4HAXA

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1(k579a)-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
200
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/antibiotic
total genus 58
structure length 200
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4haxA00
3G82C 1CRPA 1E2JA 3BRWD 1HEIA 2F55A 2E9SA 1J99A 3OEED 4GFDA 5E95A 4Z51A 4W5HA 4LJ5A 1S2MA 2XOKD 3BB4A 3B1ZA 4K46A 2WM9B 1KO5A 4NYMQ 5D3QA 5JEDA 4EFMA 4XTRA 4CIDA 4D80A 4DSNA 3QKRB 4KFTA 4ZCMA 4L5BA 2LKDA 2UZ3A 3CH5A 2W2VA 1EESA 2X77A 4FI3C 4JL8A 2R6AA 3QE0A 1JEDA 1TQ6A 3W6PA 1ZIOA 3RSLA 4WZAE 3VR2A 2J5XA 1N6RA 2B8TA 1SXJE 4G0NA 2BCGY 1R4AA 5LBIA 2G77B 1J8YF 5JWRA 1D2NA 1GL7A 2IT1A 4GP7A 3R7WB 3LX5A 1FW6A 4TMXA 2VF7A 1KK2A 4BLSA 3UK6A 2O8CB 5DLQC 4BFZA 1KI2A 3OE7D 3ZVLA 2P65A 2J1LA 3F8TA 4RD6A 5FUXA 4CEJB 1N0WA 3H0KA 2DB3A 2GCOA 3CZPA 5FI0B 5IK2A 1OSNA 1VCMA 4R9UC 5BN4A 1EXMA 2EQBA 5BN3A 4V0OA 2BIFA 3U7HB 3VX4A 2VSOA 2QUZA 1OHHA 4UNRA 3VU9A 2ZSAA 3AVQA 2EFHB 3W9YA 3HDTA 3PJRA 4C2TA 2ZU0C 3G5UA 1VYUA 4KO8A 1KSHA 2VLIA 3K70C 3BFVA 3H2YA 3P4YA 4NYIQ 1OF1A 1F2TB 2R6CA 3HYTA 1OFHA 2ODBA 1RE0A 3THXA 1E2IA 1PLJA 5F98A 1G17A 2D7DA 1FUKA 2ZYUX 2O8FB 3NWJA 3U6KA 3UXMA 1E98A 1VCIA 1W47A 3C16C 4XD7A 1OYWA 4CEIB 1NVWQ 2R44A 4MRSA 5SZIA 1P62B 4IEIA 2V9PA 3K9HA 4PC7A 1N6HA 2VIIA 1SKQA 2G0TA 1N6LA 3A8TA 2X2FA 1E3MA 2QM7A 3ASYA 3TR0A 2A5DA 2AXNA 3B82A 1CULC 1L2TA 4MQBA 1G8GA 3O47A 3GLHE 4IFEA 2XZOA 3I5XA 5JEEA 3P27A 3I61A 2GEVA 4EFLA 5TMPA 3L0IB 1Z6YA 2ZVQX 2CHGA 4JBXA 4ESVA 1JR3E 3DDCA 3GLHA 3R9XA 3LQRA 5H70A 4GT1A 1ZBDA 1A2KC 3BIFA 5J4LA 1W36D 4Q4HB 2WVJA 2ZXUA 1TUIA 2R6DA 1JR3A 2BV3A 4NCHA 1KSJA 1SVOA 1Z8FA 4JZKA 1YR9A 1T3LA 2VHCA 1E9RA 2UZIR 2NG1A 1YZLA 4LHWA 1CBUA 4DLRA 4EJSC 3I8SA 1R5NA 4FCVA 3CZQA 2ERXA 4AURA 5KUTA 3V4RA 3RS3A 3R9WA 4C0HA 1UBCA 5FPYA 4DSUA 2I1VB 2KBFA 4G5SA 4BE7B 1NSFA 5EP2A 5D3MA 1G4UR 1GITA 3CF6R 5LDDC 5E4FA 1KO1A 1ZM9A 3ZIAA 2IA5A 4LZZA 5HZKA 4L4UA 1H8EA 2GJKA 5SZJA 3HP1A 5CDFA 3U44B 1JEEA 1ZUNB 1IM2A 1COWA 1XMSA 5KSOA 3I5YA 3X1XA 4OQFA 4FCTA 2GESA 4ACBA 5JMTA 2WBLC 4V03A 3U60B 2P5SA 3W3AA 1UFQA 4H1UA 4PO8A 2C9OA 2OM2A 2HF8A 4KFUA 1D2EA 3FHCB 3SFVA 2CMKA 2EWWA 1NP6A 2RMKA 3CRRA 2PEYA 4ZIRA 1KDPA 2F43B 3T1QA 4NYJR 4LJ7A 4PAQA 1W0JD 1SKYB 4HLUC 1YU9A 4PAOA 4BFVA 1DPFA 1IN5A 3AH8A 1ZVQA 4B35A 2HT1A 4C0BA 2RAPA 1VTKA 1IXSB 3ZZTA 1ZNWA 4QBIA 2DWQA 2HJVA 2P2LA 1Z0FA 4PHGA 3VKHA 2W6JD 2DCUA 1S0UA 2WAYA 1LS1A 1U0HC 3MAAC 2QMOA 4NCNA 2AFIE 3TAHA 3FOZA 1KNQA 1LV7A 2A5FA 1U8ZA 2ZM5A 2W83A 2PCJA 4BFTA 1F2UA 1PJRA 2FDCA 2X1VA 821PA 3DEFA 3RRNA 3NHBA 3DZ8A 4LPKA 1X8JA 1IN7A 1QVRA 2AKYA 3A1WA 3RS7A 3WHKA 4QKQA 3D3QA 4BPBA 1BMFD 2GCPA 2CE2X 4IDQA 3RHFA 4O2LA 4TLCA 2FZ4A 2IK8A 4OJQA 2JCSA 1LTQA 2MSEB 3EARA 1CLUA 3VR6A 3BORA 4DZZA 1SVSA 1DAGA 2ORWA 4JYBA 4PC1A 5JS7A 1EFHA 1DVRA 2ZRGA 2QGNA 1QBKC 2HLDA 5FL7D 2PLFA 4DDUA 2ZJZA 4YMSA 1E2DA 3IIKA 1A7JA 4JL6A 1C4OA 1U8YA 4KV9A 2QTHA 1U2RA 2EFCB 3LH5A 5KSPA 1S4QA 3AKDA 1QG2A 4MYCA 3BGWA 2NPIA 3THYA 2ZI7A 1E69A 1LNZA 4GSYA 3NHAA 4AY2A 1T8TA 1ZD8A 2NPFA 2ZRDA 3GEEA 1VCOA 1XEXB 1U0LA 3AF0A 4HB4A 1NN3A 1AA9A 2BDTA 4GBMA 1E9SA 3KUDA 3OESA 3GFTA 2ZUDA 1KSFX 2Q21A 4WZ6A 4IHQA 2J0UA 3DMNA 5HCIA 4Q03A 4FINA 5CLLA 2O8BB 1G9XA 4M53A 1J90A 1HH4A 2GAAA 2ZRKA 3M0EA 1MABA 4RSGA 4WAUA 2AHOA 5EE1A 1UDXA 4FD2A 4Q7MB 4QBHA 4Q47A 3LO5A 2PMKA 4CGZA 3HU3A 3FKSA 1IN8A 2YC2C 1CU1A 2ZE6A 4JSYA 5DYIA 5L3SA 2XXAA 1E2GA 3SNHA 3R8FA 3BE4A 3CNNA 3E70C 5EP1A 4LBVA 521PA 4GP6A 1KTVA 1ZCBA 4KVGA 2A7QA 1XNJA 3E2IA 3R20A 5AUNB 2YNMA 2JLSA 4L9SA 4LYHA 2GKSA 5EUMA 1IY1A 2PZEA 1IN4A 1YZGA 1D9ZA 4WZBE 4ZI2A 5H1YA 2ZRJA 1D6JA 1E9AA 2PBRA 1R2QA 4PSVA 1P9RA 2KJQA 1XRJA 1Z0KA 4JT4A 2AX4A 2I4IA 1M6NA 5EJEA 1X1RA 2GHIA 4C9BA 3EIEA 1DEKA 3SEAA 4JVNA 2ORVA 4XVRA 1JECA 5JJLA 2LKCA 3QF4B 4AG6A 2ZRAA 4FMDB 1BIFA 1M34E 4CRWB 1Z63A 4U02A 4AC9A 1ZNYA 2WICA 4UNPA 3B9QA 2ASEA 1H8HD 1U90A 1W36B 2WPDA 1TX4B 3CBQA 2VSXA 2P67A 1X86B 1RC8A 3FMPB 4KVAA 4FWTA 1UDWA 2DFNA 4DRZA 2ZE5A 3ZS9A 1SGWA 5FOTA 2BHRA 6Q21A 1N5IA 3DKPA 1W2GA 2WTUA 2FNAA 5CITA 2QG6A 3CIOA 1CR2A 5HZHA 2XSZA 3L8ZA 3LQQA 4ON9A 3WNCA 3OHMA 4GMXA 2WJJA 3W5IA 1WCV1 2VSFA 4URUR 4HUQB 1R6BX 3BH7A 3ND8A 2VBCA 1Z0IA 1XPUA 3OFND 3X2SA 2FWRA 2QI9C 3RAPR 3FMIA 5DE3A 1ODFA 1PLLA 1MO4A 2HF9A 3JVVA 2QAJA 5FR2A 1MO6A 3U4QB 1HE1C 4GL2A 3LVQE 2QBYA 2C04A 4ZDKA 3T1VA 5AJWA 3SOPA 2BVNA 2C99A 1NMYA 3AM1A 1BS1A 1Q21A 3A36A 1CKEA 1KI9A 2HUPA 3DHWC 3EWAA 4RFSA 4XSHA 3TH5A 4B3BA 2QMUA 4K81B 4BRUA 3SN6A 4Q7JB 1T5LA 1YHNA 4DBLC 4EKDA 1JALA 3DOFA 5KU1A 4JVMA 5CK4A 1RRPA 1E2PA 3GJ7A 3QSYA 2IXEA 2RHMA 2ZSDA 4EJSA 4I4LA 3KQKA 3EX7C 2H16A 1G19A 2JATA 1IONA 5DN6A 3A1VA 4DLUA 2CHVA 1W4RA 4M1WA 2ZREA 1Z47A 1ZU5A 3VTKA 1E96A 2ZS7A 4OI1A 3TUIC 4MH0R 4B3GA 4WW0A 2G88A 2IYQA 2Q9BA 1OXUA 2QTVB 3QI2A 1NG1A 3CNLA 4ERNA 3UKDA 4B33A 1CR0A 3LXXA 4CZ2A 2ZSEA 3FKQA 5KSYA 2OCBA 1M1YE 3S1AB 1US8B 2VHUA 3PUWA 1AJEA 1KHTA 2GF9A 2ZRCA 1JAHA 3GJ0A 5E7IA 2E1RA 3KFVA 1YR7A 2IL1A 1P72A 1SHKA 1ZRHA 4OQMA 4AG5A 1UJ2A 4WXPA 1CP2A 