4HAXB

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1(k579a)-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/antibiotic
molecule keywords Exportin-1
total genus 34
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4haxB00
2AL6A 4K17A 3TO1A 1NU2A 1KZ7A 3ULCA 1ZC3B 1MIZB 4Y94A 3AU5A 3AU4A 3TVVA 5KQ1A 1WGUA 2DX5A 1Y5OA 3GYPA 1FHWA 1V89A 5D3YA 2COAA 4B6HA 2Y7BA 2N23A 2QKMA 2NMBA 1U2BA 2D9YA 1E5WA 4YONA 4TKNA 4F7HA 4C0AA 1RRPB 5JP4A 1KZGA 1EAZA 1AWEA 3D8FA 5LONB 3SNHA 3DXDA 1WI1A 3KY9A 3SYXA 3KRXA 5FI1A 1WVHA 4KVGB 3DXCA 1UNRA 3GYOA 2I1KA 2RVBB 4DBBA 3PSCA 2DKQA 4PNKA 2HTHB 4PQ0A 4HB4B 3ZVRA 1X1GA 2P8VA 2OTXA 2EC1A 1XR0B 4Z2NA 1FHOA 5DHAB 1UNPA 3VIAA 1SGHA 4HAVB 5C5BA 5KCVA 2L1CA 1RJ2A 3AJ4A 1TXDA 1Z87A 1XODA 1U5GA 1MAIA 2E2XA 4KHAA 3T06A 2DYQA 1J0WA 3PZDA 2UVMA 2VSZA 2Y8GA 1P3RA 2D9ZA 1W1GA 4DX90 5EFXA 5HE0A 4GZUA 1U27A 1MKEA 2IYBA 1LW3A 1ZM0A 1U5FA 1N3HA 2YS5A 1SHCA 2RNRB 3M1IB 4GMXB 3V5WA 1XCGA 2Z0OA 2DFKA 3DXEA 2P0HA 1UEFA 2ZPYA 2L2IA 2GCLA 2LG1A 2D4QA 3U7DA 1QC6A 3OANA 2LKOA 1DROA 3CIKA 5D3VA 2MKRA 2PZ1A 5KQ4A 2D9XA 2MFQA 5J3YA 4F7UP 2D2QA 3KSYA 4K81A 2YT0A 1U5DA 4F7GA 5DIFB 1H4RA 5C16A 3P6AA 3F5RA 3FSSA 2RGNB 1XKEA 5FI0A 1V5MA 4EJNA 1TJ6A 2CRFA 1PLSA 5D3WA 1NTVA 4MT7A 5C79A 2DYNA 1PMSA 1FAOA 4ZRJA 1ZSQA 2Z0PA 4P7IA 2ROZB 1GC6A 3QIJA 1PFJA 5DH9B 4HDOA 4CHJA 4K2PA 2R0DA 1AQCA 4A6FB 3WA0A 4MK0A 4NY0A 1UPRA 2EMSA 4IAPA 1DDWA 2W2WA 2P0DA 2K2JA 1FGYA 2ROVA 2J0KA 4WJ7A 2CY5A 1V5PA 3RCPA 2MDXA 3FEHA 2Q13A 3ULBA 1X1FA 5HE2A 3PVWA 2GJYA 2QKLA 2X18A 1V61A 1U5EA 1EF1A 1ZVRA 2KGXB 2YT1A 2VRWB 4L6EA 1GG3A 3LJUX 2ELAA 2KUPA 1NTYA 5D27A 5LOPB 2UZRA 3MPXA 4HHVA 1W1DA 1V5UA 3PEGA 2MWNB 2UZSA 3SV1A 2EJ8A 3QBVB 3VOQA 4CYEA 2COFA 2K2UA 5C6RA 2J0MA 3U8ZA 2LYDA 2M38A 1OMWA 4GPTB 2YRYA 2ELBA 2I5CA 2VKIA 4HAZB 5CLLB 1DDVA 2DHIA 2EMTA 4GMVA 1U29A 2M14A 4ZRIA 1IRSA 2YSZA 1Q67A 2XQNM 3FM8C 1UNQA 3HW2B 4EMOA 3O96A 1X05A 3N7CA 3PVLA 3SUZA 2BCJA 4A6FA 2OQBA 3A8PA 