4HAXA

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1(k579a)-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
200
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
molecule tags Protein transport/antibiotic
source organism Saccharomyces cerevisiae
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
total genus 58
structure length 200
sequence length 209
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4haxA00
2KSQA 3VR6A 4IXMA 3W3AA 2P3SA 2ODBA 5J5CA 4G5RA 4MYTA 4BFTA 1II0A 4TN1A 1Z6YA 5FUWA 5GJVC 5L3RA 3SE0A 2N42A 2IUSA 2OBLA 4PPFA 3QIAA 3UMRA 1COWA 4L15A 4CW7A 4FINA 2CXXA 3VMFA 1KYIA 3TUIC 3QXHA 2ZS9A 5KNDA 4P32A 1JXMA 2PH1A 2FX3A 1TEVA 3ONWA 1KO5A 4XD7A 2EVWX 1R7RA 3CF6R 1MH1A 1ZNXA 2A30A 2GBLA 3HR8A 4NH0A 4LYJA 4OI2A 1JALA 1G291 1CJUC 1P2SA 1K5DA 3CUEF 4QBHA 3GLGA 2QN6A 5LPNA 1OB5A 1G3QA 1CRQA 1FOEB 4URZR 4BLTA 4TYNA 2XOKD 3CPJB 3K9NA 5CK5A 2JLQA 4IRUB 1K6MA 4TQUS 3IIKA 2XTZA 2KWIA 2GF0A 3QF4A 2CHGA 1EX7A 1R10A 1R5OA 3KTAB 4JLJA 3RS0A 1TQ6A 1N6IA 4OQFA 1CR1A 5CJPA 4R71A 2DWQA 3F8TA 2G88A 3QE0A 1F5NA 3Q5DA 2IHYA 3QI2A 1AGPA 4O25A 5KTYA 5LBIA 2XEXA 4MRVA 3SJBA 2BKEA 3K1JA 2WPDA 3NIBA 1Z2CA 2IYUA 3A1UA 4IEEA 2A7QA 1RYFA 4O0MA 1G20E 1Z6GA 3TQCA 2KE5A 1KTVA 3QKRB 4KBGA 2GCOA 5AUPB 1ZUNB 4AG5A 1LB1B 1BMFD 4P3YA 3GD7A 2C9CA 3ZQ6A 1XNJA 1BKDR 2QEQA 3GFPA 4OHWA 5BN5A 2C03A 2ZIAA 1JAIA 2EFGA 2VEDA 5JFGA 2AR7A 3EA5A 4E07A 3DMNA 4QM7A 3AEZA 4P33A 1W7AA 4URUR 4B74A 2Q0HA 1YRBA 1RPZA 1ZM2A 3GFTA 4KLZA 3THXB 1OPXA 3NDBB 5TV2A 1DAIA 3KQLA 3SJAA 5K8UA 2IEYA 4B3CA 4U5XA 5ANRB 5KSOA 2ZAOA 4V0LA 5DE3A 4WOPA 3RRYA 3NEYA 1OXTA 4V0KA 1TUIA 3LVRE 1XEXB 3PG5A 1E2IA 1DTSA 1WF3A 2IYTA 5L3QA 1L4YA 2GCOB 121PA 2PT5A 2HXSA 1E94E 3AGPA 4HZUB 4B3DA 4MQBA 1D2EA 3LX8A 4WBSA 3BB1A 2OCAA 4BFSA 1QBKC 3BE4A 4PAOA 2RHMA 1C1YA 1GAJA 2YINC 4LYHA 4BRWA 1NY5A 1AZSC 2ZRGA 2NZJA 4RD6A 1UFQA 2IS6A 2BEKA 2IXEA 3CX7A 1NVVQ 2AWOA 2XITA 1E98A 2JASA 1IN7A 2ZRJA 5BXQC 5JCZA 1BOFA 1E9SA 3UWOA 2ZSBA 1P62B 4MGYR 3GP8A 2YKGA 1RC8A 3DMDA 1R2QA 4IXNA 5KYKA 1I4DD 3BJIC 3W34A 1W48A 4ERNA 3D7MA 3HU3A 1S2MA 2OG2A 2QA5A 2XOKA 4IHQA 5FOSA 2QE7D 1F60A 1E0AA 3B60A 5CLLA 2QBYB 1RRPA 4QGFA 2R6GA 4YMSA 2ODEA 5JS7A 1W0JD 1EFCA 2C78A 3OEHA 4KSCA 3HU1A 1DO0A 2GBLC 2X2EA 2NMVA 1OIWA 2OBNA 3B1YA 3KUCA 3LXXA 5E4FA 3OIUA 4DLXA 2HF8A 3QVVA 2V1UA 4HUQB 2A5JA 2RGDA 4HAXA 4EQ6A 4EFLA 1JR3D 1XCMA 4TTRA 1Z8FA 3QQ5A 1T3HA 1UBFA 4PSVA 1E3MA 2NOAA 4KFUA 3V00A 1W0KA 1Q3TA 3BAFA 4TL9A 4ZDKA 1Z0DA 2QMOA 5G53C 1P9RA 1GFIA 3JZAA 1DARA 4IVPA 3L82B 4DIEA 1NLYA 2OCBA 4I1SA 2QL6A 1W4AA 1AS2A 1TX4B 3SJCA 1ZC3A 2WZQA 4XVRA 3HU2A 4AKGA 3B9QA 4NTZA 5LDDC 4HAWA 4ESHA 5G3ZA 1JR3E 2SHKA 4MRNA 5FUYA 4NPHA 2IT1A 2GTPA 2F1RA 2O8BB 3MG9A 3U60B 1XX6A 3SOPA 1KI6A 1E2JA 2IS2A 4PPGA 1U94A 3AVXA 1NBMA 2JJ2D 4B2PA 1OXUA 1C4OA 2IWHA 1L2TA 4LJ5A 2NGRA 3NBYC 3L2OB 2PX3A 3QXXA 1J8YF 3DEFA 4B3FX 4C3ZA 3SQWA 4RCYA 4FXPA 4TMWA 1JXOA 3V4FA 4E09A 3UXMA 2X1VA 2XX3A 3DZDA 1XEWY 1ZAKA 2BBWA 4NKRA 4QNMA 3GLFE 3EZFA 2QMEA 5JJLA 1Q57A 1DAEA 4TWZA 5CIWA 3EIQA 4HLDA 3K70D 4Q7LA 4NDZA 5D3MB 1E9RA 4GMDA 3DL0A 4DCNA 1KO8A 1G4AE 1I4TD 2J0SA 3CRW1 1OE0A 2ZRFA 5D3MA 4DC9A 3VR4A 1SVKA 1U90A 3NG1A 3GPLA 4XTCS 2FOLA 1H8HA 4IOKA 4A36A 4LV5B 1EGAA 2A5FA 2AL7A 2QP9X 1FP6A 1P7CA 4NP6A 3X1DA 1NNEA 1ZNYA 3GJ6A 5JEDA 4MUAA 4O3MA 2NO7A 1XJ0A 4DDWA 3MWKA 4IOLA 2JLXA 1XPUA 4IOMA 1GUAA 4HDCA 1HUQA 1EESA 3L0PA 4LBYA 5FL7D 4DXAA 1RVDA 1GTVA 4V0NA 1G4UR 4DLWA 2XB2A 3CBQA 1T3SA 3KKMA 3CB4A 1E2HA 2F9MA 1YHNA 1KK1A 4A82A 4BEBA 2ZQ5A 4BRUA 1OYWA 3A4NA 3MCAA 2QPOA 2FG5A 2H92A 2B7CA 1MOZA 2ZJZA 4F4IA 1IOZA 1E2KA 1JPNA 2CEAA 5DNYB 2HYDA 2R8RA 2G3YA 3O8CA 3KB2A 3QKUA 1ZNWA 3C41J 4GI7A 1IN5A 1FP7A 2YYZA 1Z47A 1J2JA 4C7OB 2CNWD 4LJ4A 1F2TA 2MSCB 4V0MA 4AY2A 5DYGA 4AYTA 1OHHA 1N0UA 2CK3A 3K09C 2ZTSA 3M0EA 1HURA 4KV9A 1MABA 4XIGS 3SZRA 4MKHA 2BBOA 1G6HA 4Q4JA 5FR2A 1Q21A 1FQKA 1Y3AA 2GJ8A 4FI3C 2ZI6A 3AP3A 2V6JA 4RD2A 2OAP1 5FPHA 1VECA 2W0MA 5FBWB 1XTIA 5SZHB 3ZS9A 1Z63A 4TL6A 2JJ1A 5G3YA 4NCJA 4BZQA 2ASEA 4HAYA 4P0TA 1KSGA 4DCUA 1OT3A 1T8UA 2XNSA 4JLPA 3TRFA 2WWIA 1G8GA 2UZ3A 5AJXA 5EP4A 1G17A 4KYIB 1QG2A 1G3IA 4LJ7A 1FMJA 3ZVNA 3KDSE 3QPVA 5JBQA 5L3SA 3IUYA 4Q1DA 1Z0JA 3W90A 1IN4A 3BH6A 4QOSA 3GLGB 4G5SA 4OQLA 3U44A 4QBIA 4Q7MB 1X1SA 2ZR0A 2FGJA 3AVTA 3E1SA 2VH5R 3VTKA 4URYR 4Q4JB 3E70C 3ZJYA 4PHTA 3ND8A 3F5FA 4EFNA 1J8MF 3U44B 3L0SA 2D2FA 5KNCA 1CU1A 1IJFA 2QPAA 4GOXA 1TL7C 4KSBA 4G5GA 4IDQA 4LPKA 4CEHB 2JLZA 3S1AB 3SHFA 4D4KA 3P1JA 4GBMA 4OK3A 4NHOA 1HA3A 2YWHA 5F98A 2VTKA 4TMKA 1GDDA 2L0XA 2REXB 2CVFA 1NVUQ 2CL6X 1DADA 4RZXA 3RC3A 4LC1A 4DDTA 1GKIA 4B2LA 4FMCB 3UANA 4QC2A 2WV9A 3QPUA 1HE1C 1I2DA 4CGZA 3KFXA 3AVUA 3TK1A 1T6NA 4DLZA 2CL0X 1ZIPA 5A0FA 6Q21A 3SI7A 2IS4A 3K70C 2LWIA 3EC1A 4GNKA 1UDWA 1JEDA 1ZP6A 3PVSA 1IY1A 4LHZA 3A6PC 4M1WA 4EQ6B 1UBCA 4TT3A 3UMSA 1DAGA 2HF9A 2VP5A 3CX8A 3CRQA 1R8QA 1TU3A 1RKBA 2O8DA 1AS3A 2C77A 3PITA 1YE8A 5L3VA 3EG5A 2AK3A 4M9SA 1Q22A 5BN4A 3REGA 5JRJA 1LF5A 2CLDX 5AJZA 3AKDA 1M7BA 4FMDB 3TMKA 2CHVA 3I62A 2CCJA 