4HAXA

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1(k579a)-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
200
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/antibiotic
total genus 58
structure length 200
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4haxA00
2GAOA 5G40A 1M74A 5FPHA 2B7CA 3U2QA 4AC9A 3W34A 1ZINA 2ZRAA 2RGNC 2VTKA 4NONA 5JMTA 5IT5A 4QL3A 4HEJA 3UMSA 3W9YA 4B3FX 1KSJA 3P26A 3W3ZB 4KVAA 1NSFA 2HJVA 4HB0A 3LXXA 2J59A 4GNKA 2QE7D 2LKDA 5FOXA 1ZAKA 3HU1A 2OESA 4KXFB 4F38A 4JL6A 3KQLA 3GLHE 1NIJA 1CJUC 3DMNA 2KJQA 3RC8A 4G0NA 3T15A 2KE5A 2D06A 4V0KA 5JWRA 4BASA 4PAOA 4JT4A 1W4BA 3A1UA 3EPKA 2ZQ5A 3GCGA 4FW9A 4M21A 3FTQA 2OAQ1 2V3CC 2JEOA 2RGNA 4MKGA 4BLRA 2WJGA 4XSGA 4RY2A 3K8YA 3FKQA 1QHIA 2GZAA 2PEZA 4V03A 4U7DA 5FI0B 1IQPA 1D9ZA 1RYHA 2H18A 2ZPTX 4DBLC 1HQYE 2P2LA 2FA9A 4GMDA 3T5GA 1HUQA 2NPIA 3CX7A 4AY2A 2O8EA 4DLUA 3SJZA 3Q7PA 3WNDA 2P65A 2YINC 3RS7A 4F4IA 5HZKA 2FFAA 2VL7A 3TUZC 3KKMA 4RD4A 3NC1C 5FBWB 1MH1A 1KGDA 3OAAD 2GVDC 2F9MA 1LS1A 4A15A 3PJRA 3BIFA 2WKQA 1CJTC 3VNUA 2IYVA 1PLJA 1R5NA 3LX8A 3NH6A 5FPTA 3ZS8A 1M7GA 4DCVA 5G3YA 2YHSA 3Q72A 4WZAE 1E99A 1GKIA 3L43A 4X8OA 2OG2A 5HCIA 4JLDA 1MKYA 4QC2A 3U4QB 4RD6A 4IFEA 3ICQB 3U3JA 1KK1A 2REXB 3SBEA 3BH7A 3CNLA 2HF9A 2R6DA 3EAQA 3OIUA 4TTRA 1J7KA 2YWEA 1SVWA 4A2WA 2J0UB 2C04A 5FR1A 1Q1EA 2R6CA 1KI3A 3WY9A 1U94A 3EX7C 3AVWA 3HJNA 1G7RA 2QY9A 1TEXA 5H68A 2J7KA 3FPAA 3IQXA 4YMSA 5UKDA 2IXFA 3RS3A 3U7GA 1G20E 5L3QA 3K0CC 1COWD 2QT0A 1NKSA 3IHWA 1R2QA 3AKEA 3GP8A 1AS0A 5DE3A 1KO7A 2ZJBA 2V55B 4G3XA 2CCGA 3T06B 3WMGA 3B85A 4MKFA 1FX0B 3AGQA 2ZYVX 4Q47A 5AUNB 4Q7KA 3QKRB 4WXPA 1OW3B 2F6RA 1G4UR 1F60A 1G5PA 1R0ZA 4LJ9A 2P67A 3CF2A 1YR6A 3NEJA 2IYUA 4B43A 4JSTA 4C9BA 4PX9A 4EPTA 4MDFA 5C1BA 1OXUA 2IUUA 4DCTA 3K0FA 4PQYA 2QPAA 2PLRA 4I1VA 3K0CA 3SJBA 3NTUA 3AF2A 4GRAA 4O2RA 1TQ4A 4LBVA 4BWYA 3AH8A 5L8VA 3ZZUA 4PHTA 5FOTA 1ZVQA 1TU3A 2CLCX 2UZ3A 3EZ2A 3PCRB 4P4UA 3GLFE 2CCKA 2FF7A 2EU8A 4NYIR 2QTFA 1GL6A 1YR7A 3LWNA 3U3RA 2YC2C 4B76A 1GVNB 3VHXA 1QRAA 4JLKA 1U0LA 2A5YB 1KJZA 5J4KA 3ZDQA 5F98A 1E79D 4XOIA 3WXMA 4NCKA 1F3OA 4QNRA 4DLYA 2WSSA 3LVRE 4IHQA 4KYIB 2VLIA 2ZI4A 1TPZA 4JIMA 4B3CA 4AK9A 1KZ7B 2CVHA 5KSYA 1E9SA 2Q9AA 2ZRBA 3BB3A 3EC1A 2FZLA 5JHHB 2OE2A 5K8UA 2R6AA 4M9QA 4Q02A 3I32A 4OHZA 1ANKA 4BFTA 4HZIA 1RW4A 1AZTA 2A7QA 1JR3E 4FWTA 1VTKA 3K70B 1V43A 4GI7A 3FB4A 3T1OA 3UK6A 2IF2A 4CF7A 1OJLA 2YOFA 4MUAA 3PG5A 2FOLA 4P33A 2NIPA 1KDRA 4KO8A 2DPXA 1XPRA 1PLKA 4RFSA 2RAPA 2EVWX 4XIGS 3LLUA 4I1OA 1J8MF 1UDWA 1OIWA 3CB4A 4XWAA 3ICEA 1VCNA 3FFAA 5DGXA 4NE2A 1GWNA 4M2LA 1U9IC 2BV3A 1XJQA 3KTAB 3AVTA 1JEEA 4D4MA 4Q4AB 2PCLA 5DNYB 1XTJA 3MD0A 1GKUB 4OK3A 2E87A 5E4FA 5FTJA 3LBIA 4YMUA 2HYIC 2ZSBA 3I3SR 4LJ7A 4QFMA 1E2IA 4DDTA 2J45A 2W6JA 2WBLC 4D0LB 1W36B 5G3ZA 2V1UA 1LFDB 4MYCA 2W58A 4PZLA 2WJVA 2JDIA 5J40A 2VQSA 2KSQA 1KY3A 3A1VA 1I4LD 4QBIA 4HAVA 1LS6A 4A0GA 3BGWA 4UXIA 4TL9A 2NZJA 3AEZA 4NDZA 1TF2A 2QT1A 1R6BX 2XZPA 4TL7A 1IXSB 1OIVA 4GOXA 2A5FA 1U9IA 2PZGA 5JS8A 4LHXA 3GLFB 4BQSA 1XEXA 4NPHA 2VO1A 1EESA 2BIFA 1TL7C 1T4GA 4DLXA 2R2AA 4YQFA 3OE7A 4DSOA 4XVUA 3WBKA 4IEEA 1GAJA 5TDHA 3RLFA 4M9SA 3VR5A 2R9VA 3KXLA 5LD2B 2BMDA 1FMLA 3NHAA 1F6BA 4RZ2A 1XF9A 1LTQA 4LC1A 4DUGA 1DEKA 5AJZA 3ZZ0A 4JL5A 1FP6A 4NCNA 3AVVA 1KK3A 1QG4A 4ACAA 2ZITA 4MGZR 4V0ME 2JDID 1E94E 3PUZA 2GZHA 3DDCA 3IIJA 4AIIA 4I81A 4M1SA 5K8IA 3R9WA 2AWNA 2PT7A 1J70A 3Q5DA 1SXJA 2ECKA 2Z4RA 3KUDA 4MRPA 1E69A 5JWHA 3SQXA 2VP2A 4NYJQ 2JLRA 1CJKC 1M1YE 2RGCA 1II8A 1MRNA 4HB4A 1UFQA 1XD8A 2OFWA 1ZM4A 2RGEA 3D8BA 1TF7A 1Z0DA 4Q4LA 4M9ZA 3N70A 1KO4A 2NQ2C 4DZZA 2ZSEA 2WHXA 2JIZA 3FDIA 3V4FA 4OK6A 5BXQC 1MO3A 3GFPA 3LQRA 2G1JA 1G3IA 1BIFA 4JT2A 1X6VA 4NTZA 2Q6TA 3SBDA 3O8RA 1WCV1 4HDQB 2L0XA 1M8PA 2HF8A 1W7AA 3NC0C 4L8GA 1G17A 3R7WB 4DUGD 3AVOA 4HUTA 1M2OB 4E5UA 1U2RA 1ZUIA 3IIKA 1Z22A 1I4TD 3CW2A 3FHTA 4AKGA 1DOAA 2JLYA 4C0QC 3IKJA 3QF7A 1M7BA 4AYTA 3VKHA 4ZCMA 2EFDB 3PEUA 3IPYA 3PXGA 1II0A 3UKDA 1OB2A 1OYYA 3KKOA 4Z8XA 4FCWA 2VSXA 2GK6A 2XJ4A 4URUR 3ZGXA 4C0KA 5KHOC 2P6RA 1X1RA 1AJEA 1G7TA 2OM2A 5FPKA 3SI7A 2FH5B 3A8TA 1CJVC 2FSHA 1KSGA 4RVCA 2ZRPA 4DT1B 2JIZD 4E07A 4C7OB 1KKMA 4FWIB 4DC9A 5CLLA 3H4MA 4URYR 1G8YA 5KOYA 5CB8A 4WIAA 2DY1A 4AYXA 3E5HA 2XB2A 4U02A 1PV4A 3AVQA 5A0FA 3QENA 2XSZA 3GLIE 1NL3A 4Q4HB 4LK2A 3VFDA 1M7HA 3THWB 4RD3A 3BS4A 3AF3A 1AS2A 4K8OA 4P3YA 4EFLA 3DVLA 2J0SA 2G0NA 2C98A 4UKDA 4TYWA 2QAJA 4NZYA 3OIWA 3SFVA 2ZUBA 4MYTA 3NWJA 4DRZA 1KI9A 1T6NA 1D2NA 3NEYA 2ZRGA 2NO1A 2H1LA 4MA4A 4D25A 4BZQA 1KZGB 1W44A 1KDTA 2CL0X 3X1DA 2AFHE 2F3TA 1HYQA 3OEEA 4EDHA 1N6IA 3OEHD 1E0JA 1ZU4A 2OXRA 3MWKA 4WA7A 5JI2E 4G5GA 1DE0A 1E9BA 2EW1A 2JJ1A 2PCJA 2PX0A 4YDSA 4MKHA 3WRXC 4OQMA 3CBQA 3RWOA 4DSUA 1WF3A 1R0XA 3NG1A 1VG8A 4B2LA 2YOHA 2DFTA 3GLHA 2ZS7A 2GJ8A 2PJZA 5GJCA 3CPEA 3KZ1E 2ZE7A 3MLEA 4DCUA 1E2PA 2RGXA 3KDSE 2J41A 1KAOA 2VHCA 4FCVA 1NN1A 2OCYC 3FMFA 2VBCA 4TLBA 2J1LA 5HZHA 2OZEA 4IOJA 5LDDC 4R9UC 5KTYA 1X86B 4IDNA 1OHHA 5K8TA 4HAXA 2VRWA 2GBLC 5CK4A 