2I1JA 2D9VA 4WVFB 4ZRKA 1H10A 2RLOA 3MDBC 4IFSA 2AEHA 1DDMA 1MK9B 2DN6A 4HAYB 2CAYA 2N0YA 1XD4A 3A98B 2CY4A 2NZ8B 2YF0A 1MPHA 2DA0A 2ADZA 4BBKA 3WYFB 4GN1A 1J19A 1TQZA 2I5FA 1EGXA 4IOYX 4D0NB 1FGZA 1WG7A 5DHFB 1K5DB 1Y19B 1W1HA 1XX0A 3ODWA 2D9WA 4Z2MB 2H7DA 4HAWB 4TYZA 4XWXA 1FB8A 2YVCA 5J3QA 2DHJA 2YS3A 1M7RA 4A6HA 2P0FA 1LB1A 1WGQA 1ZC4B 5JHHA 2JP2A 2J0JA 2K00A 3TCAA 2DKPA 2LULA 4KAXB 3HK0A 5J3TA 4HAXB 1X86A 4DXAB 4KHBB 3BINA 4WSFA 1BAKA 2RUKB 3CXBB 1ISNA 2CODA 2W2XD 3IVFA 2G35A 2GCJA 3D8DA 5GOWB 4HB3B 3PVUA 4K2OA 2H7EA 2YS1A 2R09A 3UZTA 5CLQB 1OY2A 1X11A 2HE7A 3KZ1A 1FHXA 3ML4A 5C5BB 1NI2A 1BWNA 3A8QA 3KRWA 4HDQA 3G9WA 2IFSA 2J59M 2DX1A 3ODXA 4CHMA 3TW1A 1OQNA 3X23A 4MY6A 3NSUA 3ZDTA 5L81A 3P7ZA 5D3XA 1BTNA 2V76A 4HATB 3F0WA 4EKUA 1MK7B 1P5TA 2DTCA 2GS0A 4HB0B 1B55A 5JHGA 4HB2B 4YL8A 1V88A 2D10A 2LOXA 4KHOA 2Z0QA 2Y8FA 2LOZA 4H8SA 2DLWA 3PP2A 4HAUB 1FOEA 2DHKA 1M7EA 5DI9B 2FJLA 1MIXA 1DYNA 1UPQA 3BJIA 5JLJB 3QWMA 1WJMA 1P6SA 2KCJA 2W2XC 5HE3A 3D8EA 3HQCA 1QQGA 4NSWA 2RSGA 1DBHA 3SO6A 1WJ1A 4A6KA 1EVHA 1K5GB 1I2HA 3ODOA 4DX8A 1GC7A 3PG7A 3TFMA 1BTKA 4A5KA 1I7AA 2D11A 5HE1A 2COCA 1KI1B 4GXBA
chains in the Genus database with same CATH superfamily
2AL6A 4K17A 4OT1A 3TO1A 1NU2A 1KZ7A 3ULCA 1ZC3B 1MIZB 2FJUB 4Y94A 3AU5A 3AU4A 3TVVA 5KQ1A 1WGUA 2DX5A 1Y5OA 3GYPA 1FHWA 1V89A 5D3YA 2COAA 4B6HA 2Y7BA 2N23A 2QKMA 2NMBA 2Z59A 1U2BA 2D9YA 1E5WA 4YONA 4TKNA 4F7HA 4C0AA 1RRPB 5JP4A 1KZGA 1EAZA 1AWEA 3D8FA 5LONB 3SNHA 3DXDA 1WI1A 3KY9A 3SYXA 3KRXA 5FI1A 1WVHA 4KVGB 3DXCA 1MI1A 4GNKB 1UNRA 2K8EA 3GYOA 2I1KA 2RVBB 3HSAA 4DBBA 3PSCA 2DKQA 4PNKA 2HTHB 4PQ0A 4HB4B 3ZVRA 1X1GA 2P8VA 2OTXA 2EC1A 1XR0B 4Z2NA 1FHOA 5DHAB 1UNPA 2NBVA 3VIAA 1SGHA 4HAVB 5C5BA 5KCVA 2L1CA 1RJ2A 3AJ4A 1TXDA 3DCXA 1Z87A 1XODA 1U5GA 1MAIA 2E2XA 4KHAA 3T06A 2DYQA 1J0WA 3PZDA 2UVMA 2VSZA 2Y8GA 5IRSA 1P3RA 2D9ZA 2ZKMX 1W1GA 4DX90 5EFXA 5HE0A 4GZUA 1U27A 1MKEA 2IYBA 1LW3A 1ZM0A 4OSNA 1U5FA 1N3HA 