1YA 5JRZA 3U4QB 4AKHA 3EPLA 1VCNA 4NYMR 1ZNXA 1NN3A 1D2EA 3SJBA 4BLQA 2ZRMA 2WSMA 2JJ1A 3CRRA 2F6RA 2IXFA 3AVOA 2HCBA 4AYTA 2IF0A 2QA5A 3QY0A 3TH5A 2YOGA 4TLDA 4HLUC 3B2EA 4UNRA 2BHRA 2VEDA 4JLAA 3CF0A 2GXQA 1GL9B 2QAGB 5FTMA 2H17A 4IRUB 4NYMQ 4XWAA 3U7EB 3K9LA 3LVQE 4GMDA 3SJCA 2OCPA 3LRPA 4AYXA 2G0TA 2QP9X 4OHWA 3QUSA 2QE7A 4EDHA 1Z6TA 3THYA 2Q9BA 5ELXA 4M21A 5FOXA 4ZCMA 3ZZTA 2NIPA 3U61B 5KHOC 3RC3A 3VR4A 1RC8A 1S4QA 1QG2A 3ZVLA 3KUDA 4KSBA 5KSPA 3D6TB 4JL5A 2AWOA 2J5XA 4EFLA 4YMVA 4BFSA 1EFCA 2KB0A 1M1YE 1C1YA 5DHFA 5BXQC 1AA9A 1S96A 3GEEA 4WIAA 4LRWA 3R20A 1YZQA 3TSOA 1Z2CA 5E7MA 2IX3A 3LQQA 2FWRA 1AM4D 4Q47A 1IM2A 1YU9A 1NRJB 1ZVQA 2WKRA 1H8EA 2BBSA 4TTPA 3BORA 2P5SA 4QHSA 2VHCA 4HSEA 2GK6A 2G83A 4ARZA 4M1MA 4BLRA 3U44A 3TIFA 3QF4B 3QSYA 1M7BA 2ATVA 1Z0KA 2F43B 2XTMA 2ZE8A 3AP3A 2IWHA 3O8RA 1FFHA 1P6XA 2R6AA 1G20E 3CM0A 1KAOA 3PENA 4W5WA 1P75A 4S2EA 4FMCB 2XTZA 2ZYUX 3GFOA 3X2SA 3IPXA 4QG7A 4YLGA 3EC2A 4V03A 1VHLA 2ZS8A 3K1JA 1XBTA 4BFWA 2Y8EA 4M2LA 4CW7A 4DT1A 3LFUA 2ZJ2A 1YZLA 4JLVA 1CJUC 4LJ7A 4GT1A 2B8TA 3FHTA 2FFAA 5JSZB 3IGFA 4BLOA 1IY2A 4GP6A 1NP6A 3BH6A 3NDPA 2WOJA 1T4GA 5CLQA 3OFND 5KYKA 6Q21A 4TLCA 3UXMA 3KKQA 1OIXA 1ELOA 5AJXA 2ECKA 2QAGC 3AGPA 2IA5A 4BFTA 4WZBE 4QGAA 1XTQA 1ZU5A 2ZJYA 3B1WA 4RCZA 2WAYA 4BFXA 5DH9A 4B2PA 1OKKA 5B64A 4CEJA 1SVMA 4AC9A 3GJ7A 3LX5A 1NMXA 1SKQA 1JBKA 1IY0A 1T5IA 3T06B 3QPWA 4ILEA 5G3ZA 3KKMA 1T8UA 3LBHA 3X1DA 3B78A 4PFSA 3VU9A 1U0JA 4JIMA 2K5UA 3T1QA 4EJSA 2WJJA 1G5TA 1GTVA 3ZQ6A 1LF0A 4FMDF 3WNBA 4RZUA 5DNYB 2JIZD 3SJZA 3W6PA 1TQ6A 4JLKA 5J47A 1KJWA 3WMFA 2H57A 2QENA 2ZE6A 3D8BA 1E2KA 3OIVA 2HUPA 2IS2A 4L15A 3EIHA 4WAUA 2OCYC 1Z63A 1JAIA 1Z6XA 2ZJOA 4QL3A 1AS3A 2OT3B 5AJVB 3EPKA 4MGZR 1ZD9A 1RIFA 4MUAA 3NXSA 3OEED 4DLRA 1N6LA 5EUQB 3ZVRA 1P9WA 5EE3A 1E3MA 1SQ5A 2EFEB 4AKEA 4AYWA 4D0LB 3GLFE 4GOJA 4MDFA 4B2IA 3BAFA 4PQFA 2WOOA 4X8OA 2J7KA 2QTHA 2JLUA 5FFMA 1DADA 1XEFA 2IYLD 4QGHA 4XTRA 4MRSA 3MAAC 5P21A 4DEYA 2GXUA 3WYGA 4S35A 1ETUA 5B57C 1GM5A 4YC7A 2WWHA 4A0FA 2PCJA 2DFNA 5GVRA 2R8RA 1E2IA 4A2PA 3ZD7A 4HB4A 4Q9IA 2OZEA 2ZUDA 1KI4A 3SE0A 3BERA 2X77A 1J99A 1NG9A 1FOEB 4EPYA 4X8MA 4XIGS 4EPTA 1YZTA 4AKIA 4L9SA 3FFBA 2PCLA 3UKDA 1DS6A 4Q1CA 1E2QA 4EPXA 4DHEA 1OFUX 1IN8A 3B1ZA 3LY5A 4IFBA 2J0UA 4LYAA 2CVFA 2GCOA 3OEHD 4MYUA 2NTYC 4Q1FA 3PITA 1KIMA 1A82A 1RYHA 1G7SA 3I32A 4PAQA 3SQXA 3W6NA 1NMYA 3HP1A 1QVRA 4MKHA 4RKEA 3C16C 1RE0A 1GRRA 2QT1A 2ZJ5A 3B9QA 3AKDA 5FR2A 3RSLA 1DTSA 2BMEA 2OFOA 4DB4A 2AHOA 5F3WB 1YRBA 2NMVA 4O0MA 4M0LA 4HAXA 2D2FA 3ASYA 2RGBA 4G5SA 3RSOA 1NBMD 3VQTA 1XEXB 2HJVA 2GZHA 4Q03A 3CR8A 3MJHA 4GOXA 1GNRA 1Z6AA 1IN7A 2ZR0A 5EZ5A 2OXCA 4GOKA 4JVMA 4HUTA 4KITB 3WYFA 2V7QD 3GLIA 2CLCX 3GJXC 1MABB 4MYTA 5JWRA 1CR0A 3I5XA 4GZLA 4P4SA 4EQ6B 3ND8A 3RS3A 2IYWA 1EK0A 1T0HB 2CNWD 2IWRA 1F2UB 2CMKA 1KMHB 2V8OA 4B76A 5F9FA 1G8PA 5KTYA 4LJ6A 3MUFA 4EFMA 1EFRD 4KYIB 4R71A 2GETA 5TV2A 2P2LA 5HE9A 2O8FA 1LS6A 2QQ0A 3A8TA 3PUYA 4IDNA 2QY9A 3LW8A 1IONA 4GRAA 4HLCA 4PZLA 5CB8A 1GNPA 8OHMA 2EYUA 4IJMA 1XCGB 4R98A 4LCBA 2ZRLA 3OFNA 2H5EA 1Z8FA 3AF3A 1XTSA 4EAQA 3K0AA 4B34A 2WICA 1XD9A 2DWQA 3MLEA 2ZREA 4DUGD 2C03A 2N1BA 5L8VA 4WOPA 1R5OA 4X8LA 1EWRA 3GJ0A 4URZR 1JEDA 2XOKD 1NI3A 1NL3A 2JCSA 3UWOA 1A4RA 3QVUA 4B3BA 4B6EA 1G4AE 5JHHB 4ESVA 2AX4A 4D4MA 4M1SA 3I5YA 2D7DA 2FSGA 4AG5A 4NYIQ 1W36B 2O0KA 1SXJA 1IJFA 5FL7D 5IDVA 4AIIA 1X1RA 4PPNA 3KUCA 4PAOA 3IKJA 2JIZA 2VO1A 2RH5A 5CIWA 2XSZA 3RRYA 5JEDA 2OE2A 1GAJA 2XXAB 4BZXA 2BOVA 3ICEA 4Q1EA 4M1OA 1T0JB 5IK2A 1NSFA 2BKEA 4ZCLA 2ASEA 1S3SA 2ZRDA 4FCTA 3ZYCA 4IDPA 5EXXA 2GKSA 1G3MA 2W6ID 5EXSA 3BC1A 3BS4A 2YV5A 3FYHA 1SVWA 2IYRA 1M7HA 3OEEA 4D4LA 5FBVB 3AVWA 2IW3A 4M9ZA 2MSCB 4R7ZA 2RCNA 3B1XA 4Y0AA 3ZIAD 5KOYA 2IEZA 4TMVA 1II8A 4IVPA 4WXPA 4FIDA 1RPZA 1XXHA 3QKSB 2REBA 5FPSA 4LOAA 1E79D 4IW3B 5DYGA 3I8XA 4AG6A 3ICQB 1JR3E 2EFHB 1BS1A 2UKDA 1U98A 4JVSB 2O5VA 1R7RA 1KMQA 3SR0A 4DRZA 2WJVA 1QRAA 2ZRCA 4Q4HB 2X1VA 5E7IA 2VTKA 1Z47A 3PV0A 2BMDA 1NKTA 4D4JA 1XX6A 1GL6A 2ZYTX 3EIQA 3GEHA 3QQ5A 1CLUA 4DB2A 1JECA 3TR0A 521PA 3PUVA 4KFUA 5CITA 1W4RA 1OH7A 5CDFE 1QHGA 2HV8A 1JEEA 4LSGA 1FQKA 2WIBA 1R0YA 1XEWY 3MFYA 3KXIA 1E2JA 5HCIA 2OBLA 1US8A 4IEEA 3OEHA 4M4SA 4TZ0A 2OBNA 1R10A 2WJGA 1G7TA 3OIYA 3SYKA 3AM1A 3EWSA 1RVDA 1HE1C 