3WMEA 4EPYA 3B1WA 5C4MA 3REFA 2IWRA 2JLWA 2P5TB 3OEED 1Z83A 4OI1A 2WTUA 4ERNA 3IDQA 3MMPA 2B7BA 4B35A 2DFLA 4QGHA 3K70C 2ZRLA 3BB1A 2O8EB 1GNRA 3W6OA 4ZCLA 1RC8A 3M6AA 3FKSD 2CCJA 3TJZA 4BZXA 2RMKA 2ATVA 1OFTA 4FMDB 4JLBA 4GBMA 1C9KA 3IO3A 2GF9A 3W8NA 4ASUA 1S1CA 2ZETA 4UNSA 2HT1A 1BKDR 1E2FA 3EG5A 5EE0A 5HR5A 2EWVA 2QM8A 2GBLA 1G64A 4EQ6A 4JLPA 4I99A 5D3MA 4B32A 2QL6A 2GXUA 4L15A 1TF5A 3U44A 1R5OA 3MFYA 4NCHA 5JSZA 4JVNA 1HV8A 4EPWA 3P20A 4M0LA 1IY2A 3ZQ6A 3H86A 3FE2A 2N46A 3FMPB 5AJVB 1XRJA 2EQBA 4B47A 3EXAA 1CR4A 3DZ8A 3A1TA 4M1TA 3ECCA 2O8FA 3S1AA 2XGJA 4IDPA 4M4SA 4ZO4A 4KITB 2Q3MA 1IN5A 3BE4A 1EFHA 2G0TA 3CH5A 5L3QB 4PXAA 4YLGA 1T8UA 1QDEA 1XJ0A 4QBHA 4W9MC 3I5YA 5DH9A 1MO5A 1NP6A 2DWOA 4BPBA 1U81A 4C2TA 1C1YA 2CHVA 4BECA 3QJYA 4TQUS 2H5EA 2O5VA 3UG6A 1EFUA 2RCNA 1UKVY 3LV8A 4MQBA 4ASUD 2I1QA 5F3WB 1UEJA 4TMWA 3WYFA 1E0SA 2VH5R 2ZS9A 4D0NA 3WRYC 2QGNA 2IYWA 2W0SA 2H57A 5LD2C 3MAAC 4TYQA 1HE8B 1H8HA 3FVQA 4Q9IA 3R20A 2FU5C 4TLCA 2GETA 5HKKA 4TLDA 3K0FB 5EP1A 4G1UC 3K70D 5JHGB 5H70A 5DYGA 4RD1A 2QENA 4KAXA 1DAMA 1ZNWA 2ZR9A 5FTMA 3QI2A 1FOEB 4YMVA 2F1RA 2AN9A 5AJYA 3L0OA 3HYRA 2IUTA 2VF8A 2HEIA 2WWWA 3N2IA 1YRBA 2CVFA 2X2EA 3BH0A 5B2ZA 4B33A 3CPHA 5FTLA 2W0MA 4IVQA 1P9WA 2PT5A 4PO9A 4FCTA 4A9AA 2JLQA 4W5WA 2I3BA 4IOLA 1FPMA 1GNPA 2D2FA 2QRNA 1KSFX 2ZI7A 5FOSA 2ZJ8A 4CEHA 2QP9X 4MRSA 3TK1A 3GJ5A 3K53A 4B3DA 4C3ZA 1G7SA 4B6EA 2AKYA 4LCBA 1H65A 3HU3A 4KCGA 1OV4A 4Q1DA 1IN4A 4HDOB 3PUYA 4WVFA 4RD0A 3THOA 3DEFA 4TT3A 1AIPA 1NBMA 4PHGA 4MH0R 1AN0A 1IN6A 4LPSA 4MUBA 4QXAA 1NKTA 2FN4A 2ZI6A 2RHMA 4A92A 5HKKD 5JJKA 4ARZA 2NO7A 5B64A 1SXJE 4C0SA 3RHFA 1TMKA 4RKFA 2FSGA 1TQ6A 4TLAA 4TQ9A 3EW9A 2F1HA 4BLOA 4F93B 1KIMA 1NN0A 1RYFA 4P4SA 1XZQA 5AWFC 5FTKA 5EUMA 2YWFA 2WVJA 1CR0A 1F5NA 2ZEJA 1LB1B 1JQJC 2GESA 3UPUA 3RNLA 3LX5A 5C4GB 3ZLJA 2QQEA 3EZ9A 4CEIA 1MO6A 5EZ6B 5JFGA 5KPDA 5SZIA 1NRJB 1AQUA 1NVWQ 1QZXA 1XFAA 2Y8EA 4Q1FA 2JLSA 4RFSB 2XOKA 1XTRA 4HB3A 3U3MA 2YOGA 4XD7A 1Q3TA 1SKQA 2VHUA 4OJKA 4GSYA 4L9WA 1ZD9A 3K09C 4TZ0A 3I8SA 2ZUCA 5LB4A 3SC3A 4LBZA 3N5CA 4TYNA 2JJ2A 1GG2A 2ZRCA 2WIAA 2BEKA 2BDTA 2CE2X 3NXSA 1JXOA 3AF4A 4F91B 3RS4A 4A0FA 1VG0B 3OIVA 4EPXA 1F2TA 1GIAA 1ZC4A 4ESHA 4OJQA 4YXWA 3B1ZA 1RRGA 2C95A 4TLEA 5KYKA 4RD2A 3ZZTA 1BOFA 2AK2A 2VPPA 3SZRA 3G0HA 4UJ3A 4DHEA 3LQQA 4LX0A 3RYTC 1W5TA 2O0JA 2GZDA 1Z3IX 2ZJ2A 2VHQA 1GTVA 2ZS8A 3EZFA 3OFNA 2ZAMA 3K09A 5SZKB 1XEXB 4LYHA 4PPGA 4QJ4A 4BFZA 4TMXA 2XOKD 3RRNA 4XD7D 3D31A 3NBXX 5JJIA 1NY6A 3CIOA 4H9GA 4D0GA 5B58C 4ILEA 1UJ2A 1X1SA 2C96A 2NO6A 2OILA 4E09A 3HYTA 4W5JA 5EE1A 2Q21A 2WKRA 2JJ2D 5KDDA 5GADl 4DEXA 5FPYA 3UIEA 3FWYA 1LVGA 3U6BA 4UXJA 4V0MA 4KV9A 2VIIA 1OB5A 1Z2AA 4YXWD 2OAP1 1IAQA 5J5CA 4OQXA 1VG9B 3EA5A 1SXJB 4KFTA 3LD9A 3ADKA 5HCNA 3WHLA 1DBSA 5AR1A 5HE9A 2ANBA 3QKSA 4NP6A 1II8B 3AB3A 3SJCA 2CEAA 4Q1BA 3VTKA 2J0VA 1KI1A 4I1SA 4W5HA 1YR9A 3H84A 2FSIA 3I73A 2WWIA 5CJPA 5SZHB 3BORA 1W0JD 1ONBA 4LDJA 3IPXA 4PQRA 4JLMA 1N6NA 5CITA 3SYLA 2G6BA 1N2CE 2A30A 3CX6A 3KQNA 2WKPA 4A2PA 4CYMA 3RRZA 2A3RA 4AWXA 4XJXA 4L16A 3K0AA 4GPTA 2C77A 1YKSA 1NG9A 4A36A 1DPFA 1XTQA 4NYMQ 2XAUA 3LDAA 3U6KA 1WDTA 4B3XA 5IDVA 4EIWA 1JB1A 1MABA 3BFKA 4A6XA 1XWIA 1KNXA 5JCZA 1XU4A 4WZ6A 4OI0A 1HE1C 1RVDA 2NO0A 2FSFA 3AV0B 3GJXC 1Z29A 1E9CA 2IL1A 1XEFA 4HSEA 3WYGA 2MMCA 4UNPA 4US0R 4TMZA 4PC3A 3PEWA 4K81B 4XWOA 2ZYTX 4LJYA 3SJAA 3PIRA 4U00A 2AWOA 1A82A 2GKSA 1FNNA 4B71A 2WAXA 1RPZA 4QHSA 4MRNA 3EWSA 1AZSC 3OESA 3GEEA 1KNQA 1Q22A 3RAPR 5CIQA 4BFVA 2WIBA 4PANA 1CJMA 4QOSA 4A0RA 4JYBA 3ZD6A 3SYNA 3VQTA 4DCSA 2F55A 2FV8A 1TQ2A 3GLIA 1E2EA 1CU1A 2DBYA 2FJUA 2BHRA 2F1IA 5FTNA 1I2MA 2XTNA 3B5JA 1K8RA 1KMHA 2Z43A 3X2SA 2IS4A 1M34E 2A9KA 2EYQA 1MR3F 2QU8A 3EC2A 1IJFA 2H8KA 3DM9B 2QP3A 2LCFA 4DSTA 4KYUA 3WP0A 2OXCA 2ZJ5A 4OK5A 3X1WA 3VKWA 3TAUA 4IDOA 3TQFA 4HLQB 4ABYA 3QSYA 1X8LA 1Z63A 1E2JA 1HURA 3AF0A 1GL9B 2D2EA 2OCPA 4BLQA 1G3UA 2NTYC 4LV8B 4R7ZA 4JJZA 1G6OA 1UBEA 2ODWA 3N2EA 4GZMA 3GLGA 4CEJA 3EZ7A 1DO0A 3BERA 2IX3A 4RZ3A 4M53A 1KJWA 2WJJA 4M22A 1FTNA 1VHTA 4M1YA 3QE0A 1ZC3A 1W1WA 5JJLA 2FPKA 2B6HA 3GLHB 2DCUA 1XX6A 4JVMA 3VX3A 1Z0FA 1XXHA 3UG7A 1MO4A 1W4AA 1TUIA 2JLVA 2YZ2A 1QHHB 4ZI2A 2QGZA 4P0TA 2IEZA 3VR3A 4V0LA 2Q9BA 4URVR 1E2HA 2BVNA 3EIQA 3I72A 2BMFA 3PQCA 4UNRA 1GM5A 1UADA 1Z07A 3VHLB 1N6HA 4C0LA 2C5LA 2Z83A 4ZDJA 2E9SA 3WP1B 3P4XA 1E1QA 3LW7A 5P21A 4LYJA 1Q1ZA 1YRAA 3K9GA 4HLCA 4CW7A 5J4YA 1GITA 3QQ5A 1O3YA 4C0HA 5FUVA 5BYJA 2GEDA 1XZPA 5JS7A 5JBQA 3DOFA 3FMOB 3B7GA 3GJ4A 2ORIA 4ZI3A 2AXNA 1JJVA 3D6TB 1JPNA 4RZUA 2HUPA 2KBFA 1ZP6A 2HT6A 3KQUA 2O8BA 3W8RA 1DAEA 2UKDA 3VNVA 3DL0A 1OF1A 3NKVA 2ERYA 1KJYA 1NBME 1XJCA 4EQ6B 5D3MB 4BGDA 4PO8A 1OPXA 1N5IA 3JZMA 1KI2A 4A82A 3U44B 1N5KA 2PZFA 3ZVLA 4BE7B 5JSZB 5DI9A 2GCNA 1QG2A 1T0JB 3CNOA 3I8XA 1RFLA 3IEVA 2ZRFA 4IVPA 4LHWA 2OCBA 2BBWA 1NLFA 1P5ZB 1E1QD 3S1AB 2O8FB 1Z0JA 1BMFA 2R8RA 1RJ9A 3BH6A 2ZE5A 3C7KA 2XZOA 2BCGY 1AKYA 4QM6A 3QNUA 3UWOA 1QHXA 2ZSAA 1XTKA 3ASZA 1ZD1A 1W49A 1FUUA 1WP9A 2PBRA 2RGDA 1LF5A 3C14C 3MJHA 3PFIA 