2YS5A 1SHCA 2RNRB 3M1IB 4GMXB 3V5WA 1XCGA 2Z0OA 2DFKA 3DXEA 2P0HA 1UEFA 2ZPYA 2L2IA 2GCLA 2LG1A 2D4QA 2KR0A 3U7DA 1QC6A 3OANA 2LKOA 1DROA 4GOUA 3CIKA 5D3VA 2MKRA 2PZ1A 5KQ4A 2Z14A 2D9XA 2MFQA 5J3YA 4F7UP 2D2QA 3KSYA 4K81A 2YT0A 1U5DA 4F7GA 5DIFB 1H4RA 5C16A 3P6AA 3F5RA 3FSSA 2Z13A 2RGNB 1XKEA 5FI0A 1V5MA 4EJNA 2YT2A 1TJ6A 2CRFA 1PLSA 5D3WA 1NTVA 4MT7A 5C79A 2DYNA 1PMSA 1FAOA 4ZRJA 1ZSQA 2Z0PA 3NWDA 4P7IA 2ROZB 1GC6A 3QIJA 1PFJA 5DH9B 4HDOA 4CHJA 4K2PA 2R0DA 1AQCA 4A6FB 3WA0A 4MK0A 4NY0A 1UPRA 2EMSA 4IAPA 1DDWA 2W2WA 2P0DA 2K2JA 1FGYA 2ROVA 2J0KA 4WJ7A 2CY5A 1V5PA 3RCPA 2MDXA 3FEHA 2Q13A 3ULBA 1X1FA 5HE2A 3PVWA 2K49A 2GJYA 2QKLA 2X18A 1V61A 1U5EA 1EF1A 1ZVRA 2KGXB 2YT1A 2VRWB 4L6EA 1GG3A 3LJUX 2ELAA 2KUPA 1NTYA 3OHMB 5D27A 5LOPB 2UZRA 3MPXA 4HHVA 1W1DA 1V5UA 3PEGA 3HIEA 2MWNB 2UZSA 3SV1A 2EJ8A 3QBVB 3VOQA 4CYEA 2COFA 2K2UA 5C6RA 2J0MA 3U8ZA 2LYDA 2M38A 1OMWA 4GPTB 2YRYA 2ELBA 2I5CA 2VKIA 4HAZB 5CLLB 1ZYIA 1DDVA 5LG4B 2DHIA 2EMTA 4GMVA 1U29A 2M14A 4ZRIA 1IRSA 2YSZA 1Q67A 2XQNM 2KIEA 3FM8C 1UNQA 3HW2B 4EMOA 3O96A 1X05A 3N7CA 3PVLA 3SUZA 2BCJA 4D6WA 4A6FA 2OQBA 2R2YA 3A8PA 2I1JA 2D9VA 4WVFB 4ZRKA 4QJ3B 1H10A 2RLOA 3MDBC 4IFSA 2AEHA 1DDMA 1MK9B 2DN6A 4HAYB 2CAYA 1T77A 2N0YA 1XD4A 3A98B 2Z4DA 2CY4A 2NZ8B 2YF0A 1MPHA 2DA0A 2RRFA 2ADZA 4BBKA 3WYFB 4GN1A 1J19A 1TQZA 2I5FA 1EGXA 4IOYX 4CSQA 4D0NB 1FGZA 1WG7A 5DHFB 1K5DB 5I2MA 1Y19B 1W1HA 1XX0A 3A58A 3ODWA 2D9WA 4Z2MB 2H7DA 4HAWB 4TYZA 4XWXA 1FB8A 2YVCA 4QXAB 2DHJA 3B77A 5J3QA 2YS3A 1M7RA 4A6HA 3FVCA 3NW8A 2P0FA 1LB1A 4L1RA 1WGQA 1ZC4B 5JHHA 2JP2A 2J0JA 2K00A 3TCAA 2DKPA 2LULA 4KAXB 3HK0A 5J3TA 4HAXB 1X86A 4DXAB 4KHBB 3BINA 4WSFA 3NWFA 1BAKA 2RUKB 3CXBB 1ISNA 2CODA 2W2XD 2KUQA 3IVFA 2G35A 2GCJA 3D8DA 2GUMA 5GOWB 4HB3B 3PVUA 4K2OA 2H7EA 2YS1A 3U12A 2R09A 3UZTA 5CLQB 1OY2A 1X11A 2HE7A 3KZ1A 1FHXA 3ML4A 5C5BB 1NI2A 1BWNA 3A8QA 3KRWA 4HDQA 3G9WA 5M4YB 2IFSA 2J59M 2DX1A 3ODXA 4CHMA 3TW1A 1OQNA 3X23A 4MY6A 3NSUA 