2YWFA 3VR1A 3C14C 4MDFA 3W6NA 3G0HA 3A1TA 3CNLA 1VIAA 2QT1A 3HPRA 2AD5A 4B48A 2OO7A 2FPKA 1M6NA 4FCTA 4Q4HA 1YZTA 1QHSA 3MWJA 5UKDA 1E0JA 3OE7A 1KI9A 3CR7A 1R0WA 1IQPA 4UJ5A 4ZPXA 2Q9CA 3SEAA 3GFOA 1XPRA 1QHGA 4G3XA 2R9VA 4JVLA 1XTRA 1SULA 3A37A 4PO8A 3T1TA 3C5CA 4PSKA 1U2RA 3P4XA 4DLYA 2K5UA 5BYKA 4ZI3A 4A0RA 1U0HC 3NHAA 2O8CB 3EPJA 1AZTA 3AVOA 4QJ4A 5J4VA 1SXJA 4OKSA 5IF9A 3D3QA 4G1UC 1ZC4A 1CKEA 1W47A 3MGCA 1PUJA 2B8TA 1XMSA 2RGBA 1KI7A 1UM8A 1ZM4A 1KK0A 2YOGA 2Q21A 2RGGA 2AXNA 1Z08A 5AJVB 1KNQA 1GSIA 1Q0UA 3O47A 3VKWA 2CJWA 2R6AA 4C0HA 3U3OA 3DHWC 1G21E 4B3XA 1IN6A 4LBWA 2Q3FA 1QVAA 2RKOA 1R0XA 1BYUA 4JS0A 4BFZA 1KI1A 1N0VC 2FEOA 2ZRBA 1OXXK 4GOJA 2YV5A 1R4AA 2QPTA 1KKLA 2YNMA 3GLHE 3GMTA 1AM4D 1EX6A 1Z5ZA 3U6KA 4HLQB 3RDPA 5FTNA 3TE6A 2BJVA 1G5RA 5C1BA 3B78A 5J4LA 2RMKA 1ZRHA 1XZQA 1SZPA 4BLPA 1G8FA 3UG7A 1N6OA 4Q00A 5E3HA 1P2UA 4E5UA 3UATA 4OI4A 2O8FA 3AF2A 3BH7A 3PXGA 4D26A 2HT1A 3KTAA 3LQQA 5F3WB 4BFXA 4L9SA 2KBEA 5E95A 3N2EA 4LPSA 4Z8YA 3NHBA 2BV3A 3EA0A 4XSGA 1XJQA 5DI9A 4LUCA 4M53A 4V03A 5HKKA 5JS8A 1GZSA 1W4RA 3FHTA 2CLSA 4NYIQ 1AJEA 4YDSA 1TUEA 4AK9A 1Q12A 2WIBA 3NDPA 3WYAA 4PC1A 4B47A 2IX3A 8OHMA 1YQTA 2VP9A 4FWTA 5E7MA 3WMEA 3F3YA 4NYMR 1Z28A 1D2NA 4B32A 5A4JA 3GJ3A 1AN0A 4KJZA 3ADKA 1LNZA 4TLBA 4KCGA 4C4PA 2IF0A 1JQJC 4A2PA 4D6PA 2NO0A 1XEXA 2A78A 1G3RA 4TL8A 2ZSAA 1MO5A 4PAQA 4OYHA 3QNUA 2A5GA 1M8PA 3LQRA 4CT4B 3H1TA 4K8OA 2QMUA 1D8TA 1GKUB 1DE0A 1S96A 4HZIA 2ZM5A 4DZZA 3T34A 2F7SA 3EPLA 2BMJA 3FMFA 2QTHA 5DN6D 2D7CA 4KFTA 1V5WA 3QOFA 1IM2A 1E1RD 1PZNA 4YMUA 3ADBA 2J0UB 4ZCMA 4LCBA 2OFXA 3L43A 4A0HA 3IIJA 5IHPA 2C99A 4PC3A 3TR0A 2XXAB 1RZ3A 3CPHA 5JLJA 5AK0A 1CXZA 3GLHA 4BFVA 1G8PA 3ZLJA 5HE9A 1AQUA 2O0KA 1N5LA 1W36D 4KODA 3NBZC 3EX7C 3DPUA 5TXGA 3W5JA 2QRZA 4B75A 4B44A 4HAZA 2ZYWX 5DN6A 2DR3A 2QAJA 4HSEA 4OQMA 1KNXA 1R8SA 4NCIA 4NYJQ 2Q3MA 2JLYA 1IBRA 5FBLB 2O5VA 5K8TA 2HYIC 2WBLC 1UDXA 2CLCX 5FUXA 2DPXA 3BD9A 4D2IA 1YKSA 1OW3B 4EPYA 3VR3A 4EFMA 2GJ9A 3IBGA 1E9DA 2W83A 5DGXA 3EASA 4Q9JA 2WJVA 3V9PA 3RYTC 3TVTA 5FOTA 4A8JC 1LS6A 4C30A 1W2GA 4H1VA 4LK2A 4B6FA 1FW6A 1IXSB 3N2IA 2ZEJA 3EW9A 2CBZA 1A5TA 1KSFX 1TEXA 4EPWA 1AQYA 4RJLA 2FMXA 3TUZC 5FTKA 3X1ZA 3I8SA 4LZZA 5BWMA 4BFWA 4W5WA 1FNMA 4QXAA 1K8RA 3AB3A 3CH5A 5DIFA 1QRAA 3THOA 2HXYA 1RRCA 5JI3E 4CEHA 5HKKD 2WWYA 4OBEA 2VHQA 3G5UA 5FH9A 2YHSA 1OYYA 3FDIA 4YXWD 2ANBA 1YZNA 3OEEA 1LS1A 4LHYA 1CR2A 1YR8A 4HB3A 2ZU0C 1CIPA 3BIFA 2IS1A 2WJYA 2B7BA 2ZS8A 1WQ1R 2C95A 2G0TA 2ZRIA 3QSYA 621PA 2GK7A 1NIJA 4M2LA 1IHUA 4YDHB 4Q9LA 1GM5A 4MRRA 3WHLA 1DAFA 2OM2A 4OK6A 5FL7A 5J4YA 1OB2A 1AIPA 1P4SA 3C5HA 5BYJA 1M2OB 2ZVQX 5CM9C 1XD8A 1KDTA 3A4MA 4G5OA 5GJWC 2XSZD 3R7WB 1H65A 1TADA 2EYQA 1D6JA 3Q9LA 3AVYA 3DO6A 4BLRA 4NYJR 1BH2A 4DIDA 4YC7A 3EC2A 2FA9A 2ONJA 1E2QA 4JT4A 5FPSA 2QU8A 4JVSB 1PLJA 5FPKA 2V6IA 2ZPTX 2WSMA 3BK7A 2X77A 5HPYB 1ESMA 2IF2A 3P27A 2QSZA 1NVWQ 5LD2B 2VP2A 1PLLA 2EU8A 4IDPA 1UF9A 2V54A 1NN5A 4BUJA 4DDVA 3T1VA 5FI0B 2RB4A 2R6DA 5E7IA 4DCTA 5C46F 3K70B 1HEIA 2RCNA 1GITA 3ZIAD 3ZYCA 3RWOA 3U61B 1FL9A 1QG4A 3BFVA 3TJZA 4JBWA 4OHVA 3H2YA 1CEEA 1E0SA 1RIFA 1KJWA 5EJEA 3PFIA 2XZOA 5FTMA 1S8FA 4TMTA 4EPRA 4PR0A 1HV8A 3ZDQA 1SKQA 3O8BA 3E2IA 3PENA 1ZD9A 5FPTA 1FQJA 2WJIA 2PT7A 1X1RA 3AF4A 1SGWA 2PL3A 3DOFA 2FZLA 3TKLA 1NMYA 4Q1AA 5SZKB 3PJRA 1CF4A 1UBGA 1GL7A 3NKVA 4TZ6A 4MRPA 1MV5A 3BS4A 2XZPA 1ZM9A 3WRXC 3DOEA 2R62A 4MKIA 4ACBA 1UEIA 4KITB 2QY9A 3H86A 4AIIA 4D82A 5EZ5A 1VG1A 3QKTA 3KQNA 3TLXA 5EE1A 1SQ5A 1M7HA 4DLTA 1QHYA 3AVPA 1OFHA 2AHOA 4LOAA 4M1MA 1T5LA 1VG0B 1HE8B 1NMXA 1UKEA 1N5KA 1DAMA 4NCNA 4DUGA 1VCMA 2O8EA 4YMWA 4DCVA 521PA 2A5DA 1BO6A 3T1QA 3PEVA 4L4UA 4PHGA 4WXPA 2ZE5A 3TR5A 3MWYW 4BLSA 5K8IA 1UADA 1WXQA 3MJHA 1OH5A 3U3MA 3H4MA 3LBIA 3M4YA 4L16A 2GZAA 1UAAA 4YMTA 1RFLA 3W8RA 1LF0A 2FSHA 3R8FA 3FKSA 1EFRD 2XJ9A 3B82A 3ADCA 2B21A 2G9NA 2WSSA 1D5CA 4QRHA 3P32A 5CJ2A 1S1MA 4ZKEA 2O52A 4JIMA 2ERXA 4PO1A 3RS2A 4BZPA 1IY0A 2IYXA 4G0NA 1PVOA 1L8QA 1Z6AA 4YMVA 3TSOA 5L8VA 1N25A 1R6BX 4Q01A 4BFYA 1IXZA 1WRBA 5B64A 2Z43A 3T06B 3A1WA 3IO5A 1U8YA 1MABB 2FSGA 2I1QA 3B1ZA 4JSTA 4GP6A 4US0R 3U2QA 1OLOA 3KJGA 4DUGD 4DBLC 3ASZA 4QG7A 3U7HB 3ICQB 3MAAC 3VNUA 1N6RA 3U7GA 4F4CA 2CMKA 3FHOA 4RZ2A 4JLAA 3WY9A 3REFA 1XD2A 2RGEA 1JR6A 3A58B 2FFAA 2WJGA 1R0YA 1OHHD 2C9YA 2CK3D 2NG1A 2Z0MA 4S35A 2DWOA 1ZCBA 3TUJC 4F93B 3WXMA 5JJKA 5FOUA 2XB4A 3BGWA 1DVRA 1S9DA 3IEVA 2RGXA 2QUZA 4UJ3A 4K81B 3T15A 4UNRA 4C2TA 4TYYA 3HDTA 1G8HA 2GDJA 2PLFA 4QHSA 2F43A 1CJTC 1VYUA 4M1TA 2ATXA 4CDGA 3DZ8A 5J40A 5AUNB 4CZ2A 1GL6A 4WZAE 1DS6A 1ZD1A 1E9CA 1XJCA 2ZE8A 4W7SA 4HLCA 4C0LA 1XEFA 4Q02A 1Z2AA 4R2HA 1KI8A 1QVRA 2W0SA 4JLDA 3ZIAA 3X2SA 4NCKA 1ZCAA 3NVAA 3GLFA 3VKGA 5JHHB 4I1OA 2A5YB 4B33A 3ZGXA 2JLSA 4DSTA 4KAXA 2JA1A 3BFXA 1NSTA 3FTQA 1Q3HA 1XB2A 2OLJA 4D4JA 4Z1MD 1P61B 2ZANA 3HYTA 4FCWA 4M1KA 4R9UC 4V02A 3FFBA 3OEED 1GL9B 4JL5A 1M74A 1W4CA 2GRJA 2KBFA 4L8GA 3RAPR 4GL2A 4TSFA 1TPZA 4QKQA 1DOAA 2V8OA 4Q48A 4CRWB 1E2MA 2IEZA 4YQFA 2O8FB 2FEMA 4A1FA 4HDOB 2AKAB 3TW4A 2P2LA 3RWMB 4BGDA 2MSEB 