5FBLB 3KTAA 1CJVC 1OW3B 4Q02A 3P1JA 4Q4AA 2QP4A 1ZUHA 1W36C 3I73A 2FU5C 3AP2A 4TYWA 4P3YA 3X1XA 1ZD1A 2RKOA 2XEXA 1NBMA 4KBFA 2WMNB 3RANA 3C15C 1QHIA 3MWKA 3O47A 4R2IA 1E69A 1R0WA 4TYYA 3MGCA 4L4UA 4ON9A 4BWYA 3U3OA 2V7QA 1VECA 5J40A 4O3MA 3E70C 3QNUA 4DLYA 4JLPA 3FHCB 4TTQA 3VR2A 4HI0E 2JDID 2CNWA 1PLJA 1AN0A 1ZINA 1AK2A 3NC1C 4B43A 4MRVA 1OH5A 4GFDA 4PO9A 2ZUBA 1EFRA 1BMFD 1AKYA 1W44A 1E0JA 1DE0A 3C5HA 4W5JA 2AK3A 3IO3A 5DI9A 1D9ZA 3U3RA 2FX3A 1X1SA 3B13B 2VHTA 4U7DA 5HR5A 4U02A 3A58B 4HLDA 1E0KA 3THXA 2ANBA 4M1TA 5BYKA 2W2XA 2GCNA 3CB4A 1S9DA 1A7JA 4W9MC 3L0PA 4JBYA 1TQ4A 3UANA 1MH1A 5CM9C 3O8CA 3KB1A 1P9RA 4DKXA 1IOZA 3HJNA 2BMFA 4JKYA 1GRQA 1QHYA 1DO2A 3K0FB 1R0XA 4LBZA 1SVLA 2ZE5A 4GBMA 4DUGA 3PQCA 5DSZA 1CXZA 3SS8A 2P6RA 2BV3A 1CR1A 2XOKA 1VG8A 3RRMA 2IHBA 4HDQB 5A0FA 2V3CC 4TZ6A 1DPFA 3AUXA 3LD9A 2F1JA 5G3YA 1FX0A 1NIJA 4FN5A 2JGNA 4B47A 5K8TA 1N6NA 2DYKA 1GDDA 1XTIA 2G1KA 4AI6A 3U7HB 5FL7A 3P20A 3RDPA 3QF7A 5DN6D 3CNLA 3W3ZB 1XRJA 2DWOA 1ZU4A 1KAGA 3IHLA 1W7AA 1N5JA 3FMOB 3KJIA 3A1WA 3A4NA 4UJ3A 1TUIA 2LCFA 2RGNA 1NVVR 5BN5A 4IVRA 4YQFA 3GJ5A 4HUQB 3U5ZB 1LB1B 5JI2E 1CRQA 1HA3A 3VNUA 3FMPB 1I2DA 3QXJA 4POAA 3BGWA 2QGZA 5C18A 1SULA 1S0UA 2KBFA 3LV8A 1ZD8A 2AR7A 2HEIA 3P27A 2CK3D 2YZ2A 2ODNA 4OI2A 3FHOA 2PMDA 4JJKA 2GEUA 2JJ1D 3CIOA 3UG7A 3GD7A 3L8ZA 4P4UA 1E79A 1NVVQ 5FTKA 4JLNA 3VFDA 2ZS9A 1LY1A 2VP0A 3CUEF 2FJUA 4CYMA 2ZRGA 3T5DA 5GJCA 5JCZA 4JKIA 2PLFA 4HLQB 2GNOA 5JEEA 2NO1A 2QN6A 1GKUB 2VQSA 1GKYA 2ZSFA 2L0XA 4BECA 1CJMA 1PUJA 2N42A 3QKRB 2AD5A 2O8DA 3G0HA 5H68A 2V9PA 4MUBA 4YXWD 5J4HA 1U8YA 2X2EA 2ZROA 4I4LA 4JS0A 2GF9A 2OAQ1 4O25A 4ZDKA 3K70D 3M1IA 2ZR9A 2XJ4A 4QBFA 3UMRA 5CLLA 1KDTA 2NPFA 2FGJA 4ZPXA 4FMCF 1XTRA 4LWZA 3KB2A 2WJHA 2A5GA 2QTFA 1DAEA 4C4PA 3S1AB 3U7FB 2LWIA 2ZRNA 2O8CA 5E95A 1XMIA 3TVTA 2ZRAA 4N1AA 1UM8A 1R8SA 4LJ9A 2JLZA 1G41A 1P62B 5GJWC 2JASA 1UKVY 3N70A 1KY3A 4LJ8A 2FN4A 5IRCD 1P9NA 2KE5A 2VF7A 4MKIA 4PTLA 4TSFA 3TNFA 5C2JB 5J4VA 4C0AC 1QHHB 1YJ5A 4KV9A 1V5WA 4ZV4A 2ZVQX 3BFXA 3PG5A 3GPLA 1H8ED 1FMJA 1HTWA 5FOUA 2HT6A 4UNPA 2YINC 2CDNA 4JZKA 1HY3A 1YR7A 3K53A 4LBVA 2VP9A 1IHUA 1PVOA 1G7RA 2CCJA 1MV5A 3MWYW 3ZZ0A 4RSGA 3KQLA 3K0CC 2B92A 1DVRA 1MRSA 1PLLA 2A9KA 4RD6A 3SBDA 3I4LA 3OHMA 2ZRKA 4OL0A 2VSXA 2XITA 3TE6A 3LA6A 1KK0A 4TMZA 1Z6YA 3MJRA 3RC8A 2Q21A 1XD2B 1DOAA 1AGPA 1IY1A 1XJ0A 1BMFA 2NOAA 2X8AA 4CEIA 4BEBA 5H1YA 5D3MB 3LNCA 1TEVA 4KSCA 3ZZUA 4CT4B 1GVNB 1IQPA 1LNZA 1Q22A 1R6BX 4UXIA 3VR3A 4DSOA 1F6BA 4IOMA 5HCNA 3VTKA 3CRVA 1TQDA 4OHZA 4DVGA 1GOTA 2PLRA 3B8HA 2OO7A 4V0OA 2J9RA 3RS2A 4P32A 3W90A 2J0SA 4IFEA 3THWB 5LDDC 1WDTA 2ZPTX 1G4UR 4NCNA 3C14C 3DZ8A 2QRZA 4R9UC 2F1IA 4E22A 5JJIA 2ZVPX 3THOA 3L2OB 4K46A 3P4YA 1U90A 3FOZA 4DLWA 1J7KA 1UBCA 3AKYA 3EZFA 1NNEA 3L0IB 5KSOA 1NY6A 5AJYA 2O8EA 1FL9A 4OHYA 1MO6A 2AN9A 2V6IA 5DN6A 4LX0A 2J41A 4FD2A 4Z54A 2ZSDA 1XMSA 4XOIA 1U8ZA 1U9IA 3TW4A 3PEVA 4ZDIA 2CBZA 1NIPA 5KO2A 2F9MA 3Q5DA 3LBIA 1XB2A 5FBQB 1S2MA 5TXGA 4PR0A 2GEDA 3OF5A 2MSEB 1GIAA 4FW9A 4DXAA 1ZIOA 4DSUA 1MO5A 2IUTA 2YOHA 5L3SB 1SVIA 2FEOA 4ZO4A 3SDZA 2FGKA 3TMKA 2GJSA 3EA0A 2CK3A 3KQKA 3VR1A 4C3ZA 3EAQA 2ZAMA 5AUOB 1YZKA 1CKEA 1M74A 4WA7A 4YONB 4B32A 4BPBA 1JPNA 3EZ2A 1N5LA 3R9IA 2NQ2C 4ERNA 2QMOA 1FPMA 2C9OA 2PJZA 4B33A 1E2MA 3TQCA 4IOKA 2YKGA 2CHVA 2D74A 3QPUA 2IYVA 4ACBA 1G8FA 1MR3F 4HAWA 2CJWB 2Q3FA 3UPUA 4FXPA 4A8JA 1PLKA 3IDQA 1Q57A 2UZIR 1G16A 3QG5A 4HEJA 1Z29A 4YXWA 5FUWA 5EQTA 4OK5A 3EG5A 3T1OA 3GLIB 4A82A 1OXVA 1KKLA 4P33A 1TTTA 1RRGA 2RGCA 3CRQA 2FG5A 3R8CA 5FR1A 5HZHA 1WQ1R 3DPUA 5JBQA 3AVVA 1OLOA 4R2HA 4AWXA 1P2VA 2REXB 2J46A 5JCPA 3W9YA 1KI2A 3GJ3A 1NLZA 4L5BA 3GLGA 1WMSA 221PA 2CL6X 5HKKD 1FUUA 3SYNA 1CIPA 2CHGA 2VHQA 4NE2A 4US1R 1ZJ6A 3ZDQA 2WV9A 3W6OA 3PEYA 3B1YA 3CO5A 2EU8A 2QAJA 3THYB 3K70B 4I81A 1PUIA 1YRAA 1TU4A 4EFNA 3K09A 3U3MA 3CZQA 3L8YA 3HR8A 1KNQA 2R6FA 2AKAB 2YWFA 2WWGA 4B44A 1Z07A 1TADA 4G5QA 5HZKA 1E1QD 4WZAE 2OLJA 4F93B 3G5UA 4Z1MA 1TMKA 4KLNA 4OJQA 4AY2A 1GILA 4OK6A 3EZ6A 4QM7A 5F2EA 1N6RA 2RHDA 2IXGA 4OI1A 3HPQA 4OK3A 4OHXA 2IHYA 1SKYB 2GWHA 3TK1A 3BOSA 3SC3A 3UIEA 1K8RA 3M0EA 2R6GA 1OHHD 4Q5IA 2VF8A 4ARZB 4OQNA 3U44B 1AIPA 3NBZC 3HU1A 2QTVB 2QMEA 3QEOA 3CX7A 3NBYC 1XNJA 2WSSD 1U94A 4DDWA 5E4FA 1GUAA 2ONKA 1FTSA 2GA8A 1KSFX 5A4JA 