3ZDTA 5L81A 3P7ZA 5D3XA 2KIGA 1BTNA 2V76A 4HSIA 4HATB 3F0WA 3NWAA 4EKUA 1MK7B 1P5TA 5I2SA 2DTCA 2GS0A 4HB0B 1B55A 4QJ5B 5JHGA 4HB2B 4YL8A 1V88A 2D10A 2LOXA 4KHOA 2Z0QA 2Y8FA 4KHBA 2LOZA 4H8SA 2DLWA 3PP2A 4HAUB 1FOEA 2DHKA 1M7EA 5DI9B 2FJLA 1MIXA 1DYNA 1UPQA 3BJIA 5JLJB 3QWMA 1WJMA 1P6SA 4QJ4B 2KCJA 2W2XC 5HE3A 3D8EA 3HQCA 1QQGA 4NSWA 2RSGA 1DBHA 3SO6A 1WJ1A 4A6KA 1EVHA 1K5GB 1I2HA 3ODOA 4DX8A 4DIXA 1GC7A 3PG7A 3TFMA 1BTKA 4A5KA 1I7AA 2D11A 5HE1A 2COCA 1KI1B 4GXBA
chains in the Genus database with same CATH topology
2AL6A 4K17A 3TO1A 1NU2A 1KZ7A 3ULCA 1ZC3B 1MIZB 4Y94A 3AU5A 3AU4A 3TVVA 5KQ1A 1WGUA 2DX5A 1Y5OA 3GYPA 1FHWA 1V89A 5D3YA 2COAA 4B6HA 2Y7BA 2N23A 2QKMA 2NMBA 1U2BA 2D9YA 1E5WA 4YONA 4TKNA 4F7HA 4C0AA 1RRPB 5JP4A 1KZGA 1EAZA 1AWEA 3D8FA 5LONB 3SNHA 3DXDA 1WI1A 3KY9A 3SYXA 3KRXA 5FI1A 1WVHA 4KVGB 3DXCA 1UNRA 3GYOA 2I1KA 2RVBB 4DBBA 3PSCA 2DKQA 4PNKA 2HTHB 4PQ0A 4HB4B 3ZVRA 1X1GA 2P8VA 2OTXA 2EC1A 1XR0B 4Z2NA 1FHOA 5DHAB 1UNPA 3VIAA 1SGHA 4HAVB 5C5BA 5KCVA 2L1CA 1RJ2A 3AJ4A 1TXDA 1Z87A 1XODA 1U5GA 1MAIA 2E2XA 4KHAA 3T06A 2DYQA 1J0WA 3PZDA 2UVMA 2VSZA 2Y8GA 1P3RA 2D9ZA 1W1GA 4DX90 5EFXA 5HE0A 4GZUA 1U27A 1MKEA 2IYBA 1LW3A 1ZM0A 1U5FA 1N3HA 2YS5A 1SHCA 2RNRB 3M1IB 4GMXB 3V5WA 1XCGA 2Z0OA 2DFKA 3DXEA 2P0HA 1UEFA 2ZPYA 2L2IA 2GCLA 2LG1A 2D4QA 3U7DA 1QC6A 3OANA 2LKOA 1DROA 3CIKA 5D3VA 2MKRA 2PZ1A 5KQ4A 2D9XA 2MFQA 5J3YA 4F7UP 2D2QA 3KSYA 4K81A 2YT0A 1U5DA 4F7GA 5DIFB 1H4RA 5C16A 3P6AA 3F5RA 3FSSA 2RGNB 1XKEA 5FI0A 1V5MA 4EJNA 1TJ6A 2CRFA 1PLSA 5D3WA 1NTVA 4MT7A 5C79A 2DYNA 1PMSA 1FAOA 4ZRJA 1ZSQA 2Z0PA 4P7IA 2ROZB 1GC6A 3QIJA 1PFJA 5DH9B 4HDOA 4CHJA 4K2PA 2R0DA 1AQCA 4A6FB 3WA0A 4MK0A 4NY0A 1UPRA 2EMSA 4IAPA 1DDWA 2W2WA 2P0DA 2K2JA 1FGYA 2ROVA 2J0KA 4WJ7A 2CY5A 1V5PA 3RCPA 2MDXA 3FEHA 2Q13A 3ULBA 1X1FA 5HE2A 3PVWA 2GJYA 2QKLA 2X18A 1V61A 1U5EA 1EF1A 1ZVRA 2KGXB 2YT1A 2VRWB 4L6EA 1GG3A 3LJUX 2ELAA 2KUPA 1NTYA 5D27A 5LOPB 2UZRA 3MPXA 4HHVA 1W1DA 1V5UA 