5L3SA 4YONB 5FBVB 4D4LA 2WSSD 3U61B 4NYIQ 1OH7A 4FIDA 1Z6GA 4KJZA 3CR7A 1NN5A 4B48A 3UATA 1JBKA 3VR2A 4BEBA 4PSVA 5FBQB 3EZ6A 5FR2A 4IW3B 4XVRA 4ITRC 1RKBA 4BZPA 5JECA 2REOA 4Z1MA 1LV7A 3B9QA 4GDFA 1UKEA 3T1TA 4ON9A 3E70C 3CUEF 1DADA 2JCSA 2HLDA 3W6NA 4A4DA 2IXGA 1E32A 1VYTA 1E0KA 5TVKA 1W4RA 4BFYA 2D4HA 2HCJB 4HUQA 1AQYA 5HE8A 3RSLA 1Q57A 2CDNA 1BMFD 4LOAA 121PA 1Z6AA 3BRWD 3X1YA 1Q1QA 2ZTSA 2XEXA 4A8JC 3NBZC 4D4JA 1SXJC 1X8JA 2H7VA 4QBFA 1ZM9A 4OQFA 4KFRA 5IK2A 2WOOA 4WXRA 2VHTA 3LW8A 4L9SA 4F4CA 4AKHA 2A5DA 1KTVA 1E2DA 1MOZA 2ZRHA 3DKPA 3LRPA 4B75A 3EPLA 1E96A 2WM9B 1ZM7A 3NBFA 3AVYA 1NMZA 2EFHB 2W6JD 4Z1MD 1XTIA 3UMRA 3TRFA 4B44A 2IK8A 1P3JA 4O0MA 1JQLB 2ATXA 4LJ6A 4ZIRA 2HLDD 2VP5A 1IOZA 2BEJA 1U8YA 2XNDA 3QBVA 4A8JA 4NBSA 4US1R 5CM8B 1HQCA 4ARZB 3WNBA 2D3WA 4IKEA 3AVUA 1E2MA 2ZRJA 4DLRA 4LHYA 1GZSA 1DAHA 1Z08A 2A78A 1U0HC 4P4SB 5TB5A 1J90A 1QVRA 2AR7A 3A37A 1W0KA 5CK5A 3NDBB 3AGPA 4Z54A 2GILA 5IK2D 4CEIB 2H16A 4M1KA 2VP4A 1ZCAA 3RVBA 1J8YF 1G4AE 4P32A 4L4UA 3I5XA 3OE7D 3TMKA 1OFHA 1T3SA 2ZRIA 2ZROA 5GJVC 4DLZA 4YMWA 4OBEA 2YJTD 5AUPB 1NVVQ 1TX4B 5KO2A 4ZKDA 1CBUA 3VR6A 1G8GA 2HDNB 3A4MA 4GFDA 1DARA 2PH1A 2Z5FA 4PSAA 4OYHA 4MRVA 2QTHA 3RABA 5DHAA 2XNDD 4Y0VA 1G6HA 2WWHA 4BLSA 1SXJD 1F2TB 2ZE6A 3U3OA 5KU1A 1K6MA 4X8HA 4EKDA 1VIYA 4TMTA 2DFNA 3QG5A 2V7QA 1VPLA 4B34A 1W47A 4JL8A 3TH5A 1XMSA 1NJGA 1W0KD 5EXSA 4ZDWA 1OKKA 4MRRA 3QVUA 4LBWA 3AVPA 1XCGB 4G5QA 4JJKA 1GRRA 1A5TA 1Z6XA 3TVDA 3THYB 5KSPA 3ZH9B 3Q85A 3H0KA 1Z06A 3IBYA 3L0IB 4GL2A 4YMTA 2TMKA 2JLZA 2WJHA 1NJFA 4QKQA 3PV0A 3QXCA 1HT1E 4KI0A 1P75A 3LY5A 3FFBA 3HPRA 3PEYA 3MJRA 2WAYA 2J7PA 1R8SA 4PPFA 2ZSFA 3KKQA 4DJTA 2G88A 1DO2A 1VDZA 3PUXA 2GCOA 2P0EA 3HP1A 5FBRB 3KXKA 1ZNYA 2W83A 1UKZA 2Q3FA 3TIFA 1S8FA 4HZUA 2F3RA 3L8YA 1IN7A 2WOJA 4KSBA 4Z8YA 2V7QD 4M9XA 2KB0A 1VYVA 3B1XA 1N6OA 3GLGE 2EYUA 2J3EA 2V6JA 3QKSB 3U7FB 1OH6A 1OKKD 4ZV4A 1FNMA 1BYIA 3B82A 3QOFA 3VMFA 3PR1A 4RZXA 2Z6VA 4Q1AA 5HTKA 2NO9A 3PEVA 4ZDKA 2QPOA 2D7CA 2WWFA 5L3VA 1R5BA 2QQ0A 5FOUA 1P61B 2GXSA 4XTRA 4QBGB 2JJ8A 4KBFA 2XSZD 4B6FA 4G5SA 1XXHE 3WYAA 2V4ZA 1YZKA 2VHJA 4Q4JA 3WBJA 4TWZA 3K0AB 4DXAA 5AJWA 1ZNXA 3E2IA 2IS6A 2OO7A 4HAYA 1YQTA 1YZNA 4TTQA 1BH2A 1WB9A 3V9PA 2QRZA 2ORWA 2YWGA 2PZEA 1GNQA 2WICA 3FGNA 3Q5EA 1W46A 2IYLD 4LHZA 3CONA 1MABB 3EIHA 1E4VA 3VX4A 2QI9C 4OHVA 2QMEA 2FZ4A 3AKDA 1BS1A 1CRQA 4LV5B 1XCPA 4EFMA 2DWQA 2JJ1D 1VKJA 2QROA 2ANCA 3LO5A 2O8DA 3C41J 3ZVMA 4AKEA 1E9FA 5IHPA 2W2VA 4AI6A 3VKGA 2X19A 2QSYA 2IWHA 1SHKA 4HLUC 2GEVA 2VP9A 3DPUA 2PJRA 4JVLA 1E1RA 4QRHA 4TYYA 2RGAA 4LY6A 1LW7A 1Z5ZA 2G83A 1FQKA 1LY1A 2O0KA 4TYPA 3O8BA 3GLIB 3NVAA 3QVVA 1MT0A 1F2UA 5KDLA 2KI5A 1G3RA 3P4YA 1P2VA 1ZMXA 3KFXA 1KMHB 4PQFA 1EG7A 1KKLA 2QP4A 1OHHD 4XSHA 4OI2A 1B0UA 1Z0IA 1YZTA 1Z2CA 3EWAA 2IS2A 1HA3A 2PX3A 3ZQJA 2J87A 5BW8A 4B3GA 1EX6A 4MYHA 5J4HA 2EFEB 3BBPA 4OQNA 4ACBA 3EASA 2WJYA 3BD9A 2CL7X 4DSNA 5ELXA 4HLUA 3C16C 2G1KA 2C03A 5TV2A 2O0HA 4OQLA 4RFVA 2BC9A 1N5LA 5B57C 1AS3A 4C4PA 3QKUA 3GLGB 4CEJB 4JVSB 2XZLA 1OXVA 2IT1A 4DWJA 2VEDA 2GAAA 2XNSA 3ZJYA 721PA 3TSWA 2H92A 4Q1CA 2RB4A 3ZS9A 4S35A 3T35A 1ZYUA 1GL7A 1SVKA 2GDJA 2R62A 3BFXA 5HPYB 1E9AA 1UBGA 2R6FA 4MITA 5DISB 2ODNA 3A36A 2RGGA 2OEPA 2KWIA 1UPTA 1XD9A 2QMHA 1G3QA 1XXHB 3B78A 4JLOA 4PR0A 3F3YA 1G19A 1N6PA 5JRZA 1A7JA 4LJ5A 1CEEA 1PUJA 2AFIE 3A58B 1HY3A 1J2JA 2WWGA 1CF4A 2ZANA 1A1VA 1DG3A 4G5OA 3KB1A 1EWRA 2ODEA 4NHOA 1E98A 1JJ7A 2YNMA 3Q7QA 4HATA 2BM0A 2IYRA 1OSNA 3OZXA 4URWR 2VSOA 3KJHA 1NG1A 2YVUA 4XVQA 3IILA 5E95A 3TW4A 2VP6A 4C30A 2C9CA 1D2EA 2F7SA 1TQDA 1VHLA 3I4LA 4Y0AA 3LNCA 4Q21A 1K5DA 3CRW1 4R2HA 4LJ4A 3HR7A 3F8TA 3DZDA 3JVVA 4I1UA 3DO6A 4AYWA 2GXAA 4JLNA 3KJIA 2ZJYA 3MWLA 3W90A 3C4JA 3PENA 2O8BB 5K8LA 3A4LA 1U8ZA 4A1FA 4Q1EA 3EA0A 3QUSA 5B30A 3P27A 4JLAA 1SGWA 1OT3A 1H8HD 3HPQA 4CRWB 4TMKA 1G1MA 2VF7A 5CIWA 3G5UA 4WBSA 2W6IA 4II7A 5DIFA 1UF9A 2V9PA 4I4LA 5JCPA 4BFSA 1CXZA 5DO9A 2SHKA 4FXPA 4LSGA 2QTVB 5EXTA 2OFXA 4TSFA 1TAGA 3LH5A 1KK0A 2IYYA 1FL9A 1IBRA 1RJ9B 3FHOA 4FINA 4D4KA 5TXGA 1KYIA 5BYKA 1KI7A 1E6CA 3M0EA 4Q00A 1EGAA 3UWKA 5EP3A 5L3SB 5M04A 3GD7A 3QBTA 1CR1A 1P72A 4J0QA 1PLLA 1T9HA 3LA6A 3W3AA 1ELOA 1F48A 3CRMA 1Q21A 2F1JA 4BLTA 1Q44A 2VP0A 5E7IA 3CRRA 3LBHA 4TT3D 4B3BA 4BFXA 1VMAA 3QG1A 4PC2A 2CLSA 1NBMD 2MSEB 3QIAA 2IW3A 5KNDA 5CLQA 1W4CA 5AUOB 4X8MA 3CRQA 5JZVA 2W6ID 3BAFA 4QJ5A 3SHWA 2GRJA 1CULC 1L7VC 2CXXA 1T91A 1Z8FA 2GXQA 2GTPA 5DI3A 3IIMA 4HUQB 3VU9A 1XCMA 2B21A 4PZZA 1DVRA 3RRYA 4TSFD 1P73A 3V4RA 2D74A 3A1WA 4MGIR 3RC3A 4MDEA 2A5GA 3TR5A 4EFNA 1NMYA 1P62B 3HWSA 3L8ZA 2IS1A 2VSFA 4L5BA 4MGYR 5EXXA 2XXAA 1GRQA 4KVGA 2C78A 2UVQA 3CX8A 1YJ5A 2CLDX 5CDFA 4DVGA 1WA5A 1NF3A 4O3MA 5CYOA 5FFMA 2R44A 4EJSC 2AD5A 4JMPA 1YZQA 1P2UA 4B74A 1UBFA 1TUEA 2CNWA 5KNBA 2ZRDA 4DB2A 1Q0UA 1FMJA 2PMKA 4IJMA 2WSMA 1R7RA 4FMCF 5DHFA 4TZ6A 2ZE8A 4IFBA 3VR4A 1S9DA 2FFBA 1X3SA 4A8JB 2J0QA 3TLXA 3KKPA 1OIXA 4POAA 1DAIA 4HI0E 1GP2A 5TY0A 1AA9A 1S1MA 3ASYA 3QKTA 1GOTA 1T3LA 4QHYA 4PPQA 1P2TA 3OFND 3IO5A 1H8EA 2Z0MA 