1FTNA 2PEYA 3ZS8A 2JLVA 4DLSA 2BBTA 1KKMA 4JVNA 4U7DA 4AYXA 2CVHA 3MD0A 1OV4A 3KXKA 1VMAA 1U81A 1II8B 2Z6VA 3RS7A 1Z07A 4M4SA 2JJ8A 4GRAA 1KY2A 1QHNA 1VTKA 2F1IA 3K0SA 3L8YA 3GLHB 1ZYUA 4FIDA 5B57C 5C2JB 2FSFA 1CJKC 3AM1A 3ICEA 3WHKA 2OSBA 4WW0A 3BERA 3QXSA 4POAA 5P21A 1W49A 1PUIA 4LSGA 2FFBA 5DISB 3NC1C 5AJWA 1NY6A 4WZ6A 5DYIA 4YXWA 2JIZD 1P9WA 2ZUBA 1S0UA 4F7WA 3TAHA 3P20A 2VHTA 1MO6A 1E99A 3FHCB 5FUVA 3EPKA 1OFTA 2ZYUX 4AURA 4NZYA 2IYVA 2UVQA 5F2EA 4ZO4A 3KKNA 2RGAA 5EP1A 1DPFA 4IW3B 2B92A 2FWRA 3ZVRA 1LY1A 1T8TA 2ONKA 2IYSA 2C8VA 2H1LA 4JBYA 3OF5A 2ZETA 3QBTA 4URVR 1P9NA 2BVNA 3W9YA 3KQHA 2QTVB 1PV4A 3Q7QA 2QM7A 4A8JA 4RD4A 1XRJA 4PQYA 4ZIRA 1OKKD 1DG3A 4D80A 4LHXA 1ZM7A 3Q7PA 3I92A 1G64A 1RRFA 1SXJE 1YZGA 2R6FA 3CW2A 4K46A 4Z8XA 2P6RA 4RD1A 5H70A 1TAGA 4D0GA 3WBKA 3NH6A 3OFND 3CRMA 3KKOA 2Q6TA 3SYLA 1RJ9A 2AWNA 3M6AA 1W0JA 3K9LA 1TF2A 4QBFA 4LJYA 1P72A 2FFQA 5BQ5A 2IXFA 4ZV4A 1W2HA 1U0LA 1X3SA 1JBKA 2ZJ2A 5FBQB 5JMTA 5M04A 1EFRA 1GNQA 4TYQA 2VRWA 1CJMA 5EE9A 4IVQA 4TL7A 2Z5FA 5EE5B 1SXJD 3EPHA 2D4HA 2HCBA 5H8WA 5GJCA 1P60A 3GQBA 1R5BA 2PCJA 5KSZA 3IGFA 1YR9A 2OFWA 3MRSA 2OXCA 1P2VA 4JL6A 1II9A 4BECA 5TVKA 1LTQA 5FOWA 1E1RA 2Z83A 1ZNZA 2JATA 3Q3JB 1XXHA 3EWAA 4KXFB 2IHBA 2ZI5A 3GJ4A 4TZ0A 2XXAA 1ZJ6A 2V1XA 2WWFA 3SYNA 3R9IA 5KUTA 3AH8A 2BCJQ 1FUKA 3FVQA 1NLFA 4FD2A 1G18A 4QJ3A 3TBKA 4NL4H 3LWNA 1G7CA 4AD8A 3QXCA 2OHFA 4RY2A 1G19A 2AK2A 4JKYA 1G41A 3AF3A 3R8CA 5B58C 2V3CC 3K0EA 2CE7A 1XCPA 4QGGA 1U0JA 2QORA 3MSXA 3BH0A 1IJEA 5KPDA 1N2CE 2QE7A 1T9HA 1P73A 2J45A 1ZU4A 4TMXA 3SC3A 3V4RA 2BC9A 2ZRHA 4ZKDA 2F6RA 4PHFA 1DG1G 2NO6A 3BORA 2C5LA 4DSOA 1SVIA 3SN6A 3EZ6A 3OIVA 4JYCA 5J4KA 3SS8A 1K5GA 3AKCA 2IWRA 3ZZTA 1UKZA 2FGKA 1JEEA 2MSDB 5DHFA 3RHFA 2Q9AA 3B7GA 4LBZA 2F3TA 2AFIE 4WAUA 3I61A 4S2EA 4II7A 3U4QB 4LJ8A 4I81A 1E2GA 3K53A 3QXJA 1XBTA 3OAAD 4PSAA 3X1YA 4DDUA 4AG6A 1B0UA 5AWFC 2H8KA 1TQ4A 5CIQA 1Y63A 2J7PA 3WNBA 3VQTA 5IRCD 2WPDD 2RAPA 1E2NA 2WWWA 2G6BA 2VP6A 2VBCA 1NBME 4JMPA 4RKFA 1XDBA 1NN1A 3FB4A 4WA7A 3FKQA 3RS4A 4QNRA 4M22A 1NJFA 2OILA 1T0JB 3U3JA 2NO9A 4B71A 4CT5A 2QP3A 4B2IA 1UEJA 1Z3IX 1JR3A 2F1HA 1WBDA 3WRYC 4BASA 2X8AA 2FV8A 4D0NA 4HLUA 1AKYA 2GKSA 3C7KA 3FE2A 3QBVA 4KI0A 1TQDA 2YVUA 3CRVA 1EFTA 2IK8A 3K0CC 2J59A 1F2TB 2LCFA 1XEWX 3LH5A 1SXJC 2GJSA 2PMKA 1M34E 2R65A 1ELOA 1NF3A 2FFHA 1Z6XA 3NWJA 1TQ2A 4HB2A 5H68A 4NONA 4IOJA 3GJ5A 1SKYB 2R6CA 2JIZA 4RFVA 3QPWA 1GRQA 3CNNA 2WOOA 1XF9A 4R2IA 4UKDA 4BLQA 5DI3B 3IEUA 2QM8A 5JEEA 3LBHA 3SBEA 3S1AA 2HUPA 1SHZA 4WXRA 3TW8B 3CNOA 4GP7A 2WTUA 2J7KA 3EZ2A 2YC4C 1OF1A 2GILA 1LW7A 2NIPA 1JPJA 3WMGA 1E4VA 2DY1A 3ASYA 1SKYE 3IO3A 1MRNA 5IT5A 2I1VB 2XNDA 3KKQA 2ZRAA 4N0EA 3IHWA 2ZRMA 1FX0B 2ZREA 1T3LA 4JSYA 4C0SA 4Q21A 2GK6A 2W6ID 2ZRDA 1TF5A 4O2RA 4XD7D 3K9GA 1Q1BA 4HUTA 3MLEA 1GOTA 3I32A 5FI1B 4LJAA 3W5IA 4EKDA 4TSFD 2PZFA 4Y0AA 3WNCA 1ONBA 3W6PA 3U5ZB 2VSOA 4Q47A 3IKJA 1XTJA 4QL3A 2G0NA 2OT3B 1YZKA 5HTKA 2DFNA 2VL7A 3K0FB 3H0KA 4GFDA 5KSPA 1TU4A 4KFRA 3OAAA 1KI4A 4A92A 4M9ZA 4MA4A 4AWXA 1A4RA 1WA5A 5JCPA 3I5YA 3W3ZB 3SFVA 2IBMA 3SJZA 2IYWA 4XWOA 4QJ5A 3NBXX 3GJ8A 4HZUA 1L4UA 5DLQC 1IN8A 3BB4A 4HDQB 2J0QA 1S3SA 2QQ0A 5FOXA 2WIAA 5C4MA 4A15A 2DFLA 4MGZR 1XZPA 2J1LA 3RABA 5EE3A 4XJXA 2D62A 5DI3A 1HH4A 1F2UB 3T35A 1ANKA 2QROA 1E2DA 1UKVY 2OZEA 4JLBA 4DSNA 3RRZA 1MRSA 2PLRA 4PC6A 1KSJA 4Q66C 1E1QD 4ON9A 1PJRA 3DVLA 1PLKA 2IYQA 3O8DA 3PUZA 1OH7A 1R0ZA 2ZYVX 3U3KA 5HE8A 3AUXA 3IQXA 5FFMA 4OQXA 4QGHA 2GWHA 3QUSA 3FOZA 3CONA 5KOYA 2ZRNA 3IBYA 1IY2A 1E9EA 4LV8B 1VHTA 5TARA 4DKXA 1XU4A 1CR0A 2CNWA 4X8MA 4OHYA 2J87A 3A4LA 5TDHA 1YJ5A 4IKEA 4B3BA 1Z06A 4RD0A 4BE7B 5KDOA 3AP1A 3B9PA 3HYRA 2OUKA 4IJMA 1U98A 3U7FB 3KL4A 4A6PA 4TLAA 4A6XA 3SBDA 4FMCF 5FTLA 2QGNA 4ILEA 1P2TA 3KQUA 1KHTA 3U7EB 2NZ8A 4KVGA 3EXAA 5KDDA 5EXXA 3UIEA 2B6HA 4L9WA 2B8WA 1Q44A 1N6KA 3CZQA 3ND9A 3RNLA 1DAKA 3SFZA 4Z51A 4LJ6A 2BOVA 2GAAA 4BQSA 1L7VC 2DWPA 4JJZA 4MRSA 2ZRKA 3EAQA 4M0LA 4HB4A 3GEIA 4M8NE 1GRRA 5J4HA 1MO3A 3RC8A 3QF7A 4P4TA 4ZIRB 2ZI3A 5K8LA 1M1YE 1N6LA 3CR8A 4J0QA 2OLKA 4O2LA 3RANA 2RGCA 1FX0A 1UPTA 1UBEA 2WKPA 4FWIB 1SVWA 3RSLA 4CYMA 1YR6A 1E9FA 2RH5A 4JLMA 3LBNA 3R9WA 2G83A 1OH6A 1KDRA 3KJHA 4I99A 4AKIA 4DWJA 2AKYA 3LD9A 4U02A 2H16A 3RRMA 2H7VA 4I1UA 2I4IA 2ZRLA 3HWSA 2QQEA 3K0AB 1HT1E 2PCLA 1N6NA 3TIFA 4EPXA 1KAGA 2G1KA 1I2MA 4F4JA 4PXAA 4PQRA 2BHRA 2WMOB 4RFSB 3DM9B 4YLGA 1F48A 1E1QA 1NN3A 1RE0A 1KSHA 1T91A 4Q19A 5KSYA 3KXLA 821PA 3J81k 1VYVA 1F2UA 2QAGA 2W00A 4P4UA 3L0IB 4TT3D 2YOHA 3MFYA 4C9BA 1KMHA 1EFUA 1N5JA 4LGMA 4PANA 1T4GA 4HATA 3GCGA 1W4BA 3OZXA 3OE7D 2AFHE 5CK4A 4B76A 2REOA 3FFAA 2EWVA 2ZS7A 4HUQA 2OE2A 3QKRA 5CYOA 1DBSA 2BIFA 4XTRA 3AGQA 3M1IA 1TTTA 3DKVA 3EZ7A 3ZVMA 3MMPA 3VFDA 2QZ4A 2GXAA 1X8JA 1SVSA 3AVVA 1NN0A 2X19A 5H1YA 2C98A 4NMMA 2D74A 4JLKA 5HR5A 2ORWA 1E32A 4PPNA 1Q1ZA 4V0OA 4UQOA 4NE2A 4DB2A 2IYZA 3VX4A 4CIDA 4IDOA 3UPUA 1O3YA 2FNAA 3FMPB 4A4DA 3RS3A 2QNRA 2GESA 2XTNA 1N3BA 5DSZA 1E9BA 3NXSA 2ORVA 3N70A 1CR4A 2NTYC 5AUQA 3FMOB 3LNCA 3PR1A 1X86B 4P31A 2YWGA 5C18A 4LC0A 