3PEGA 2MWNB 2UZSA 3SV1A 2EJ8A 3QBVB 3VOQA 4CYEA 2COFA 2K2UA 5C6RA 2J0MA 3U8ZA 2LYDA 2M38A 1OMWA 4GPTB 2YRYA 2ELBA 2I5CA 2VKIA 4HAZB 5CLLB 1DDVA 2DHIA 2EMTA 4GMVA 1U29A 2M14A 4ZRIA 1IRSA 2YSZA 1Q67A 2XQNM 3FM8C 1UNQA 3HW2B 4EMOA 3O96A 1X05A 3N7CA 3PVLA 3SUZA 2BCJA 4A6FA 2OQBA 3A8PA 2I1JA 2D9VA 4WVFB 4ZRKA 1H10A 2RLOA 3MDBC 4IFSA 2AEHA 1DDMA 1MK9B 2DN6A 4HAYB 2CAYA 2N0YA 1XD4A 3A98B 2CY4A 2NZ8B 2YF0A 1MPHA 2DA0A 2ADZA 4BBKA 3WYFB 4GN1A 1J19A 1TQZA 2I5FA 1EGXA 4IOYX 4D0NB 1FGZA 1WG7A 5DHFB 1K5DB 1Y19B 1W1HA 1XX0A 3ODWA 2D9WA 4Z2MB 2H7DA 4HAWB 4TYZA 4XWXA 1FB8A 2YVCA 5J3QA 2DHJA 2YS3A 1M7RA 4A6HA 2P0FA 1LB1A 1WGQA 1ZC4B 5JHHA 2JP2A 2J0JA 2K00A 3TCAA 2DKPA 2LULA 4KAXB 3HK0A 5J3TA 4HAXB 1X86A 4DXAB 4KHBB 3BINA 4WSFA 1BAKA 2RUKB 3CXBB 1ISNA 2CODA 2W2XD 3IVFA 2G35A 2GCJA 3D8DA 5GOWB 4HB3B 3PVUA 4K2OA 2H7EA 2YS1A 2R09A 3UZTA 5CLQB 1OY2A 1X11A 2HE7A 3KZ1A 1FHXA 3ML4A 5C5BB 1NI2A 1BWNA 3A8QA 3KRWA 4HDQA 3G9WA 2IFSA 2J59M 2DX1A 3ODXA 4CHMA 3TW1A 1OQNA 3X23A 4MY6A 3NSUA 3ZDTA 5L81A 3P7ZA 5D3XA 1BTNA 2V76A 4HATB 3F0WA 4EKUA 1MK7B 1P5TA 2DTCA 2GS0A 4HB0B 1B55A 5JHGA 4HB2B 4YL8A 1V88A 2D10A 2LOXA 4KHOA 2Z0QA 2Y8FA 2LOZA 4H8SA 2DLWA 3PP2A 4HAUB 1FOEA 2DHKA 1M7EA 5DI9B 2FJLA 1MIXA 1DYNA 1UPQA 3BJIA 5JLJB 3QWMA 1WJMA 1P6SA 2KCJA 2W2XC 5HE3A 3D8EA 3HQCA 1QQGA 4NSWA 2RSGA 1DBHA 3SO6A 1WJ1A 4A6KA 1EVHA 1K5GB 1I2HA 3ODOA 4DX8A 1GC7A 3PG7A 3TFMA 1BTKA 4A5KA 1I7AA 2D11A 5HE1A 2COCA 1KI1B 4GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  4K17 A;  3TO1 A;  1NU2 A;  1KZ7 A;  3ULC A;  1ZC3 B;  1MIZ B;  4Y94 A;  3AU5 A;  3AU4 A;  3TVV A;  5KQ1 A;  1WGU A;  2DX5 A;  1Y5O A;  3GYP A;  1FHW A;  1V89 A;  5D3Y A;  2COA A;  4B6H A;  2Y7B A;  2N23 A;  2QKM A;  2NMB A;  1U2B A;  2D9Y A;  1E5W A;  4YON A;  4TKN A;  4F7H A;  4C0A A;  1RRP B;  5JP4 A;  1KZG A;  1EAZ A;  1AWE A;  3D8F A;  5LON B;  3SNH A;  3DXD A;  1WI1 A;  3KY9 A;  3SYX A;  3KRX A;  5FI1 A;  1WVH A;  4KVG B;  3DXC