4EJSA 2ZAOA 1KSHA 3UANA 4A0HA 3RS5A 3LXRA 2A5JA 1RIFA 2KBEA 3OF5A 3U7HB 3AP1A 2V6IA 2ZM5A 3E1SA 3DOEA 4PTLA 1XD2A 3MWJA 4AKIA 2PEYA 4U5XA 3AP3A 2IF0A 1QHYA 3SOPA 2JATA 2ZUDA 1ZUHA 3U7EB 4UNQA 2BBOA 1UAAA 1W48A 2CNWD 4HDCA 2JLUA 3QF4A 4JBWA 3I61A 4CZ2A 1TTTA 3GPLA 3TAHA 5DSZA 5C2JB 4FMDF 3CRVA 3SN6A 2D7DA 1P2SA 1LF0A 3OAAA 4IXNA 4BFUA 3Q9LA 1KY2A 4F7WA 5TMPA 1CIPA 4D80A 3BC1A 3C5CA 2FWRA 1ZCBA 2OV2A 3MGCA 1EXMA 2RHDA 2WPDA 2PMDA 4PSKA 1SVSA 2IYTA 4DDUA 1JR6A 5IRCD 1TNDA 1H8ED 2ASEA 2GK7A 2X2FA 3ZVRA 1G8FA 1P9RA 4QG7A 2CE7A 4LYFA 3Q3JB 1Y63A 2WV9A 5IF9A 5LB2A 4PFSA 4N0DA 4PAQA 1VCOA 1S3GA 2OSBA 4DLVA 4V0NA 2OCAA 3NDPA 1AGRA 2ZR0A 4LJAA 1UDXA 4JLJA 4CT5A 2YV5A 4LHVA 3QXJA 5EE5B 2IXEA 1NN3A 4AD8A 2GCPA 4CDGA 2CHGA 1COWA 3R8CA 4JZKA 3A1SA 5CYPA 3T1QA 4DKXA 2P6NA 3O47A 1KI6A 2GJ9A 5KSOA 1KHTA 5FOWA 221PA 2DR3A 1YVDA 2N42A 3CF6R 3IBGA 4C0BA 2GCOB 2IHYA 4GOKA 1ZM3A 2FEMA 3SU8A 1Q1BA 2ZI9A 2BJWA 4FD2A 1KMQA 4WAUA 4HZUB 3EPHA 4OL0A 2H17A 2WPDD 1N0WA 1ZW6A 4R2IA 3LFUA 3CWZA 4ZKEA 2J5XA 5EUQB 3BJIC 4RKEA 4PPNA 2J46A 3NBYC 2F43A 2WWXA 5JI3E 1KI4A 4BLPA 5EXPA 1S3SA 5GVRA 1AM4D 2O8CA 1G8PA 3H2YA 4LWZA 1Q20A 1JPJA 4CVNA 2AHOA 1SULA 3CNNA 4G01B 3AUXA 3AKYA 2X8AA 3V00A 3M4YA 2P5SA 5KUTA 4CT4B 4M1MA 3GFTA 1T3HA 1L4UA 4Q4JB 4Q9HA 2QG6A 2WJIA 1E79A 4RSGA 1CR2A 1R8QA 1S0UA 1D6JA 1E2GA 4GOJA 4LPKA 4LZZA 4HB2A 1NIPA 5JEDA 4WOPA 3R9IA 1EFTA 2ZR7A 1OE0A 4QGFA 1BYUA 2C9OA 2VYFA 2LWIA 3DHWC 4US2R 2Q0HA 5F2EA 1E3MA 1ESMA 3WMFA 4DEYA 2XTZA 3L82B 1HH4A 1WQ1R 4O25A 1Y3AA 1OXTA 4UJ5A 1YHNA 3C8UA 1ZNZA 2HJGA 3SYKA 2IYZA 2CHQA 2XTMA 2QBYA 1E2LA 2BOVA 4KSCA 5JWOA 1PZNA 2V8OA 4KLNA 4DB4A 2O8DB 2WMOB 3BWDD 1ESNA 5JRJA 4QGGA 4DCNA 1KDOA 4V02A 5L3RA 2CJWA 3KJGA 4TL8A 4Q5IA 1AK2A 4H1VA 5BWMA 1ZUNB 2GVZC 4PHFA 3T5DA 4Q7LA 2OBNA 2C99A 4R71A 1ETUA 3DMDA 3BB4A 5AUQA 2BBTA 3AUYA 1GUAA 5AK0A 3SQWA 5EZ5A 2AK3A 1F2UB 3BFVA 3LBNA 4BFWA 2IEYA 2FEOA 1JAHA 4IOMA 1G3MA 2JLXA 2GA8A 1IXZA 3X1ZA 3K0SA 2K5UA 4KBGA 5J4LA 1NLZA 5J4VA 2JASA 1P9NA 5GVSA 1IONA 5DN6A 3KB2A 4BRWA 1GSIA 4K46A 5H1YA 3B1YA 4UQOA 2FE4A 3GMTA 2AXPA 1Q3HA 4D26A 3GJ6A 1CLUA 5FL3A 3MG9A 5KNCA 1R0WA 3QY0A 4B2PA 4D81A 3ZD7A 5GJWC 1CRPA 3FOZA 1WXQA 3HU2A 2ZI3A 2NGRA 1G21E 1DTSA 2ZYUX 1E2KA 1II9A 1KOFA 2QAGC 4GP6A 2ZXUA 1U0JA 1OYWA 5FOVA 5FUWA 3ND8A 1A4RA 3NH9A 2XX3A 2YWHA 4Q9KA 2GHIA 2QSZA 3THXA 1D5CA 5J47A 1SVOA 1GILA 1A2KC 3PVSA 4MKIA 3I62A 1GDDA 1I2DA 3U60B 2W00A 1KAGA 2ERXA 3CZPA 5EJEA 4AG6A 1N25A 4TQAA 2QMOA 3WHKA 1S96A 1D2MA 1XEWY 1HEIA 3SDZA 4OHYA 1US8A 2OLKA 2NOAA 5E7MA 1L2TA 1VCIA 3PUVA 5DN6D 2IUSA 2R6GA 1VECA 3QEOA 4PZYA 1DG1G 2B8TA 2GJSA 4JSYA 1WE2A 6Q21A 3DM5A 2C2HA 2QAGA 1K5GA 3T34A 4Q19A 4LUCA 4C2UA 2Z4SA 2CMKA 2FMXA 2R65A 3VAAA 4NYJR 3JZAA 5KSZA 3TNFA 1EFCA 3FHCB 1G5TA 2ZVPX 1PJRA 5CDFE 4E03A 2GNOA 1JAIA 3AP2A 4DDVA 3RS2A 3MCAA 4CEHB 4PO1A 3P32A 1JALA 4DDWA 1R10A 1NSTA 4LYAA 4NCJA 4C0JA 3TE6A 2LKCA 1UBCA 521PA 1QBKC 2DWPA 1N5JA 1EK0A 3KX2A 4DIEA 3OHMA 1NNEA 1ZBDA 4NH0A 5G41A 1IY1A 2GWHA 2BM1A 1NVVR 1XMVA 4MYUA 2HXSA 1N0VC 3A4NA 2UZIR 2YYZA 1DS6A 1RE0A 2GEUA 2FPMA 3U3KA 2AL7A 2BMEA 3FYHA 2BKUA 4IOKA 1WBDA 2BBSA 2ZSDA 1W2HA 2ZJOA 1FP7A 4PC6A 4UXHA 1U8AA 2ONJA 2ZU0C 3B6EA 3BK7A 5FL7A 3TKLA 2PLFA 3BXZA 3Q8XB 1N0UA 2ONKA 1RRPA 3NHBA 1Z6YA 5BN5A 4LI0A 1EWQA 1L8QA 2B92A 1T8TA 4TN1A 3FMIA 1NVUQ 5ANRB 4NKRA 3KQHA 1XMJA 5DLQC 2OFOA 1E9EA 3CKLA 1EX7A 2GJKA 4JS0A 3RWMB 1P6XA 3ZVNA 8OHMA 4PAMA 1CP2A 5AJXA 2QEQA 1P7CA 1WRBA 3KKNA 2ZYWX 3KUCA 3JVUA 1VG1A 2IBMA 1MV5A 2NG1A 4JKIA 2WMNB 3MSXA 3M1IA 2EFCB 1QF9A 3CF0A 3ONWA 4Q7MB 1E4YA 2IA5A 4URZR 5EP2A 5FUXA 5A4JA 5DI3B 621PA 3VU9B 1Z0AA 4ZDIA 5FL7D 2QM7A 3HDTA 2IHBA 4Q7JB 4TL6A 2NPFA 1IY0A 4QHTA 4N1AA 4FN5A 4QM7A 3L0SA 2DYKA 1G8HA 3IEUA 5F9HA 1CKEA 4JYCA 2ZVQX 4ZPXA 1S9HA 2W2TA 3SR0A 5G53C 4CGZA 1FTSA 2JA1A 4S2EA 3T12A 3QEJA 2QORA 2XXAB 1XNJA 3B13B 4EPVA 1EFRA 3B9PA 4Z51A 3GJ7A 4IVRA 2ZJAA 1Z6TA 2WZQA 2YC4C 5E7JA 3OEHA 2OBLA 3L0PA 1ZJ6A 1G7CA 4LV6A 5FI1B 3KQKA 3TSOA 1S4QA 2OHFA 1QHNA 2ZRKA 1UKYA 3TUIC 2FFQA 1U98A 1ZM2A 4QGAA 1NY5A 2BWJA 2JGNA 4YDHB 1KO5A 3MWYW 2OUKA 2BJVA 1R0YA 4P4TA 1G9XA 5BN4A 1KDPA 5CM9C 1SKYE 3CLVA 2BCJQ 3U4QA 1XBTA 1E0AA 2FDCA 3B1VA 2NZ8A 3QXSA 2DHRA 4GZLA 1OH5A 4EJSB 3LAWA 4AG5A 3CPJB 4E22A 2J0UA 4JBYA 3SEAA 4Q03A 1SVLA 1EFRD 1SQ5A 3I1FA 1A2BA 1KK2A 2BMJA 1XD2B 2QMUA 1OFUX 2QPTA 3QPWA 4XWKA 3CO5A 4Q9JA 2B8WA 1YZGA 2AX4A 2J7PD 1NVXQ 3R8FA 4KFSA 2C8VA 3SHFA 3A6PC 3GJ0A 1RRCA 1J99A 3TBKA 4NL4H 3QF4B 4FI3C 4N3NA 1FX0A 4KU4A 4IRUB 2ORVA 2ZREA 3FKSA 4HLDA 3QKRA 4UNNA 4FMCB 4G5RA 4D82A 1Z28A 1DELA 1GRNA 4BUJA 4WZBE 5JEEA 3R9XA 4D2IA 1PVOA 4D6PA 2A2ZA 4X8LA 1YE8A 1QHHA 4RJLA 3K9LA 2FG5A 1FW6A 1ZRHA 2RH5A 2QZ4A 3QPVA 4DIDA 5GJBA 2P3SA 3KXIA 4BRUA 1D8TA 1G5RA 3GQBA 3RSOA 3MUFA 4JKYA 2DB3A 1ZD8A 3ADCA 1Q12A 2D62A 5CB6A 5EE3A 4OKSA 3AQ4A 4MGKR 4GP7A 3REGA 2FFHA 2MSCB 2MSDB 4M8NE 3QXXA 4LGMA 2IYSA 2REBA 2EFGA 2G3YA 1KO8A 5TARA 4NMMA 3K9HA 4KLZA 2QN6A 4OHWA 3SNHA 4QJ3A 4DLTA 2EWWA 2HCBA 4F92B 1W5SA 1HT2E 1M6NA 1S2MA 2AKAB 4FMBB 4Q9LA 