1TNDA 3CRW1 5EQTA 2F1RA 4NBSA 4LV8B 3W8RA 4BLRA 4N0EA 4PTLA 1XTRA 4Q1EA 4KAXA 3ZD7A 1Q3TA 2XTNA 2FA9A 1Y3AA 1W1WA 2FZLA 2JGNA 4TWZA 1FQKA 4C3ZA 4N0DA 1EX6A 1UKZA 5EZ5A 5L3QB 2JLVA 1KI6A 1KIMA 4MUAA 3BXZA 2IYSA 4M1YA 4HB3A 3ZDQA 4DLTA 2F1HA 4PX9A 3I3SR 2R65A 2WSSD 1WA5A 2H7VA 1ZYUA 5HKKD 2K5UA 2UVQA 4NYMR 1XPOA 3SS8A 2W0SA 2YVUA 3N2EA 3D31A 3Q7PA 2IYRA 1DADA 1JQLB 1E2NA 2CLCX 4Q00A 3N2IA 4I81A 1E32A 4C0AC 3KJEA 1XPRA 1KJZA 1R0YA 3FVQA 4XJXA 3GLGE 1SXJC 2RGGA 5KDLA 2CNWD 4IXNA 1M7BA 2XNDD 2JIZD 4Z54A 2F3RA 1G8PA 4FMCF 1UBFA 4PO9A 3GLGA 221PA 3NC0C 3I62A 5E7JA 2QE7D 1KDTA 1TADA 2RGCA 3HU2A 4EPVA 1S1CA 1ESNA 1XEWX 3A1UA 4KFRA 2CJWB 3SJBA 3BB1A 1RFLA 2PZFA 3PUYA 3EZ7A 1BOFA 2OE2A 5F2EA 1G7TA 5FPKA 1DAMA 4LJAA 1R7RA 1X3SA 2ZETA 4WXRA 5A0FA 2VHTA 2HYIC 4TLEA 2BMFA 4ZDJA 4B2LA 3JZMA 2DWOA 2ZAMA 3B7GA 3OIWA 4GOJA 2D3WA 1G3UA 3CWZA 4DCNA 1MO3A 5B58C 3DM5A 2RGBA 3REGA 3T61A 1XEFA 1ZNZA 4XIGS 3LWNA 1A82A 3RWMB 1PUJA 1VG1A 1NLFA 1WRBA 2FGJA 2PX3A 1A2BA 4XVQA 4I99A 1A5TA 2IUUA 1I2DA 5JRJA 1JB1A 5AUOB 2JA1A 4NYIR 2ZU6A 5AUPB 4DLXA 4UKDA 1TMKA 3GJ6A 2WJIA 4ACAA 1DAIA 1G8YA 2YINC 5FOWA 3TSOA 1IHUA 4QHTA 4G1UC 1BO6A 3PEUA 4OQNA 1II9A 4M1TA 1G291 3MUFA 3OIVA 3K0AB 4ZCLA 3JVUA 3TVTA 3UIEA 2FJUA 3D6TB 3JZAA 2AR7A 4MA4A 1XMIA 2FPKA 4KU4A 5B30A 3ICQB 2GBLA 4R2HA 3WBJA 2C9CA 2NGRA 4G01B 3CO5A 3AKCA 2W00A 3KKOA 2J87A 4M0LA 3BH0A 3MLEA 4E09A 2FOLA 2IUSA 2NOAA 2YOFA 3EC1A 4GPTA 3LAWA 4B3CA 2C2HA 2VPPA 4LYFA 4C7OB 3LA6A 1BYUA 1Z6TA 2QSZA 3I73A 4FW9A 4QHYA 4I1VA 3V9PA 3WBKA 1GL6A 1KI4A 3L2OB 4BLTA 1IY2A 4DIDA 4ZCIA 1JI0A 3IGFA 5HCNA 2AK2A 2DFKB 3PV0A 1RYFA 1OHHD 4JJZA 3GJXC 3K53A 4D26A 4GOXA 4OBEA 2A30A 2AWOA 4F4CA 5EXTA 4Q1DA 5JJIA 1GOTA 4P4SA 1G8FA 3NXSA 3AF1A 4XOIA 2OILA 1RRGA 1EFCA 1KK3A 3F0TA 5DO9A 1N5JA 3BB3A 3WNDA 3C8UA 2PCLA 4LJYA 4AIIA 4I1UA 4YONB 2BJWA 3H84A 1ZMXA 3EASA 4PPFA 3LBNA 4D25A 3CONA 3HWSA 4RKEA 4RJLA 1ETUA 3SFZA 5H8WA 3RS5A 1YZQA 4XD7D 1XB2A 2ZS9A 4KLNA 1DO0A 2ZIAA 4XWAA 1CJVC 1E9DA 1KO7A 4F93B 4YMWA 5KYKA 5BYJA 4KBFA 4URYR 1VKJA 3W6OA 1AQUA 3ND9A 3OIUA 4Q9JA 4NU0A 1NLZA 3BFXA 4IXMA 2EFEB 3T35A 3RS2A 4AYTA 2GXUA 4NPHA 1IXRC 1KI8A 2QPAA 3AF3A 3LDAA 4YLGA 2EU8A 2R6FA 1RIFA 5EE3A 2DYKA 2VP0A 1UEIA 4D0GA 4QL3A 1UKYA 3AUXA 4QNMA 3KKNA 1E9FA 1ZM2A 3MG9A 3A1SA 4C4PA 1NKSA 1QRAA 3VR5A 4EFNA 2XX3A 4D4MA 3AVXA 2VP2A 4AYWA 4KBGA 4M8NE 2ZI9A 2JLUA 3RRYA 1NG9A 2BMEA 5DI3B 4TTQA 4R71A 3C14C 3IDQA 4LYAA 4DDWA 3C7KA 4V0NA 1TPZA 1YZNA 4C0KA 4OKSA 3GMTA 5GJWC 3UG7A 2OCPA 4A0GA 2G3YA 3EPJA 3EZ9A 3K1JA 1WQ1R 2F1JA 1IN6A 3BERA 2ZYTX 1K5GA 3WMEA 4Y0VA 1QHHB 2JJ8A 4YDHB 3ZIAD 2ZJ2A 2O0JA 1W5SA 3TNFA 1T6NA 5DSZA 2VEDA 4LI0A 4LV5B 3QKRA 4LGMA 1XBTA 1COWD 4KHZA 4QJ4A 2BM1A 4O2RA 1J8MF 2FPLA 2TMKA 2ANCA 4KXFB 3BFKA 2KBEA 2QP4A 1SVKA 4D82A 2O8EB 1RJ9B 3PUXA 4GZLA 1Z08A 4QBFA 4JMPA 3CF0A 2CLSA 2OCYC 1NL3A 1G7SA 3KB1A 1G3RA 2QQ0A 3KTAB 3T34A 1IJFA 1FX0B 2ZI5A 1IQPA 2F9LA 1R8SA 4QFMA 2VQSA 4Q9IA 1K6MA 5TDHA 4M9SA 1XTIA 4LCBA 2CHQA 2XZPA 3UG6A 3O8CA 2WV9A 3KDSE 3IO5A 2BKEA 3SJZA 1Z0AA 4ABYA 3WXMA 2JLXA 2O8CA 5CK5A 1VCNA 1I4TD 1XJQA 2DFLA 1EX7A 2QORA 2Z83A 3GLIB 3MWYW 2AD5A 2EVWX 4RZUA 1SXJA 3KKQA 1OIWA 3LLMA 2CE7A 2H8KA 2JLWA 1YR8A 3ZD6A 5K8IA 3VKWA 1GZSA 1XWIA 3CB4A 3AVVA 2WIBA 4Q9HA 5FTKA 2D2EA 1D2MA 3P32A 2J7KA 1CRQA 1J70A 1ZAKA 1PLKA 4RD1A 4IDPA 2ZUBA 3O8DA 2QMEA 3QKUA 1W2HA 3GJ8A 3QF7A 4PQYA 4A36A 1U0JA 4TN1A 2EYQA 2IYYA 1HUQA 2O8DA 1TEXA 3GFPA 2FEOA 2ONKA 4F7WA 3PUVA 4DKXA 1N6KA 1DG3A 2QAGA 1LY1A 4BASA 3V4FA 4JLBA 2IEZA 4A9AA 1R5OA 2KE5A 3QNUA 1I2MA 2HLDD 5FPSA 4HAUA 4L15A 2OZEA 1Z6GA 4Z8XA 1S9DA 3NEJA 1OXXK 5HTKA 3IHWA 3OZXA 2FMXA 1OXTA 2H17A 5KPDA 2GILA 1WDTA 3HYRA 2B7BA 4M1OA 5FR1A 4DCTA 1R0ZA 2R62A 2QRZA 3NH6A 4F91B 2XB4A 2MSDB 3DPUA 2B7CA 1ZM4A 2GCOB 4PQRA 3TUZC 1E2HA 1GKUB 2IW3A 2H57A 1OKKA 4C0QC 1XD2A 4QGAA 2YC4C 4JJKA 1GWNA 3I1FA 1VG0B 2C77A 3TMKA 1L8QA 2WZQA 1E2MA 3KQNA 4DIEA 3FKSD 3NVAA 4A4DA 4DDTA 2NZJA 1ZM3A 4IDNA 1GKYA 5G3ZA 3THXB 5IRCD 2Z43A 4US0R 3B9PA 1Z22A 2FSHA 4A8JB 4YMTA 3BD9A 1DTSA 1E2KA 4OK3A 5A4JA 2XB2A 4M4SA 4W7SA 4MRVA 3KQUA 1G20E 2RCNA 4OQLA 4IVPA 2AKAB 4F4JA 5JI2E 1KAGA 2WKRA 2WOOA 1KK0A 3HR7A 4ZDIA 1XCPA 5AJXA 2VH5R 3U44A 2ZRMA 3IEUA 4Q1BA 2GEDA 3LY5A 3PFIA 3K70D 3B2EA 3GJ5A 4LX0A 4MKFA 4Q1FA 3AP2A 3UMFA 3NH9A 4TYYA 1S96A 3FDIA 1E1RA 2ZRBA 3KX2A 4EPWA 3BS4A 5DI9A 1Q3HA 1SKYE 2Z4SA 4BFYA 5FBLB 1NN0A 2PJZA 4PC3A 1PVOA 1GNRA 3H86A 4URVR 1WBBA 5KO2A 2WPDD 2QN6A 3A4NA 3RYTC 1GRNA 3SBDA 1VDZA 2MSCB 1OJLA 4S35A 1DG1G 1R5BA 1T91A 2RH5A 4Q01A 3CR7A 3QPVA 2YKGA 1XF9A 3TQFA 1OH7A 5J40A 2FEMA 4R7ZA 2KI5A 3QXHA 3L43A 4GRAA 2XSZD 4U7DA 2WJYA 1SULA 3NG1A 5M04A 1MR3F 1UM8A 1E1QA 3TUJC 4N3NA 2RKOA 1OT3A 4B48A 4M2LA 2JLZA 2ZYVX 2WWFA 3RC8A 4TQAA 3B6EA 1XCMA 4IVRA 5ANRB 1YZKA 2RGNA 2J0QA 4IEEA 1NRJB 4J0QA 5JCPA 2YZ2A 5GJBA 5KNCA 4EIWA 1G6HA 2JDIA 1PZNA 1UKVY 2BBTA 1P2SA 1UBGA 2F6RA 2MMCA 2KWIA 2IF2A 2H92A 1ELOA 1XJ0A 3ADKA 3SJAA 4ZIRB 3MSXA 5FUWA 4B75A 3LNCA 4HB2A 5DN6D 4ASUD 3QXSA 4Q4LA 5G3YA 1L7VC 2ZS8A 2IBMA 1NN5A 4BLQA 