2FNAA 4LJ4A 2QPTA 2YJTD 1TF5A 1ZAKA 1Q12A 4A4DA 4A2QA 1VIYA 2C98A 1KKMA 3BE4A 4DT1B 1H8HD 4IEIA 1SKYE 2XB2A 3Q9LA 1LV7A 5DLQC 1ONBA 2CE7A 3P32A 2FH5B 4TYQA 3X1ZA 1MKYA 1OYYA 3T15A 1FQJA 3A4LA 4A15A 4K8OA 1XCMA 5KUTA 4PSVA 2Z4SA 2C99A 2F1RA 2O8BA 1BIFA 1SHKA 1SXJD 3SOPA 3GLFA 4YMTA 2MMCA 2OFXA 2EFCB 1UKEA 3PJRA 3CX6A 4BLPA 1UDXA 2AK2A 1G3RA 2PZEA 1V43A 3QJYA 2XSZD 4DCVA 4CEJB 5EE5B 1LFDB 3UMFA 1XCPA 1N6HA 2V55B 2F1HA 5IK2D 3TUIC 4C0KA 5GADl 1UBGA 4DIEA 3VU9B 2BJWA 3B1VA 1RFLA 3SHWA 1RKBA 1W2GA 4EJSB 1Z3IX 5KSZA 2V1UA 4KCGA 1JNYA 1TF7A 4MA4A 4D80A 4URUR 1KO8A 5KDLA 5AUPB 3LXXA 3EASA 3UK6A 2ZAOA 3ZQJA 4LJ5A 1UF9A 1SZPA 3C8UA 4MGYR 3GLHA 2EFGA 1R2QA 4LHZA 4M9QA 5CJ2A 1SHZA 5FUYA 3TAUA 2DCUA 4I1SA 1EX6A 2IYUA 1XFAA 1MO3A 1K5GA 3M6AA 4NBSA 3B85A 4URWR 3EX7C 4HATA 4MGKR 1KI1A 2G1JA 3AVYA 3EC1A 3W5JA 2QEQA 2A2ZA 1E2PA 2PEZA 5JHGB 1XZQA 3T1VA 4E03A 4OI4A 3DEFA 4B3FX 2ODEA 3DM5A 1UFQA 1JXOA 1QHXA 2J1LA 5C46F 3N2IA 2QL6A 1E9CA 4RFSA 2C9CA 2ZTSA 5JI3E 1B23P 1YVDA 5KNBA 1E32A 2VPPA 1ZM7A 2JLYA 1U0HC 1ODFA 3JZAA 2IYZA 4EPVA 2P5TB 2QPOA 4LJYA 3EZ7A 1ANKA 5H8WA 4HB0A 4G5GA 3AVXA 2RGGA 4IDHA 1AJEA 1HH4A 3NBXX 4BLTA 5FH9A 1AQUA 2ZYWX 1VDZA 1N2CE 3DZDA 3C41J 1WRBA 3AF1A 3P4XA 2Q0HA 2VRWA 4TWZA 1EGAA 1Q1QA 1VCMA 4US0R 3EZ9A 1YZGA 5HKKA 4IXNA 2BC9A 1KO4A 4DLSA 4Z8XA 4JYCA 3RRNA 2P3SA 4G1UC 3ADCA 5FOVA 1J70A 2ZRHA 3IQXA 4DDVA 2Z4RA 2R62A 2JJ8A 3IIMA 5JMTA 1JPJA 1NLFA 4DLVA 5CK5A 4D81A 1NKSA 5FPKA 3IHWA 4GI7A 3QKTA 1DBSA 1WXQA 2J0UB 1XF9A 3RWMB 2GCOB 5JLJA 1RRPA 2NO7A 4MYCA 1P73A 2CE2X 2VP6A 4X8HA 2IYQA 3SU8A 721PA 2GBLA 4PX9A 2OSBA 2NO0A 2FDCA 1E1QA 3AV0B 2R44A 2PX0A 1W49A 4TQUS 4EJSC 4LYHA 2W0SA 3AH8A 3CX8A 3W8RA 4PZYA 3KQHA 1MOZA 4LYFA 3T12A 4UNNA 4GZMA 2IYXA 3U6BA 4GNKA 3RS4A 3O8BA 2EFDB 2G9NA 3QKUA 1KHTA 1OHHA 2J7PD 3TVDA 3CPEA 1NN1A 1M34E 5F98A 1VMAA 1RW4A 2WBLC 2AXNA 1OXXK 2ZETA 1S1CA 2IXEA 2EW1A 2FZ4A 1ZUNB 1EFUA 2JATA 1T9HA 4KU4A 2YVUA 1YKSA 2KWIA 2WKPA 1N6KA 1N0VC 2A5FA 2OM2A 1P61B 2QUZA 2XAUA 2WSSA 3QXCA 4P4SB 2EVWX 2ZI6A 4TQ9A 3VKWA 4YMUA 4OQXA 3CRMA 1EESA 3QI2A 3AVUA 1Q0UA 1W46A 2E9SA 1S1MA 4Q9KA 3KFVA 5G40A 2ZI7A 1C4OA 1H8HA 3AKCA 4PPGA 2O8FB 5BN3A 3ZH9B 1N5KA 5DE3A 5BW8A 1Y63A 3D7MA 1NF3A 4XWKA 1GSIA 1TQ2A 4LV5B 3WHKA 4NKRA 1OFHA 3B9PA 3GLIE 1IBRA 5CM8B 4JLBA 2YHSA 2WM9B 2ZI9A 1CTQA 1ZYUA 1G8YA 1MT0A 5KPJA 3K0AB 1Z0JA 1JI0A 3BRWD 4DCUA 2GZDA 1JR3A 3KXKA 4II7A 4ABYA 1CJTC 1EFTA 1Z6GA 1HYQA 3QPVA 4NONA 5AUNB 4Q19A 2OFWA 2ZR7A 2ERXA 2Q9CA 1FNMA 1TUEA 3BB4A 3NG1A 5C4MA 1EG7A 3DMNA 4L8GA 2PT5A 4C2TA 3KJEA 1KNXA 2Q3HA 4RD4A 2GDJA 1WP9A 4O2LA 2YC4C 4BRUA 1TEXA 1WE2A 2JLSA 4JBXA 3A1VA 5EP2A 1SXJB 1U99A 3U6KA 1P2UA 2OCAA 2P6UA 2QNRA 1Z5ZA 4HZUA 4Q1BA 1KI7A 2ORWA 4P0TA 1KY2A 2HJGA 1DO0A 4NYJR 1Z2AA 3KKOA 4XD7D 3X1YA 2LKDA 1WBBA 2ZXUA 1DAMA 4D0GA 1OFIA 2CCGA 1DAGA 1E2NA 3FGNA 2WHXA 1G17A 2XTNA 4BGDA 2IC5A 3VHXA 1J8MF 1WA5A 4KVGA 4CEHA 2BWJA 1HQYE 1I4LD 1XD8A 2H1LA 2PX3A 4C7OA 1E4VA 1II8B 1S3GA 3WBJA 1XXHB 1G3IA 3AEZA 3R8FA 3DKPA 3T35A 1N6IA 1I4TD 1NG1A 2A78A 1KI6A 4D82A 2GJAA 3ADBA 4HAVA 1C9KA 2VYFA 1B0UA 3HPRA 5EXPA 1G21E 3X1WA 2C8VA 3SJAA 1W1WA 3BIFA 1R5NA 2IK8A 4TSFD 4GMXA 3BXZA 2QROA 4F91B 2CVHA 2YYZA 4I1UA 1T6NA 3V4RA 4OKSA 5KDOA 3GP8A 4BFZA 1N0UA 4ZI2A 4HDOB 2DWPA 1XXHE 4JLOA 2HYDA 4AD8A 1LW7A 3A6PC 3P26A 4MRPA 1CS4C 2VLIA 3PFIA 3SFVA 4EPWA 2HYIC 3B7GA 1US8B 4E5UA 4ZIRA 1JQLB 4NZYA 4TQAA 1XMVA 4UKDA 3CBQA 1E1RA 3REFA 421PA 1ZM9A 4HDCA 1KDOA 2BEKA 3FKSA 2IYYA 3KTAB 3ONWA 4Q4AB 2I1VB 4CF7A 4JVNA 2X19A 5LB4A 3L0OA 4JLMA 1UEJA 2NZ8A 3N2EA 1X8JA 3VX3A 4PHFA 4XH9B 2VL7A 2TMKA 3HDTA 2RMKA 3MCAA 4PO8A 3BD9A 3NVAA 2MSDB 1DEKA 2J7PA 2F55A 4V0MA 4YDHB 4NTZA 3I3SR 4BFYA 1P4SA 1UEIA 4LY6A 3H86A 4RD1A 2W00A 4LGMA 3R7WA 4W5HA 2VP2A 1X6VA 2W6JA 1Z08A 1G6HA 3Q85A 4MYHA 2ORVA 1IN5A 1ZMXA 2FE4A 3DL0A 1IXZA 2H7VA 1VG9B 1XTJA 1KK3A 5K8UA 1G6OA 1P72A 4FWIB 5L3QA 1G9XA 3CPJB 2EYQA 4JBWA 4BASA 1D2MA 1KJZA 5L3RA 4D4KA 2QI9C 4F38A 2GAOA 3LBNA 1G3QA 5JJKA 4C0BA 1S9HA 3LX8A 4CRWB 3THXB 1UBEA 5EE0A 4QJ4A 3PUXA 3KQUA 1F2TA 4PQYA 3HU2A 3DVLA 2JA1A 2Z6VA 2VA8A 4DLTA 4PHHA 1NMZA 4QHTA 2BCJQ 5JFGA 4A6XA 3ZLJA 2J0VA 1F5NA 4HAYA 3TUJC 2QM7A 3T5GA 3JVUA 2ZRJA 5J4KA 3JVVA 4NDZA 3ETLA 3EPJA 2GCPA 1GL7A 1XJQA 3LDAA 1FX0B 1HT2E 2GHIA 3PUZA 4C0LA 1N5IA 