5A5GA 3K0EA 1KI6B 1TADA 1JEDA 5D3QA 1U90A 2QNRA 4KFUA 2OT3B 1KO1A 1E9RA 5JLJA 4WW0A 5EP4A 1VIAA 2HXYA 3ADDA 1T5IA 1G16A 3B2EA 3LVQE 4IDQA 1W2GA 2N1BA 2X77A 1GFIA 1XPUA 3D7MA 1SKYB 1YZLA 3B8HA 1MRSA 2XITA 2ZJZA 4LJ8A 3OIYA 1UEIA 2ODBA 3L2OB 2F9LA 1QHSA 4B2IA 1QHGA 1YR8A 3RS0A 1Z47A 2I4IA 2IYQA 2F43B 1E1RD 4M1OA 5DYIA 5FBLB 1W36C 3TUJC 1TEVA 1GKYA 1TU4A 2IYXA 1YZUA 3O8CA 1XP8A 3EPJA 2O8CB 2V54A 4A2QA 1VCMA 2ZI5A 1UM8A 1VYUA 2RGBA 2FNAA 2DFKB 3TQCA 5EE9A 4IDHA 2ZRMA 4C0AC 1D9XA 2GF0A 2QA5A 3MRSA 2I1VB 4H1UA 4IEIA 3KTAA 3F5FA 3RDPA 2P6UA 3IQWA 2GJAA 4A6PA 4Q4AA 5E3HA 3B60A 3TSZA 2ZIAA 1G291 1N3BA 4TTPA 3T1VA 1X8KA 2BKEA 2Q3HA 4RCZA 4F4JA 2V1XA 5SZJA 1RRFA 1SVIA 3F0TA 4M1WA 2CBZA 3W6PA 3GFOA 1SZPA 4PC1A 4YC7A 5KPJA 5LPNA 1C4OA 3AF1A 2QBYB 3GEHA 4IXMA 3AKCA 4XH9B 3GJ3A 2G9NA 4AURA 1IXRC 2OBMA 421PA 1XB2A 3CM0A 3CR8A 2CL6X 2XJ9A 4LRWA 3ADBA 1NMXA 2FGJA 1E2QA 2QUZA 3WNCA 1JXMA 3GEIA 2CJWB 1IJEA 1BO6A 2Q9CA 4CIDA 3CZQA 1P60A 3BOSA 3EIEA 2IC5A 821PA 3QXHA 3GLFA 1OH8A 1T0HB 1DAFA 2CK3A 3PUWA 4Q18A 5BQ5A 4Q66C 3C15C 3DKVA 4HAWA 1T5LA 2VA8A 4EUNA 4EPRA 1OLOA 3T61A 1R4AA 3LLMA 3TW8B 1LNZA 5BN3A 3H1TA 1DAKA 1N6LA 2ZU6A 3ZYCA 1SHZA 3PITA 2RKOA 1O87A 1AKEA 4OI4A 4PC7A 3CWQA 3TGPA 1W36D 3G82C 5F9FA 1Z0KA 4PHHA 4QNMA 2PL3A 3QPUA 4KODA 3IUYA 3NIBA 1L4YA 2G77B 3W5IA 2XB4A 3AM1A 2W2XA 3AVXA 5LBIA 3SS8A 1N6KA 5CJ2A 2C9YA 1JR3A 1ZIPA 1PUIA 4B73A 4HAZA 2HYDA 4EAQA 2J9RA 4GMXA 1I4DD 1E9DA 3P1JA 4RCYA 3K1JA 1B23P 4Q48A 4DLWA 1XMIA 2CK3D 4KHZA 3GJ8A 1XDBA 3W5JA 4BEJA 3THXB 4GT1A 1FZQA 3EARA 5FUYA 4URXR 3TR0A 1WBBA 3O8DA 3KL4A 1CS4C 2E1RA 1OXSC 1G41A 4R98A 3ND9A 1ODFA 4V0OA 3SFZA 1OFIA 3X1XA 4Q01A 2MMGA 3RANA 1FQJA 3SE0A 1KI8A 3R7WA 4O2LA 2JAQA 2FGKA 3ZIAA 1XEWX 1US8B 4JLVA 3I92A 1QVAA 2AD1A 3IGFA 4OHXA 1V5WA 5C46F 4LC0A 3VR1A 3C5HA 1CTQA 1RZ3A 3HR8A 4JBXA 2QAGB 1IHUA 2YKGA 3J81k 1P4SA 2NMVA 1HTWA 1E2NA 1IM2A 1JNYA 1DAGA 1WMSA 5KDOA 2O52A 1JECA 1JR3D 4NCIA 4XTCS 1NI3A 4DLSA 3ETLA 4W7SA 5FH9A 1U99A 1OXXK 2OLJA 1ZIOA 3KJEA 3U5ZB 1XPOA 5H8WA 1ZU5A 2HV8A 2FX3A 4DT1A 4C7OA 2FPLA 2QE7A 2ZRNA 3UXMA 3THYA 1YU9A 4ZCIA 4ZIRB 3KFVA 1N6RA 4NU0A 1AGPA 1NLYA 1W0JA 3RRMA 5C18A 1G18A 2WWYA 4HAUA 3K9NA 2X1VA 3IHLA 4NYMR 1JI0A 3ZIAD 4N0EA 4Q4HA 5EQTA 1FFHA 1FUKA 3THWA 1IN8A 3D3QA 5FPSA 1SVMA 3TVTA 4P31A 4TMVA 3CH4B 1XTSA 4LBYA 4ESVA 4HYYA 3UMFA
chains in the Genus database with same CATH superfamily
5ARDA 4IUDS 1BVRA 4HUJA 4XYGA 5G40A 5L4LA 5B12A 5FPHA 4UDYX 4C4TA 2WU4A 4IIUA 2TMGA 4JK3A 3I9FA 5DSXA 2GAIA 4Q4DA 2XHEA 1NQAO 3F46A 4XYBA 2ZRAA 3F9IA 2RGNC 4RJ2A 1W19A 1WZEA 2FK7A 3P94A 1HFKA 5JMTA 1M1YA 2IIVA 3L8HA 5TGTA 4QL3A 2PO7A 5D01A 3P26A 1UPBA 2CBXA 5FORA 2HJVA 1EM8B 3WGHA 2UDPA 2CJFA 1QOZA 3BWVA 4Q6WA 2J59A 4GNKA 1Y3IA 2LKDA 4IZIA 5DBHX 5BSEA 2DXIA 3QW2A 2EJUA 1ESCA 2FF5A 2OESA 3D6NB 2DAPA 3I5MA 4D9JA 4F38A 4K6CA 4FTWA 1YZYA 3H04A 3DMNA 3L7DA 4Z86A 3LSTA 5D5HA 2O57A 4V0KA 5EIHA 3BJRA 2ZWOA 2VYCA 3PD1A 3V1LA 4EMBA 4RL4A 4ER0A 4AAYA 1SHUX 4PAOA 3FYCA 1H3NA 1LVUA 4ZREA 2ZQ5A 2EC5A 2ZWMA 4YIKA 3MWGA 4M21A 4DA6A 4EJ2A 3DAPA 3O4VA 2V3CC 4BDSA 4I50F 4U7JA 3OJXA 1NNUA 5D87A 5HIKA 3WL7A 3HXLA 3K8YA 3N2NA 2PEZA 1HTTA 2WP8J 4V03A 4J7AA 4EJFA 4F7DA 1BW9A 4U7DA 3IJRA 1A3CA 1M2FA 2NP6A 3LGAA 3EUAA 3ZGLA 1DBIA 1U5CA 3JATA 3L40A 4DBLC 4OOEA 1G66A 2P2LA 4GMDA 5T67A 2EZTA 3V55A 2O59A 3KYIB 4DBVO 4AY2A 3JR7A 4ZYVA 3HCEA 3IP9A 2TRSB 1QO0D 2IEBA 4H3HB 5FD8A 2UZ4A 2WWRA 1GZ4A 1HZJA 1XZKA 2JBWA 2VL7A 4G25A 4WOKA 3IUPA 5SYNA 4D9BA 4DUZB 3UV6A 3H9QA 3TGLA 1JHZA 4TWJA 3BIFA 1LBTA 2C1XA 4ZV9A 3VNUA 2IYVA 5JDIC 3GFSA 4IG4A 2W6ZA 5EJ2A 4JUAA 4MVJI 1WXIA 5FPTA 3T3IA 2O2IA 4X1IB 4ALIA 4DCVA 2XCSB 2FQ1A 3Q72A 1E99A 1XDUA 2FPSA 3E8MA 2FPGB 1QDUA 3L43A 2OG2A 1XVTA 4HNVA 2RHWA 2UXDB 1R12A 5CTAA 4RD6A 4IFEA 1EFPB 3SAJA 1VPWA 2TECE 5LJLA 3SR3A 4ER5A 4NZZA 2REXB 2CLIB 1A8HA 4PLCA 2FB9A 3G89A 1GKLA 1DI0A 2HF9A 4ARUA 4I50A 4BX0A 3EAQA 4RLHA 5GP1A 4C01A 1WMBA 2I6UA 2HQSA 1RWQA 2KS6A 2YWEA 2J0UB 1J07A 2C04A 3GARA 1F0NA 2LCQA 1MC4A 1PUXA 1HG1A 1Q1EA 2R6CA 3LKDA 4LWOA 1KI3A 5FR1A 4EBBA 3OY7A 1IHOA 3CN7A 2WR8A 4UUOA 2AFHA 3CUUA 2CNKA 1JT9A 1FSZA 2K6GA 5I7OA 1XCOA 3DL7A 3EIUA 4NENA 3RYFB 2FPPB 4RX1A 5UKDA 5K5EA 3IQDB 5FI3A 1H4QA 4M83A 4A91A 1R3UA 1O89A 3IHWA 4UBOA 3DBOB 4ND8A 1Z26A 2AJLI 4BQIA 4LFBB 3IBCA 4JH0A 1VE5A 3LF1A 4FFRA 2V55B 5CT5A 4G3XA 4BO0A 1BVYF 1Z25A 3AGQA 2ZYVX 1O9GA 4MNTA 4J07A 5AKIA 1OW3B 2F6RA 3GAZA 1G4UR 3ZOKA 4WZBA 2CXHA 3X1KA 3BL8A 4J0EA 4LJ9A 2K4MA 2Y92A 5FFFA 3RM3A 2OORA 5A02A 2IYUA 2PDAA 5ESRA 1XN1A 4PX9A 1PZFA 2B4TO 1MA3A 2O2XA 3B3AA 3KYJB 3PF9A 5ALHA 1F17A 1SUSA 1L5ZA 1U9CA 1OXUA 4BGUA 4EPTA 3RYCA 3KXDA 2I7TA 3UVEA 4DCTA 4R9RA 1SU6A 2PLRA 3I9MA 3SJBA 5IW8A 1TQ4A 2X9QA 4BWYA 3ECSA 3QY9A 4QG3A 3LWZA 1J8VA 2G8NA 4X1YB 2NU9B 1J33A 1RI4A 4I2VA 2CLCX 4QE3A 4TV9A 1XT6A 5FOTA 5C51B 1K98A 2XZDA 2CCKA 3NT5A 4OSOA 1EXWA 3C45A 1ZA1A 2Y0CA 2HZBA 4IP0A 1GVNB 1EDDA 3CVXA 5DOZA 1U0LA 2WFLB 3K2IA 3TO5A 4LF4B 4ZGGA 5J4KA 4MW1A 1E79D 4XOIA 4C2AA 4QNRA 2W90A 4WOJA 4MWSA 3W8DA 1M83A 