1KZ7B 4YMUA 5E7MA 5GVRA 5C46F 2PT7A 2C78A 3QG1A 2RB4A 4B2PA 1MV5A 3EXAA 3X1YA 5K8TA 1HQYE 4TMVA 3QXJA 1XEXA 1SHZA 1N2CE 2WIAA 2V55B 2DR3A 2GZDA 1MT0A 2XJ4A 3QY0A 3SJCA 4AKEA 1XMVA 4ARZA 5C4MA 1DELA 4KYIB 1RW4A 3AV0B 3MJHA 4W5WA 1Z06A 5BYKA 1ZW6A 2XJ9A 3B1XA 1Z0JA 2O8BA 3P4XA 3VNUA 4MDFA 1F60A 1N6IA 2GK6A 5J5CA 4HAXA 4AKHA 1KMHB 1LF0A 2Z6VA 3FMOB 1N3BA 4PXAA 4DVGA 4A82A 4BFUA 2AXPA 5J4HA 2C95A 4NL4H 3FE2A 1QDEA 4MUBA 4YQFA 1PUIA 1YR6A 3QJYA 5GADl 1G3QA 4LDJA 3MWJA 2J0SA 4KSBA 4ILEA 4M9QA 5DHFA 5FOSA 3GJ3A 5AJVB 5CB6A 3D7MA 2RHDA 4Q9LA 5C2JB 4TL8A 1EWQA 4LWZA 2ZRNA 2J46A 3PITA 2XZLA 1YJ5A 4V0LA 1DARA 3ZYCA 2G0NA 4KJZA 1P3JA 2DFTA 4CF7A 2PZGA 4LC1A 3ZVRA 5J4KA 3CKLA 4TMTA 4TTRA 5TY0A 2Y8EA 2BEJA 2CL6X 1X6VA 4BZPA 3LRPA 1D8TA 2EFDB 2NZ8A 2ZJOA 1AKYA 1IXZA 3KJGA 4O3MA 3A6PC 3WHLA 1S8FA 4MYTA 1W49A 1FQJA 2P5TB 4PSAA 3R9IA 3I92A 3BH6A 1W44A 2Z4RA 1XTJA 3F5FA 4Q1AA 2IC5A 5FPHA 4TZ0A 4HLQB 3I4LA 2GBLC 4PHHA 4BWYA 1P4SA 4A0HA 5C18A 1SVWA 2XXAB 1Z5ZA 1KY3A 3Q5DA 3KL4A 3AP3A 2IXFA 1KZGB 2REBA 4LHVA 3NTUA 3MRSA 5JJKA 1AK2A 1EWRA 3EC2A 2C9YA 1SQ5A 4NZYA 5TV2A 1II8A 4URZR 5LPNA 2ZVPX 4PAMA 5GJCA 4M9ZA 3M1IA 2HV8A 2D4HA 4A0RA 3O8RA 2PT5A 2RGAA 4FMDF 5JHHB 4IOMA 1ZD9A 5JCZA 3T12A 2OXCA 3UPUA 4UQOA 2IF0A 1HE8B 1Q44A 5E3HA 4XWOA 1X1SA 3K70B 1XJCA 3B8HA 4M1KA 2G1KA 3WY9A 1C9KA 3A4MA 4IW3B 4Z1MA 2FN4A 4LV6A 2BBSA 2GXSA 2O52A 3KB2A 1E2LA 2GK7A 4JVSB 3ZJYA 1PV4A 3VR4A 2IWRA 1R10A 1VG8A 1GNQA 3NBZC 3RS4A 4V0ME 1S9HA 2VYFA 3CF2A 1BKDR 4RCZA 1Z6XA 4TLAA 1E0KA 2VP4A 3BK7A 3WRYC 4E07A 4V0MA 5KTYA 1U8AA 3DO6A 2ZQ5A 5FUVA 1EFUA 1YZTA 2GNOA 2EW1A 3OIYA 2NO0A 4HYYA 1MOZA 5B57C 3EPLA 2NO7A 4FIDA 3IQWA 2OEPA 1XDBA 3CLVA 5IF9A 3EZFA 4OJKA 1AQYA 4Q19A 4B32A 5JS8A 2A9KA 3UMRA 2ZAOA 2YOHA 1ANKA 4Q4AB 2P6UA 1U98A 3OEHA 4UXIA 4E22A 1US8A 1WB9A 1JR6A 2OBLA 5CIWA 4F4IA 3AVWA 2QBYB 1D9XA 1XMJA 4NONA 3IBGA 1OIXA 4ZDWA 1WXQA 1ZD1A 2SHKA 4RFSB 3TK1A 1NMXA 2NO1A 1JAIA 1TU4A 2QROA 4UXHA 1LFDB 3W34A 3EIQA 4V02A 4DJTA 1H65A 1E99A 2W58A 2WWGA 3TE6A 5KPJA 4CDGA 5JSZB 1KMQA 1B23P 3J81k 1MRSA 3ZQJA 3MGCA 3Q3JB 1FNNA 1N0VC 3PG5A 4IFBA 4EJSB 4GDFA 4M22A 1OXVA 1HA3A 1DOAA 2IYZA 3QBVA 4HZUA 3VAAA 2HEIA 2IEYA 4HUTA 2PMDA 5LD2B 2Q9AA 3VFDA 2G1JA 2GDJA 4LC0A 4LJ6A 5FBWB 1A4RA 3N70A 1GP2A 3AB3A 4H9GA 2BOVA 4JLMA 3CR8A 1AS3A 3EW9A 3TSWA 3CPHA 4NMMA 5JLJA 2VL7A 4P0TA 1FL9A 4RY2A 3IQXA 1AGRA 4QGFA 2JAQA 4YXWA 2WSMA 4U5XA 2ONJA 2IYXA 2BJVA 4JKYA 2Z0MA 3SYNA 2XAUA 1GIAA 1G5TA 3K9GA 3ZVNA 3KKPA 3UANA 4KSCA 3OF5A 5EE0A 4P32A 1NY6A 4Q9KA 4OK6A 2Q0HA 3IHLA 3K0EA 4Q4JB 5AR1A 4DUGA 3EIHA 3MMPA 4IOKA 4OI0A 2IS4A 3EZ6A 1FP7A 1Q0UA 2BMJA 1G64A 1L4UA 1E9BA 1VIAA 5IT5A 4QHSA 5DYGA 4G5OA 3SZRA 2FV8A 2WMNB 1OV4A 4BQSA 1NBME 2OFOA 2XTZA 2CJWA 4EPTA 1KJWA 1P61B 2YWHA 4WBSA 1E79A 2B8WA 2R8RA 4L16A 1LVGA 1NBMA 1G3IA 2R9VA 3RWOA 1AM4D 1S3SA 2EFGA 1YZUA 1LF5A 3UWKA 1KI6B 1MO5A 2ZJAA 4W9MC 4MGZR 4DLVA 2AFHE 2G83A 4YMVA 5EP3A 5FBQB 4QGHA 3U3KA 4QC2A 1OIVA 4GI7A 2IX3A 3UMSA 5FOUA 1P9WA 2GJAA 2QGZA 2QAGC 5FTMA 1JJ7A 4JT2A 4BFWA 2W0MA 2YOGA 3EG5A 1JQJC 3DOEA 2WMOB 8OHMA 3WYGA 5DIFA 1NF3A 2L0XA 1YRAA 2Q6TA 2OBNA 3AQ4A 2IYVA 1KYIA 1G8HA 1T4GA 4B74A 3H1TA 3K0FB 421PA 2XGJA 2QENA 2B92A 3SR0A 2WWXA 3SDZA 5EE9A 1XXHB 3TKLA 3LLUA 3QPUA 1XX6A 1G41A 1TUEA 2GJ9A 2QEQA 1HYQA 2ZR7A 4MRNA 4TZ6A 2WJGA 3GFOA 4M1SA 2BM0A 1K5DA 2WHXA 4HLCA 1QF9A 1DO2A 1XZQA 2XTMA 1U99A 3ZQ6A 1VYVA 4WIAA 1G5RA 4GZMA 2ZRFA 4TL7A 5IDVA 1B0UA 3I72A 3QBTA 2QU8A 2R2AA 4TYQA 3QIAA 1Z07A 3WNBA 3VMFA 1KDOA 4LHYA 4ZV4A 2V3CC 1OE0A 5CLQA 4C7OA 1SXJD 3GLFB 1QHXA 4UXJA 4QM7A 3WRXC 5KHOC 2V54A 4TQUS 2HJGA 2FFHA 2DY1A 2YWEA 4LJ9A 721PA 2HDNB 2CL7X 5HE9A 1V43A 2ZRIA 2G9NA 4C0SA 3P20A 4DLZA 4MRRA 3SC3A 5IK2D 5FUYA 4DCSA 4JS0A 5FTLA 3NBFA 3VR3A 3TQCA 4DDVA 2GVZC 2ZJ5A 1BH2A 3KQLA 2P0EA 3SHWA 3IPYA 1O87A 1G18A 1C1YA 4JL5A 4RD2A 2BWJA 3CPJB 3LBHA 5JRZA 2IS1A 2GTPA 4BFSA 1T9HA 2KSQA 3RLFA 4RD0A 4RFVA 1XP8A 5EZ6B 1RRFA 3KKMA 4I1OA 3IEVA 3KQHA 1FUUA 1YVDA 1TF7A 4P33A 4DT1A 3VX3A 1UF9A 5JWOA 1VG9B 2DWPA 3THWB 4HDOB 5K8LA 1E2EA 4XWKA 4JBWA 1WF3A 4FN5A 2CVFA 2ZSBA 5JWHA 3RNLA 3SYLA 2ZJ8A 5KNBA 4B34A 2NO6A 1CR1A 4IRUB 1Q1EA 2QL6A 2QZ4A 2ZI3A 3H4MA 1G4AE 4Q1CA 4NHOA 3DVLA 3X1WA 4LJ4A 1OKKD 2ZPTX 4OI4A 1ZJ6A 2GXQA 2V8OA 2VP6A 1T0HB 2ODEA 4HB0A 1N25A 4US1R 1M7HA 4P4TA 3QENA 4P4SB 2F3TA 4CEHB 3U3MA 2OV2A 1HURA 4DCVA 4LSGA 4DEYA 4BECA 2B21A 3FGNA 3IBYA 3GP8A 4Q21A 2PJRA 2V4ZA 3U3JA 2RGNC 2ZR9A 4EQ6A 2A5GA 2V7QA 3CX7A 1WMSA 1JR3D 1NLYA 2ZITA 3GEIA 3T1OA 5GVSA 1WE2A 4CW7A 1EFTA 3AP1A 4XVUA 5KDDA 1QHHA 1IY0A 3A58B 5LB4A 3V00A 1NI3A 1Z29A 2CL0X 4URXR 1GM5A 2CK3A 1AS0A 4WVFA 4L9WA 2D74A 4IDHA 4LOAA 1GG2A 4B2IA 1W0KA 3KXIA 4NCIA 1W4AA 4P3YA 4MRPA 5DGXA 2YJTD 3LVRE 1RJ9A 4A1FA 2IXGA 2J7PA 2V1UA 3NC1C 2IS6A 2OESA 1E1RD 3B1YA 1H8ED 4LBZA 2GCNA 1JXOA 4C2UA 1VPLA 1RYHA 1VMAA 4HEJA 2ATXA 3ZVMA 3TJZA 5J4VA 3LXRA 4XTCS 2D06A 2GEUA 5LB2A 5TARA 3VQTA 5CB8A 1UPTA 4QG7A 1JXMA 1GAJA 3T1TA 3GLIE 1VECA 5ELXA 1K8RA 2KB0A 1IOZA 4JIMA 2JLYA 3QUSA 1AZSC 4JKIA 5FBRB 2FPMA 3Q7QA 