A;  1UNR A;  3GYO A;  2I1K A;  2RVB B;  4DBB A;  3PSC A;  2DKQ A;  4PNK A;  2HTH B;  4PQ0 A;  4HB4 B;  3ZVR A;  1X1G A;  2P8V A;  2OTX A;  2EC1 A;  1XR0 B;  4Z2N A;  1FHO A;  5DHA B;  1UNP A;  3VIA A;  1SGH A;  4HAV B;  5C5B A;  5KCV A;  2L1C A;  1RJ2 A;  3AJ4 A;  1TXD A;  1Z87 A;  1XOD A;  1U5G A;  1MAI A;  2E2X A;  4KHA A;  3T06 A;  2DYQ A;  1J0W A;  3PZD A;  2UVM A;  2VSZ A;  2Y8G A;  1P3R A;  2D9Z A;  1W1G A;  4DX9 0;  5EFX A;  5HE0 A;  4GZU A;  1U27 A;  1MKE A;  2IYB A;  1LW3 A;  1ZM0 A;  1U5F A;  1N3H A;  2YS5 A;  1SHC A;  2RNR B;  3M1I B;  4GMX B;  3V5W A;  1XCG A;  2Z0O A;  2DFK A;  3DXE A;  2P0H A;  1UEF A;  2ZPY A;  2L2I A;  2GCL A;  2LG1 A;  2D4Q A;  3U7D A;  1QC6 A;  3OAN A;  2LKO A;  1DRO A;  3CIK A;  5D3V A;  2MKR A;  2PZ1 A;  5KQ4 A;  2D9X A;  2MFQ A;  5J3Y A;  4F7U P;  2D2Q A;  3KSY A;  4K81 A;  2YT0 A;  1U5D A;  4F7G A;  5DIF B;  1H4R A;  5C16 A;  3P6A A;  3F5R A;  3FSS A;  2RGN B;  1XKE A;  5FI0 A;  1V5M A;  4EJN A;  1TJ6 A;  2CRF A;  1PLS A;  5D3W A;  1NTV A;  4MT7 A;  5C79 A;  2DYN A;  1PMS A;  1FAO A;  4ZRJ A;  1ZSQ A;  2Z0P A;  4P7I A;  2ROZ B;  1GC6 A;  3QIJ A;  1PFJ A;  5DH9 B;  4HDO A;  4CHJ A;  4K2P A;  2R0D A;  1AQC A;  4A6F B;  3WA0 A;  4MK0 A;  4NY0 A;  1UPR A;  2EMS A;  4IAP A;  1DDW A;  2W2W A;  2P0D A;  2K2J A;  1FGY A;  2ROV A;  2J0K A;  4WJ7 A;  2CY5 A;  1V5P A;  3RCP A;  2MDX A;  3FEH A;  2Q13 A;  3ULB A;  1X1F A;  5HE2 A;  3PVW A;  2GJY A;  2QKL A;  2X18 A;  1V61 A;  1U5E A;  1EF1 A;  1ZVR A;  2KGX B;  2YT1 A;  2VRW B;  4L6E A;  1GG3 A;  3LJU X;  2ELA A;  2KUP A;  1NTY A;  5D27 A;  5LOP B;  2UZR A;  3MPX A;  4HHV A;  1W1D A;  1V5U A;  3PEG A;  2MWN B;  2UZS A;  3SV1 A;  2EJ8 A;  3QBV B;  3VOQ A;  4CYE A;  2COF A;  2K2U A;  5C6R A;  2J0M A;  3U8Z A;  2LYD A;  2M38 A;  1OMW A;  4GPT B;  2YRY A;  2ELB A;  2I5C A;  2VKI A;  4HAZ B;  5CLL B;  1DDV A;  2DHI A;  2EMT A;  4GMV A;  1U29 A;  2M14 A;  4ZRI A;  1IRS A;  