4RC9A 4KQKA 2VLIA 3UENA 1N8NA 1QANA 3QVWA 4XGNA 5DGHA 1LBHA 5J23A 4QVKA 5EZYB 4MUYA 2X7HA 3S8EA 2EERA 3GRRA 2P9YA 2EJTA 4JIMA 5KSYA 2NT3A 1KZ7B 1Y6QA 2CVHA 1E9SA 3IXLA 2Q9AA 4MUIA 1M3SA 5JHHB 2FZLA 1TC1A 2R6AA 4RKQA 1U2DA 4WZAB 5I4KA 1AV6A 1KQ3A 4MAFA 1HT0A 4N9QA 4CM7A 1QYXA 1CUGA 2FSPA 4MB2A 4EA6A 1YDMA 2Y05A 3E3NA 1AUVA 3GA7A 4QU5A 2X4IA 5FJJA 4DAOA 5FBHA 1L5GB 2C4UA 1GGEA 2E4UA 1RW4A 3IAM1 4HZIA 4YHBA 1AZTA 2BEUA 2H0AA 2D5IA 1VTKA 5NLLA 5A6SA 2EX0A 3MJVA 4N54A 1RU3A 2IF2A 2OZLB 4CF7A 2ZKLA 1EVLA 2YOFA 1JBQA 4WGFA 5CA0B 1O03A 4P33A 2NIPA 1YC2A 1ZSNA 4KR7A 1KDRA 1B93A 4HN2A 4KO8A 3DCJA 4CTNA 3HSKA 3IMFA 2I2FA 3BDAA 3KQOA 3O5AA 5IX8A 1Y6FA 4XIGS 4JJGA 3JQ9C 2HJ9A 4XWAA 1FJGB 2R8ZA 4M2LA 2BV3A 3V1YA 1XJQA 1TCCA 2FMFA 3DXFA 5DX1A 3V4SA 1HR0B 4Q4AB 4BNFA 1GKUB 4TWBA 5FTJA 3OE4A 3VOTA 1TAQA 4B6GA 2WBLC 1T9AA 2AC2A 4S05A 2PAAA 1GPUA 1W36B 3MCZA 3WKCA 4BO8A 1LFDB 4N8SA 3LPAA 1I1HA 4D9HA 4TWIA 4K9QA 3D6HA 3AL2A 3T1NA 2BY4A 2H2FA 4QU8A 1JDTA 2GN0A 1RLJA 2OCXA 3A1VA 1I4LD 3NUZA 3O2QB 3OZGA 2PGDA 3HQ4O 4HH4A 4PLVA 4QBIA 1VMDA 2VDOB 3AYXB 4CLEA 1D6SA 2JHGA 3AEZA 1TF2A 1VJRA 4M1EA 1IXSB 4PNEA 1T2EA 1UBUS 1U9IA 4BWGA 1NVTA 4BCCA 5JS8A 2WB4A 3T3GA 5J2TB 5CLJA 5DP1A 3ZHYA 3LDUA 3M6IA 5IJWA 2HSZA 4WK0B 9LDBA 5I7SA 4O1IA 1NW5A 1QV7A 2OG1A 3I04M 1TL7C 1YJBA 4HEA6 1EESA 1T4GA 3H9GA 2JPDA 2JIQA 3LWDA 1RHQA 3I2HA 4UAVA 4XEUA 4XVUA 4KXUA 3OQIA 3C3WA 5C0OE 5TDHA 3RLFA 4PE5B 3VR5A 1U2QA 3LQ1A 2R7MA 3A26A 4RQAA 5BN3B 4UU1A 4RZ2A 3HJHA 1LTQA 3SE7A 3LRXA 4TUYB 5AJZA 1A1SA 1BWRA 3D02A 5EY5B 4BNDA 3DVAA 5ED4A 1NXWA 2Z2KA 1QS0A 1UXGA 1VSBA 4LC9A 1N32B 3PUZA 1YKGA 4AFNA 4GBED 2ZUFA 2XQIA 1AD2A 4IJQA 4I81A 4E08A 4M1SA 2DFPA 2AWNA 3T54A 2MU1A 3RH0A 2VPWA 3KUDA 4F9GA 5JWHA 2HIMA 2IPLA 4CGYA 1ZA2A 2DSNA 3HVHA 3SQXA 4MWZA 4D3DA 1CJKC 2RGCA 1II8A 5FV4A 5AKYA 4P9NA 1RXYA 1UFQA 3WLSA 2BONA 1XD8A 3OY2A 2DECA 4P1ZA 2RGEA 3OQBA 1TF7A 1Z0DA 4QDUA 5CB6A 2P2SA 1TVCA 2DUNA 3H9JA 3B3FA 5FP0A 2RGYA 4P3XA 4NRDA 4DG5A 4DQDA 4D7AA 4DW8A 1N7JA 2CDRA 3GFPA 3OO1A 4JGGA 5ESXA 1X7XB 3GLKA 1E3DA 1V7QA 3IH5A 2VI5A 3DV0A 1R6AA 4YP7A 4X1KA 1M8PA 1V9CA 3TRHA 3DA8A 3LGSA 3MQ4A 4DUGD 3E81A 4NF2A 1UUFA 4DIBA 2NUAB 3BMXA 1ZXXA 4TS4A 1JHVA 2LR0A 4C89A 1U2RA 1ZUIA 2OV3A 1GADO 2Q6OA 4KE6A 3UGKA 3B5IA 1NGSA 1DOAA 1LCIA 1Z7GA 3M89A 1DC6A 1ONPA 2VDNB 4AYTA 3N53A 5LQCA 1GCUA 2M1ZA 1WZNA 1T9ZA 4AZTA 3CEMA 4LW8A 4NICA 1OB2A 4U8HA 1TZMA 1U0RA 3LCRA 4Z8XA 4FCWA 2VJQA 1GZ3A 3G2MA 2QLBA 1DSSG 3GR6A 2FW8A 4RVOA 4YACA 1XLTC 2ZIXA 3RSQA 4AP9A 4URUR 1X39A 3ZGXA 1D0SA 2ZBUA 1X1RA 2CLKB 4H6WA 1G7TA 4RGQA 4RTRA 1AJEA 2VA9A 1P2DA 1I7SB 3B7WA 3AF5A 2BR4A 1CJVC 2FSHA 1CQIB 1KSGA 3T7DA 2ZRPA 4JVOA 4E07A 1M1NA 4P98A 3V4LA 3V9AA 4UCWA 2H06A 2WHPA 1V35A 4DPLA 4L50A 5CLLA 4B40A 3FTNA 5KOYA 1QCZA 3EF3A 3ICWA 4K40A 5U4QA 2R751 1DU4A 2DH5A 2B9EA 1YTLA 1GCOA 2H5JA 1C1DA 2XSZA 3H99A 1AG9A 1HORA 2Q6VA 1M7HA 1Q0ZA 4FHEA 4QSHA 1L5YA 5I9NA 1A71A 1Z73A 1RE1A 2JFVA 1AS2A 4J2OA 4P3YA 4XARA 4TVKA 3GFRA 3SICE 2KW5A 4G41A 4ARAA 1DRVA 4O5AA 1TK3A 1OAOC 3OIWA 4NZYA 2ZUBA 3BQ9A 3VC3A 5KYYA 1VLMA 1T6NA 1D2NA 3DLIA 4RLFA 5DW3A 1AGYA 2ZRGA 3E3OA 2NO1A 3GP5A 4MA4A 1ZMRA 4QFBA 4M76B 1SC4A 1KDTA 3E0QA 3K0HA 3OQPA 4BZQA 4DY4A 4EYKA 2CL0X 5CVEA 2F3TA 1N2GA 2QIPA 2Y68A 3OZFA 1N6IA 2MCFA 3KFLA 3BTVA 1NW7A 3MWKA 1AE1A 2PUVA 4WA7A 1IJBA 1M1YB 2O7VA 5J9FA 3MRXA 2PCJA 2PX0A 1OPRA 2V3VA 3IKVA 4OQMA 1QP0A 3UMGA 2PKXA 5EJ7A 2GCEA 1WF3A 3P5SA 1N34B 5IASA 3V4OA 3OBBA 3Q9NA 2YOHA 5F33A 2DFTA 2IELA 3R3YA 5KQGA 3GGPA 2PJZA 3IBSA 4NOLA 1J0EA 3WB2A 3U81A 16PKA 1UT8A 2QUAA 3MLEA 3M6FA 2CKDA 1N2CA 2J09A 4D44A 5JANA 4C4AA 5KNDH 4NR0A 1HQKA 4CCSA 1ZS9A 1O08A 2H31A 4JDUA 1FP4A 4Z7NB 4L07A 3FFXA 1KBQA 3QEBZ 3JQ6A 1XTVA 2BLLA 4PNHA 1V47A 2VBCA 3FMFA 5BXYA 2A59A 2J1LA 1NQXA 4LYDA 4IOJA 4TS1A 2PM8A 1G8KA 2XCLA 1X86B 4EVSA 5KTYA 5LDDC 2O1SA 1A77A 2IW1A 2J3DA 4GXNA 3T7JA 4R05A 4ROTA 1K75A 5EJ8A 3KLNA 3WLQA 1T8YA 4PFKA 3WRXA 3K5PA 2B8JA 1E3EA 1JLSA 1JQBA 1BW9B 4K9MA 1LNSA 3G8YA 2E21A 2BFCA 3LLVA 2P5TB 1Z83A 4OI1A 4EJ6A 5AVJA 4ERNA 5LZ4A 2B7BA 1PQWA 2XUKA 3H4IA 3JATB 3WLEA 2B99A 3O92A 1E9VA 4G97A 1IPHA 4OFWA 2PL1A 2QN8A 5CVUA 1ESEA 3TZKA 4QEDA 2MHCA 1GNRA 4C5CA 2RGUA 2QUBA 4ZQHA 4RENA 2IRWA 5CDTA 1X0XA 1QQ7A 1CCWA 3OJFA 2BAGA 3ESBA 4BZXA 4B83A 3PTLA 3RQSA 2JG3A 4MLPA 5A4DA 4NFHA 1AKUA 2GF9A 3LP5A 5CA1F 2J3MA 4OHBA 2JGAA 2ZETA 4YWJA 2IZ1A 4LNAA 4XUGB 1BKDR 3GNQA 4RTLA 5A3RA 2H5LA 4GYJA 4LDNA 3QPAA 1E62A 2GBLA 3BSSA 3HBMA 4UATA 5D3MA 5KQSA 4B32A 2QL6A 2GXUA 2ID4A 3VO9A 2FWJA 1QLJA 1UWLA 4XVHA 4AXXA 4G5XA 3UAGA 5K0SA 1GTJ1 3ZU4A 2E18A 3CCCA 4NCHA 1P3DA 1PWXA 3GWZA 4JVNA 1HV8A 2G76A 4CUKA 3P20A 4M0LA 2J3IA 3CO0S 4RKWA 3RGGA 3H86A 3DE2X 3ZQ6A 2PU5A 2WUFA 4I50B 5KJCA 4JYZA 2F4VB 4HY3A 1XZBA 3RK0A 3SGLA 3O4JA 2PWAA 2GB4A 1W59A 5DEIA 2ZDGA 2XGJA 4M4SA 4KITB 2Q3MA 3P2JA 3RTDA 3JWGA 1IN5A 1DCFA 2AFHB 2MR6A 3BE4A 5G4LA 1KDYA 3LCVB 3WKEA 3EJWA 4XYEA 3T6KA 4NENB 1RHUA 3ENZA 1U31A 2OTCA 5DNUA 3G3EA 3E84A 4QBHA 4EKYA 3GH1A 1BHJA 1NZFA 3RFFA 4ND8B 2DWOA 3CNEA 