3CF2A 3ECCA 4Q9JA 5CK4A 4I1VA 2QP3A 2WIAA 5K8LA 3V9PA 5KSYA 5FTJA 4ESHA 2JEOA 3AVPA 3GJ4A 3LQRA 3N5CA 4Q48A 1HT1E 4M9SA 1BOFA 3Q3JB 4XD7A 4DEXA 3U7GA 3A1UA 1BYIA 3C4JA 1OIVA 1Q1BA 4TMTA 3T61A 1RRCA 1M2OB 3KJGA 4Q4JA 2QQEA 4D6PA 4KAXA 3SYLA 1OFTA 1G5PA 1E2DA 1L4YA 1NJFA 2PT7A 1G64A 3D31A 1XPOA 3ZVMA 4ITRC 4HB2A 3K8YA 4A36A 2B8WA 1JALA 4FINA 4IKEA 1A2KC 2ZYVX 4M22A 4Q66C 3ZS9A 4NL4H 2C5LA 4MH0R 3QIAA 2H92A 1E9RA 4QRHA 1E4YA 5AJWA 4Y0VA 1ZC3A 2O8DB 2AL7A 2J45A 5JWHA 4MGIR 1ZUIA 5FBWB 3CF6R 5FL3A 4PC1A 4G0NA 1P7CA 4LHWA 4JT2A 5GJBA 5EE1A 4LC0A 3VKGA 2H8KA 2GEVA 1W48A 4QBHA 1N0WA 2QGNA 1RJ9A 3IBYA 2PBRA 1E9BA 2FPMA 3HYRA 2GAAA 3KJHA 4G5OA 3RHFA 2O8CB 1J90A 1FW6A 1LF5A 2FV8A 4Z1MD 1VIAA 2E87A 3AGQA 1R0ZA 2A7QA 3DDCA 1KO5A 3MWLA 3DOFA 2ZUCA 5AR1A 3QG1A 4JLDA 4A0HA 1ZNYA 3K9HA 5JRJA 1W4AA 2QRNA 2PZFA 1AZSC 4NCIA 3MG9A 4TLEA 5FUVA 4YDSA 4HLUA 4OHVA 5DGXA 1UJ2A 1OT3A 2NO9A 4DLZA 1E9SA 5IF9A 3AKEA 1VG0B 1XP8A 3QE0A 4PSAA 2RGNC 4NCJA 3F8TA 3HR7A 3OESA 4H1UA 4JL6A 1JQJC 4XVQA 3W8NA 2GRJA 3SQWA 1HURA 1N25A 1Q3HA 5SZHB 4OI0A 1HV8A 3WRXC 2J3EA 1W0KD 3DMDA 1E2LA 5DIFA 3U3KA 3WNCA 2VBCA 1PZNA 4YMSA 4OQLA 3LH5A 1KGDA 1T5LA 4WVFA 1BKDR 2J0QA 2G6BA 1RZ3A 2GJ8A 3E5HA 1GFIA 4PQRA 2OEPA 1FUKA 1Q3TA 4KVAA 2GK7A 4CEIB 3CKLA 4RD3A 2OV2A 5EXTA 1W0JD 1YZUA 2XB4A 4KFTA 3T1TA 1ZRHA 1XPRA 3B60A 1G3UA 2G3YA 1IXSB 2W2VA 2DBYA 1AS0A 3MMPA 2B7BA 2JAQA 4KFSA 2GESA 2Z5FA 3BFVA 2BCGY 2W58A 1XDBA 3JZMA 4PC6A 4IXMA 5EJEA 3Q7PA 1Q1EA 2C78A 4TL9A 1L7VC 5EZ6B 1OXUA 2OCBA 1TX4B 3TQFA 1X86B 3EIEA 3FFAA 1L8QA 5FTNA 2HLDA 2P0EA 3VAAA 4B74A 2YC2C 4DSTA 1L2TA 4UXJA 4DCNA 1A1VA 1NSTA 2D7CA 2ZEJA 1TAGA 1N6OA 1S8FA 3BK7A 5DI3A 5AWFC 5J5CA 4NP6A 1LS1A 1KI9A 3LW7A 3FWYA 2FEMA 4KJZA 4MITA 3WY9A 5JJLA 3T34A 2O8EB 4JSYA 2NO6A 5EP1A 4ZKEA 3SNHA 3U4QA 2YNMA 2C95A 4WXRA 3RYTC 1W4BA 5HTKA 3TRFA 4Z8YA 2FFQA 3NHAA 3KX2A 3ZS8A 1F48A 3H2YA 2HXYA 3BH7A 2QT0A 1YZNA 1Y3AA 1KZGB 1PJRA 1MRNA 4H1VA 4C0JA 5M04A 3VNVA 1UADA 2GVZC 5C1BA 1E94E 3CWQA 4XJXA 2BJVA 1OXSC 4FCVA 5AJZA 4DSNA 2QAGA 4RCYA 4KLZA 4RZ2A 3I62A 5CYOA 3C7KA 4KYUA 4D0NA 1IXRC 2C77A 4PHGA 4PPQA 2RGXA 2VSFA 4NPHA 5KPDA 3GJ8A 1JJVA 4URYR 1E98A 1ESMA 1A5TA 2DPXA 2FFBA 2HF9A 3EWAA 4OJKA 2R65A 3K0EA 1KK1A 3OZXA 1YQTA 2WJYA 1VKJA 2ATXA 1NVWQ 3FTQA 4QBGB 2BEJA 2V1XA 1ZW6A 4M8NE 2B7CA 3LAWA 1VCIA 3OIUA 3IILA 2A3RA 3CRW1 2RHMA 4A8JB 2QSYA 1NVXQ 2IT1A 2ZRIA 2BBOA 3IIJA 1ZM2A 5TVKA 5FOTA 5GVSA 2H16A 4Q21A 1D9XA 2KI5A 3DOEA 1OPXA 1NLYA 2QMUA 5G53C 2FFHA 4GP7A 1P60A 3NHBA 3QEJA 3I72A 3KXLA 3PVSA 4Q18A 3R9XA 3GLGB 4BZQA 3QF4A 1X8KA 1K6MA 1U0LA 3CLVA 2F43A 4Q7KA 5LBIA 1O87A 4BFVA 3GCGA 1KO7A 1DAKA 4Q4LA 4BLSA 4LDJA 4B73A 2BM0A 1VPLA 4V0LA 2IEYA 1Z0FA 1G19A 3G82C 1E2FA 2V54A 4RVCA 5G41A 4BEJA 4OQMA 2C2HA 3PEUA 1UDWA 4U00A 2HCJB 2WWFA 4BFUA 4O2RA 3F5FA 4URVR 5JSZA 3LXRA 1GG2A 1ZBDA 1HEIA 2UZ3A 2BIFA 3AP1A 1GWNA 2CL0X 1U9IC 1EX7A 2ZRBA 2WTUA 2F3TA 3BWDD 1JAHA 1DAIA 3IPYA 1Q1ZA 2P67A 4MRNA 4EUNA 5TMPA 2FMXA 3GLGE 1EFHA 3WXMA 2IYTA 3DHWC 1VHTA 3QOFA 3K9GA 3QXSA 4LPKA 3NC0C 3NWJA 5BYJA 5J4YA 1U8AA 4PAMA 1Z28A 3ADKA 3AUYA 1W0KA 1I4DD 2UVQA 2JLRA 1WB9A 4PANA 1MO4A 3VR6A 3KFXA 1QHNA 2ZRPA 2OESA 2PZGA 5DYIA 3UWKA 2CL7X 3WRYC 1KDRA 2BVNA 2NGRA 1W0JA 4CZ2A 1UBFA 3W34A 3RLFA 4L16A 2FSIA 1DELA 1EXMA 1KYIA 1SVSA 4B48A 4FI3C 2ZM5A 5JZVA 4PPFA 2ONJA 1CBUA 4RZ3A 1W36D 4LBWA 2QORA 1D6JA 2VIIA 1WBDA 5SZKB 2EWVA 3ASZA 4A8JC 3ADDA 1JR3D 3AB3A 4DCSA 3BJIC 1AGRA 3BBPA 4TT3D 3K70C 4PO1A 5UKDA 3H84A 1KSHA 4W7SA 3QXHA 4BZPA 2PJRA 3VX4A 3SN6A 3K0SA 1WF3A 2RGAA 3KDSE 4RY2A 2W2TA 4C2UA 4GDFA 2XJ9A 5KU1A 4QC2A 1XTKA 2NPIA 3QBVA 1OYWA 3H4MA 5FBRB 2O8BB 3GLFB 1TPZA
chains in the Genus database with same CATH superfamily