1VG9B 3P26A 3U4QA 1MO4A 4KHZA 4A8JB 3A36A 1J99A 1I4LD 3VR5A 3PEYA 1AGRA 4JL8A 1FFHA 1KJZA 3B6EA 4LY6A 4JYBA 4PX9A 1Z0AA 3I5XA 3LVQE 3QVUA 1WBBA 1BIFA 2JDID 2BM0A 3W6OA 2FPMA 4GPTA 2F1JA 2GETA 3TVDA 3PUXA 3EZ9A 5FBVB 4CF7A 2DB3A 1X8LA 2WVJA 2J41A 2BJWA 1H8HD 3ZZ0A 2PZGA 2JLUA 3K8YA 2QAGB 2VIIA 2Z4RA 3LW7A 4IFBA 3VAAA 2ZRPA 3A1VA 1G5TA 4B43A 3VNVA 1P5ZB 4RCZA 4X8HA 4GZLA 2ZJAA 2ZXUA 1EFHA 2KJQA 1XTSA 1VCOA 4Q1EA 2P65A 2GNOA 4KLNA 1E2PA 5E7JA 2WJJA 2EQBA 2V4ZA 2Z4SA 4QGAA 4XVQA 3THYB 4OI0A 2H18A 2P0EA 3LAWA 5EUQB 5TB5A 5IK2D 1YRAA 4EUNA 2ORIA 4PPQA 1G9XA 3I4LA 4LYFA 5JWOA 3LA6A 4P4SA 1UKYA 1H8ED 3B8HA 2VPPA 1E4YA 1XMIA 2GJKA 4ZCLA 4BFUA 1CTQA 2AN9A 2RGNC 3HR7A 5GVRA 5HCNA 3AF1A 1WMSA 3OESA 4ESVA 1E79A 4ARZB 5FBRB 4WZBE 4MKFA 221PA 4MGIR 5EP3A 2WKQA 3TSWA 3C16C 4Y0VA 4DLUA 5JECA 2GXSA 2E1RA 1GRNA 4LV6A 2XZLA 1KO4A 5TY0A 2J46A 2EFEB 2WSSD 2C9OA 3ECCA 3KZ1E 2WWHA 3ZH9B 4A9AA 2DCUA 1ZM3A 3HJNA 2BMEA 2BDTA 2QAGC 1KMQA 2IYLD 2ZUCA 4TTQA 3B85A 3LXRA 1G7TA 3PQCA 2WWGA 3FWYA 2I3BA 4W5JA 2D7DA 4PTLA 3PUVA 1AA9A 1OSNA 4TLCA 1VIYA 4UNNA 2FPLA 3VHXA 1MKYA 3RLFA 4C0AC 4XWKA 5GJBA 4KU4A 4JT2A 1J70A 2VLIA 1GWNA 2FF7A 2ZE6A 1SVMA 2O8EB 1AKEA 2VHCA 4A2QA 1JQLB 2VP0A 4PZYA 4Q18A 4DRZA 2QG6A 4IEIA 1HT2E 4HYYA 4QBGB 4EJSC 4W5HA 3L0OA 4D4MA 3IDQA 2JEOA 2PEZA 3UKDA 4DB4A 1EWQA 2EW1A 1W36C 3BFKA 2JLRA 2HT6A 3LLMA 3CM0A 3JVVA 2F43B 1G1MA 2OCYC 4RZ3A 3I3SR 2ZVPX 2PMDA 1YU9A 2IYYA 1G6OA 1OXSC 4PC7A 3CX6A 3I1FA 3ADDA 1IXRC 4LWZA 4TMZA 2VQSA 4C2UA 2ZI7A 1CULC 3Q5EA 2V7QA 1Z0IA 3ZD7A 2HLDA 4CEJA 1S1CA 2ODNA 3PIRA 4HI0E 5A5GA 2WAYA 2W2XA 4JJKA 2VSFA 3NH9A 1QHHA 2JJ2A 1E2LA 1NBMD 2OXRA 1SHKA 2FJUA 3O8RA 1ZVQA 3PUWA 3T5GA 3LFUA 2GA8A 4N0DA 5G40A 1ESNA 1XXHB 4KYUA 3MWLA 3QEOA 4KFSA 2CCGA 1KI3A 2HLDD 2JLWA 2VO1A 4RZUA 4AKEA 2V7QD 3MUFA 3CRRA 2GHIA 1KK2A 2IC5A 4UXJA 4NBSA 3A8TA 4HLUC 4F91B 3PUYA 1QZXA 1E0KA 1W0KD 3NC0C 3K0FA 3NTUA 1XXHE 1F6BA 4EPVA 4R98A 2WWXA 3ZZUA 3KFVA 4LBVA 3T5DA 2CDNA 2WOJA 4BZXA 3TGPA 3C8UA 4FCVA 1QHHB 4OL0A 4EJSB 3UMFA 3D31A 3EIHA 4PZZA 3QG5A 2RGNA 1A82A 2ZROA 1H8EA 2WMNB 3DM5A 4GSYA 4E03A 2MMGA 2WKRA 3KB1A 4D25A 2BMDA 4Q9HA 3C15C 4MYUA 4PZLA 2GF9A 5L3QB 2REBA 4JLOA 1CS4C 1OIVA 4LYAA 1SXJB 3QKSB 4DT1B 2EFHB 2NQ2C 2ZSDA 3AVQA 2D06A 2VYFA 1JJVA 2OESA 2VA8A 3PEWA 1J7KA 2O0JA 1ODFA 2YC2C 4NYMQ 3A1SA 1X8KA 2R2AA 5DH9A 1W44A 3THWA 2XGJA 1VCNA 1JB1A 1JI0A 3B13B 1VPLA 1JECA 3IILA 4B3GA 1HTWA 1ZINA 4XOIA 2GCNA 1N0WA 3SR0A 4TMVA 2V55B 2AX4A 1OH8A 2JAQA 4Q9IA 1HYQA 4IDNA 2CCKA 2QSYA 1ZW6A 2IA5A 1XD2B 1BS1A 4JKIA 4JVMA 1O87A 3QENA 1S4QA 2IUUA 3VU9A 4M9XA 1QHXA 3OEHD 4EPTA 4Q9KA 2P5SA 2XAUA 4LX0A 4CEIB 1ZIOA 5IK2A 1GNPA 3JZMA 3OIWA 5GADl 2O0HA 1XWIA 5CITA 1GP2A 4MYCA 1Q1QA 1XFAA 3GJ0A 4Q5IA 4LRWA 1ZU5A 3IHLA 2FE4A 1US8B 1G8YA 4JLNA 3CIOA 4FN5A 3B1XA 4URWR 1AS0A 2O8DB 4GT1A 1YZQA 1BYIA 2ZR7A 5EE0A 1MT0A 2ZE7A 2Q3HA 3U6BA 3IIMA 1P75A 2ZJ5A 1YR7A 2D3WA 4HAUA 1R5NA 5DO9A 4P4SB 1P6XA 1JAHA 1RJ9B 4N1AA 2J9RA 3R7WA 2KI5A 2DFKB 1RW4A 2BCGY 3EARA 1OFIA 2J7PD 1G16A 2GJAA 2BBSA 4OHZA 4Q03A 4MKGA 2DBYA 3THYA 2FU5C 4CEJB 1G7RA 2FZ4A 2PJZA 5EXPA 4XVUA 3BBPA 1FMLA 3VX3A 2W58A 3GLFB 3AUYA 3GLIB 2GZDA 2N1BA 5FL3A 4KO8A 2QRNA 5JJIA 5SZJA 2J0VA 2CE2X 4DEYA 1XP8A 3CLVA 3LX5A 4MYHA 2A3RA 4FMBB 4US1R 1XTQA 2EWWA 2GXQA 2P5TB 4Q4AA 3WYFA 4LHVA 1CJVC 3I8XA 2UKDA 4FMDF 4R7ZA 4UNPA 1NSFA 2W6JD 2LKDA 2MMCA 1QHIA 5FPYA 4PHHA 3GLIE 4CVNA 4U00A 1GG2A 2ZR9A 3TAUA 2ZSFA 3VKHA 1EXMA 5CDFE 1XPOA 5KNBA 2GVDC 2ANCA 4PO9A 1UJ2A 2IL1A 1BMFA 1SVLA 1XMJA 2VSXA 3NEJA 1E2EA 2R44A 5HZKA 2QP4A 1NRJB 3PEUA 3WYGA 2F3RA 1A7JA 4JBXA 4PC2A 1V43A 4E22A 2DFTA 421PA 2VF7A 3FYHA 5KO2A 3B5JA 4N3NA 4ZCIA 1M7GA 2GEDA 2JJ1D 1C9KA 3X1WA 2ATVA 4M1YA 1U9IC 2LKCA 3UG6A 1ZD8A 2P6UA 5KHOC 5HZHA 1N6HA 4MDEA 2QENA 1E9AA 5F9FA 1QDEA 2NPIA 4D81A 4Q1FA 4H9GA 3KKPA 4ARZA 1W46A 4US2R 3CWQA 2C2HA 4AC9A 4QM6A 1D2MA 3MJRA 4DLRA 4ZDIA 1XMVA 4M1OA 2GVZC 5ELXA 2EFDB 3JVUA 3DDCA 1HY3A 1T0HB 3GJ7A 3ZVLA 4EIWA 1YVDA 4OK5A 4RVCA 4Q7JB 1CP2A 4TLEA 1KMHB 3WMFA 1Q1EA 1KO7A 2UZIR 3VU9B 3N5CA 1CLUA 1F3OA 1QF9A 3I72A 4DCSA 5AJYA 4DEXA 2V9PA 1ZBDA 1NVXQ 1X6VA 2JGNA 4LJ9A 2BWJA 4AI6A 1VHLA 2G1JA 1S9HA 4Q1BA 1COWD 1N6PA 2BMFA 1U8AA 2QI9C 1RYHA 3ZD6A 2ECKA 2BM1A 4OJKA 5JI2E 4B35A 1GNRA 3QY0A 1DELA 5CLQA 3CF2A 3B2EA 2TMKA 2HJVA 1E6CA 5KU1A 4A0GA 4IVRA 4D4LA 2QGZA 3DKPA 5JRZA 1E96A 3BXZA 2X2FA 4MITA 2GXUA 2CL7X 2H57A 2ZSEA 5C4GB 1A2KC 2GCPA 5CDFA 2W2TA 3EWSA 2NO1A 3G82C 4ASUA 3LY5A 1W1WA 1OXVA 3T61A 4DJTA 5AR1A 2DHRA 1NJGA 1U8ZA 4B6EA 3GLIA 1Q20A 3GEHA 2N46A 3KJIA 4HEJA 4YONB 1NMZA 3RRNA 3X1XA 1E79D 2HDNB 3B1VA 2RHDA 3QG1A 4LHWA 3NBFA 4OHXA 1W5SA 4EJSA 4RKEA 5CB6A 4MGKR 3WP1B 1KOFA 2ZJOA 3GJXC 2VP4A 1WDTA 3CF0A 4UNSA 2E9SA 5LB4A 4RD3A 4GOKA 3TNFA 3K9HA 3UWKA 2XJ4A 5FR1A 2ZRCA 2HEIA 2DYKA 3LDAA 1II8A 3SHWA 5EXTA 5JSZA 2WHXA 1KJYA 1KO1A 3BRWD 5JWRA 1KY3A 4A0FA 1FUUA 2EYUA 1XCGB 4EDHA 3T1OA 3SDZA 1KI2A 2ODWA 1WB9A 4MH0R 3CWZA 3SQXA 3Q85A 1VG8A 2ZI9A 3T12A 2PJRA 1Z83A 1TNDA 1KAOA 5CB8A 1NKSA 2WJHA 1DAHA 2FDCA 4QHYA 4XH9B 4DLVA 2ZUDA 4HAVA 