2YSZ A;  1Q67 A;  2XQN M;  3FM8 C;  1UNQ A;  3HW2 B;  4EMO A;  3O96 A;  1X05 A;  3N7C A;  3PVL A;  3SUZ A;  2BCJ A;  4A6F A;  2OQB A;  3A8P A;  2I1J A;  2D9V A;  4WVF B;  4ZRK A;  1H10 A;  2RLO A;  3MDB C;  4IFS A;  2AEH A;  1DDM A;  1MK9 B;  2DN6 A;  4HAY B;  2CAY A;  2N0Y A;  1XD4 A;  3A98 B;  2CY4 A;  2NZ8 B;  2YF0 A;  1MPH A;  2DA0 A;  2ADZ A;  4BBK A;  3WYF B;  4GN1 A;  1J19 A;  1TQZ A;  2I5F A;  1EGX A;  4IOY X;  4D0N B;  1FGZ A;  1WG7 A;  5DHF B;  1K5D B;  1Y19 B;  1W1H A;  1XX0 A;  3ODW A;  2D9W A;  4Z2M B;  2H7D A;  4HAW B;  4TYZ A;  4XWX A;  1FB8 A;  2YVC A;  5J3Q A;  2DHJ A;  2YS3 A;  1M7R A;  4A6H A;  2P0F A;  1LB1 A;  1WGQ A;  1ZC4 B;  5JHH A;  2JP2 A;  2J0J A;  2K00 A;  3TCA A;  2DKP A;  2LUL A;  4KAX B;  3HK0 A;  5J3T A;  4HAX B;  1X86 A;  4DXA B;  4KHB B;  3BIN A;  4WSF A;  1BAK A;  2RUK B;  3CXB B;  1ISN A;  2COD A;  2W2X D;  3IVF A;  2G35 A;  2GCJ A;  3D8D A;  5GOW B;  4HB3 B;  3PVU A;  4K2O A;  2H7E A;  2YS1 A;  2R09 A;  3UZT A;  5CLQ B;  1OY2 A;  1X11 A;  2HE7 A;  3KZ1 A;  1FHX A;  3ML4 A;  5C5B B;  1NI2 A;  1BWN A;  3A8Q A;  3KRW A;  4HDQ A;  3G9W A;  2IFS A;  2J59 M;  2DX1 A;  3ODX A;  4CHM A;  3TW1 A;  1OQN A;  3X23 A;  4MY6 A;  3NSU A;  3ZDT A;  5L81 A;  3P7Z A;  5D3X A;  1BTN A;  2V76 A;  4HAT B;  3F0W A;  4EKU A;  1MK7 B;  1P5T A;  2DTC A;  2GS0 A;  4HB0 B;  1B55 A;  5JHG A;  4HB2 B;  4YL8 A;  1V88 A;  2D10 A;  2LOX A;  4KHO A;  2Z0Q A;  2Y8F A;  2LOZ A;  4H8S A;  2DLW A;  3PP2 A;  4HAU B;  1FOE A;  2DHK A;  1M7E A;  5DI9 B;  2FJL A;  1MIX A;  1DYN A;  1UPQ A;  3BJI A;  5JLJ B;  3QWM A;  1WJM A;  1P6S A;  2KCJ A;  2W2X C;  5HE3 A;  3D8E A;  3HQC A;  1QQG A;  4NSW A;  2RSG A;  1DBH A;  3SO6 A;  1WJ1 A;  4A6K A;  1EVH A;  1K5G B;  1I2H A;  3ODO A;  4DX8 A;  1GC7 A;  3PG7 A;  3TFM A;  1BTK A;  4A5K A;  1I7A A;  2D11 A;  5HE1 A;  2COC A;  1KI1 B;  4GXB A; 
#chains in the Genus database with same CATH topology