4X8OA 1M2OB 1P2VA 2FE4A 1CJTC 3EAQA 4MGYR 4RD4A 5EXSA 3R7WA 1NMZA 2HCJB 3HU1A 1E1QD 5DHAA 1AGPA 4CYMA 4A0FA 1OH6A 3A1TA 1CJKC 1NKTA 3QKSB 4GOKA 4HATA 5FPTA 1Z2AA 3E1SA 5J47A 5AK0A 4B73A 4C30A 3Q85A 4OHXA 4CEJA 1NJFA 2YWGA 5G41A 2OAQ1 4B3XA 4KCGA 3TSZA 2LWIA 4G5GA 4UNSA 4TSFA 1ONBA 2C03A 2DBYA 2WKQA 1T5IA 4Z8YA 2JDID 4Q7LA 3X1ZA 1T8UA 1Z83A 2Q3MA 2NMVA 2XITA 4P31A 1YQTA 4B44A 2AK3A 2GJ8A 4JSTA 3ECCA 3K0CC 2CVHA 1F2TA 1Q20A 3KFXA 3NBXX 1N5LA 4KFSA 3CRMA 3L0SA 4Q02A 3TGPA 2HXYA 3N5CA 4A2PA 1J2JA 3FYHA 1FTNA 1NIJA 1Y63A 2GRJA 4F38A 1II0A 1F5NA 3PCRB 1ZC3A 3AKEA 2J0VA 4AKIA 3HPRA 2O8FA 3AF4A 3GCGA 2BEKA 2CLDX 1O3YA 1W36C 2CDNA 1W4CA 2C5LA 3P1JA 2NQ2C 4HAWA 4CEIA 4QXAA 1KI7A 4E03A 2FSFA 1SXJB 1DAHA 5FOVA 3NKVA 2P6RA 4EPXA 2I1QA 3BWDD 4H1VA 3EPHA 1KI3A 2ZRPA 4TL9A 1CTQA 1TQDA 1Z28A 2X19A 2Q3FA 1IBRA 1FMLA 3KZ1E 3WP0A 2ECKA 4TLBA 2OO7A 2JJ1A 1ESMA 3QEJA 1TU3A 1TEVA 3B85A 4RZ3A 1AIPA 621PA 1DE0A 2PLRA 3SQWA 3L82B 5TB5A 3M6AA 1Q1QA 2JJ2A 1U9IC 1XTSA 4CVNA 4QJ5A 2W6IA 3MFYA 4BZXA 4HAVA 3MWLA 5L3RA 2BBWA 2FH5B 4QNRA 2O8DB 3VU9B 3KXKA 2GVDC 1ZIPA 1IAQA 1X8LA 3F3YA 2QAGB 4Q4HA 1ZINA 4PFSA 1EFRA 4A8JA 1NVVQ 1OB5A 3L0OA 4IVQA 4MGKR 2CCGA 3LW8A 4KODA 3B1VA 2D2FA 4JLAA 5CM8B 2PH1A 5SZHB 3OAAA 2GWHA 4D4KA 4Q7KA 2N1BA 2FU5C 4GMDA 3CUEF 2VF8A 2OLKA 3IIMA 2BKUA 2I3BA 4I1SA 1KDRA 4PPQA 4D0LB 4UNQA 4DWJA 3L8YA 3VHXA 1OFTA 3C5CA 4ZI3A 3B13B 1KJYA 1TQ4A 4JLNA 4TT3A 5F3WB 2D62A 1UKEA 1QHIA 1XD2B 1F48A 3CRVA 3WMGA 3PVSA 4HDCA 5AWFC 3LD9A 4D0NA 4UJ3A 2CBZA 1RRCA 2ZI4A 4URWR 3BBPA 4CT4B 1G7CA 3G0HA 4AWXA 1MH1A 1M74A 2NO9A 4TL6A 2Z5FA 2YYZA 2ZSFA 5HR5A 1N6OA 3GLHB 2F43A 1KKLA 1J7KA 5CM9C 2J9RA 4BFXA 4PSKA 2D7CA 3RRMA 5BN5A 2ZE7A 5C4GB 1OXSC 5CDFE 1VYTA 3CH4B 4L8GA 4BLPA 3T5DA 4LHXA 1OFIA 4WA7A 3FWYA 2GZAA 3OEEA 2CEAA 3RVBA 3QG5A 1TTTA 2XOKA 2CCJA 3FFAA 5HE8A 3X1DA 4EPYA 5D3MB 1N0UA 2J41A 5FL3A 4JBYA 3HR8A 2VO1A 1DAEA 4Z1MD 4OHWA 2O0HA 1EK0A 1IJEA 5EXPA 1OYYA 3K09A 1X8KA 2QPTA 3DL0A 3QQ5A 5G40A 4QOSA 5FOXA 2CCKA 3I32A 1E2FA 2WKPA 3PIRA 4MYUA 1L4YA 2UKDA 4TQ9A 5FFMA 2R6GA 5TVKA 3W90A 4PZZA 2WWHA 2ODNA 4LUCA 2QP9X 4PZYA 1QVAA 4PANA 4B47A 2AD1A 1G7RA 3QEOA 1V5WA 1E0SA 1F6BA 1GKIA 1TF2A 3AVPA 4W5JA 1OPXA 5KOYA 2ODWA 4QBGB 5P21A 1ZM7A 1YRBA 1LS6A 1OFUX 4TTPA 1Q57A 4OI2A 1P60A 4NDZA 1HQCA 5KDOA 4JLVA 2PEZA 2QT1A 3IIJA 1M7GA 3KJIA 4II7A 2C8VA 3IKJA 4U00A 3OE7A 4G5RA 2A5JA 4QRHA 5J4YA 1GVNB 1XD9A 3OEHD 3C4JA 3A4LA 3HPQA 1KAOA 4A15A 1KMHA 5B2ZA 4JYCA 2BC9A 4E5UA 3AGQA 1QZXA 3PR1A 4Q5IA 2NIPA 4AI6A 5BW8A 5H68A 1HT1E 1F2UB 4EUNA 2CXXA 1CF4A 4ZKDA 1Z6AA 3B1WA 1RPZA 4JLPA 4FXPA 4D6PA 3NIBA 3I8XA 3AGPA 3SI7A 2YHSA 5CYOA 3L0PA 2V6JA 1CEEA 5HPYB 3DKVA 4BZQA 1ZU4A 2OCAA 1FP6A 3SE0A 1S1MA 4LBWA 1AS2A 1XTKA 3BOSA 3UWOA 4BLOA 3VR1A 3ETLA 2IHYA 1M8PA 3TW8B 3U5ZB 3CNOA 3AF2A 1BYIA 4CT5A 4NKRA 3C41J 2FFAA 4DB4A 1Q1ZA 1P5ZB 4O0MA 1DAFA 1GSIA 4JVLA 1R8QA 3IILA 1DBSA 5JI3E 2E87A 1JNYA 2JLRA 1KOFA 1ZUIA 1KK1A 2WJHA 3T5GA 4KITB 4B6FA 1SVMA 4ARZB 3CM0A 4YXWD 1W46A 3THYB 2VP5A 4PHTA 3T15A 1NJGA 4IJMA 2ZJBA 1XD8A 1OLOA 1TQ2A 4AYXA 4UNNA 2X8AA 4TMWA 3FPAA 3QF4A 2J45A 3K0CA 4MKHA 2WJVA 4DUGD 3PEVA 1U81A 3ZZ0A 2WOJA 2QTFA 1CXZA 3LW7A 1P75A 2GA8A 4NP6A 2J0UB 4HZIA 1P9NA 4A2QA 3LX8A 3QVUA 2QSYA 1MABB 3RABA 1P6XA 4HAZA 1SVLA 3U7FB 2H18A 4LBYA 3U2QA 2AWNA 4TYWA 2IS2A 1DS6A 2PX0A 1DAKA 1UBEA 1E79D 1E4VA 1EG7A 5TXGA 5L3SB 3U61B 3PEYA 1NBMD 4YC7A 4FMBB 4HI0E 1QHNA 1EGAA 3TR5A 1E9EA 4MYHA 2V1XA 4X8LA 1FZQA 4HAYA 4OL0A 3SQXA 2Q9CA 4DEXA 3ZZUA 4HUQA 1U9IA 4XH9B 4LHZA 1G5PA 2F9MA 1LW7A 3RS0A 2FSGA 4KLZA 3QXXA 4ZKEA 2RGDA 3U4QA 3QKTA 3SU8A 5KSZA 2ZE8A 4ZO4A 3GD7A 4OHYA 1N5KA 3BC1A 4LY6A 1FTSA 121PA 2REXB 1P2TA 2EWVA 1G6OA 4UJ5A 4MITA 3REFA 4PPNA 1OH5A 1GL9B 3A37A 5F9HA 4G5QA 5AJZA 1D5CA 4MKIA 4A2WA 4LYJA 2MMGA 4RVCA 1R0WA 2OUKA 2JASA 2OXRA 1E6CA 3LV8A 1GUAA 1W0JA 3NBYC 1A1VA 1T3SA 2XNSA 4WOPA 3LFUA 3GEHA 4C0LA 3RANA 5JHGB 2QQEA 1HV8A 1II8B 3QPWA 5DISB 2C98A 1VIYA 4EPRA 3K9LA 4BGDA 1QG4A 2QNRA 3AEZA 5LD2C 3HJNA 2BCJQ 4Q4AA 2J3EA 3EA5A 4RD3A 3K0SA 4B43A 1SZPA 2W2XA 4JLDA 4NE2A 2W6JA 3GPLA 1R0XA 3ADCA 5CJPA 3NDBB 5FTNA 4NCJA 5EUQB 1GRQA 2JEOA 2ZROA 2OLJA 3E5HA 4MGIR 1E2QA 1GDDA 2ERYA 3RDPA 1XZPA 3AUYA 2AL7A 3U3OA 4D81A 3S1AA 3LBIA 5JSZA 3TLXA 2ANBA 1TAGA 5L3VA 2ZUCA 1KSGA 2QMHA 1BMFA 2IYWA 4PO1A 5C1BA 2WWYA 4FWIB 4PHFA 1E94E 4X8MA 1KO4A 4ASUA 4D2IA 3U6BA 5CJ2A 4JLOA 2LCFA 3FB4A 1GILA 4NCKA 4TMKA 1NVXQ 3WYAA 3TW4A 1HY3A 1GRRA 1RZ3A 1W48A 1VHLA 2ZRLA 4PR0A 1KY2A 5SZKB 4QJ3A 5FL7A 4MDEA 1KO8A 3NDPA 3PQCA 4NYJQ 5FTJA 2WWWA 3CRQA 2WWIA 4R2IA 3B78A 2P6NA 4Q18A 4DLYA 3DZDA 2OFWA 5L3QA 4OHVA 4TYPA 3FMFA 4LK2A 5JZVA 3TBKA 3ASZA 4HLDA 2QY9A 1T0JB 4IOJA 2V6IA 3GJ4A 1WBDA 4AK9A 2QRNA 2X2EA 2F1IA 3GQBA 1VHTA 3ADBA 3W6NA 3QVVA 4Q4JA 5AUQA 1XCGB 2J59A 1HT2E 1CIPA 2IUTA 4HLUA 4IDOA 2A3RA 3EPKA 1KGDA 4HDQB 1NN1A 4R98A 3IO3A 2ZJYA 3WMFA 5JBQA 3T06B 4ITRC 1S3GA 2Q3HA 4M1MA 1P7CA 2VHQA 4EAQA 2QP3A 3Q72A 1KI1A 3TAUA 4PQFA 5GJVC 1TL7C 3SYKA 4Q66C 2BMDA 1CR4A 2O5VA 3K8YA 2NTYC 4RCYA 5EE5B 4QM6A 3UATA 