1CS0B 5DX1A 3R44A 1VIDA 3WK8A 3D6HA 3K9NA 3JD4A 1FJGB 1XYGA 4KGZA 2PQ0A 3EPRA 2WKQA 4P2GA 2C4MA 3NBMA 3U0BA 3DT6A 1ZNZA 5KYUA 1YS1X 1JJ7A 3K09C 4HV4A 3OURA 1R4ZA 1J0DA 4LS3A 4UUOA 5B3LA 1MEEA 3IBFA 2IUEA 1JDTA 4G01B 4HZIA 4H3HB 4L6AA 3W78A 3IJPA 3I6ZA 4WFJA 4AK9A 4RQUA 5TDHA 4BLVA 3MT8A 4BQSA 1UFVA 3ORYA 4WOCA 2CHFA 5CDSA 3HQ4O 4YRZA 1DDIA 2R60A 4AZVA 4BO8A 1L9XA 3IDSA 1JFFB 4B8YA 3RHSA 5LD2B 1F12A 3HACA 1JE1A 1EXNA 1JHMA 1LRKA 3SIXA 4US2R 2ZSEA 4QJ3A 3OKAA 4FDAA 1CUVA 1DC4A 2F1OA 3EGIA 3PPVA 4QOJA 4AJOA 5KCZA 1XVLA 1KQGA 2HCRA 5KKNB 3VMFA 1RAEA 1XWIA 3COVA 2CYBA 1P17A 3TSZA 4UOEA 1OH8A 4IVQA 3UXYA 1NQVA 3A6HA 1GA6A 4UJ5A 5DO9A 2JCBA 3WMXA 1KJNA 3N74A 3OQOA 5LL6P 1YHNA 1KVQA 2C7VA 4J1NA 3I6MA 3IKLA 1Z37A 1YAJA 2FUEA 5AVVA 3Q1LA 5I7RA 4BJ6A 4UD2A 1XZJA 4RFSB 3GVCA 5TVGA 5BWBA 2GHRA 4XVRA 2O0HA 1ODKA 2XUQA 1E9DA 1QGUA 1QQ5A 3KM0A 4J7XA 1LTKA 3EODA 4IDQA 4ZC8A 2FPPA 3GLHE 4UBIA 5ITVA 3CO0S 5ERYA 4YMWA 4Q7LA 4NK4A 2EBFX 1GDTA 5C81A 1ZP6A 3W8NA 1XEXA 4LZLA 4ENSA 1Z88A 3SXJA 3PT5A 4CBVA 1U7XA 1LK5A 3ZDYB 3MWGA 3N3AC 2BD0A 3VU8A 3ZGXA 5IWAB 2WPDD 3VAYA 1NFRA 2I3ZA 1NN0A 2F67A 1NMQA 1OAAA 2R2GA 1WSDA 3WO0A 1Q19A 5KNDD 5FPYA 4UD6A 1G55A 2WD8A 3E58A 1MABA 4FK8A 4ZOEA 1W4CA 3NS7A 2QD1A 3ILVA 5D87A 1R6AA 1ZHOA 1L7QA 3ZWYA 4OF4A 4LGYA 4UMEA 1F2UA 3G2LA 1KMHA 4M6WA 1ADFA 1E99A 3R3SA 4PBSA 4S0ZA 5TX7A 2ZG6A 4R2XA 1TYAE 1JTFA 4H4EA 1LSSA 2AJTA 5DFAA 3WZLA 1ODIA 3TBKA 1IPEA 1J2JA 1AD2A 4EGFA 4EKDA 3ZGZA 2F17A 2ZZKA 3UO8B 2IF2A 2BE9A 2Q5HA 3ZCRA 4ZI3A 2YXBA 2O1EA 1SU4A 3AVQA 3B1JA 3W3AD 4BWVA 1G2PA 3VOAA 3RAPR 3JZDA 2QKYA 2JJYA 1II0A 1NP7A 3P0EA 5BN1A 3SZRA 3MTEA 4R2LA 2GYWA 5EP4A 3GN1A 3SX0A 5DM2A 4RAOA 1Z22A 2VJNA 4FHDA 2PYZA 3KCNA 3L1VA 3NANA 3WBKA 5LJLA 2AFRA 5E38A 4G4SO 2QVXX 4A9AA 2RHWA 1VKRA 1G18A 2D5BA 4JJZA 4YRFA 5K8IA 3UAZA 2ZSHA 5JAQA 2IVZA 4DLXA 4EMSA 2Y9PB 2IH5A 4C6TB 5B2ZA 2Z58A 1JFSA 3JW8A 4MWOA 3RV3A 3FYDA 5D3ZA 3TOCA 1R4AA 1U2GC 3I2IA 1EQUA 4IXWA 4RVHA 5DBGA 5B58C 1G5RA 3T1YB 1I3MA 4BU1A 4EZEA 2UUOA 4F04A 1DFGA 4B2LA 3HYTA 3KUUA 3HXLA 3A37A 2I6GA 2RGDA 2CHUA 2FRDA 2RC5A 2ZCVA 4QU5A 4CR8A 2CNNA 1QVAA 1UFOA 3OE7D 4NYIR 4Q9DA 3GNQA 4EIWA 1KYQA 5AXDA 2NU9B 3DLIA 4GS5A 2WAXA 1VGRA 4UQOA 1XZPA 4JFRA 2H2GA 3RS8A 4L5IA 1JXAA 1FRNA 4DE5A 4E07A 3CSUA 5IHXA 4ISBA 4MKGA 3CUYA 5KYXB 3DP7A 1LPMA 3F7OA 5CVDA 4RHXA 4OB8A 1FXWA 4TKVB 5FPPA 5TMEA 1UBRS 2JK1A 5CCDA 1KI8A 3VC1A 3B36A 3RTCA 4MKFA 1H2AS 3LK7A 1Y7HA 3BICA 1OXTA 2EWWA 3D5EA 3FYSA 4HXEB 4MW5A 4TLAA 1OLUB 5NLLA 3RS0A 3L6DA 3PHGA 4I1YA 4HPXB 3L04A 1OF1A 4WK6A 1SK8A 5CDFA 3ZHOA 2WHPB 1LSJA 3PIIA 2RI0A 3E22B 2DE0X 3GGDA 3JASA 4CM5A 2FKAA 4OHMA 3U3JA 1VJRA 2P3LA 4UZEA 1XRRA 1LLDA 1EMDA 2JI6A 2VNKA 5EPOA 5WRFA 3W2TA 1FTWA 4UPVA 1G66A 2ZPAA 4RJJA 2P6NA 4FSHA 4D57A 3MOSA 2CCKA 4Q00A 5I4CA 2G0NA 2Z2KA 5LU8A 1Y0BA 3SFZA 2P75A 5EP3A 1L0BA 1RXIA 2VDUE 3NTUA 4G0OA 1W88A 1CJCA 4HN2A 1ZNWA 2FOLA 4N0MA 5C4GB 3D8RA 2AKYA 2QSJA 3JSAA 4LNHA 3FHLA 1IMOA 1SXJE 2IDKA 4N82A 4XSHA 1N4AA 2NV2B 5AKIA 2O19A 1GY8A 3G79A 1NYLA 2GD2A 5HFJA 3UG6A 2OFPA 1QTIA 1ZGCA 2R47A 5IZ4A 4YAGA 1TEHA 2XMPA 5EIEA 3DTVA 2AV6A 2I54A 3TKAA 1BFDA 1ORRA 4BQRA 1YIAA 5FJIA 1K2WA 2HCTA 2I87A 1D1SA 3Q8XB 1JKJB 3LQ1A 4PYIA 1LDEA 1GAEO 3H6HA 2ZZNA 3HCFA 3RYHB 1GR0A 2RKBA 3AEKB 4J0JA 1M76A 4ZXPA 1AZTA 1DWUA 1VSUA 2AOWA 2E5WA 2Q6LA 1Z5WA 3I2GA 3NWEA 3CQ9A 3DVAA 1S5PA 3O1IC 3K9CA 3GDFA 3FFTA 1E4EA 4QVIA 5TARA 2FUKA 2AFIE 3QEKA 3RRZA 1LLUA 3HO6A 1FZQA 2ZKLA 1KI6B 1R88A 3BGVA 4JBGA 4YP5A 5L3VA 5EZYB 3ZU5A 2PMCA 4B35A 1CY8A 4D2IA 3K71B 1EVEA 1BDMA 2X58A 4A2CA 3NDBB 4KBGA 1U2RA 2UXBB 4DQUA 4PINA 4EF4A 4IX1A 3D4NA 1E9AA 1K7SN 1QORA 4M3NA 2WJPA 1JDJA 1EINA 4DBLE 3FYUA 4WCDA 1E96A 3V4ZA 3J81k 1OV4A 2VZEA 4E33A 1GGMA 3QNWA 4HX9A 4HFRA 1ZIPA 4RK5A 5FF9A 5I9SA 5EQJB 5LKAA 1D7OA 3BSFA 3EQ8A 3PQ5A 4JUBA 3R3WA 1GNSA 2GPYA 2HMUA 1Q44A 2A5DA 5DSXA 4EFKA 1CNFA 2DSTA 1OB2A 1P2FA 5DGCA 3WNQA 3JQPA 3H2BA 4GMFA 3FPFA 1DQSA 1KS2A 2A86A 1KBQA 2JFXA 2Z83A 4U3JA 2WUEA 3H0KA 3BL8A 2F8MA 3R0VA 2H7XA 2ERYA 3NHSA 4U2DA 1RPNA 2I2DA 4XJVA 1S7CA 4MLDA 2QN7A 4O5OA 5JDCC 4BNHA 2Y1GA 4N4AA 2OWDA 4FS8A 4RLHA 4A0RA 1M1NB 2HU7A 4UARA 3T3DA 3B5JA 3A14A 1KEUA 1E5LA 1BX1A 4MQBA 2PH1A 2ZS7A 3GJ6A 3KLBA 1ENYA 2JJ2A 3BIXA 4JDPA 5L53A 3AR7A 3CTMA 1LTQA 1T3HA 2XKKA 3JQFC 2YMLA 4FC7A 1X8LA 4A92A 2QRJA 2IU0A 5DM60 5EJAA 1H9AA 4KO3S 1BYUA 2JLQA 3R7WB 1ABBA 4M1QA 4BE4A 3KKZA 3MJDA 3P0HA 3ZQ4A 5HDBB 3FUTA 1JEQB 2FN3A 4ACAA 1S2OA 2JBWA 1Q2XA 2BBWA 1MAWA 2HX1A 1AS2A 1BTOA 1DNPA 1F1BA 1RVV1 2GCIA 4ZCTA 1GKIA 5K45A 4DYDA 2OLKA 3GP5A 3LJKA 4D79A 5BR1A 3L0SA 5L3QB 2ZTUA 3C8ZA 3GJYA 1SQ6A 2YJZA 4XA8A 4XASA 4DMMA 2ENUA 2WTXA 3JQGA 4L50A 4WNIA 3HKEA 3WHPA 2QD5A 1V1JA 3FRIA 5BN4A 3IQEA 4PC3A 1L6IA 1KSJA 2CVZA 4JMPA 2P6MA 3TGWA 3G8AA 1MHTA 4X24A 4KMSA 2HF2A 3E9QA 4ZDWA 5CA1F 1EVKA 2VP4A 4MZXA 1F2TB 3C8HA 2A30A 2B8JA 