5EQTA 5EUMA 1WP9A 2Y8EA 3EIEA 4C7OA 2XSZA 5SZIA 1DEKA 2ERYA 2ZU6A 4MUBA 4TQ9A 3RVBA 3W8NA 4TQAA 2O8BA 4KVAA 2EFCB 4G5QA 4Z1MA 1GILA 2CJWB 2IW3A 5LD2C 1ZUIA 1D9XA 5GVSA 2BEJA 1U9IA 1LV7A 2QT0A 3AKEA 3ZQJA 4RFSA 3FMIA 5IDVA 5HCIA 721PA 2P67A 3KQKA 2C04A 3C4JA 2OFOA 2VF8A 3THWB 1ETUA 1NP6A 2PBRA 5J47A 2W2VA 4XSHA 4F38A 4M9QA 3D6TB 1NKTA 4UXHA 3HPQA 2G77B 5FTJA 2ZAMA 1Z0FA 1VKJA 3QKSA 4DT1A 4TYWA 2O8CA 2OEPA 4X8LA 3UK6A 2GZHA 3WNDA 5BW8A 3AVWA 2GEVA 4G01B 3ETLA 1EWRA 1XD9A 1D9ZA 1OIXA 2WM9B 3LO5A 3TSZA 4DHEA 3OHMA 4NYIR 4AYWA 4TTPA 4BWYA 4H1UA 4UNQA 2QBYA 5BN3A 5EP2A 4Q4HB 3AV0B 1SVOA 4C0JA 2PX0A 4JZKA 3LW8A 3TH5A 1RRGA 2BKUA 2WAXA 4ITRC 4BEJA 4I1VA 1VDZA 3Q8XB 2H5EA 4IFEA 2HJGA 4EAQA 4I4LA 1FNNA 1FPMA 3B1WA 2Q9BA 4V0ME 3LRPA 2YZ2A 2KB0A 2QMHA 4GMXA 2OV2A 3K09A 2H17A 1NI3A 5KDLA 3PCRB 4L5BA 3H84A 4QHTA 4BPBA 1TMKA 3SNHA 3QJYA 1N5IA 1Z29A 3CZPA 5EZ6B 2GAOA 2JDIA 4NCHA 3BWDD 5B2ZA 2XTMA 4B73A 4F92B 3F0TA 4QFMA 2ZYTX 1WCV1 3Q72A 4X8OA 4NU0A 5DHAA 3SU8A 5JSZB 1A1VA 3FKSD 1NL3A 2IYRA 3RSOA 2ZITA 5FOVA 1HQYE 2CHQA 3CPEA 4ABYA 1NG1A 4W9MC 3I73A 1AK2A 1KI6B 2OAQ1 3BC1A 3AF0A 2C96A 1YZLA 4OJQA 3L8ZA 2WICA 4PQFA 4PFSA 4RSGA 1IAQA 1GKYA 2A2ZA 1KGDA 3BB3A 1LFDB 4JLVA 3SYKA 2F9LA 3E5HA 1OFUX 4C0KA 2D2EA 5JHGB 5JZVA 2QTFA 3THXA 1KZGB 2E87A 5AUOB 5B30A 3CKLA 2NPFA 4D0LB 3VHLB 4DVGA 1NG9A 1IONA 2GEUA 3K0AA 5G41A 1NIPA 1E2FA 1NLZA 2W6IA 5LB2A 1KDOA 4PAMA 4FW9A 2AD1A 1LVGA 3HP1A 1G5PA 2OCPA 3AP2A 4AKHA 4LDJA 4Q4AB 5D3QA 4KBFA 2HCJB 4ACAA 2XNDD 2YJTD 3GEEA 4OQNA 2VHJA 4M1SA 4ZI2A 3CH4B 3OIYA 4HB0A 4M21A 1VCIA 2A9KA 3PV0A 3QEJA 4BLOA 5TMPA 2IXGA 2YOFA 2P6NA 2J3EA 5CM8B 4ZDJA 1YZUA 3KX2A 3CO5A 3BOSA 4XWAA 4LI0A 3AKYA 1KIMA 4Q1CA 4ASUD 5L3SB 3GLGE 1T5IA 2FSIA 4IDHA 1B23P 4GZMA 4Z54A 4UXIA 4WVFA 1G3UA 4A2WA 1MR3F 4TYPA 3U3RA 2ZJYA 4C0QC 1A2BA 3KJEA 2FN4A 1KDPA 5CYPA 5EXSA 3K0CA 4C0BA 3WBJA 3QF4B 1KZ7B 1U99A 2PZEA 4OI1A 3KUDA 1JNYA 1NVVR 2ZI4A 3LLUA 4Q7KA 4TLDA 3TQFA 1KK3A 4GDFA 1G3MA 2OBMA 3RS5A 3IPXA 1TF7A 1P3JA 1VYTA 4B34A 1FZQA 2IUTA 3FPAA 1GVNB 1ZMXA 3KXIA 2W6JA 1J90A 1US8A 5KPJA 1GIAA 2ZJ8A 1ZUHA 2AXPA 1WE2A 1DO2A 4WIAA 3OFNA 5JWHA 2HV8A 1EG7A 3D8BA 4DSUA 4URXR 2F55A 1CRPA 5F9HA 1W5TA 1Z22A 1HQCA 1EK0A 1Z0KA 3VR2A 1OJLA 1E69A 2JCSA 1Z6TA 4CEIA 3LV8A 1OKKA 3IQWA 1XTKA 4ZDWA 1G7SA 3P4YA 3WP0A 3IPYA 1CBUA 2FH5B 3FGNA 3AQ4A 4Q4LA 3R20A 1W36B 1JJ7A 2J0UA 3R9XA 1FTSA 2J5XA 2VHUA 1S3GA 2ZJBA 2YWEA
chains in the Genus database with same CATH superfamily
2AN5A 2FVXA 4NULA 2BGUA 3W3AA 4XIFA 1DIAA 2P3SA 3MGBA 4D5EA 5LU9A 3HKBB 4TN1A 4WZBB 4FBLA 5JW6A 5TVGA 3NO4A 3SE0A 3BT7A 2JRLA 2PRZA 3T5MA 2AMJA 4BP1A 3Q8LA 3ZLUA 2N42A 2BHNA 3G0BA 1GDHA 1F17A 3AMVA 1JFFB 4L6CA 4PPFA 4DREA 2EATA 3UMRA 5LJIA 4AICA 3O26A 1TUBA 1UDRA 4FINA 2CXXA 4KWCA 4AJ9A 4ARBA 4CMKA 3W05A 1XFDA 3VBEA 1ZUNA 1QMGA 2XEDA 4MR7A 4ZCQA 2OGSA 3SEZA 3IHKA 4V1CB 5KNDA 4P32A 1JXMA 2PH1A 2YJ3A 1PD0A 3ONWA 4MIYA 1R7RA 1Z13A 1ZNXA 2AJ8A 3IE2A 2ZDQA 2VHZA 1J8VA 3F7NA 4LYJA 3R6TA 4NH0A 5DX1A 1NQUA 3RVQA 3GLGA 1T4DA 3LFTA 2I2BA 3IBFA 4M76B 5F1PA 4URZR 3F2VA 5LPNA 2IS4A 4D4HA 1AXGA 3CPJB 2FEAA 5CJJA 1KJ9A 2JLQA 4P98A 4IRUB 2BL4A 5F21A 5EHNA 4TQUS 1C9YA 2CKDA 3O75A 5B4TA 2XTZA 2NVUB 4CKWA 2NUTB 1KWGA 1X1TA 1CUCA 4P7BA 5HJ5A 2DU8A 3G0DA 1OBVA 3KAPA 2YJ6A 1NXQA 3RS0A 2WZDA 4OQFA 3CZAA 1V4VA 4R71A 4B32A 2QGFA 2VUHB 3G68A 3IALA 3L8HA 3QE0A 3QI2A 2VDLB 1YTLA 3Q2OA 4GX2A 4HOYA 6YASA 4EX7A 5M2QA 4BXOA 5LBIA 3D5QA 2I1LA 2QLJA 3L04A 3OLYA 4MRVA 4MICA 3NATA 3SJBA 4ALJA 4E3WA 2ZB4A 4HDNA 4J7XA 3NIBA 4RE6A 1E1MA 3A1UA 4IEEA 5JY1A 3BHIA 1A9XB 1Z6GA 2D59A 4RVOA 4KBGA 4G2NA 2QXTA 3L05A 2IV2X 1ZUNB 2FMUA 1LB1B 1BMFD 2RJNA 3B70A 3FX2A 4E12A 2EHJA 2C9CA 1I32A 1ABEA 3JPYA 3GF4A 3LCJA 3TQTA 2LW7A 3QUAA 5BN5A 1JZTA 1ZD5A 4IF6A 3PR2B 4XX1A 2EFGA 2VEDA 5ALDA 2H3EA 1BS9A 1TO6A 1BXRB 1Y1TA 3EA5A 3FRIA 4BL5A 4E07A 3WIBA 3PI6A 2B0JA 3EXIA 4URUR 2HGZA 2Q0HA 2ECPA 1GZ3A 1X2BA 3Q88A 4XYBA 1KRWA 2RDMA 1IG0A 1RPZA 3A2NA 1ZM2A 3THXB 2IEDA 3F4LA 1I7SB 1L5QA 2W2LA 3L5KA 4QQRA 2ZSUA 4YJGB 3MFQA 5HX7A 3KQLA 2VXOA 4RC9A 1HQKA 4FXOA 2EDCA 1MG5A 3N76A 3PA8A 4U5XA 5BNIA 1QGUA 1VOTA 2RK3A 2PY6A 2QW8A 2ZAOA 2FSVC 5DTMA 2O2CA 2AUTA 5JOQA 2BTEA 3K1ZA 4WOPA 1MB4A 4GKVA 4NE7A 3SVLA 1OXTA 1LDMA 4HDRB 3HSSA 4IH9A 3PG5A 2JPDA 3UHAA 2JC3A 4ERXA 1P7ZA 3OPQA 2IYTA 2GCOB 2P4SA 3DL2A 1IY9A 3AGPA 4HZUB 2J48A 2OB1A 2P35A 5E6RB 3IXMA 5CEEA 1SBYA 3OOJA 3CTMA 1Y6GA 1QB8A 4ZVRA 3IKLA 2IDJA 3DXFA 4BRWA 2FPUA 3MTDA 1NY5A 4RD6A 1GPAA 5LQNA 1XVUA 5A06A 3OZDA 3LUKA 2BEKA 4NXNB 3SS7X 2WABA 2HJSA 1NVVQ 3M6MD 2AWOA 2DKOA 2XITA 4N3AA 2ZRJA 1IN7A 4MSUA 2GLUA 3NTOA 2OO5A 1BOFA 3ZE1B 1FU7A 1QYXA 1X15A 1QK5A 2PKXA 2H11A 2ZWPA 1EDDA 3ENZA 3ESRA 3GLTA 1RC8A 1PFGA 2B35A 2QUJA 1C7ZA 1R2QA 4IINA 2IU4A 1V1MA 4WXHA 1QLWA 5FP0A 3TPCA 1Z38A 2X4GA 4DBZA 2Y68A 2QD2A 4ERNA 1JWBB 1O94C 4NZ9A 5FOSA 2XOKA 3H6HA 2QMYA 5E4JA 1KL7A 1E0AA 2OYSA 3B60A 3AR2A 1R6DA 3KZVA 4YAJA 2H9AA 5D85A 5FNVA 1RRPA 4CM9D 3EY9A 4PYNA 3FDXA 4QGFA 2ODEA 3NASA 4UE6A 1W0JD 4LWOA 1M2KA 1ONPA 4DMMA 4G85A 2NMVA 2WB2A 