4PZLA 2OBMA 4HZUB 1U94A 3IPXA 2WAXA 4AKGA 3IUYA 2IYLD 3AVTA 2GAOA 4KYUA 4LPSA 2V7QD 3SHFA 4O25A 2P3SA 4X8HA 1OH8A 5EP4A 2ZANA 4OQXA 1GTVA 4TMZA 1FNMA 4JLKA 4FMCB 4B3FX 5K8UA 4B71A 1YKSA 5UKDA 3WP1B 5BQ5A 3QXCA 2CK3D 5EXXA 4A6XA 3U3RA 1UEJA 1XXHE 2G6BA 1W7AA 3VKGA 2OHFA 5L8VA 1W0KD 5BXQC 3K0FA 3M4YA 1MKYA 4OHZA 1XXHA 2J7PD 4GNKA 4TLDA 3MCAA 4DSTA 1H8HA 3EWSA 3PXGA 4TYNA 1RKBA 3ICEA 4A6PA 4G3XA 1FFHA 1F3OA 4K8OA 1P73A 3MD0A 3EA0A 1NIPA 1FPMA 5CYPA 2A78A 3AVUA 1G21E 3TRFA 3GLGB 1Q22A 2EYUA 2YV5A 2ZR0A 4A92A 1QHGA 2HCBA 3K0AA 1T3HA 4DSOA 3U7GA 2IWHA 1I4DD 3GLFE 3VHLB 5CIQA 5IHPA 1FMJA 2VHJA 3Q5EA 4DC9A 2BBOA 5FBVB 4US2R 2W2TA 4RZ2A 3GLFA 4M21A 1ZUHA 3W5JA 1AKEA 3P26A 2FFQA 1JBKA 3OFNA 1GNPA 3DMDA 3U7EB 5G53C 2JLQA 4B6EA 2FF7A 2OT3B 2AN9A 3KXLA 1UADA 3ONWA 4PC6A 4A8JC 2VA8A 1ZCAA 3TIFA 5DNYB 1NNEA 2VRWA 4PPGA 4V0KA 4OYHA 4D4JA 3CW2A 4TSFD 1Q1BA 3TVDA 1G16A 2ZEJA 2ZYWX 4MKGA 4DLSA 3MWKA 1XEWY 2HYDA 2DHRA 4IOLA 4AD8A 1NVVR 2IHBA 3ZH9B 1HTWA 5F9FA 4BUJA 5JECA 3C15C 4B76A 3THOA 2HXSA 3KUCA 4P4UA 4YDSA 1QHYA 2GF0A 4FCWA 1CS4C 4F92B 5JFGA 3THWA 1WP9A 2ATVA 3CX6A 4LJ8A 5AJYA 3WYFA 1XTQA 1XFAA 1XU4A 1G3MA 1SVIA 3FTQA 3ZGXA 2YWFA 1NY5A 2OG2A 3B5JA 1YE8A 2ZTSA 4XSGA 3K9NA 1P2UA 3Q9LA 1OW3B 3KJHA 4KI0A 3FFBA 5B64A 2QA5A 4ZPXA 3MJRA 1FOEB 1Z2CA 3DM9B 1NVUQ 1AN0A 2ORIA 4M9XA 4DXAA 3RRZA 2JJ1D 1UAAA 3PENA 4BEJA 5KNDA 2PL3A 4CEHA 3AVOA 4POAA 2QT0A 2JJ2D 4HSEA 5FH9A 5BWMA 2QM8A 1W4BA 2HT6A 2W6ID 2ZRHA 4Y0AA 1JJVA 1ZC4A 2RGEA 1JPJA 2XEXA 3CX8A 1QHSA 3VNVA 4S2EA 3R8CA 4D4LA 4OK5A 4NH0A 1EFRD 3PEWA 2OAP1 2IYUA 1Q12A 1Z0DA 3O8BA 4EDHA 2H5EA 5DI3A 4RKFA 1TF5A 2FGKA 3NEYA 2FFBA 3EZ2A 4BRWA 4DT1B 1N6PA 2A5YB 4C0JA 4LRWA 3OAAD 4DB2A 3BJIC 3Q8XB 3QOFA 3K09C 3ZLJA 2REOA 1CJMA 3SBEA 2FG5A 5A5GA 3PUZA 2ZI6A 3CWQA 2WSSA 2C96A 4NTZA 4B3DA 2F7SA 2H1LA 5HKKA 3FHTA 1AZTA 1E9CA 1OB2A 4DCUA 2VP9A 2RGXA 1N6NA 4RZXA 3BAFA 4TT3D 1ZNXA 3CPEA 2IYTA 2GZHA 5DH9A 1NSTA 1KKMA 4DLWA 4BEBA 3ADDA 1CJUC 4PC2A 3RC3A 2O8EA 4N1AA 1I4LD 1E0JA 2CNWA 3W3ZB 2GJSA 2FSIA 2XNDA 3FHOA 3W8NA 1LB1B 2JIZA 3C5HA 1Z3IX 2A2ZA 3D8BA 4IKEA 2QPOA 4Q48A 4ESHA 1MRNA 2N46A 4DHEA 2GXAA 2O0KA 2OSBA 1E4YA 3KTAA 1FX0A 2DPXA 2QE7A 2B6HA 2VTKA 1JPNA 1ZP6A 4QGGA 4EQ6B 1KNXA 2GETA 1E0AA 2FX3A 2OFXA 1GFIA 5FI1B 3AVYA 1G1MA 3AKYA 1W5TA 4JLJA 3RSOA 3B60A 3QKSA 2N42A 3ZS8A 1RVDA 3GLIA
chains in the Genus database with same CATH superfamily
5CVUA 3TLBA 3DMYA 4V3BA 1CRPA 1XRQA 1E2JA 3LF2A 2CYAA 4OAQA 4MLPA 5CAEB 3R74A 2XCUA 4GFDA 2F4VB 2Q0SA 1CVRA 3BXGA 1E7WA 4K46A 2WM9B 1A8QA 5E9JA 3BBLA 3KV1A 1NI4B 1QO9A 4KXMA 5D3QA 3ETHA 2A67A 1YB2A 2CSUA 4GGPA 5GM1A 5JD4A 1KYTA 1T36B 1JSZA 4KQCA 5JTTA 4F06A 2CJPA 4OJTA 5D7NA 1J2EA 1QFZA 1OZGA 2WD8A 3JR7A 3B3QA 2UV8A 4O33A 7REQB 2AC2A 1X9HA 2IZ1A 2CLEB 5EEHA 4BNWA 1N9GB 3ILVA 3LTEA 4ZREA 5DNAA 4KQ2A 3AERA 1K4KA 2NXEA 2NU9B 1TQ6A 3LPAA 2DULA 3WB9A 3W6PA 3WL5A 1JFFA 2PXHA 1L6IA 1ZIOA 2ERCA 4XIFA 4C5BA 1N6RA 1JQ5A 4IXWA 4TN5A 3KV3O 1R4AA 3PLRA 2G77B 5BRNA 2JHCA 3GLRA 5JWRA 2J5QA 3BREA 4QDJA 3W06A 4HMPA 4JB2A 5J5AA 2ZDQA 3MJVA 2XHEA 3D4IA 3LX5A 4DQUA 2OOSA 3BJZA 4TMXA 1AHPA 1KK2A 1TLLA 3PNOA 4P1ZA 1GQSA 2A57A 2BLLA 1RRKA 3T1NA 3VU8A 5D7BA 2C4UA 2WR8A 3ORHA 3RYFA 1FC0A 4B3MB 5JSHA 1Y8AA 1ECLA 2P65A 1BFDA 3O6VA 1N0WA 2DB3A 4ZVNA 2FFRA 1IB6A 2XADA 3DXXA 5CW1A 5J2UB 3ZI0A 4D8YA 5BN4A 5IASA 2DGDA 3RH0A 1Y7LA 3DFFA 3VX4A 1ZJWA 1EFDN 4H3KB 4I9HA 1SUWA 2Q7XA 1L3CA 1OHHA 2DUMA 5C8YB 1WUKS 1U0BB 3AVQA 5KVVA 4C2TA 2EFYA 2QSUA 4CFZA 3G5UA 4KO8A 2Z04A 5JAOA 1UPUA 3GROA 1JFTA 2XMSA 3ORFA 2VLIA 2X0FA 3OIDA 1B0ZA 3K70C 3BFVA 3P4YA 4ARSA 4QQKA 1YS2X 2GHRA 3C0KA 3GOHA 2R6CA 3HYTA 1AKVA 1OFHA 1WDMA 1RE0A 3ONFA 1BS9A 5F98A 1WKBA 1L8AA 1E63A 2D7DA 4M9UA 1WZCA 4OAPA 2IU3A 2ZYUX 3JD1A 1QFMA 1E1KA 4YIHA 2O1EA 1TFUA 4ALLA 4L4ZA 4CL3A 4G0MA 5ADVA 1H4SA 3MPUA 2F59A 2EL9A 3MS7A 3DQPA 1OYWA 4XCQA 2G82A 2OD9A 4MRSA 3DHNA 1H6BA 1FEZA 2HU5A 4H35A 3M49A 5A1JA 4PNZA 1IG3A 2X2FA 1KJNA 2QM7A 3H2BA 4IIHA 2PUGA 4D8VA 1YO6A 1RCUA 2A5DA 4LZLA 1DKOA 1A95A 2VUIB 4O63O 1CJSA 4MI3A 1L2TA 4J75A 5HIMA 1WPXA 5SY4A 1G8GA 2B1IA 5IKPA 1UMKA 5JEEA 4MMZB 4KGVA 4Q3KA 3ZD9A 3ZJ5A 3MRVA 5F12A 2PUFA 1Q0QA 3PC3A 3P2IA 4ESVA 3GLHA 1VE6A 1HQKA 4D8UA 1FNSA 1E7QA 1DX4A 1W36D 4JYZA 1A27A 2PQ2A 3E9MA 3EA4A 3IESA 1GLNA 1T3ZA 2ZXUA 2EGGA 1JR3A 2ZJFA 4O8CA 4W99A 4D8TA 3LK6A 3UC5A 1H9CA 4UHKA 2HK9A 1SVOA 4BP1A 4JC8A 2G08A 4TSRA 2QZPA 1VL8A 2IVZA 5EGNA 1Q0TA 2VHCA 4QZVA 2EC5A 3HUUA 2ZUTA 1RHKA 2M6SA 2CZGA 5JYBA 4YACA 3KXDA 5AW2A 1PR1A 1R5NA 1YB5A 5B3KA 1UBHS 3EAGA 4D5GA 3S27A 2I4RA 4AX8A 1TM3E 5F2KA 1AH2A 4C0HA 3HA7A 3OUTA 1WB4A 3C3CA 1NSFA 3EGCA 5EWLA 1DJLA 1I6MA 3OF2A 3CF6R 1VIDA 4JA0A 4I50F 1ZM9A 1G66A 4G0YA 1PIWA 1ZD4A 4DCPA 1E4EA 1JEEA 1RAFA 3NAMA 4DWVA 3H1EA 4R0MA 1BKSB 4HXYA 1SD5A 3X1XA 2O19A 3A27A 3QHPA 4F97A 1QO0A 4ZVQA 3T7JA 3KCNA 4V03A 4CMIB 1BXGB 3M6WA 2P5SA 4CQLA 3TG2A 4W5RA 1FLVA 1Y7TA 3W7BA 1EUCB 2QX9A 3SFVA 2PDAA 4NS1A 1HG0A 1NP6A 1CB7A 2VDMB 3OOJA 1B74A 4G56A 3CRRA 4I1RA 4ZIRA 2NXCA 4AX4A 1KU0A 1TT7A 1JRLA 