2CKDA 1BXRA 5JH7F 4CQLB 4QUDA 2WD7A 5BPFA 5G1NA 2Q4DA 1SVKA 3K3PA 4L7VA 4FOSA 1IAQA 4F4JA 4ZYTA 2QY6A 3AF2A 4JBLA 2B36A 2HDWA 2X6RA 5LYYA 5JVDF 2PGXA 1AKVA 4ZO6A 3ZV3A 4PC7A 4RF5A 5BNFA 5KJFA 4I14A 2B82A 1Z33A 3I53A 2A5JA 2KJQA 2EG5A 3LWNA 3LGXA 2NVWA 1KYTA 5E9AA 4OAOA 1KZ7B 2Z3WA 2OHGA 3HU3A 3KJQA 2VP5A 2VDWA 4QA9A 1BROA 1ZQ1A 2W6IA 2IIPA 2IYNA 3QKRA 3SYMA 1FRFS 3RAFC 1KO1A 2HWWA 4W9RA 4KACA 5CGQB 1PR0A 4XVUA 4GL2A 4C3UA 5AQ1A 1DC5A 1TCAA 2GSDA 3NH6A 1N3IA 3KZKA 3MBOA 4UEKA 1PS0A 4QFMA 4MYSA 1NUSA 2H9YA 3VBCA 2PTHA 1D1PA 1NI4B 3FPJA 3BH0A 4HGYA 3T3IA 1XWFA 1FC0A 3T8YA 1NXVA 1QBKC 5KTOA 5SYMA 2RGYA 2IPAB 1RJWA 4Q4JB 1CQPA 5EPEA 1J1IA 2GK3A 2OENG 4FJ0A 3UMVA 3BDIA 2NLOA 2H00A 3GMIA 4RD0A 4JYAB 1UC8A 4EL5A 3IEVA 3ZHRA 3EW9A 5TS2A 4CIAA 4LQDA 1ZC4A 1NT4A 3C3WA 3N07A 3IUPA 3PWTA 3E81A 4A2WA 5HF6A 1SUEA 4HR7A 5GIPE 2VK1A 1DG9A 3RS7A 4P38A 4AY3A 4C3VA 1CUBA 2GVNA 3B89A 2PMKA 3AHIA 4J0HA 3JAWB 2C8JA 3IE2A 4LVOA 1LLCA 3BREA 2I76A 4OSOA 3KQQA 1YASA 3K94A 2FQYA 1CQWA 3C5CA 1ZK0A 4ZP1A 5JAOA 1A7UA 2AZ4A 4KNWA 1RI3A 4RJLA 3TF5A 3S2EA 4WERA 3SZMA 3EPHA 2ZDHA 1OA0A 4TZTA 4OBEA 4RANA 2IUUA 3L8HA 1VPTA 3AF4A 2QZZA 1LCIA 2O7NA 2C97A 4W6QA 3A9TA 1KC1A 1UBUS 4K6FA 2YWGA 2ZBGA 5EMJA 2C2ZA 1CG6A 2GCEA 2WJIA 2JL1A 4L57A 4RHTA 2O07A 2W2LD 3ITDA 4BVFA 1CUZA 5E2IA 2PT9A 1P91A 3O2JA 2D4HA 4NESA 2VWPA 1M72A 3K6KA 4NOKA 2I5PO 2ISSD 4F2DA 1XEWX 2JCGA 1YJCA 2WRZA 4ECAA 1PD1A 2JLWA 3GFPA 4I1OA 4PLYA 7GPBA 3OOJA 3NORA 3L06A 2BGLA 1I51A 4ENPA 5TT0A 2BZGA 1VTKA 1AB6A 3CWZA 2VJQA 5TF4A 7REQB 1EUCB 2VTDA 4UVHA 4RO0A 2AVNA 2LCQA 4Y9UA 5AVQA 4TV8B 2XBMA 3OT1A 4J2TA 1NQAO 3IEXA 4JLUA 2XUHA 1EBFA 1IN4A 4QUEA 4YMGA 3R6DA 3VR0A 3CW9A 2ZJAA 3VR6D 2OSVA 4RA9B 4QNMA 3KPJA 1KMMA 3IVAA 3ROFA 4Z4QA 1R37A 3NUZA 2YH2A 1SGWA 1WXXA 1E6CA 3OIWA 3Q5EA 4P86A 2XYRA 4BRWA 1N3YA 5F76A 3ZTYA 2IS4A 2HC9A 3WGLA 1RWMA 2NU7A 2OZVA 1X15A 1YE8A 3PCTA 4O4LB 1DAFA 4R3WA 4S1TA 4JR1A 3TX2A 1XLTA 3O8NA 2EJTA 2ZB2A 4XDGA 5DBOA 3KR1A 4RULA 2NU6A 1GG5A 1U11A 3WA6A 1ML3A 4ZVSA 4C30A 3ZDBA 1N3BA 1PNTA 1P1JA 2IZ1A 2B2NA 5IF3A 3NIFB 3PNMA 3ZTTA 4N0DA 2HGZA 6PFKA 2VSNA 2CLDX 4WSOA 3A31A 2OHFA 4IFTA 1Z0IA 1C7RA 2RGEA 2YHAA 2B4AA 2OG2A 1G1MA 3B82A 3EPPA 1FMCA 1QF6A 4FFVA 1SOAA 1GO2A 1PUXA 1ZK2A 2HIMA 3KG2A 4Q4DA 3EWNA 2JD0A 3K4QA 3GEDA 5JS8A 2FPRA 3EXHB 1A2OA 3NUQA 2PL3A 3FCCA 5DISB 3DDHA 3LLMA 1M6VB 3F3SA 1IDN1 4FKMA 4KQEA 3KOUA 3MD0A 5FNVA 3FPKA 2W70A 4BNXA 4PGAA 5D7NA 5L3SA 3IA7A 4L5CA 1THZA 3UATA 5KYTA 4ND2A 1V11B 4AP9A 4DARA 1U3DA 1PGOA 3D9QX 3PCRB 3J81A 3NEYA 4U2GA 5ANRB 1UZMA 4RUKA 5EUCA 3REGA 3PJFA 5JY6A 2Z2YA 1NT2A 2Z5GA 3FJYA 4HB3A 3TNDA 1ZO8A 4TL6A 4UTPA 3H2JA 1QH9A 2A67A 3GDWA 4OYRA 3M4YA 3STHA 3WMWA 2B61A 4QM6A 2QSZA 2O4CA 4QELA 5LOVF 2GFHA 3ZHSA 4S05A 2B1JA 1Z75A 2D2EA 2VPYA 3FIJA 2OCIA 4AP5A 2C8KA 4GNRA 3P9IA 4B4VA 3WMRA 1SUIA 5T41A 1P0FA 1GNQA 1WNTA 1U7TA 2MINB 1R3DA 4TXNA 2V0CA 3HXTA 2OM6A 4BE9A 4AKHA 1LSUA 2OMKA 1J09A 3RYFB 1U8UA 4DPKA 1ZK4A 2DLCX 2BKXA 1XELA 2JJ1A 2Z1DA 5CA1B 4AYTA 4DV0B 5EMKA 5DPMA 2YOGA 4TLDA 5AOVA 3UWDA 1KDYA 5COQA 4C7MA 4LNUB 3KEOA 5PGMA 3BMCA 4A91A 4UNRA 5GINE 4EF6A 1AVTA 1T29A 1XCBA 2OP1A 1PZHA 3VKFA 1N75A 3LHDA 1OJ7A 3IIIA 3KYJB 1GL9B 4QUBA 4X00A 5FTMA 2ENWA 3FLEA 1YVRA 4XWAA 2B83A 2XGOA 2FUCA 1J5EB 1CUSA 1RBYA 4GWLA 4AX4A 3AI1A 4MKXA 3IP3A 1TUGA 1MC8A 2FEXA 2Q9BA 4QXPA 1D04A 4M21A 3E4CA 4QXMA 3JVEA 5FOXA 3IEMA 3OH8A 4Q82A 3RC3A 3HWWA 3ZD8A 4EH1A 1QP7A 3GEPA 3TPCA 5ES4B 4L1KA 3OETA 2GNPA 2OZPA 5BVHA 3DTYA 3M9WA 1DRWA 1RMTA 2X40A 2J5XA 4JIGA 4CPDA 1WCIB 4LRXA 4DIOA 5HKAA 3G88A 4ZN6A 1M1YE 3C5EA 2ZSIA 5DHFA 1AA9A 1PTJA 1S96A 3MJ4A 2AUMA 4WIAA 2JCVA 3O95A 4RWEA 4WKBA 3TSOA 1NV8A 5IYZF 1KRXA 1UQUA 2FWRA 3WGKA 1KH3A 1MQ9A 3GRFA 3JAKA 1DBPA 1NRJB 1N2GA 2VFAA 3WADA 2Q3JA 3B3QA 4AJ9A 1AUVA 1G59A 2WKRA 2VHWA 2QJWA 4JI1B 4BVEA 4FZ5A 4CMHA 2I2FA 4OQ4A 5CYGA 2FR8A 2A1UB 3A3OA 4M1MA 4XB6B 4ARZA 4BLRA 1LBSA 4FWBA 2C3PA 5T8KA 3FSEA 1Z0KA 2YWBA 3AP3A 1FLVA 4K3UA 1P4AA 3O8RA 2HADA 2G8NA 1D6MA 2GR9A 2R6AA 2CJFA 4W5WA 1JYEA 3E1GA 3PENA 5AHRA 3UK0A 2QRQA 3GVIA 1CP3A 4P9NA 1O4VA 4JOQA 3G85A 1YB6A 5L45A 3GFOA 2AA3A 4YLGA 5EPUA 3P9XA 2G4LA 3EC2A 4OPMA 3X1KA 4BNWA 5JQWA 1VHLA 3AM3A 4OVKA 5EWLA 5LUBA 4EGJA 3TECE 1L7NA 3QE9Y 3HM9A 2WAOA 1P4RA 3OO0A 2ZJ2A 3G1UA 1YZLA 