1R9JA 4V38A 3KUCA 4F2HA 1EU1A 3GVXA 2X6RA 2AE1A 4OXRA 2YMPA 4AY4A 3OIUA 1M3SA 5LLSA 2HF8A 1SZJG 1THGA 3OOYA 1HDCA 1YRYE 4GPEA 5ELLA 4Y1EA 4OQEA 1DXOA 1XCMA 2J3MA 1Z8FA 2WE8A 3FNEA 1QVWA 2C4UA 4MVJA 4NFHA 4TTRA 4K26A 1PDWA 3DOIA 4OJNA 3OTOB 4YWHA 2CB0A 5C32A 1QIGA 4B3HA 1Y81A 6REQA 2W6PA 3DLIA 4X44A 2NOAA 2UZ0A 4KFUA 1DPGA 3UOGA 1UDAA 1PG2A 2G9ZA 3RODA 3CG0A 1Q3TA 2RB5A 3NNDA 4IJUA 2QMOA 5KINB 1N92A 1YZVA 3UW3A 3L1UA 3M5CA 3VZDA 3W1VA 1NLYA 2OCBA 2QL6A 1QO9A 4CLHA 4D79A 5BNTA 2G9UA 1ZC3A 3CIFA 4AKGA 5E3IA 5AKGA 1NUAA 3ON5A 5DLPA 4HAWA 1MW8X 1TI7A 4PAWA 3QNWA 3JQ7A 2FN3A 5FUYA 4F1KA 2EJWA 5LL6P 2D1RA 4KR6A 3ZI0A 4EKEA 2VCHA 2OZPA 4AWAA 3U60B 3NHLA 4HEA1 2Q8QA 1AQLA 2HRRA 1MQSA 2H7YA 4PPGA 1JL3A 2EGUA 1VL2A 4TZTA 4A8TA 1OXUA 4PIVA 2D0PB 2AGVA 2UDPA 4OGKA 2IWHA 2NU9B 3TNJA 3BVPA 3UUFA 4DDMA 1L2TA 3JWIA 4J0KA 4L74A 4CDRA 2XRZA 1EUYA 1WTCA 3L2OB 3OO0A 2VN8A 1EFKA 2QZPA 1ODIA 4EY6A 1C41A 4FXPA 1YRWA 4TMWA 2IXAA 2CFCA 3IUSA 3U4AA 1GFZA 1T2FA 1WZIA 3CCCA 3N3AC 3UXMA 2XX3A 3V8NA 3DZDA 5KYUB 3C8MA 4I5DA 1NXPA 1W581 1XYYA 1ZAKA 3RRFA 2WUDA 1L4GA 4R3WA 9ATCA 2KPOA 3EZFA 3S6JA 4HP8A 4YDQA 5CIWA 1Z25A 2A0FA 4HLDA 2H29A 3COSA 4PZDA 1TRHA 1YAJA 3GAAA 1KO8A 2H2GA 3N5KA 3W7VA 5H81A 1YSCA 1IIRA 2EC5A 1BRMA 3CRW1 4LQ4A 4DC9A 5H4GA 3RJMA 5JASA 3IVGA 1SVKA 1YQEA 2YWRA 4TPKA 4Y1RB 5GIPE 3ZVKA 3PQ8A 5H9VA 1O57A 2VH1A 3FZEA 4IOKA 1UPBA 3I9FA 4LV5B 1AN9A 2A5FA 2YBEA 2AL7A 4LDZA 1P7CA 4IEFB 3SF8B 5L7WA 1NNEA 4C29A 3EEBA 3KVRA 3LCUA 5KYUA 2PQ6A 2R1VA 3T5CA 2VF4X 3HXLA 3DLTA 4KN8A 4YPOA 1AKVA 1Z15A 2IE0A 2V7BA 3Q41A 3RVJA 1EESA 5FQNA 2YZMA 1ZIXA 2PN1A 3CGWA 3GLQA 4LBYA 4B40A 4DY4A 2YV1A 1RRKA 1GTVA 1ZJYA 3LI2A 4V0NA 3UAVA 3ESCA 1G59A 1K3FA 1ZAYA 1C7FA 2C7BA 2FZ5A 2X40A 4GX1A 5IAGA 3O5AA 3JCZA 2XB2A 4MIEA 3N8NA 5IAOA 1SY7A 2QTGA 4GW3A 1YHNA 1KK1A 2AH5A 4A82A 2NSJA 3GH1A 4BRUA 1OYWA 3MB8A 2P5UA 2QPOA 4YV1A 3ITNA 2H92A 2JHCA 2R0QC 3DNMA 4F4IA 2ZJZA 1PZFA 5F7ZA 1IOZA 1E2KA 1QB7A 3LMKA 4RUKA 3UWMA 3H83A 3JVIA 4P36A 4ROSA 5T41A 3S2UA 5DNYB 4MS4A 5TQVA 4NICA 5AQEA 4AT1A 1ZOLA 4MQ5A 5DTIA 2EBUA 3FM9A 1WCYA 4F2GA 1ZNWA 4GI7A 3OJCA 1T3ZA 1Z47A 2NNWB 1SHLA 3A2LA 4KXQA 2JAWA 2C0QA 2CNWD 5BN5B 4EX6A 5BN1A 5I01A 3LS2A 3ROGA 4BC0A 1V7QA 4LJ4A 1F2TA 5SYMA 4X24A 4H7FA 5DYGA 4AY2A 1OHHA 1OX4B 4TROA 4J2OA 4D9GA 1MABA 3M2PA 3SZRA 5LMZA 2ECFA 3WXBA 2BBOA 2IYFA 4YRLA 1YD7A 5AI4A 4Y2TA 4Q4JA 4N5MA 3C6YA 2VTBA 4GKAA 3OFVA 3CCFA 3OD5A 1UUFA 4BVBA 1NLMA 3GCZA 2PWZA 1ZVJA 2AQIA 2V6JA 5ERGB 5I7HA 2EKLA 3RIMA 1MGOA 1ORIA 5FBWB 1FY2A 1J39A 3ZS9A 2GEKA 2JRCA 1M66A 4K9QA 1YONA 2JJ1A 4MP8A 5IAKA 3M82A 3BICA 5GPBA 1IL0A 2VNAA 4RDXA 3MJCA 1HDXA 5C81A 3L7OA 4L3OA 4EBBA 3LKBA 3JWJA 1DWQA 4X20A 1PFWA 1LNSA 3A11A 4GQBA 4JLPA 4O5OA 3MINA 4XVHA 5DVZA 1Y5NA 3HHPA 4TL8A 1EZ4A 5AJXA 3FN4A 4F97A 3EXEA 4C04A 4BP9A 3BD8A 1P91A 1I2ZA 1FMJA 3QU9A 1F1BA 3L8MA 4FHGA 3X1KA 4ZTUB 4Q1DA 4QOSA 1ORWA 4D6XA 1NQWA 4WJZA 3OZVA 3Q2IA 4OFWA 2L82A 1WKVA 1PV2A 2ZR0A 4KK4A 2IZ7A 2VH5R 4KH0A 2DFVA 4URYR 4WFQA 3FCCA 2YJZA 3ZJYA 1Z4KA 5JBNA 3UJ8A 4RAOA 3OPMA 2CNDA 1J8MF 1YK1A 2AR9A 3D2CA 4L4ZA 4BFLA 2D2FA 1Z4IA 1CU1A 1Q7EA 2ISSD 2AN1A 2O1EA 1NTOA 4GOXA 3P2IA 1W19A 4KSBA 2ZB7A 1SD5A 4L27A 3EEQA 4BVHA 5JS1A 4ND1A 5ARCA 1CUVA 3NRJA 5AJUA 1ORHA 3EVFA 4LNHA 4CIWA 4EW2A 4HFJA 3WTCA 4R41A 4FYPA 4OK3A 1ZNQO 2IV3A 4B1FA 2J31A 2GYYA 3RYCA 4YJGA 1FFXA 4PYKA 4NZNA 4KWIA 2HCRA 3LO8A 2CL6X 2REXB 3AB7A 2IHNA 5DFAA 3T99A 3RGGA 3MJFA 3A3NA 4MI3A 2WV9A 3I01A 4Z9XA 5AM3A 4W6ZA 1YDFA 3MYRA 1SBCA 1ZMRA 3WL5A 1P9LA 3OM0A 4BNWA 1XNRB 5K3AA 5BNZA 3KFXA 1WMFA 2CL0X 5EIOA 5A0FA 2XAAA 3WWYA 3KEQA 3GPDG 4M98A 1WSWA 3TOZA 3I52A 5DNDA 1HO3A 2L69A 2BZ0A 2GDZA 2LWIA 4GNKA 3PVSA 3DC7A 5HIKA 1IY1A 3K2EA 3FUWA 4M1WA 4ZAGA 4TT3A 1PIWA 2LIVA 3DR3A 3H0CA 4N7RA 1NATA 2HQ1A 3PITA 4V0RA 3QYFA 2W2KA 3AF6A 5DSXA 4M9SA 5BN4A 3R3JA 3REGA 3SIWA 1LF5A 4TXMA 4RXUA 2IQIA 4RELA 1Z18A 3Q1LA 4FMDB 3TMKA 4P81A 4PG4A 4EW1A 1ZK1A 2LBPA 2CCJA 2YWFA 1N2OA 4GS5A 3NJRA 4OH1A 4J49A 4BNYA 2NUTA 4PONA 4MS1B 5K0JA 1VJDA 4U6NA 2NVUA 1DFHA 2WHRA 3QFFA 2O3TA 2X13A 4CKWB 5LP6A 4RQBA 3HPRA 3A05A 3AUAA 3R6WA 2M6KA 2NXNA 2OO7A 2FPKA 2X8BA 1FSZA 2C3PA 3H9BA 5DXJA 5KZMB 2J07A 4RHUA 1QHSA 1UT8A 4JQCA 1Z26A 2R00A 3TIGA 4DLNA 4RX1A 4MMXB 1T1RA 1R0WA 2PFSA 2I5PO 3LCRA 1RCTE 1Z4PX 1HETA 4ZPXA 3SEAA 2IPLA 3QMVA 5KI6A 1XVLA 3A37A 4W1PA 3E03A 4N0PA 3C5CA 4PSKA 4QUHA 3V5NA 3P4XA 5DTEA 4AIRA 3ZK9A 4AO6A 4A0RA 1Z88A 5BYKA 4FB4A 5A6VA 2O8CB 1AZTA 4L0CA 3S44A 3FZYA 1IIBA 1CG6A 4RGYA 3RBAA 2BHSA 3ESAA 3IMKA 1UKBA 3GARA 1EXDA 4OKSA 3ZCPA 5C35A 1E77A 3H1AA 4LWQA 2HL6A 4LXYA 3REQB 2QMZA 3CLRC 2GTIA 5KOIA 1LDGA 3IQEA 1QFYA 3PF8A 3JQEA 4HBZA 1JG2A 2RGGA 3CF4G 1W1IA 3DZHA 3DFUA 1X3LA 2AXNA 1Z08A 2HPZA 1KNQA 1LLUA 1Q0UA 2FFJA 3DULA 3GIWA 3O47A 4IHJF 3NKFA 1DCFA 3E9EA 4JBNA 1A8UA 2R6AA 2WPNA 3F6EX 5GMOA 1RI3A 1J0AA 2NV0A 3U3OA 1WMDA 1XTTA 5F2OA 1E2BA 2H1WA 2QXUA 1FVHA 4Z6KA 3SAJA 1K3UB 1Q1NA 1WS6A 2RKOA 2MJLA 2XKJE 3CE6A 1I1OA 3GJYA 3LP5A 4JS0A 4O4JB 4RHXA 2FEOA 5DYWA 3QHPA 1NMSA 5K05A 4GOJA 3ME5A 3P0RA 