4NAVA 1UCFA 4REMA 4BPBA 1HNWB 1U81A 3C4QA 3TCNA 1ZCJA 5BUQA 1C1YA 2CHVA 3JV7A 1L0BA 2H5EA 3DP7A 2O5VA 4LQ4A 4P93A 4Q12A 1CETA 2Y4OA 4M46A 4MQBA 3ZHBA 2G63A 2B4AA 2I1QA 1JFVA 1V1MA 2QZJA 4FJ0A 5A0VA 5H16A 4WZBB 1E0SA 4DWOA 3CURA 2ZS9A 3DE0X 4D0NA 5KWVA 2WD9A 3S44A 1U5AA 3WRYC 5AVUA 2XCUA 2C0PA 2H57A 2GEBA 3WFIA 1MA0A 4GUDA 2DPLA 2GK4A 3RYCB 2FU5C 5EERA 3M5DA 2QMYA 1ZKMA 1A9TA 3PIIA 2WF6A 3ANMA 2AEFA 2QLFA 3L0BA 3L7NA 3UA3A 3NIGB 4N41A 2QENA 2B30A 5K09A 3NX4A 1DAMA 2V6FA 2AZMA 4AIRA 1WM1A 2A1TR 2WSLA 1VHDA 4BNHA 1IVNA 5HJ2A 4TV9B 3L0OA 3MT8A 5AHWA 5CIYA 1CJSA 2G40A 1NLUA 2VF8A 2VNHA 2WWWA 3GW8A 3L1UA 3M70A 1GY8A 2BH2A 1DPGA 3JQEA 4B33A 2OVFA 2W0MA 4IVQA 2IQIA 2JCVA 1JLLA 3OLCX 4FCTA 2PVPA 4MQ6A 4CQNA 4A9AA 2JLQA 4KH1A 2WT8A 1QR6A 5C5CA 4IOLA 1FPMA 4UDNA 5E4YA 5DHSA 1NPTO 3VAYA 3O1JC 4MRSA 1HDEA 3GJ5A 3K53A 3AFMA 4RANA 4C3ZA 1G7SA 4C7XA 1LSOA 5BSWA 4KNYA 4MJ3A 5HUQA 3PLAE 1OV4A 1P77A 3NOOA 4U6NA 5A3SA 3OLXA 4YQEA 5H4GA 3PUYA 4WVFA 4RD0A 3THOA 1F4PA 3AJ8A 4EGQA 4EVIA 4F2PA 5AJUA 1AN0A 1ULSA 3EE6A 1UPAA 3ETEA 2ZI6A 3CVUA 2RHMA 1GGJA 1UMCA 3M6VA 3PPVA 4A92A 5JJKA 4JI8B 1SXJE 2JGDA 2P9ZA 3K1ZA 4KR6A 2BEUB 3N75A 1TMKA 2RD2A 1TQ6A 4TQ9A 4P34A 2F8SA 1CC1S 2VDUE 2F1HA 4ND7A 5A6SB 1NN0A 4PEVA 4CQJA 1KIAA 2YWFA 2WVJA 1CR0A 2I2XB 1LB1B 3UPUA 1SQ6A 2JW5A 2ZBPA 2V03A 3SZGA 2VYQA 2Q6KA 3MOGA 1KZ4A 3ADPA 2VAWA 3D8TA 3EZ9A 3GGCA 4JC8A 2HO5A 3LCJA 5EZ6B 5SZIA 5A4IS 1NVWQ 2VQFB 3C3XA 5C34B 5L4NA 2VK1A 2NPOA 1FYFA 1DJQA 3DD1A 3C8DA 2O4UX 4EI7A 4AJPA 3PQ4A 1VL8A 2F8LA 2R1UA 2QTBA 4RH1A 2VWQA 2GQ0A 3M3PA 4BQEA 4CWAA 1PG5A 3QVTA 4TZ0A 1QZZA 3ONVA 4BMXA 4LBZA 4BLWA 1IUOA 2PX2A 4TYNA 2JJ2A 1GG2A 3QNMA 3WWCA 3ORRA 2ZRCA 3AW8A 3L7YA 4N6OA 1RWNA 2PXXA 2WJZB 1UKAA 3EXFA 2HC9A 1PS8A 3U1TA 4MLDA 3DOOA 3DOJA 3KK0A 3LUFA 4RE6A 3HB0A 4W6ZA 1F2TA 1WX1A 4L5YA 5GM2A 3LQ4A 4QOGA 2PSSA 4MYRA 2Z3ZA 1RRGA 1DAOA 1ISFA 1EU1A 5KYKA 5D5QA 1BOFA 5AI8A 4GPIB 3SZRA 5C1DA 1JT2A 4LX0A 1H5UA 2JIRA 4NFYA 1BRMA 1LPMA 3RYTC 1GUYA 3EPPA 4M6WA 4GXTA 3QV1A 5KMGA 4DJJA 1GTVA 2ZS8A 4H6VA 2TSYB 2ZAMA 3K09A 1JU9A 3LHIA 3KUXA 2HQRA 1I24A 5SZKB 4EUSA 3ZE7A 1V3QE 3UAVA 4GE3A 4BFZA 5M29A 2HHCA 2YMQA 4ZT7A 2E49A 2ENWA 3TDNA 1NR7A 4D98A 3CKMA 3UAXA 2QZZA 3NBXX 3OQIB 1NY6A 4H9GA 5HM8A 3E5NA 4RVSA 1L1FA 1L7BA 1ICEA 1CUUA 4QLAA 2I4NA 5FWXA 4Y6QA 3V8VA 1FJ2A 4CLXA 3HYTA 4P7GA 3NMUF 4E3WA 2Q21A 1WOYA 2ZB3A 3C5WP 2V7PA 5FHQA 1YBHA 3PLNA 3HO1A 1JDBC 4DYHA 4G4SP 5EJFA 5GADl 5CMLA 1XAIA 1MFZA 5CEJA 3ZW8A 1R9NA 3FWYA 1IJKA 1LI4A 1LVGA 1PD0A 2QRJA 3DVAB 3U6BA 4KV9A 1QS0B 5AK5A 2VIIA 4PNPA 5IWCA 4YXWD 1IAQA 3T3EA 2JH3A 3OTGA 3HXTA 4DE5A 3E22A 1UWCA 4EEZA 3L1IA 4Y8VA 1KIFA 1RWKA 1C0KA 5HE9A 1XAJA 3QKSA 2CLLB 1II8B 2E4ZA 1E3IA 1KQPA 3AB3A 3E9MA 1ORHA 3DC2A 2CEAA 4FYXA 2QNBA 4U5QA 3SJCA 5KYXA 4K9KA 1ONSA 1RM3A 4DV0B 4W82A 3UJAA 3I73A 5K0JA 5D7NA 3SM3A 3ZCQA 5LOVA 1E60A 2I3DA 4YK7A 3T3NA 1YS1X 2FEXA 2QXYA 2C2WA 2OOSA 3IIIA 3IPXA 3NKLA 4PQRA 2ABWA 1C9NA 4F9FA 3SQLA 1GV1A 2DCMA 4DY6A 2GM4A 1N6NA 1YRHA 3L01A 2G6BA 4JX8A 4X3CA 5G1NA 4CG3A 2A30A 3DV0B 3KQNA 2WKPA 2HIGA 3LG2A 3P9KA 4X1KB 3ZQUA 5K0BA 1V8ZA 2XYGA 3NM4A 7AT1A 1AHHA 1M1XB 4XJXA 5K3CA 4AWXA 2XDYA 3F1KA 3SXPA 5BSKA 1QDLB 2XA2A 4GPTA 3RROA 5KQRA 1LX6A 1XTQA 4KWHA 1FY2A 4NYMQ 1G9TA 2HMTA 2EQ5A 1DX4A 1K3UB 2XAUA 4B3XA 3IE1A 1J1ZA 2QD5A 4A6XA 5JCZA 1ORRA 3HNOA 1HE1C 1L9XA 3AMVA 4I3FA 1E9CA 3PKZA 1QE0A 2HL6A 5TF0A 3WYGA 4RY8A 4AQDA 5DBFA 4PC3A 2ZYTX 1SBIA 4MCIA 2HWYA 3CNQS 3WS7A 1I7DA 2AWOA 1A82A 4IZ6A 4CU5A 1LVHA 4OX9Y 3M4JA 4BTLA 4LJSA 4MRNA 5K51A 1M1NB 2W6OA 3UJ3X 2WHPB 4WDRA 3G49A 1D7AA 2H00A 3H17A 4PANA 4XQ0A 4ATNA 5KKNB 4IXTA 3CVWA 3G9QA 1Z18A 1T1IA 1C8VB 3SYNA 3VQTA 4DREA 2AQ8A 2FV8A 1TQ2A 3GLIA 4XD2A 1C1DB 2DBYA 2VBFA 1QV9A 3G0OA 5JZBA 3WAGA 5FBZA 5FTNA 1I2MA 2XTNA 1XRPA 4OHPA 2R8EA 1HE4A 4KB5A 1EXVA 2NW6A 4J2HA 3X2SA 2I5PO 1M34E 2A9KA 2EYQA 2IS4A 5DLEA 4IGIA 2AG1A 1SUAA 2DLDA 2VJCA 2GK3A 5BQPA 3WK5A 3DM9B 1P8JA 2LCFA 4FFBA 4X0EA 3IFSA 3WP0A 2OXCA 5KYYB 2OK8A 4FFDA 5K99A 3TQFA 2MOKA 3QSYA 4M60A 1Z63A 1E2JA 3S7TA 2PA3A 1E8MA 2O0LA 1N2XA 2NTYC 4MMXB 2C84A 1JJFA 2PWBA 2JEZA 3D9QX 1G6OA 1JP7A 4ALMA 4JX9A 3MHTA 4GZMA 3WDKA 1T34A 2FPWA 3Q3IA 3R09A 3EZ7A 1AXRA 3A3YA 1VJDA 4H7KA 1MJGM 2P6PA 2JGEA 1C0LA 3SX2A 3C87A 1XCLA 4DMMA 3RG2A 1KJWA 4G1FA 2QOEA 4RYDA 1XL1A 4M1YA 1HZZA 3A9CA 1CUHA 2Q2QA 4RK6A 1JFRA 1W1WA 3URMA 5AM0A 5JJLA 2B6HA 2DQYA 2DCUA 3QMMA 1XX6A 4UE6A 1P0IA 4JVMA 1ZNQO 3ZOZA 3ROPA 1UXJA 2HSGA 1K8QA 3MS2A 1N2CB 3ICCA 1Z0FA 3TXXA 1K66A 3BM5A 1CB7A 2D5BA 2ETVA 1S2GA 1CQWA 2DQZA 3LUJA 1AXGA 1FP4B 2YJNA 2ZQYA 3BD8A 2YZ2A 3AIKA 3C5VA 2WRZA 3HACA 4RVGA 5COAA 5FLYA 3BK1A 5I5EA 4A8HA 1NQWA 3VR3A 2IBSA 1UXIA 4W1SA 4OXKA 4BX8A 3HUEA 3J7TA 3RIMA 3RNOA 2A35A 2BMFA 3R5FA 3TL6A 3VC2A 4U2BA 3WX0A 1PJQA 1GTG1 4IGAA 1W93A 1Y7IA 1G0OA 3G6KA 3R5XA 1HC7A 2C5LA 4HPWA 1MGOA 4C0LA 2E9SA 4R2JA 1SOMA 3BSYA 1QPBA 4ZGBA 2BFCB 1XMXA 4PZAA 1GHTA 2EKQA 2RJ3A 3PJDA 1MRZA 5I4IA 5JXJA 1HDXA 2FEWB 4OG2A 3TSCA 5IAAA 5J4YA 1GITA 4ZQGA 5CLHA 1SPXA 1EA5A 3QQ5A 