1UR5A 3AEXA 1W0JD 2II6A 1E6LA 1PJTA 4UBNA 3SIXA 5BN5B 4BFVA 4HPXB 1CV2A 1H69A 3URKA 1ZVQA 3OA0A 5AI5A 1ABFA 3V1NA 5KX5F 1T9GS 2YW9A 1JHYA 5SY9A 3DLCA 5BW4A 4HGQA 4RYDA 3AV3A 3ZZTA 2P2LA 1CQJA 4JJ4A 4A16A 2DCUA 2XWPA 3I05A 4DV2B 4RBNA 3H4VA 4WN9B 3GOQA 2QYHA 2VZLA 1F8YA 2A5FA 4KL8S 5IDWA 1FBTA 1W2WB 5FWNA 4P93A 1F2UA 2JIPA 2IZZA 4WGFA 4EUEA 4AMVA 1XZDA 2X1VA 3BCSA 821PA 3CMMA 1N1GA 2AI1A 5EFOA 2AFIA 2PS9A 2PN1A 4OGWA 4OP2A 3T5MA 4LPKA 1DKQA 1ORDA 1TMOA 4PTZA 3DZJA 1JYSA 1BMFD 1GCOA 4E7OA 2H2HA 2C83A 3E5NA 2OCLA 3KZKA 4NNPA 3QV1A 5FYQA 5DP1A 2JCSA 1VHWA 4H6WA 3BORA 4DZZA 1U8FO 5ESXA 1BE1A 3E7XA 4DAOA 1DCKA 3OC6A 5DSTA 1DVRA 3IAS6 4K9NA 4RCVA 4MUJA 4HWOA 4EI9A 1R50A 3OX4A 4CHGA 3AZOA 1U9YA 1UXKA 3KBOA 4DDUA 2W6CX 3DV2A 1E2DA 1VBKA 3V6MA 1PGNA 2AJ8A 1U8YA 2LE0A 2IOHA 2PUJA 4KV9A 4WVLA 4YAKA 4M98A 4D98A 2G76A 2AEJA 5DDIP 2YIDA 3AKDA 1QG2A 1TRKA 2A0YA 2DKNA 4MYCA 4C4RA 5AM3A 4WESA 3IELA 1OPRA 1YHZA 3AFIA 4GSYA 3ULKA 4CKBA 4F9GA 5KYWA 4AY2A 2CXTA 1T8TA 5DMHA 2UYGA 2ZRDA 3KELA 1H0HA 1Y4ZA 3GT3A 3WQHA 2WAAA 3OHPA 2VUTA 1V6SA 4NFSA 5FEUA 1U0LA 7ADHA 2CYCA 2MINA 1AA9A 1Q19A 2PA0A 1UBLS 4ND7A 3VR4H 4DZRA 5T67A 1BEZA 3FNFA 2Q21A 3KHTA 1N2CB 3DMTA 2YV3A 4DJJA 4J03A 3RYHB 4EARA 1A96A 1ZISA 1G9XA 1LDMA 2Z2KA 4M53A 1J90A 4MGHA 2CLHB 2ZRKA 5EKUA 4JJEA 3S2EA 1Y6FA 1MEJA 2FQWA 2PBZA 2W6NA 3OT4A 4JZYA 4Q7MB 3GVPA 3V97A 5K09A 3ZGZA 2HX1A 1XZFA 2ZE6A 4KR3A 1XA4A 1SHUX 3JAWA 2XXAA 3SNHA 3N2NA 3AXSA 3BE4A 3CEPB 1T4CA 3E70C 3PGLA 4P4NA 5EP1A 5CFPA 2HUNA 3AJ8A 3TR6A 3U13A 1ZCBA 1YGPA 2AZMA 1I0IA 1U9ZA 4XWYA 1XNJA 4BJ3A 4DLLA 2HBYA 3H9JA 3FVTA 4UVIA 1PYOA 2JIOA 2H48A 1KP2A 4Y1GA 4DJEC 4XYBA 3IRVA 3PVCA 1GUFA 3FYUA 4ZI2A 4FFVA 1Y80A 4JX8A 4FFRA 1M6YA 1E9AA 3E3MA 4J0JA 1T5DX 4UW9A 3SXUB 5A9RA 2DQ4A 3A2KA 1LWNA 1AOXA 4WZBA 3OQBA 3UJNA 2I4IA 2DE0X 2GHIA 2VJLA 3CLRC 2JRCA 3SEAA 1U3TA 4EEXA 3DBLB 1IPFA 1DDIA 3I3OA 1RQLA 1OGIA 1M34E 1WHSA 4CRWB 3DLHA 3NHLA 4Q3EA 4U02A 4Z0HO 3R9KA 1RU3A 2DLNA 1ZY2A 3D8HA 2XNHA 1Y98A 4EW3A 1H8HD 2YH2A 4WNCA 4ZOAA 4DLBA 2PUBA 2OHIA 3U4DA 1NBHA 5EMMA 3CBQA 5I7SA 5IAKA 1K0UA 4CN9A 1XQ1A 3FMPB 3HXTA 1E3QA 3HDVA 4MK4A 2H7CA 3N75A 3DD5A 1WD7A 2L17A 3K6SA 3ZS9A 3ETCA 1HFEL 2BHRA 3CC8A 3LCVB 4RZHA 4DR5B 1LGYA 1YL6A 2QZ9A 4J94A 1W2GA 1P7PA 1N2GA 3QFTA 3ZTYA 2WTUA 2QG6A 1UBNA 1CR2A 3DFMA 2XSZA 3L8ZA 3LQQA 5JCJA 2FI1A 4DIKA 4FNMA 1MAUA 4ABTA 4FDMA 3BTOA 3W5IA 5TMDA 5EHGA 1NQOA 2QUHA 2VSFA 3NAGA 3WSTA 3QX3A 1K75A 1R6BX 4KX3A 2NZYA 4EHJA 3ND8A 1KQGA 1Y4DE 3K0KA 2CUTA 3X2SA 2F1OA 2FWRA 2QI9C 4I4TF 1O5OA 4JN6B 4KN5A 2WA1A 2I5PO 5FKJA 4YO7A 2QAJA 1NLMA 1MO6A 5D6OA 4CTJA 4F3RA 4DGQA 2C04A 1FFAA 1V35A 1JSLA 3AUUA 3UV6A 1SCJA 3PXUA 1JZQA 3Q0EA 5AJWA 1QBGA 5ALJA 4Z0NA 3RT9A 4RFSA 1TYZA 2Q5QA 1CKEA 3KQOA 3PC8A 1WDWB 1KZHA 4MUIA 3TH5A 1SIBE 2ACKA 2FZKA 4B3BA 1E3EA 3S7TA 2BFAA 3NLLA 4LW8A 4LRUA 5JPCA 3H2JA 1MIOA 1YVUA 3NHKA 4DBLC 1FQOA 3I23A 4JVMA 2ZATA 4G23A 2BUCA 4ZO6A 2RHMA 2ZSDA 3KQKA 4WLUA 4YUZA 1G19A 5AESA 1IONA 1SEPA 1TZJA 5EWMB 3OQOA 3COWA 3UFXA 2E4YA 2ZWIA 4RHXA 5CLGA 3VO2A 1Z47A 3E53A 1MVOA 3EQ2A 4GC5A 3VTKA 5I7VA 4IILA 2I7VA 1WMEA 2LVBA 3DBVO 4B3GA 4BPRA 3Q11A 4XD2A 5ENDA 5IU6A 1BDHA 1LH0A 3KEOA 4TKZA 5H5JA 1TM1E 2YX1A 3EEQA 2GM9A 1E62A 4G5XA 5AOVA 5G0VA 3AOEA 2VP3A 3ET5A 4G1FA 3MTGA 3QOXA 3E4CA 4FYPA 2YCBA 1SZCA 5JSYA 2OV1A 4F46A 1GPUA 5LQNA 4MHOA 3A3OA 4MB0A 3OZBA 3BDVA 2A9JA 3WLRA 1E58A 4ECEA 4Q3NA 1RVV1 1UWKA 5JDCC 4ARAA 1JFVA 4G8CA 4N0PA 1IC6A 1JSXA 1UK9A 1UJNA 2QF7A 2YHUA 3T5PA 3K1YA 3OZWA 3BG5A 1TVCA 4M46A 3RYIA 5H82A 1WSDA 2E1RA 5E6SA 1YB7A 1YR7A 1P72A 1P33A 1F0NA 2Q4DA 3ETEA 4QVIA 3W77A 1SHKA 1ZRHA 2SECE 1SUCA 2OAEA 4AN0A 4AUKA 5HZGA 3QWAA 1TNDA 4BLRA 5EQTA 2F1RA 1PEAA 4N0EA 4BP3A 2PWPA 2H85A 4A23A 4HEQA 4XI9A 3EF3A 3WLIA 5AKLA 2O2XA 3V1YA 2E5FA 1ISFA 1ISJA 3FLMA 4O2AF 4C3ZA 3LCRA 3EB9A 4J9VA 3F74A 1IQUA 4G2TA 1EX6A 3EVNA 3IEXA 3MERA 2E5WA 3INRA 4QIHA 3SVZA 4D3YA 3BIJA 1MW9X 1EDBA 2JJMA 3QUBA 4HB3A 2AG5A 5I3ZA 3ZDQA 5LCXA 2KPOA 5A05A 5B4TA 3W5AA 2GAJA 3AW8A 1ZYUA 5HKKD 1EXWA 4ZO9A 2HMYB 3L79A 1ULSA 1SUIA 2WD7A 3F6SA 2VJPA 2H07A 2QGFA 4NYMR 3RB8A 3UMCA 1XPOA 2W0SA 2YVUA 3N2EA 3D31A 3GVXA 1D6NA 4GRDA 4PBTA 5T4EA 3TIGA 4YASA 2IYRA 3F67A 2BGMA 3PYMA 1DADA 1E2NA 1O6BA 1FRQA 1E5XA 1LUAA 3KSZO 3M6LA 2GDZA 1WZEA 4O4JF 3TSYA 4D45A 4WSOA 2VPQA 1XPRA 4LDPA 2BFWA 3AEQA 1R0YA 4WTOA 3RFCA 1E5TA 2RGGA 4INAA 1ML3A 2CNWD 1XDDA 1M7BA 2GLUA 4D3SA 4RABA 1A72A 5JNLA 1D1SA 3GA7A 2QN3A 1TM7E 4TPKA 4DMFA 3LBYA 1K88A 8AT1A 2ZCVA 1RM3A 3D1VA 1NONA 1EVJA 2CLMB 1XT6A 2QE7D 3TD6A 1LZLA 4EHFA 4ID3A 1ESNA 3A1UA 5ENVA 1JS1X 2FZVA 3S7ZA 3PUYA 5CU7A 5KMGB 1H6CA 1HGXA 3CFYA 3HKEA 2CLIB 4DARA 5EIAA 1VE3A 4TWJA 2XQJA 3EVFA 3JQQA 3PPVA 3RBZA 3HO8A 4I55F 2J4CA 5LLSA 3BL8A 2Y77A 1OI2A 1P1BA 1C3OB 2Z5LA 4DNXA 1I1OA 1X94A 1YRLA 3DUWA 1X1QA 2ZAMA 2A33A 1X7YA 2CYBA 3G49A 4I19A 3OIWA 3KLMX 3PB3A 4PAWA 4OSOA 1BS2A 3DM5A 3GT7A 3T61A 4FDVA 4B4VA 5CB4B 2Z58A 1JU9A 3TS1A 3NWBA 1RP1A 4UQPA 2IH4A 4URFA 1A2BA 4QFCA 4YECA 4HQ0A 1F2DA 1I2DA 2HN9A 2OO5C 4RY0A 