4HUJA 3GMTA 5FEMA 1KKLA 4HRVA 1AM4D 1Z35A 2AOTB 5ED4A 1PT7A 1QGOA 2A14A 3QVXA 4GLFA 1U2DA 4RKWA 1L7OA 1PX0A 3IT1A 4F5YA 1VSVA 4N5HX 3OKFA 4RETA 3R41A 4EELA 6ABPA 1AQIA 3CVWA 5C1DA 1G8FA 2OP0A 3JVDA 4Q00A 3C1OA 5FHRA 5E3HA 3ABOB 1OBCA 2HPAA 3OCCA 4OI4A 3ORQA 4FGZA 4JXJA 1SCJA 2XXJA 3JZDA 4ZAFA 3OFKA 5KREA 3A0UA 3BIXA 4EL5A 3WJ7A 3ZWKA 2AUMA 2KBEA 5E95A 3N2EA 1OMOA 4GVLA 3RRBA 1MJGA 4Z8YA 4X91A 2R66A 3NHBA 2BV3A 2TMGA 1ZHFA 3EA0A 3L6CA 4Z4FA 1RP7A 5HKKA 3IS3A 4ZT6A 5M7EA 3TTTA 1Z7EA 1F9EA 4YHBA 1AJEA 2UYOA 1JS1X 3DAHA 3W4KA 1GPUA 5D01A 1FFDA 3R2JA 2HA6A 2PZMA 1GXSA 3WYAA 2WF8A 3OH8A 4B47A 2IX3A 8OHMA 1YQTA 4QBTA 5E7MA 4L3VA 4I14A 5B4UA 4FWTA 2NXCA 3DBIA 4NYMR 1Z28A 1N78A 3R4VA 1YCDA 3GJ3A 1BX1A 2C5EA 5AO9A 1AN0A 3O0TA 3PUHA 5CH5A 3TSAA 1YASA 3ADKA 2HM7A 4TLBA 3FCXA 4KCGA 2IF0A 1IK6A 1JQ3A 3FGOA 4D6PA 2NO0A 5ENDA 5KMGB 4IM7A 1XEXA 5LQKA 2PXXA 3R40A 1G3RA 2ZUVA 3F6BX 4OB7A 3VR3D 4LVOA 1D09A 4Y9DA 3TTXA 1WXEA 2Q5LA 3P8ZA 2QK4A 5EFOA 2CFTA 2PGDA 5BV7A 3EIOA 1FP4A 3D6FA 2VBIA 2C2BA 1UXGA 3FPBA 4EHAA 1XKQA 2LRHA 3PTLA 3T34A 5B12A 3KLBA 3FMFA 4QRDA 4ARIA 4D9NA 5AKXA 2D7CA 1TZBA 4HDMA 5IKOA 4ZTBA 1KA9H 3ANMA 1CZHA 4RTSA 1KHHA 1IM2A 1PZNA 1X7WB 3WZLA 1SUSA 1C7RA 3HNRA 4LVCA 3UA3A 3DBLB 4BPRA 1L1EA 4N6GA 3VQTA 2GLTA 2C99A 5CT6A 5AKIA 3WDLA 1SVUA 4Z4IA 1RMQA 1CXZA 1BQ4A 1VYHA 3AF5A 3D02A 3GT0A 4WXYB 3UGTA 1X74A 1IZ9A 2FRVA 1X94A 2O0KA 3KQWA 3W2FA 2DT8A 4H1TA 1XVTA 4M0MA 3JQRA 5FNZA 2JFXA 3NBZC 3ER6A 3RTDA 2XT0A 3HJGA 1DQSA 1QJCA 1YBHA 3EX7C 2GM4A 4RSHA 5E4YA 2H4ZA 2E4WA 4KAFA 4B75A 1WD7A 5EJ4A 4YCMA 4HAZA 2P3LA 3ZHBA 3PLAE 3EQ9A 2ZYWX 3PU6A 3CURA 2HFKA 2DR3A 3JQAA 1H2WA 2H4WA 4HSEA 4OQMA 4V0QA 5DN6A 1JYSA 2ONZA 2X76A 1IN1A 1UP4A 3SX4A 3V6LA 1ZLXA 3L77A 2JLYA 5FBLB 1E60A 1O03A 1RWPA 2NZWA 2XE6A 4XW2A 4YJFB 4CQLB 5LMUB 2YMQA 2ATEA 4WKPA 3ZLVA 1YQGA 5FUXA 2DPXA 1OJ7A 3L49A 2NU8B 2RIPA 4TS4A 4D2IA 1YKSA 2OHGA 4NS1A 1U1GA 4TTSA 3ZCVA 1RM5A 2GJ9A 1D2RA 1QTIA 2B2NA 4MUEA 5EAIA 2HHAA 1E9DA 4M83A 2JAOA 3JD3A 1UODA 3ZXIA 4A1OA 2L42A 3FDZA 3IP6A 5C4IA 1KFCB 1OXBB 3V9PA 4Y6RA 3RYTC 3TVTA 1XZHA 1Z5VA 3NGXA 3OG9A 4GYJA 4NDNE 4W8GA 3ZLTA 1FW6A 4KR0A 4YBZA 3N2IA 3HVRA 1R8YA 1T9GS 1XR3A 3TMYA 3ZNPA 4AZ0B 5KVAA 1TEXA 1KEEA 4REMA 4KNYA 2QTVA 3GZNB 4OF4A 4RJLA 4AUEA 5LZ9A 2Z5LA 1L6IA 4IKOA 5KYNA 3X1ZA 3AHIA 1FNMA 1ISIA 4QQNA 4J16A 1NQXA 2IY8A 4Q9NA 4YXWD 4DPKA 1D4ZA 1U5BA 1YZNA 3LX6A 3OEEA 4OFZA 5EWJA 3QEBZ 5JQGF 3SKXA 1KBQA 4YYZA 2BM9A 2A35A 2WJYA 1ZX1A 2B7BA 1NR7A 2IUYA 3KWLA 1WQ1R 4PRZA 2G0TA 4AF6A 2DBQA 1BH6A 5J5VA 3RVKA 3WAJA 4LCEA 1FZTA 1SPXA 2CLIB 4M2LA 4LDPA 4W8OA 3QEMB 2GT1A 2HLHA 1GM5A 2IU3A 1JDVA 4FW8A 1OB2A 1GO2A 2CVQA 2I6GA 5J4YA 1XO1A 2RHLA 3C5HA 1RXYA 4J7AA 1F14A 1BZYA 2H4HA 4EKYA 2A0UA 2DHEA 3FUCA 4II2A 1BHJA 3A4MA 4RPLA 2R751 5CM9C 10MHA 5IKXA 2G5PA 1XYVA 4MW7A 1H6CA 1QGDA 3ZX5A 4JB0A 1TADA 1U63A 2LUOA 5FYQA 2VQEB 2X7HA 3MAJA 2M6LA 4MVJH 1GGJA 4Y9SA 3AVYA 1PL0A 3F9RA 1XAIA 4NYJR 4F11A 3RFTA 5I9LA 2G4CA 1YRQA 3HCPA 1G60A 2ONJA 5HNKA 1L7EA 2CNBA 1QIFA 5KYYB 2B1RA 2GZMA 2X77A 2PQ2A 1YHYA 3IVCA 4BLUA 5IF3A 1YVEI 1MQAA 5EIBC 2PKQP 4YCNA 1R74A 1NVWQ 3AR9A 2VP2A 1MAWA 2EU8A 4RLSA 7AT1A 3AIKA 4CE6A 4IDPA 1XQYA 1VJ0A 2I7CA 1UF9A 2YFQA 3P9PA 3Q7EA 3UCEA 4DDVA 5FI0B 1RBYA 4B17A 1Z16A 3K5IA 1GITA 1SZCA 3ZYCA 3USZA 2QV7A 3OE5A 4B7XA 3N2KB 2VDMB 3KR0A 3ETCA 3H2YA 3UT6A 1E0SA 1TD9A 4U0JA 3PNQA 5CU7A 2Y93A 1KJWA 2GYWA 3PFIA 4R0VA 4RIGA 4B6PA 2XZOA 2IH4A 1X7WA 1ECBA 3KBBA 3VPBA 2R8XA 4EG7A 3OQPA 1C7JA 1SKQA 3E2IA 2H3HA 1ZD9A 3H7AA 1FQJA 3KR9A 2PT7A 2Y2VA 4M87A 1YO6A 5FPTA 2PNJA 5HQ3B 1C8KA 1SGWA 3OP1A 5IX8A 3ZD8A 4Q1AA 3EGIA 5SZKB 1P4GA 3FA2A 3EA4A 3NKVA 4RHCA 4WLNA 4YP7A 2OORA 4J94A 4MRPA 5FA5A 3WIDA 4CIBA 2XZPA 2WQ6A 3WRXC 3ZCTA 2R62A 4JLWA 3SC2B 3W6ZA 4HRAA 1PR2A 1UEIA 1TK3A 2Y0EA 4ACBA 2QY9A 4XUEA 3X2FA 2FQQA 2PGJA 3H86A 3G88A 1Z5OA 2RGWA 1JXAA 1SRRA 2WFAA 4D82A 4OJTA 3U3XA 3OM9A 3CX3A 5DTQA 1B3RA 3QKTA 3QUCA 4EGAA 3WC4A 3TLXA 1AV7A 1HKHA 4B3JA 1KZYC 1SQ5A 4I6EA 3HUTA 2EZ9A 2VATA 1SKAA 2QVZX 1OFHA 5AK4A 5HRCA 1UR5A 2UU9B 4D4GA 4M1MA 1T5LA 2G1UA 5A9TA 1HE8B 5ADWA 2AI3A 1K66A 2DQSA 3KZNA 4J3JA 1TPYA 3LA8A 4PEVA 5CA1A 1UKEA 1WBJB 2O0MA 1R6XA 1YDWA 1E5LA 4YMWA 2FP4A 3WA6A 3C3KA 4TKVB 2OECA 3K73O 2UUCB 3MT0A 4PHGA 2Z4TA 3FDZB 3IIIA 3HG7A 3FR8A 4P3KA 3A4TA 3EXHA 4TM8A 4Z0TA 4DEVA 2FEKA 5IJZA 1UADA 2OBYA 2W43A 5H5JA 5K8IA 5MF6A 3HXOA 1V3QE 5C1BA 4OUDB 4JK3A 1PSZA 3LUGA 1DAPA 2GZAA 4L16A 3VSDA 1K7YA 1L8AA 3PL5A 4FYVA 2Z58A 3IULA 3SIXA 4F45A 5CW2A 1FYFA 1F5SA 3ZWWA 1EFRD 1V96A 2QTAA 3B82A 2A0YA 4OQYA 4YJ3F 5FFNA 2WSSA 3WFIA 5CJ2A 3K20A 3P32A 1S1MA 2A59A 3FIUA 1RYNA 2O52A 3DPIA 4G0NA 2YH2A 1P74A 2WIGA 3L07A 4BNUA 3GCDA 4JENA 4YMVA 3TSOA 5BSKA 1LI7A 1O5OA 4Q01A 1J2EA 1IXZA 1QIDA 3AY7A 4FJ0A 2LCQA 1WRBA 3WYDA 1V8PA 3C45A 4IMPA 2Z43A 4MUFA 2QL7A 4QT0A 4POOA 5ALVA 2WJ6A 4M0EA 3G3EA 4NCBA 3IO5A 1U3FA 1U8YA 5KQLA 3B1ZA 3RYFA 4Q7QA 3FOBA 1CHDA 4TTVA 1IH8A 2C59A 1OC4A 4WY2A 3T7TA 3U2QA 4A8PA 1R0SA 4M89A 3VNUA 4BKOA 3CUKA 4QG7A 1OWOA 1OA1A 3JQFA 4I2NA 5EL0A 2D2VA 