3HI6A 1P7ZA 4FR5A 4LJ7A 3BGSA 3M2TA 4H7PA 4ZVPA 3C70A 2O2DA 3W1VA 3IGFA 1QS0B 1PW5A 3C43A 1NP6A 1HRKA 2F3SA 1BOOA 3T5AA 4J0CA 4YBZA 4B6PA 4NFYA 2FETA 1TTPB 1TLLA 2H1RA 3D81A 3F7TA 5DNCA 1T2CA 4X6UA 4YP1A 1Q0SA 4QNNA 2C5AA 1CLEA 2WDZA 2AJCA 2D1RA 3E7DA 4TLCA 4B7XA 3KKQA 1M5TA 5AJXA 1K8QA 2ECKA 4DABA 2AN5A 3AGPA 3DCNA 1TVMA 3JYQA 4Q34A 4MI3A 1E8DA 1XTQA 2YS6A 1ZU5A 3DOIA 1N8NA 2WAYA 4QREA 5DH9A 5GZ3A 1KY4A 3DBIA 1SVMA 3O26A 4LSWA 2FP4B 3LX5A 1JW9B 3H9EO 3M6VA 3MEQA 5CYFA 1IY0A 1T5IA 4CU2A 4UQLA 2CXQA 4CKEA 1WUIS 3TIXB 3VU9A 4WBNF 3DE5X 2YY5A 4R1UA 4OM8A 3INNA 3ROEA 4TTSA 4GYWA 1FP4A 2Y0EA 3T1QA 4EJSA 4R8KA 2V5VA 1Z38A 2PWYA 2BT4A 1U5BB 4JA2A 1MJNA 4ND7A 3RAJA 1G63A 2I6FA 3I1IA 4CCSA 1GGFA 3MTIA 3AYXB 4FMDF 4RZUA 3A25A 1ZI9A 2H1SA 5EJFA 4J0DA 4EEXA 4WBXC 1NQTA 2IEAA 2ZE6A 1P81A 4OGGA 4G0WA 5GM2A 1UDBA 2VPXA 4JR2A 4L15A 1YOVA 2ZT6A 3GELA 1L4GA 3AM4A 3EFHA 5C8VA 2NYAA 5B58T 4BP1A 2ZJOA 3LC1O 3PNYA 5TQ2A 5JTTA 2POCA 1WXGA 4UTXA 1PFVA 2A9PA 2DKFA 4MGZR 3EPKA 4PLTA 3AC0A 3OEED 4GL4A 4DLRA 1N6LA 4IGKA 4X95A 4R54A 3TKYA 5EE3A 2C92A 3IAXA 1RYYA 4LCEA 4R9VA 5TS3A 4CLOB 1D4ZA 4ZI5A 3IRVA 1T15A 2DUJA 2WFMA 4NZNA 4TS1A 1QU3A 2FF5A 2EZ4A 2DM6A 4JN6B 3IR6A 4Q12A 2EX4A 3ZDFA 2E6KA 1P5RA 2IPLA 2J7KA 2QTHA 2H3HA 4OHPA 2JLUA 2VDRB 4IDBA 4KX5A 1DKUA 2HQSA 2QD3A 1LLFA 2OVBA 3JTMA 3QLJA 4L8YA 4MRSA 5P21A 1SBHA 2BFDB 1M1UA 3DF9A 1MA3A 2HU8A 4FYHA 1VLLA 4GLOA 4J75A 5JO0A 4S35A 1ETUA 2J07A 4MS4B 4R81A 2CDBA 2JGDB 1CUEA 4EJ6A 4F9EA 2B30A 3CISA 2DFNA 3DEIA 1L8LA 2R8RA 5CT6A 4R8SA 5K3DA 3MTDA 3WYFA 4BUZA 2DH6A 2OTCA 4OHUA 2HJSA 3ZKWA 1H5NA 4HB4A 5L95A 2IZOA 5JVDA 4JT9A 2HA2A 3J7TA 2PKQP 3CKKA 1L1RA 2EJUA 2PBZA 1KI4A 3RHZA 4B8WA 3ONEA 3UPTA 2X77A 1NG9A 3HHEA 2W9XA 3C4VA 1D3AA 1ZXXA 1QKIA 4AKIA 4CL2A 4PQEA 2ZJFA 5KHLB 3KT0A 3UJ9A 4PR3A 1D1TA 3UKDA 4IRMA 5EY5B 4EPXA 1J8QA 3PDUA 4O29A 2OK8A 3GJQA 1A5AB 1AZLA 1JLRA 4P4NA 4WGGA 1CRWG 4G67A 4YRQA 3CZCA 2YV2A 1VB5A 4LYAA 3DCJA 1HL7A 2GI4A 1ISRA 1TW2A 3PITA 4PAQA 5JMPA 1SMKA 1Q7GA 3DLCA 3E53A 4KR9A 1Z2NX 1LPBB 5BV0A 3R2JA 1P1KA 4RKEA 1RE0A 3Q12A 4ES6A 3BULA 3EHEA 1C0EA 4N7BA 2BDEA 3IDFA 5EGNA 5ICEA 1K3FA 4BVBA 3RSLA 4I2NA 2IEIA 4U0KA 3TVYA 4C07A 5FOQA 1EYZA 2ALJA 1H0HA 1JIIA 3NT2A 4M0LA 4FT4A 5EXEA 3MD9A 2RGBA 1RBQA 4AQ7A 1NBMD 3CEMA 1GN8A 2HJVA 2GZHA 3QLTA 1XYVA 1A1SA 1I6WA 3WBFA 1BVUA 5IT4A 4HBZA 1LZLA 4OIFA 4KLAA 4NAHA 4Y2GA 3ZV4A 5KNDH 5LUAA 4KQGA 1U1FA 3O31A 3OCCA 4YB8A 4XM2A 4WASA 1LX7A 3V4OA 3WLQA 3OLYA 5FJJA 2QW1A 4YJ3A 2B69A 2V7QD 2I99A 3QXGA 3GLIA 2R4QA 3TIVA 3GJXC 1NW9B 4HH3C 4R6XA 4BV2A 1NWCA 3GJZA 3BMXA 3SCZA 2PKCA 2M6LA 1GPYA 2IYWA 5C1OA 1MOPA 2CNWD 3WS7A 1H5UA 3WIUA 1PX2A 4Y2HA 3ZU3A 3S44A 4OAQA 4KYIB 4Y1RA 1N7JA 2GETA 3W3AH 4R71A 5HZGA 3NGXA 5HE9A 5IP5A 1SOMA 2BFEB 2QQ0A 4HS9A 3JSXA 4GRAA 4PZLA 4RTSA 1GNPA 1U9CA 4G1BA 1XZLA 5DHSA 2EYUA 2O05A 3ZI7A 4AN1A 1UZAA 2BGRA 2IX9A 1QR6A 4LCBA 5GTDA 5M5BA 4AJKA 1M67A 2H5EA 2Z3VA 4AZ0B 3ONVA 2OGSA 4OLFA 5IC6A 1V5IA 4ZCPA 4L5YA 4B34A 2NPOA 5SICE 3MLEA 3ZNPA 4J91A 4HQ6A 4NEHB 4CLHA 2N1BA 3VC2A 5JXWA 1CZHA 1R5OA 2Q07A 2XQKA 3VGPA 4URZR 3WLOA 4MVJG 4DV6B 1HSOA 2X8WA 2XOKD 4CCYA 1IHOA 1NL3A 1ZH6A 1A4RA 2I29A 3UQYS 4QO7A 1YR2A 3HBLA 4H3SA 1VI6A 2B1QA 3L40A 4ESVA 5JHHB 2AX4A 3A9RA 2D7DA 4H7KA 2B34A 1LPAB 2XUJA 3AUFA 3CX3A 4AG5A 2AF4C 2BGKA 2R8BA 1W36B 4R2WA 1ZDMA 4WV3A 3RSCA 1SXJA 5HIIA 2HSGA 3GMDA 3TR6A 1FTGA 2YN4A 1E1CA 2XMZA 1F14A 1WABA 3DE7X 4PPNA 3OWOA 3HUUA 4QYTA 5ETJA 2BPOA 2V97A 2VO1A 4QOHA 4KDEA 2H29A 3ABRB 4N7MA 1L5NA 5C8YF 3WBBA 3BTUA 3PZBA 4BZXA 1VE9A 1FIUA 4RCVA 1J97A 1Y9ZA 3TQSA 3DJYA 3RTEA 2BKEA 3IMCA 4KQIA 3WK6A 3AUTA 3LPMA 4X7PA 2WWRA 3DMPA 3RUAA 3FJOA 1S3SA 4C14A 3M82A 2GKSA 5BURA 3GUYA 4D4LA 1SVWA 1M7HA 1OD6A 1JJFA 3T0GA 3V8NA 3OJCA 4Y0AA 3ZIAD 5ALHA 1JEYA 3OU6A 1N1DA 2YZNA 3SZGA 3KWLA 4I1RA 3I6YA 1JG2A 1T6XA 1XXHA 1TFRA 3AXTA 4XEHA 5FPSA 3V8EA 2Y68A 1M2JA 4AG6A 1YZFA 3U4DA 1GPJA 2EFHB 4X9XA 3RQSA 3P71T 1BS1A 4RHYA 3RIGA 3ZK7A 5E6RB 4JDUA 4NMXB 4MR7A 5LMZA 1JLMA 3MWFA 4G23A 1KMQA 4DRZA 4N48A 4F2HA 5B7QA 3UAGA 1U2EA 4C9BA 1Y5RA 3GN2A 3MUEA 4LXTA 2QUKA 1QRAA 4OJTA 1J20A 4Q4HB 2HNBA 1RYZA 4WK2B 3V8RA 2VTKA 2BP7B 4JNCA 4BDTA 4E2WA 5ADVA 2BMDA 1NKTA 1G5IA 2O7SA 2WA2A 3TB4A 3BD7A 2A9RA 3QQ5A 3IXMA 4G0MA 1W73A 3JQBC 4IKPA 1MVLA 