4HDNA 3JAMA 5BYJA 1L4HA 3OIGA 1HYGA 2PXAA 1FQOA 1XRNA 2WINI 4B7UA 4RK1A 4D9GA 4M89A 1J0AA 1B42A 2W22A 3B7GA 3F96A 3UK2A 2R8BA 3KQVA 3EMDA 2MJLA 1EP9A 2KBFA 2PBLA 1ZP6A 2HT6A 3PZBA 2CYAA 3NYQA 4JROA 2UUAB 3DNFA 1I1NA 1CF9A 3UT5A 4BO3A 3U3XA 3B12A 2UKDA 3DO8A 3VNVA 1PW5A 1SQFA 2I3AA 2IXAA 3DL0A 3L5KA 2CWDA 3FNEA 3OMLA 3NKVA 3ZU6A 1KTIA 4Z4CA 5DBEX 1DBRA 1KJYA 1NBME 2CVQA 3AU8A 4LXXA 4XIIA 5D3MB 4BGDA 3ER6A 1ZIDA 2F62A 4J43A 3JZMA 4ZT5A 5GGXA 1KI2A 3REQA 1N5KA 1A69A 2BI4A 2Q0SA 2WMDA 3MW8A 4QBKA 4AUKA 2GCNA 4AW9A 2H1VA 4BE7B 5ICCA 3OT4A 3ENNA 3RG8A 1CUYA 4N0PA 3V8PA 5BWBA 3IEVA 3I42A 2QTVA 3IMEA 4IVPA 2ZJFA 4YAEA 1POWA 1YDEA 3T8YA 2WSIA 2G06A 2XWJI 1DBPA 1ZGBA 2V7EA 4FEAA 1C7IA 1NWHA 3AUJB 4IJVA 4D9FA 2WDZA 3G9TA 1NAHA 3BRWA 5ARBA 3AXSA 5K0TA 1ZIXA 2YJ5A 1YT5A 2VP3A 3ICOA 4DJEC 1YA6A 3MTGA 3UV7A 4QM6A 1C0PA 2J08A 2JZCA 1QHXA 2Y9PB 3IOCA 3OJEA 4YPFA 2PJRA 5CCBA 1JSRA 3F6EX 1AQIA 1B0PA 2WIDA 4DA7A 1MCZA 1EH5A 4D4LA 1HNNA 4QFCA 2UXBB 3KIPA 2PRIA 3KWMA 3TB6A 1C7QA 4B48A 3UATA 2Q6LA 3VZSA 5DU2A 1BFUA 4PSVA 3EZ6A 4HFRA 3G85A 1YRQA 5IN5A 5AW6A 1KH2A 1V1MB 1QORA 1W1IA 1V71A 2PGIA 2ZBEA 3BKXA 3EWIA 2HMYB 3PXAA 4RH3A 4W5TA 3I4CA 1UKEA 4YMHA 2EJWA 1IQUA 1U6IA 3N07A 2JJMA 1DADA 3W6UA 4A4DA 5JMPA 4DLNA 4F3YA 1VYTA 3HL0A 1NI5A 1OBOA 1VJ0A 1W4RA 3OCUA 5HZGA 2WT9A 2GTHA 4HXFB 5I7UA 1QPGA 2IOFA 3GXOA 3WL5A 2IY7A 4OXIA 5HE8A 1WLSA 2B61A 3TR6A 4ZZ0A 3C1TA 3L41A 3UM9A 3CTPA 4P3KA 2PZJA 4XFKA 3AR6A 2ZTSA 3K1YA 3NBZC 4OYRA 3LQ2A 1J1IA 2OB2A 3S70A 5LN1A 4QBFA 5EPUA 3WDMA 3CH6A 5IK2A 4RXUA 2Z95A 2P9EA 4WXRA 1I51A 4HKTA 5GZ3A 1JLLB 2VHTA 4X41A 3MMSA 2GFQA 4L4YA 1GYQA 3P9RA 5F35A 4ED9A 3DKPA 4BAZA 1MEJA 3JWEA 2WM9B 1A97A 4GMFA 1YFLA 1IVYA 1XXLA 4HQOA 3IMGA 3F98A 3SC4A 1ZBQA 4FK8A 3AZPA 1P3JA 3TW0A 4G5FA 4GX1A 4O0MA 4JY7A 4K9OA 1XG5A 4HWOA 3T9FA 2HLDD 4F4FA 2VP5A 5ALZA 1IOZA 2XNDA 1L4LA 5J59A 1P31A 3DT9A 1UMCB 4NBSA 4DR5B 4F5DA 1WZ2A 1MJ5A 2AEJA 2C5EA 2JGDB 1JLMA 5TX7A 4FKBA 2ZSIA 1E2MA 2OBBA 4UVDA 4ZO6A 4J0FA 4UAJA 2FRVA 3SIXA 2M6KA 4DXDA 5TB5A 1DQPA 3IRVA 5K7SA 3FDJA 3C8HA 1PS0A 1TM2A 2AR7A 3H5NA 1NT2A 1TCUA 1W0KA 1YNSA 3AI2A 4UASA 3ZV6A 4D8UA 4E88A 5FWAA 2AOXA 1TT7A 3AGPA 3S68A 3UH0A 2JGIA 4CEIB 2Z8ZA 4BKUA 3L4BA 1SBHA 4L4UA 4UQLA 3MRVA 1DXOA 3QKWA 3RK1A 4TSKA 1T3SA 2HW8A 2EKLA 3I6BA 3ELYA 4YMWA 3U39A 1PJLA 2CXRA 4RTJA 1TX4B 3IODA 3SLGA 3DLBA 1ZI6A 1UP7A 4JASB 1XN4A 5AIBA 1Y7PA 2NLOA 3GPDG 2IUFA 4GSKA 3ABRB 4HH3C 1DARA 2FOIA 3TTTA 4CCWA 1YXMA 3EXFB 3GDWA 3I9V1 3PFWO 4U39A 4EFKA 1RRMA 1KFBB 4QT0A 3FRHA 4GO1A 4Y0VA 1UOPA 1G6HA 1CZOA 1F2TB 3HKDA 3I2IA 2HA2A 4FR5A 5EMMA 2C8KA 3SMQA 3U3OA 4B84A 2ZIUB 5HZMA 5A0TA 2R79A 2IX9A 1SD2A 3PUHA 5SY9A 1PT9A 4EKDA 4F04A 5BWCA 4DV2B 1N1GA 2DPYA 5IF3A 1VPLA 3STTA 1HKHA 2NADA 4BMVA 1K8YB 1XMSA 1U7OA 4M6WB 3GVIA 4MWGA 4PWYA 2UV8A 4MHTA 5KMGB 3QVUA 4DLKA 1L5LA 3DMRA 3OZCA 3UAYA 4JJ8A 2V7WA 2JANA 4G5QA 1MC8A 3BAZA 1GRRA 1A5TA 2G1AA 2XCIA 4PRZA 5F5LA 3OJOA 1JRLA 3ZZNA 3TVDA 3P9SA 3L7IA 1DGQA 4PW0A 4IINA 4LXHA 2AYZA 4RW0A 4RA6A 5KJFA 4CPDA 1L5KA 1G5IA 5IKPA 2HCFA 3RYIA 3O4IA 2FEKA 1NJFA 1DOZA 1JFFA 1ENYA 1K6XA 1Q7RA 3BWYA 1IQRA 3DV2A 3MWDA 5ELMA 3DCYA 4QKQA 5FWXB 4GMKA 3T7TA 2XUDA 1PQPA 3LY5A 1WCWA 3FFBA 3HPRA 5G0UA 1JH9A 2BUAA 3AY6A 3PEYA 1FRFS 2WAYA 3MQ2A 4RLSA 2IV3A 1W6UA 2JK1A 2G71A 1L7OA 1LJLA 4FFLA 3IDFA 4H4EA 1QP8A 1ZVKA 1Z2PX 5FBRB 3HGMA 2W83A 2NZXA 3IULA 2L19A 3OC6A 2F3RA 1TMYA 3E22B 2A8YA 2GPBA 1WDMA 1V39A 4MQUA 2NZWA 1VYVA 3BWBA 4LF7B 2UXCB 4HCJA 1OH6A 2XR1A 3OZSA 3QKSB 1SCDA 4R1SA 1GARA 1OKKD 1UC8A 2NWQA 3DEYX 5KYXB 3GYGA 2I33A 4OA5A 5IJ0A 2BM8A 3VMFA 1XRRA 3L7KA 4ZVRA 1CNFA 2NO9A 2FLKA 2QPOA 4L95C 5FA5A 1E7YA 4H0NA 1UQTA 5LOVB 3CEJA 1MQAA 3UFXA 3OD5A 3JZFA 4QZVA 2JJ8A 4CIYA 5F3RA 1KRHA 4S0XA 2XSZD 4B6FA 3WYAA 1VL6A 4PHCA 2Z6QA 3GYBA 1NX6A 4AF6A 4BRZA 2PHZA 2M2IA 1YZKA 2H4JA 3X1MA 2IPXA 2ZW9A 4B3JA 1ZNXA 3VDXA 1ACMA 4J75A 4QYIA 2JBHA 2OO7A 4HAYA 1D07A 1YQTA 1YZNA 4INAA 1BH2A 4LX8A 1O4VA 3A04A 3A1CA 1FVHA 2DQ4A 2GZSA 3CLKA 3V9PA 3DMTA 4OOFA 1D5WA 1PFVA 1T36A 2BZ0A 3DYIA 1TYCA 1W46A 3D8UA 3EIHA 2RJNA 3ISVA 2X7JA 1E4VA 2WILA 3TM5A 3VX4A 3HGTA 3K8QA 2Q5HA 2QMEA 3E7PA 3H5RA 4BTVA 1D6NA 1Z4QA 2B4RO 3HB9A 5E7QA 4C7BA 1ECBA 3LTNC 4LV5B 1U1IA 5H3LA 2FUCA 4EFMA 2DWQA 2CXOA 1ENPA 4YR9A 1VKJA 3BE6A 4DCCA 3OECA 4W8GA 4U6SA 1Q95A 1GNVA 3L4SO 2O8DA 4I5GA 1EFLA 3KT6A 4ER7A 3R0VA 1RWPA 5IHPA 2W2VA 4AI6A 1P0QA 5AW7A 4K9DA 5DMXA 3VKGA 3DE3X 4HLUC 2GEVA 4CV2A 3E9DA 2IU0A 1JEQA 4COKA 1WMDA 4YPOA 4IYJA 5AKJA 4V1CA 1G2QA 2PKCA 2QF7A 4AJ9A 3AWIA 2BLNA 3HR4A 3O8BA 3WK7A 3BILA 4A2CA 1ODCA 5A3QA 4UPDA 3GLIB 1TJYA 3JD2A 1OBFO 3GRFA 1WNFA 1KMCA 4HGOA 5F52A 1C9YA 5JD3A 4FS8A 1EK1A 3P4YA 3R3WA 4FW8A 4PQFA 1ZGGA 1UM9A 4W4TA 1B0UA 1FEZA 2YXPX 1GKKA 1RXWA 1DQRA 4QICA 4NE7A 2F8TA 3HBLA 1HA3A 4FFBB 2J87A 3UT6A 1PX2A 3DFKA 4Q82A 5KWJA 3BBPA 4OQNA 4YJHA 4ZO9A 5E6UA 2CFIA 4ACBA 1XMQB 3BD9A 4MUHA 1VMKA 5ELXA 4E2YA 2G1KA 3VGJA 4BY9E 1ZK3A 5AW8A 3CZ4A 2GZRA 3QKUA 3V32A 1UFVA 1XL0A 1O6CA 4YT8A 4JT9A 3ONDA 5ADHA 2XZLA 4KPUA 3RSZA