3DJFA 3FPCA 2ZU6A 1DZIA 2VYCA 1R74A 2IEGA 3GMSA 4RX1A 4F3NA 5FWYA 3MAGA 3VPFA 2VAXA 1A9YA 1ATZA 2WJIA 4L4SA 4XJVA 3I4CA 4J1NA 4LMPA 2FZEA 4X1YB 4MEJA 3MAJA 4FLMA 2ECQA 4OQNA 3QA3E 3DE6X 2Q8PA 4M1TA 5KYVA 4GX5A 1MRZA 1Q1NA 2M6RA 4AKTA 1XMXA 4KO4S 3OIVA 4LOLA 1QSGA 3K0AB 1OQAA 3DOOA 3KEFA 4OBXA 3ZK8A 3TVTA 4PR3A 1SOWA 3LPDA 4IFTA 3D6TB 4BTLA 5JSQA 2Y0PA 2AR7A 2PWBA 1K9SA 4CMKA 2OHGA 4D9FA 5JDIA 2R8BA 2WMDA 5KYNA 1WY5A 2GYWA 3O21A 4KU4A 5MFZA 2JFYA 1FMCA 2C9CA 3KKOA 2J87A 3U4IA 3J80A 4M0LA 3BH0A 3PRYA 4E09A 5CVTA 2FOLA 4X85A 2YOFA 4GPTA 1ULTA 3LAWA 4BVAA 2VPPA 4LYFA 4C7OB 1BYUA 2QPLA 3KQPA 3RSCA 5KTKA 1XJ5A 4I1VA 5CFMA 1N75A 3CRZA 2B61A 2DKOA 5FWAA 1N8TA 1IY2A 1WHTB 3OHSX 4FFWA 1G55A 4DIDA 1I7QB 1YDFA 4R0VA 2D0DA 5HCNA 4GVLA 1B00A 3T3EA 5CW2A 4H18A 4JJZA 1QQAA 2I6FA 2A30A 1U2SA 2P9ZA 3NUZA 2JH3A 4I4CA 4X71A 3VSBA 6YASA 5D3KA 2A94A 2H4HA 3AF1A 4AJ1A 1QH1A 4JNCA 3V7WA 4YPVA 4D9KA 3CE9A 4AIIA 4EA7A 3V6LA 3WHPA 1SR8A 5G0SA 1K7EB 3THRA 2PV7A 1ZMXA 4LZJA 5H16A 4QGSA 5BURA 4PPFA 1XTUA 3ZR4B 5CB0A 3LBNA 5HGXA 1DJQA 3HWSA 5DJ5A 2FVXA 3KKKA 4HC4A 3DNMA 4G97A 2BLNA 4TWAA 2EDAA 1T5OA 2JG3A 3BGDA 5EJ8A 3NHMA 2JFNA 1HTBA 2JGMA 2ZS9A 1DO0A 2ZIAA 2H6EA 3C74A 1CJVC 4LRSB 1CC1S 1E3LA 4JYPA 4D9MA 4F85A 3IUEA 3W6OA 1PW7A 2F9FA 3ND9A 3HVIA 3OIUA 4Q9JA 3RVQA 2QG9A 4IHKA 3K32A 3WRYA 1KQNA 4IXMA 1QGUB 1T35A 3B3JA 2WT8A 1DG9A 3TD2A 5I7EA 1L7QA 3HEBA 3RRXA 2HA6A 1I1QB 4FKBA 1TJYA 4MR8A 2R6FA 3IP6A 1RIFA 4R2KA 4LVCA 3AI3A 5EE3A 3UWSA 1MJGM 1UKYA 3N74A 4QNMA 3KKNA 3VNAA 3GEGA 5A3JA 4ITVA 2Y27A 2CUNA 2WTNA 1NVMB 1SPBS 2YCLA 3A1SA 3LQYA 3Q87B 4OHCA 4ZEXA 3UJ9A 2VJMB 1QRAA 3VR5A 4FQ5A 3WWDA 1LJ8A 1XJWA 5DX8A 5LQAA 2CXRA 4AYWA 1X1AA 5L4LA 4O08A 2QTMA 3RRYA 3ZCPA 3GZTB 1IM8A 2EHDA 3W2GA 2UDPA 4C7MA 4QUGA 3OQVA 3AUKA 2WU1A 3L7KA 2OCPA 3NEAA 2G3YA 5E3JA 3ZHQA 2C7PA 3EZ9A 1LTKA 2AR0A 2YXNA 4YRSA 3T0IA 1CQXA 3IAAA 4HVAA 3DB2A 1FVXA 2I8LA 1KOGA 5KCZA 4CG0A 4NBRA 1N57A 1JDBC 1N8KA 2COKA 2C2BA 2IHJA 3L7IA 4HRXA 4MKZA 4AF8A 4R5HA 1FMTA 4LI0A 3UH1A 3NIDB 1XBTA 2E3JA 1V3VA 3RVOA 1AUPA 3ZX4A 3K16A 3LFTA 1WJGA 1UMDA 2KBEA 4TRMA 4ZARA 1J8FA 1E8NA 3PUXA 4YJ3F 4AUMA 5LP6C 4CPDA 5IBRA 2JD1A 4HNUA 4IIDA 3G8AA 3I42A 1C3EA 1RMTA 3PR2B 3VDRA 3DLAA 1NL3A 1WMBA 4G5HA 4MW5A 5LWHA 4LMAA 3MOGA 3CLUC 2M9MA 1ICIA 5AKHA 2VQSA 3LT1A 2XZPA 2YDXA 3UG6A 4S1VA 4XB1A 4TWIA 1H9AA 1X1CA 2BKEA 2C7GA 3VO9A 1B73A 1JH8A 1Z0AA 1C7ZA 3AFHA 2JLXA 2O8CA 4LTDA 5CK5A 1R27A 3AHDA 5CH8A 2AS0A 2B36A 4TXLA 3QBEA 4AB1A 5F73A 1ZK0A 4RK1A 4RZUA 3GZNB 1FVOA 3KKQA 1ZLYA 1HMYA 2D1YA 1PJ3A 3EVBA 4Z86A 1WL8A 3ZD6A 2AJCA 1QP8A 1SRRA 4QPNA 3DFKA 4CQMD 3GJRA 5AW9A 3L4SO 3W6UA 4CTMA 1IK6A 1VC2A 1WSWA 2J7KA 3DNFA 3EFBA 3FHJA 4MKRA 4BX9A 4Z3DA 1YE3A 4MV4A 4PQYA 3V46A 3QF7A 4A36A 3ZE2B 2ZSHA 5AHRA 2O8DA 2IYFA 3OD5A 1FU4A 4O3FA 3V4VB 1HSZA 1Y7HA 2X0NA 2H4XA 1SOAA 1ZN9A 4C04A 2FWPA 4ZT7A 4CLOB 2AQIA 4G41A 1L7AA 1R5OA 2KE5A 4M54A 1O97C 2B3TA 2HLDD 3VTAA 1VI6A 5A3RA 3HXQA 4L15A 2JCVA 3UKOA 4YJHB 4HQKA 2W48A 3RTDA 5HK9A 5ITZB 2INGX 1S9DA 2QW8A 4Z8XA 4F3TA 2Q2VA 4YV2A 4O4HF 3K73O 2ZBVA 1PBNA 4EF6A 1MEOA 2WG2A 2FMXA 3R3YA 4QXQA 1WDTA 3HYRA 2GN1A 4PLFA 5DULA 5FR1A 2R86A 3QBDA 1VLVA 3NH6A 3V4LA 3UOAB 2F2TA 2XB4A 3JWHA 3IQIX 1VPTA 1UC4B 2H1WA 1XCLA 2H57A 2QN8A 1CHDA 1JZSA 2B2XA 3Q6NA 4QDTA 1GTZA 3A1CA 1B1CA 1NF9A 1YDWA 2TMYA 1K0FA 3I01A 3LBFA 3V8NA 4YCMA 4JJKA 3QLUC 4OX9B 2C77A 1PFVA 2NO4A 4OXNA 2VHYA 2G1UA 2WZQA 1E2MA 3R6DA 3KQNA 2VJBA 2FPXA 2AQ8A 5JC1A 3IE1A 3PD0A 2EZ8A 1IJBA 3UT0A 3WRXA 1T9CA 4QOEA 3I64A 2QRVB 3OE4A 2CB0A 3IKLA 4IDNA 3EEIA 1T9DA 1XN1A 3C45A 4IIEA 4XDYA 1RHJA 1YDEA 2IKSA 3K1AB 5JQWA 4IH9A 2I91A 3O3CA 3R7LA 3BD9A 1DTSA 3RROA 5KOHB 4OK3A 3C3YA 3EEYA 4ZCRA 3OETA 5A6VA 2GBGA 5J1SB 1G20E 3QVGA 4OQLA 4IVPA 3PDIB 2PTHA 4IO0A 4F4JA 1KAGA 2PMEA 1MJ5A 4GM1A 5JCXA 1R00A 4MVJF 3UUGA 4CIBA 4R81A 3IA7A 1AB5A 5AJXA 3NCHA 2GNPA 3R7FA 4FKZA 3IVMA 2GEDA 3LY5A 4BGEA 2P4EA 3PFIA 1AK9A 4KZPA 1L5LA 1L7DA 4LX0A 4CBVA 5AIBA 4Q1FA 3K70D 2ONCA 5GONB 2AW3A 1S96A 3FDIA 2O3UA 1S2DA 3D0RA 2VNAA 2ZRBA 5DGIA 2QD4A 4EPWA 3UMYA 1YBHA 3ZHSA 1Q3HA 1SKYE 2QW1A 1F0PA 3GARA 2PJZA 4IIJF 4PC3A 3VGJA 3KO8A 1YQQA 3D5EA 4FKMA 4C14A 3I9KA 1TKRA 4OIFA 4URVR 3SEFA 2ODTX 4B3SB 2CFCA 1UEXC 2PYDA 3AM4A 1VDZA 2MSCB 1OJLA 4S35A 4WT7A 1X38A 4YWHA 3L0ZA 1VSQA 1K5PA 4X1KB 3SM3A 1XF9A 3IH5A 4QUKA 1T2NA 4BMZA 4AY3A 4YRGA 4BWGA 1AXRA 1CERA 3SF0A 3L43A 4MZDA 3OQIB 1SULA 3NG1A 4L02A 1D07A 4JHLA 5M04A 4BXOB 3LSYA 2PQMA 2HFJA 2PX8A 4I8IA 3RV3A 3MUEA 4BZZA 1CF9A 3L0DA 2JLZA 2NVUA 1GYRA 1F4PA 4TQAA 2CHEA 3PX3A 4XQ0A 2PX5A 3L9WA 4KXUA 5B1EA 5ANRB 1Q0ZA 2GPJA 1NRJB 4RHYA 2MYNA 3KPVA 4BGIA 3FA2A 2YZ2A 4HFNA 2YASA 4LE0A 4ER5A 1G6HA 2IBSA 1PZNA 1DIBA 3MCWA 4FPXA 1GTSA 1P2SA 3BSFA 3LPMA 4BNDB 1RPTA 3JPYA 3FGZA 1JDTA 1PEYA 4TUYB 3ENNA 3ADKA 2EZ9A 3HL4A 4QYXA 1MJNA 1NOJA 1UDRA 2RGRA 3ZU2A 5EJ4A 1Y9ZA 4MRMA 4YCDA 3QXSA 4TV8B 5G3YA 2B69A 1L7VC 1V39A 1EM6A 2LR0A 2X3YA 3V4PB 5J5VA 1IPHA 2MDTA 3FROA 3NM4A 1NN5A 1DO8A 2FR1A 4LYYA 4AP6A 3NYQA 1YZFA 3G7SA 2HC9A 4F71A 