5ALOA 521PA 3W04A 5K5EA 3ZX4A 4V0SA 5T67A 3GPBA 1K98A 3MTGA 3OUUA 2HL6A 3UF0A 4DNXA 1QHGA 3WGZA 3OQJA 3WL7A 1A5BB 1RXCA 4O4IF 5CNIA 1Q74A 3MFYA 3ZJ4A 1JDNA 1HDIA 3O4RA 4LXHA 2GWRA 4YYZA 1WB6A 1Y8CA 5AKLA 5JT1A 2BKAA 1ONSA 3AI7A 4J0EA 3OCXA 4N6OA 1A8QA 4PS1A 3O9MA 4LYGA 1HFKA 4KN9S 4O2AF 4ZODA 1SZJG 3PIDA 3PQ7A 4C7JA 5K8CA 4IZIA 3SC6A 2WJGA 5F73A 2PTGA 2XI4A 1JHOA 1UFKA 3MA0A 3EWSA 4GHWA 3VUFA 4ZK6A 1AO0A 5ESWA 1BMTA 1HE1C 1C8VB 5HEKA 1ZOOA 2G04A 1P45A 1OW3B 3MJCA 4Q4AA 4DLPA 5LM3A 2QP4A 4ARUA 2JGMA 4E31A 3TRDA 1AZWA 3H9UA 3AP2A 4TYWA 1V45E 2BSAA 2R68A 4MVCA 2JKYA 1C9JA 1W19A 3GOQA 3RODA 3UA4A 5IWCA 4B3TB 1SVNA 3RUCA 3HBJA 1Q0RA 3MWKA 4Q7QA 3MC1A 1WXFA 2ZBVA 1T9KA 5DCWA 3P9CA 4NCAA 4BMPB 4RXUA 4W1RA 3T52A 4L4UA 5DM0A 2X8BA 5IJWA 3NJ8A 3T4XA 1ND6A 3HWRA 1U0OC 1VECA 3OQ1A 2W6NA 2DCMA 2D2VA 3QNUA 2ABWA 4XIFA 4DLYA 3N2ZB 3OTHA 3HDVA 1OVMA 1P31A 1OI7A 1PG5A 2JDID 2EIHA 4YRRA 3PFGA 4YCJA 3QFFA 1JP7A 1ZINA 1AK2A 3WYCA 1W4ZA 4ED9A 4C2BA 4GFDA 4HRXA 2IJGX 4LOKA 1BMFD 2H4YA 2WD9A 5A9RA 4GKKB 1E0JA 1DE0A 2OYCA 1H93A 1YZVA 3IBSA 3IO3A 3U3RA 1R4MB 1ZJ5A 4IH1A 4G0PA 1FDUA 3I9NA 1OMOA 3CR3C 3HCPA 2NO5A 2NP7A 1W34A 4BN4A 2GCNA 1A9YA 2XWSA 1S9DA 3CB4A 3ECAA 1T2VA 4COKA 1OZHA 3HDGA 4KKVA 4RVSA 5FUMA 4TWBA 3Q3EA 1JFVA 3WKCA 2ZVJA 2ZB3A 1QVZA 4GXRA 4DKXA 3CMMA 1Q1NA 5AM2A 3WAJA 1SU7A 3B2QA 1IBMB 3RVJA 1QHYA 3K0FB 3ZDEA 3MCZA 1SVLA 1WWKA 4GBMA 3H8SA 4CGYA 1D8AA 2VAPA 2WG1A 4UZFA 1BG6A 1CQJB 3COPA 2WDPA 2PS1A 1CXZA 4YPVA 4I50A 2BV3A 1Y33E 1UZLA 3T38A 3TM4A 1VG8A 4R1MA 2P6RA 4EW1A 1PEYA 1XQWA 4FFWA 4LDAA 1HE2A 3AUXA 5ALMA 5KTKA 4TZ6A 2VBGA 5G3YA 3TCXB 1FX0A 2DQZA 1NIJA 3FOAA 2DHDA 2JGNA 4BY9E 2ODAA 2HWKA 1T1EA 4C88A 3BPSA 2DYKA 1GDDA 4NS4A 3P2MA 2D2XA 3LDFA 1YUMA 1TJNA 4ND6A 2Y0PA 3UHPA 4YY3B 1UC9A 3CNLA 1KY5A 4L0CA 4JOBA 2BMWA 3E3AA 2DWOA 2BEUB 1AN9A 1N1MA 5BR8B 1KAGA 4DRYA 1DB3A 3BHIA 4EYOA 4L4SA 4YP0A 3RNOA 4AWBA 2QAIA 1TJ4A 4UJ3A 3KJIA 3A1WA 1A8SA 3OE1A 2RGNA 2ASVA 5TC4A 5BN5A 4B5KA 4JI7B 3GJ5A 4HUQB 3SWWA 3SF0A 4GXQA 2FW7A 3FGZA 3BGWA 2IP2A 3FYUC 3L7CA 4IHJA 3G3EA 1LDNA 1WKVA 4WGFA 4ZVVA 2FWNA 1OXBB 2HEIA 5COAA 3VVMA 1BGWA 2CK3D 1ZJYA 2FAXA 4GI1A 4YWHA 5GONA 1JZTA 1P9OA 3T3MB 4G97A 5MFZA 2GEUA 4IRXA 3OZWA 4P4UA 3DOOA 1E79A 1FRVA 3OZIA 4BCDA 3Q98A 2X0EA 2ZS9A 1PEDA 2P1ZA 3PICA 4D3YA 4CYMA 1EP1B 2HBRA 4DG8A 1ZKDA 3T5DA 3LVBA 1QHFA 4HLQB 4MUNA 1RAIA 2C7PA 2PQ6A 1H3EA 3GFRA 4H0CA 3ZBQA 1GKYA 3AESB 4E5KA 5AHOA 3TZ6A 4OL9A 2OGWA 4DSZA 2O8DA 3F98A 3G0HA 2V9PA 1EEXB 4O25A 3K30A 4E1VA 4ZDKA 4JS0A 5LYJB 5ILGA 2OYRA 3EDQA 1ZIXA 4QBFA 3OF2A 1IZ0A 3UMRA 2C3MA 4YTEA 2N1MA 4R3NA 4X7RA 5AW0A 3MWDA 4ZPXA 3BIWA 3VR4D 4EZBA 1SA0A 1YJ8A 3KB2A 4CKCB 5KSWB 1PKEA 3L77A 3U7FB 2ZIZA 2LWIA 2ZRNA 3V1KA 9ABPA 2O8CA 2R48A 2ZRAA 5CT5A 1MB3A 3V1UA 7MHTA 3MMSA 1NYQA 5F5NA 3IP5A 5GJWC 4ZA2A 3LQFA 2V6MA 3MBKA 1M2VA 4H59A 3N70A 1T2UA 2FN4A 4TSFA 1HG0A 2KE5A 2VF7A 3BE6A 3HEMA 3TNFA 5J4VA 2Z6QA 4C0AC 5AVUA 1LH0A 1ESEA 1YJ5A 2LVBA 3MXOA 1V5WA 1Y3FE 4KPUB 3Q0EA 4F2PA 1H8ED 1FMJA 1HTWA 5FOUA 2HT6A 4GO1A 2CDNA 5IDYA 2YXDA 4JZKA 4JUFA 3MJVA 2FCRA 3K53A 3HZRA 2HU2A 3I9JA 4Q3BA 2HMVA 4ZHQA 4LZJA 5DTQA 2ID8A 2CYAA 3TFQA 4C29A 4DC1A 2XDQB 1QRRA 4JASB 4ZU1X 1T8WA 1PVOA 1CY4A 2OCLA 2C5HA 2WLSA 3CJRA 2OXTA 5IKXA 1VL6A 1NNI1 5LQJA 4X1YA 1JG3A 2DTXA 2WM8A 2V7TA 4HRYA 4U7PB 2JZOA 2BZSA 3MWYW 5AK6A 1TA0A 2XVXA 1VXOA 3R3UA 2B1RA 4DJJA 2B92A 1DVRA 3PC3A 1CE8A 1BEUB 4A5SA 3REOA 1JHAA 3HA2A 3C3XA 2G4CA 4W7HA 5REQB 1U3UA 5JALA 1BWPA 1RAAA 2ZRKA 1XF1A 2Y0DA 1GRVA 4O2AB 1ZAYA 1SUAA 3LA6A 4QWMA 1U9JA 4TMZA 1CYDA 1YA8A 1ISHA 2Q21A 3BXPA 1XD2B 1DOAA 2JC3A 1IY1A 3LXMA 5GY7A 1AF4A 2NOAA 2X13A 4CTOA 3A9UA 2GUGA 3FPBA 3OZFA 1L4EA 4XPZA 1HYHA 1TEVA 3DQZA 2AC4A 1BS9A 1O7JA 4X54A 3ZZUA 3HKCA 1Q22A 1IQPA 1LNZA 4JLWA 4BAUA 1YA6A 4PBTA 3JQQA 3P0FA 2XDYA 3KXDA 4KXLA 4IWXA 1FDSA 1E3TA 2WF5A 2NUPA 3CRVA 3FNBA 4Z3OA 4ZT3A 2PLRA 3L6EA 3LWBA 3T5BA 2NMVA 1FYWA 2MR5A 2J9RA 2XUPA 3B12A 4YNBA 3QVMA 1KR2A 4IFEA 1THGA 3NP7A 2ZPTX 3THWB 4PV7A 1G4UR 1GTL1 3MILA 4R2JA 3C14C 3ED5A 3HB5X 3CX4A 5AKKA 3BGOS 4UAUA 3PE3A 4E22A 3JQRA 1GZ3A 4ZVRA 2PGOA 4B4DA 3L2OB 4EKNB 1PWZA 5FI5A 2H06A 4K46A 3P4YA 2XF8A 2XVYA 2II6A 3H1AA 5GOTA 2Q7OE 2JGAA 3L79A 4GXTA 4MQFB 4ETMA 2POQX 3AZOA 4DJDC 1NY6A 4OHYA 3DXYA 1ISPA 3AHCA 4AWAA