1T0BA 3C87A 4GR5A 1L5WA 4CUKA 4RZ2A 4JLAA 3REFA 1H6BA 1M2OA 1UWLA 1XD2A 2X41A 1HE2A 3DOHA 2WAMA 3A58B 2FFAA 4AMUA 4DJFC 1SM4A 4ZN6A 4NR0A 3B3JA 1OHHD 1MD9A 2C5AA 2YCBA 4B6OA 5EESA 1A97A 2NLOA 5BV0A 2JFQA 2DWOA 1YL5A 4I9NA 3LBYA 1R27A 3O2NA 4H77A 4WSOA 3KYDB 1BXGA 4FIZA 4BGEA 5FOUA 2XB4A 4F93B 5JJKA 1HOTA 1S9DA 3ZV6A 2DJIA 2RGXA 1AT1A 4UJ3A 4IIGA 1MJGM 4NAHA 3GZJA 4IXDA 4C2TA 3FSJX 5AQ1A 4CQNA 1G8HA 1NMEA 2PLFA 1BVYF 1L3CA 3QJ5A 3CYFA 1QH1B 3E9YA 3L1JA 4MW2A 2QDKA 1GCAA 4ZHSA 2ATXA 2G63A 2YBDA 5J40A 4CZ2A 4JC4A 4WZAE 1BTOA 1QFSA 3VJLA 2Y0DA 3PNOA 3EGXA 4XUGB 1UM9B 2FQWA 2O2SA 4KL8S 3VR4H 3HL4A 3WFJA 5BW4A 4C0LA 1SC1A 5JBIA 5JQWA 5I7OA 3U81A 4R2HA 3KS9A 3ZIAA 1N9ZA 2OV1A 2I7TA 4S24A 4Z9YA 4I1OA 3WHIA 1ZI9A 1B6RA 1H1TA 2GM5A 1OZHA 2JLSA 3H65A 3KALA 1VI6A 4B33A 4DSTA 2V0GA 1Q3HA 3H5VA 4ETIA 1P61B 2ZANA 4DNFA 5LP1A 1D2HA 3PDJA 2D2IA 1QH8B 1F0YA 3OEED 4G4JA 3MUOA 5CVVA 1M74A 2KBFA 1XELA 2P9JA 1M8JA 2NQTA 1ND5A 1OAOA 2D54A 1MXFA 3LLSA 3QUBA 4TSFA 4QKQA 5FI5A 4DILA 5BVHA 3L02A 1NU8A 1E2MA 4BNNA 2C1EA 4CRWB 3S2YA 1RLUA 5JTTA 1FYWA 3G02A 5DBHX 1EUDA 2P2LA 1FTWA 5AK6A 5JZMA 5AHRA 1VP3A 2JLVA 2BBTA 4EABA 4BNGA 4EMBA 5KNCD 4JI5B 1C1XB 1MUUA 5AW9A 3MW8A 2ZRQA 4OLJA 1OXMA 1TJYA 4UE3S 3G2PA 3LPCA 3Q11A 4YJHA 1U81A 4ZVTA 3O9MA 1L7NA 2O19A 1Z07A 4MWEA 3F47A 4U7FA 4XOUA 4HRYA 1T8RA 1JN0A 3G1TA 3GLHB 1CV2A 1RXIA 4G0OA 2FFRA 4GEKA 2QJFA 4MUGA 3FYDA 2SKEA 1ZD2P 1QGUB 1URPA 3FPLA 3HWX1 1CF4A 4LSGA 4MVJE 2AIRA 3KV1A 4FYXA 4EJ2A 4WZ6A 4H35A 2NYRA 3A6LA 3SWWA 1P9WA 1PK9A 3HO8A 4GECA 4UU7A 4E5NA 1PAUA 1AO3A 1ECPA 3NAZA 5KSWB 1E99A 3P94A 1PJ8A 4QUEA 3A9TA 4R8RA 5G0WA 2YRXA 5AP9A 5FOQA 2DG2A 3EPKA 5AM2A 1RYEA 5A5DA 3GI1A 2IYVA 3BULA 5F2EA 2RGAA 4LA4A 5EP1A 1DPFA 5I51A 5FAKA 4U4AA 4Q39A 2X1MA 3C3BA 1WLSA 1GDTA 3WL6A 4MRMB 4M1ZA 2YJNA 4RH0A 2ZETA 3PXAA 1K6IA 4Y2QA 1DINA 3GX1A 4W1RA 4URVR 3KQHA 2ISQA 3H4IA 3NLLA 1KS9A 1N5MA 2G08A 1EIZA 3OOEA 2ONCA 3DUFB 4M9RA 3C7AA 4OBXA 5PNTA 4CM1A 5BR4A 5BUCA 1SBQA 2AJLI 1A69A 3VPGA 1OKKD 4X1OA 3HA3A 3AC0A 4LHXA 1NBIA 4X3CA 2DZDA 1YZGA 1RRFA 1SXJE 3I92A 2R6FA 3P9ZA 2JI7A 4M55A 5LXTF 1ONNA 4A27A 2P6RA 5L95A 1TAGA 3B3QA 3TTVA 5LQMA 1H66A 4XM0A 4UARA 2E1PA 1T13A 4MV0A 3V1KA 3MINB 4ZVVA 1FXSA 3QFCA 3HVJA 3SYLA 1RJ9A 2E4XA 1ZRNA 2G6TA 1EVYA 3Q8WA 4WESA 1GLGA 1W0JA 4RGVA 3UW1A 1RC0A 2LNDA 4ZV4A 1T15A 2W6MA 3GFSA 2RHWA 1W2HA 1NVEA 3IR5A 5DM1A 3W5BA 1EP1B 1NF9A 4S1TA 4RF5A 1WM1A 3G6KA 4C5BA 2FN9A 4QQKA 3KLOA 5CLFA 5H8WA 3MBKA 5JR3A 4O33A 5KSZA 1JQKA 5D7BA 2Q0QA 2JFNA 2OFWA 4OEHA 3WL8A 4L4YA 1UZNA 4TWBA 3WNVA 1JR2A 1LTQA 4BB5A 2I22A 2CNOA 2Z2IA 1M2VB 3CKMA 1J9GA 1NLUA 1ZNZA 2ODTX 3OPYA 3Q3JB 3KPWA 4WKGA 2E7ZA 4KXFB 5DP1A 4OM8A 2QD4A 3PFKA 1K2VN 3ZJ5A 3H1PA 1KEZA 5AW2A 4HN9A 3IQDB 4JNKA 4YO7A 1MORA 1SJ9A 1JFFA 1JGTA 1FP1D 5EC8A 4LAFA 3KKZA 4QX6A 4BNTA 4NBTA 3TF5A 3L8FA 1NRXA 1EUCB 1UXIA 4EGQA 4GYYA 1SCIA 1HT0A 2MCFA 3A6GA 1VKHA 4IO1A 4PLVA 1PNOA 3BA1A 3TBKA 3UV7A 3LWNA 1G7CA 2OVFA 3M81A 3QXCA 4NZMA 4WY8A 4RY2A 4AD8A 5ITVA 1NGSA 4JKYA 4IGFA 1CQXA 1CERA 1NJSA 2EL9A 3HZRA 3H99A 2HMWA 3NHFA 4BNJA 1XCPA 2QORA 1IJEA 1C9DB 4XLZA 4XIYA 1T9HA 2D8AA 2IZ0A 3GL9A 1Y4AE 4LY3A 3CEHA 3SC3A 1LUAA 4KQKA 4D56A 2BC9A 2OENG 4PHFA 1U6JA 1YUMA 1JLLB 5AVWA 2ADFA 4LDAA 1S2OA 3LYLA 3UFXB 3UJCA 1MQ9A 3EZ6A 1L4MA 2W8BB 2C31A 2A8YA 3OIVA 2Y1EA 4JYCA 3S2GA 3AKCA 3SLKA 3SS8A 2Q5QA 2R3SA 3PXBA 3TD6A 1TAHA 1DIOB 2IRWA 4EY5A 2I2DA 1NJ6A 2J9GA 1LD3A 2PH7A 3AESB 2FB9A 2Q9AA 4LBZA 4MJXA 4HDKA 3HUEA 4XWTA 1Y8RB 1DRUA 3DBVO 3I64A 4WAUA 3P9QA 4II7A 3U4QB 3VSCA 4I81A 1B43A 4YBRA 3TTYA 3JVEA 2ZIXB 1ULBA 3QXJA 5KJ6A 4CKCB 2HMAA 3EGEA 3KE9A 2PWBA 4QJIA 1Y7PA 1TQ4A 3LUPA 1Y63A 1DUVG 4OOFA 5D1NA 4EGFA 3UMCA 2Y1FA 2HA2A 5IVDA 4C4TA 1KBZA 3H16A 1FQOA 1JHMA 1WSBA 1Y9ZA 3DHYA 2YIJA 1ES9A 3UJ9A 1FDRA 3RUCA 4MWSA 3Q9UA 3ELBA 2G76A 1HK7A 2O20A 1B26A 5BWNA 2GUGA 2X1HA 3T5BA 4HJRA 4CQLA 1TA0A 3IOCA 3IQGX 3RS4A 4GXQA 2F8TA 2O3JA 2I76A 1QYCA 2OC9A 4I5GA 2WP8J 1NBAA 1DC6A 4B71A 3GRCA 4CT5A 4CETA 2IOYA 3RG8A 3ROKA 3G5AA 1JR3A 2XE7A 3WLNA 2HFJA 1WBDA 4D92A 1B00A 2X8AA 1EEHA 4KRXA 2WU1A 3T8YA 1MJFA 3SSNA 4C21A 3FE2A 4D0NA 3C7KA 4I50A 4YAGA 4AKTA 4B3MB 4YV2A 3U7QB 3CNEA 4NV1A 3BDVA 1P0PA 3E1GA 2FPRA 4J7UA 2BFCA 2X4LA 3F3KA 1F2TB 2LCFA 4MUIA 3F3MA 1SXJC 3T6KA 3E8XA 4DLLA 4CCSA 1OWPA 3ODPA 2XDAA 3CZ9A 3GGDA 4LE2A 1NF3A 3P2YA 1AHPA 3NWJA 3H05A 1LPPA 2PH3A 4KPEC 2V03A 1KFBB 5TMEA 2R6CA 5AJTA 4RFVA 3HZZA 4PGAA 1U3WA 1V7CA 3K6KA 3QPWA 5DBGA 3ZHSA 1RTKA 4I4TF 4J0DA 5AI9A 3KL2A 2ZIEA 3WLHA 1A9SA 4BLQA 3SX0A 1Z6PA 1IHXA 2VTVA 3IEUA 3PE4A 5ENVA 1F8XA 3AFHA 3C7DB 4G9BA 4QU8A 1RKXA 2HUPA 5FBVB 4PLYA 3JQ8B 2EP5A 3DNPA 3S7ZA 3TW8B 1FYDA 1XHEA 2BI4A 3KD2A 4FLMA 3TI9A 2J7KA 5L45A 3EZ2A 2CUZA 4QNNA 2BFBA 1P0FA 2HQRA 1LW7A 4BN4A 4ZMRA 1JPJA 3BDAA 2WJWA 2Q3EA 3IA2A 3OJLA 4BIIA 1MRNA 3D64A 1RHMA 3AINA 1KOLA 3T7IA 5IT5A 4OMUA 4N0EA 3IHWA 2WV7A 2ST1A 2ZRMA 4TYMA 1J20A 3FETA 2OGWA 3LUAA 4JSYA 5SYAA 2Z8YA 3P9IA 3DV0B 2QW1A 1QE5A 3DEYX 4Z0HO 3KEMA 3I45A 2X6QA 4G23A 1TF5A 1HRDA 4O2RA 1Z2DA 2X4IA 5E9JA 4RJKA