4RANA 2C78A 3K92A 2RB4A 2I71A 2YV1A 4EMBA 3EXAA 4LF6B 3X1YA 5K8TA 3R7AA 3ZU4A 4HZGA 2R0QC 4FXOA 3VO8A 4DCVA 3QY0A 5HUHA 1JXQA 1NE7A 4OATA 1LBSA 1JDZA 4IGFA 4RSRA 3A2NA 1XRMA 1P7WA 1DELA 1ZZEA 3Q10A 1K27A 3B1KA 4KYIB 3PS9A 2B99A 3AV0B 3WV4A 3MJHA 1JEQA 1QMGA 3AETA 3I5MA 1HLDA 3PQEA 2PUCA 1TCBA 1Z0JA 2CFSA 1W75A 5EIHA 4Z4QA 1EAMA 3QXGA 1Y8ZA 3C6KA 1RNLA 2GPTA 3KYDA 4LY9A 3DDHA 3S2YA 5HP4A 2IY8A 3G2QA 4AKHA 3OX1A 1ZGGA 2BZSA 3JQFC 4LOKA 4WLOA 4F4UA 3SZOA 2AXPA 1ZNQO 1XNHA 2FFJA 4RPLA 2Y99A 1R18A 3TYXA 3CO0S 4IHJA 1P29A 2CMFA 3QJYA 5BSEA 2QKYA 3T7RA 1G3QA 2X4GA 3Q7IA 4LDJA 4PXSA 3BA6A 2DR2A 4MUMA 4Q4DA 3X44A 1WIWA 2XWJI 1ECFA 2GYYA 1S3FA 3D7MA 4UDXX 1Q74A 3WYNA 1AY0A 5C52B 2XCSB 1O08A 3CV3A 4Q9LA 1OI4A 2VHXA 3OKCA 4JQCA 5SV2A 1Z4LA 3TNYA 1YJ5A 5CT9A 4AG3A 5LP6B 5TIIA 2G0NA 3ANMA 4KJZA 3L8MA 3PL1A 3UMVA 4Z49A 2X8WA 4TMTA 1FF9A 1U0GA 3K0HA 1TUBA 1VGVA 1T1RA 1UT6A 4JP5A 5IC4A 5JCOC 1T9AA 1B6TA 3GFFA 4L4RA 4YRPA 4IP0A 4F12A 4YCSA 5ADUS 4R1LA 1FFSA 2B37A 3K6RA 1ODIA 3T7KA 1FQJA 3VU3A 2P5TB 4MO9A 2DPMA 2H2AA 4PSAA 4XB2A 1Y4UA 3RVNA 3M83A 1JJIA 3ADOA 1ZVJA 2Z4RA 3MFQA 1Y3BE 3AMVA 2ECOA 5FPHA 1DJOA 4HLQB 2W6PA 3I4LA 3JQ8B 1L5NA 4PHHA 1K98A 3W4JA 4D79A 4NBUA 2BTEA 5IP5A 1KY3A 2HK6A 3QLJA 3ZE9A 2ODAA 3PT5A 1GFWA 1NUQA 3NTUA 1GDTA 1AK2A 4KQMA 4YO8A 1IM5A 4BO2A 3EC2A 3HFJA 2FSSA 1SQ5A 1IG0A 3L7JA 5TV2A 3WQSB 5GJCA 5IJWA 1DFIA 4HWRA 4BNJA 2B8JA 4Q39A 5E4TA 3ELDA 5JHHB 5LQKA 1ZD9A 4OJYA 5EKSA 5JCZA 2OY0A 1R88A 3E6AA 3G5TA 4MAMA 1NPYA 1Q17A 1HE8B 2IF0A 3C2QA 4UQOA 4XWOA 3ETDA 1AMUA 5K0CA 4LGCA 4UTOA 5BOVA 2G1KA 1KEPA 2XWBF 4F86A 1OASA 1C9KA 1QH9A 2ZWMA 1QYIA 3DOHA 5DF1A 1DCTA 4BLVA 3DYVA 2BBSA 3RIGA 2PT9A 3S1LA 4IGIA 2LXNA 1TCAA 3F46A 1R0LA 1GCGA 1ZMRA 1SMKA 2G8LA 4H77A 4WECA 3WQQA 4PG8A 1PV4A 5KQLA 4N5NA 1P80A 2YWCA 3HNRA 3N58A 1R10A 1VG8A 3GI1A 4IGKA 3ZY4A 3W6ZA 4PLGA 3NBZC 4Q93A 3PFHA 3IAXA 4GMHA 3V7FA 2VHEA 1H94A 1YK0A 1Z6XA 3K8OE 5KTOA 5AVXA 3ZG6A 4PPYA 1CS0B 1ZMBA 2VP4A 4FWBA 4NLLA 3HBAA 4E07A 4HNRA 2P4UA 1NULA 3SZMA 3FMGA 3DO6A 1Z2DA 2JCBA 2ZQ5A 3P2JA 2BKVA 5FPPA 1YZTA 2GNOA 2Y1CA 4XYGA 5REQB 1PYDA 1SWVA 3PGJA 4IAOA 3CLRD 1P77A 2CV2A 4KMMA 4KXLA 2NO7A 3STXA 2D8AA 1K7SN 1JGTA 3WMWA 2O7VA 3R0QA 3CXUA 4U2GA 3UMRA 1DMSA 2IPAB 2VRCA 3EGDB 3N0RA 1ZL0A 1P1KA 1U98A 3OEHA 3PUKA 4M0DA 2NNWB 4I46A 1AKQA 1US8A 4CF4A 1WB9A 1JR6A 4G09A 4F4IA 3WLFA 3EK2A 2YV4A 1SXQA 3IBGA 3W05A 4AJLA 1ENPA 2SHKA 3TK1A 3H4IA 4DRXB 4KPEC 1Y5LA 1TU4A 3BD8A 3RSGA 3V7YA 4ZD6A 4DJTA 1Z15A 3C5VA 4C3OB 1OA0A 3TE6A 5KPJA 2LZ0A 3H8SA 3PTLA 4M8SA 5JSZB 2WP8J 1PP4A 3JVIA 1ZKDA 3CTMA 4P2BA 1MORA 3ZQJA 3MGCA 3RTEA 1HF3A 1N0VC 1LPNA 4EJSB 2QNIA 3CVVA 2WNIA 1R8XA 5K0JA 2IYZA 1ITZA 3QBVA 4HZUA 5E6RB 1EWKA 2IUEA 3OA2A 1UK8A 1JSCA 1CE8B 1TZCA 2X1MA 3LYHA 2FRVA 3OQJA 1I4WA 1R4NB 2ABWA 1E7YA 4GPIB 3AB3A 1A71A 3BCUA 3OKFA 2PA3A 4LJLA 2XYPA 3CR8A 1AS3A 4JLMA 4PVCA 5LOVA 3CVYA 2J48A 3CPHA 4BB0A 1R6VA 2P8JA 5CA1A 1T1EA 5JSFA 3M34A 3GBVA 5C7OO 4PLHA 2VJDA 1AK1A 3DL2A 1UIMA 1X7WA 4U5XA 3U3ZA 4I3FA 4FYVA 3H5OA 1GIAA 3BHNA 3DMGA 1G5TA 1UP4A 3HRIA 3HQ4O 4NMWA 4YRFA 2AC7A 4JDUA 1GZ5A 3OF5A 1KY5A 2JBAA 3GQBB 3OJEA 5C1PA 3TSAA 4A6DA 4E11A 3OLCX 4P5PA 3K0EA 1POWA 4J7UA 3FTEA 4LMRA 1DLIA 3BWXA 2IS4A 1I8TA 3EZ6A 1A8UA 5DRYA 1L4UA 4GECA 1VIAA 2NUAB 3ESXA 1XOIA 3P2YA 4KN8A 4G5OA 5ED0A 4A73A 3BTSA 3SZRA 1AO0A 2Q45A 3NTOA 4LEIA 2FV8A 5LZ2A 4BNZA 5JLAA 2C5AA 1WR8A 4PLTA 2XQFA 4LXQA 1WUYA 2GCIA 4JQYA 2NZUG 1KJWA 2X76A 3A7DA 2Z5GA 4L16A 1NQWA 1K3TA 4FCCA 4LZPA 2R9VA 4MWSA 3DDSA 1WABA 4LQ4A 1J8QA 1JHVA 1PG2A 1AB6A 4OQEA 2GBIA 4YRDA 1LF5A 1R3UA 2JLBA 1KI6B 1Z6ZA 3C3PA 3TFWA 3OG9A 4GMFA 1H1TA 2AFHE 1ONSA 2BGIA 2LPMA 3PGXA 4YEDA 3AM5A 5EP3A 8LDHA 3JWEA 4E08A 2FTKE 2ICAA 1ZFNA 2B9VA 2O2CA 3DOUA 1K8YB 3PDJA 2JD2A 2PG3A 1L3IA 3C3DA 4GOND 3L04A 1E3JA 3IT2A 2C9ZA 3ABOB 5FOUA 1YB4A 2F8MA 1ZJYA 3BD6A 3NC4A 2QAGC 5IVDA 3TMAA 4DCOA 4JT2A 4F9FA 2YOGA 2FPPB 2G5CA 2PHZA 3A6FA 1CEQA 3WYGA 1NF3A 1ST2A 1TMGE 3Q3GE 1GV0A 4BJ6A 1Z7YA 2YYSA 2Q1XA 4B74A 2HJSA 1XTZA 3F6PA 4LOJA 5B7GA 4N12A 4EZIA 3SR0A 2B92A 3KG2A 2XGJA 4HFMA 5EE9A 1NMQA 3LLUA 5LXTF 2MHCA 2NTVA 2QEQA 4PGGA 1ZEMA 2WLTA 3F9IA 2UU9B 4TZ6A 1GT91 3JASB 2PX6A 1DI0A 3HXKA 3GFOA 3L93A 1K5DA 3N6XA 3RC9A 2X5KO 3QE3A 1TI7A 1PL7A 2XTMA 3ESRA 5ERXA 3SC2B 1K7CA 1LLFA 1YAHA 4B3RB 1RQNA 4J3JA 1BG6A 1G5RA 4PG7A 4TL7A 3MN1A 5IDVA 4E5MA 2H8GA 2QU8A 3LVBA 1R0BA 4JUIA 2X5JO 3KIPA 3WNBA 3RJTA 4AXBA 3K0BA 2V74B 3UW3A 1L5VA 1IWBB 1WKVA 1Y3FE 1MC5A 1G21B 2YHBA 3H05A 3LDGA 5CLQA 3S2GA 2PLNA 2YRFA 4KNVA 5CBKA 2QRMA 3GLFB 2V45A 2IE8A 4QM7A 5KHOC 5E1OA 4NE7A 3PSHA 2FY8A 4YGYA 4LJ9A 1UKBA 721PA 3T6KA 5K6AA 2CL7X 5NULA 3PWSA 4EVQA 1CEYA 1D09A 3P20A 5AW3A 4MRRA 2NAFA 3ST7A 3DBRA 3JQBC 4CLRB 3LQ2A 2CT8A 4FOTA 3KQLA 1BXZA 1KYXA 2D5CA 5KI6A 1O87A 3LUGA 1E3IA 1WNFA 3WZLA 3KSBC 3EUFA 3GLQA 2V0GA 1NRWA 1XQYA 2BWJA 3DZBA 3CPJB 5TSDA 2XCTB 3OFJA 1B93A 2IEAA 4HQOA 2GTPA 2JB9A 1T9HA 1Q7BA 2WZBA 3PPWA 4OLFA 1QVWA 4RD0A 2F4NA 2QVZX 3G79A 4KH1A 2J3LA 5EZ6B 5FJIA 3RS8A 1TYEB 3KKMA 4O1HA