 2AL6 A;  4K17 A;  4OT1 A;  3TO1 A;  1NU2 A;  1KZ7 A;  3ULC A;  1ZC3 B;  1MIZ B;  2FJU B;  4Y94 A;  3AU5 A;  3AU4 A;  3TVV A;  5KQ1 A;  1WGU A;  2DX5 A;  1Y5O A;  3GYP A;  1FHW A;  1V89 A;  5D3Y A;  2COA A;  4B6H A;  2Y7B A;  2N23 A;  2QKM A;  2NMB A;  2Z59 A;  1U2B A;  2D9Y A;  1E5W A;  4YON A;  4TKN A;  4F7H A;  4C0A A;  1RRP B;  5JP4 A;  1KZG A;  1EAZ A;  1AWE A;  3D8F A;  5LON B;  3SNH A;  3DXD A;  1WI1 A;  3KY9 A;  3SYX A;  3KRX A;  5FI1 A;  1WVH A;  4KVG B;  3DXC A;  1MI1 A;  4GNK B;  1UNR A;  2K8E A;  3GYO A;  2I1K A;  2RVB B;  3HSA A;  4DBB A;  3PSC A;  2DKQ A;  4PNK A;  2HTH B;  4PQ0 A;  4HB4 B;  3ZVR A;  1X1G A;  2P8V A;  2OTX A;  2EC1 A;  1XR0 B;  4Z2N A;  1FHO A;  5DHA B;  1UNP A;  2NBV A;  3VIA A;  1SGH A;  4HAV B;  5C5B A;  5KCV A;  2L1C A;  1RJ2 A;  3AJ4 A;  1TXD A;  3DCX A;  1Z87 A;  1XOD A;  1U5G A;  1MAI A;  2E2X A;  4KHA A;  3T06 A;  2DYQ A;  1J0W A;  3PZD A;  2UVM A;  2VSZ A;  2Y8G A;  5IRS A;  1P3R A;  2D9Z A;  2ZKM X;  1W1G A;  4DX9 0;  5EFX A;  5HE0 A;  4GZU A;  1U27 A;  1MKE A;  2IYB A;  1LW3 A;  1ZM0 A;  4OSN A;  1U5F A;  1N3H A;  2YS5 A;  1SHC A;  2RNR B;  3M1I B;  4GMX B;  3V5W A;  1XCG A;  2Z0O A;  2DFK A;  3DXE A;  2P0H A;  1UEF A;  2ZPY A;  2L2I A;  2GCL A;  2LG1 A;  2D4Q A;  2KR0 A;  3U7D A;  1QC6 A;  3OAN A;  2LKO A;  1DRO A;  4GOU A;  3CIK A;  5D3V A;  2MKR A;  2PZ1 A;  5KQ4 A;  2Z14 A;  2D9X A;  2MFQ A;  5J3Y A;  4F7U P;  2D2Q A;  3KSY A;  4K81 A;  2YT0 A;  1U5D A;  4F7G A;  5DIF B;  1H4R A;  5C16 A;  3P6A A;  3F5R A;  3FSS A;  2Z13 A;  2RGN B;  1XKE A;  5FI0 A;  1V5M A;  4EJN A;  2YT2 A;  1TJ6 A;  2CRF A;  1PLS A;  5D3W A;  1NTV A;  4MT7 A;  5C79 A;  2DYN A;  1PMS A;  1FAO A;  4ZRJ A;  1ZSQ A;  2Z0P A;  3NWD A;  4P7I A;  2ROZ B;  1GC6 A;  3QIJ A;  1PFJ A;  5DH9 B;  4HDO A;  4CHJ A;  4K2P A;  2R0D A;  1AQC A;  4A6F B;  3WA0 A;  4MK0 A;  4NY0 A;  1UPR A;  2EMS A;  4IAP A;  1DDW A;  2W2W A;  2P0D A;  2K2J A;  1FGY A;  2ROV A;  2J0K A;  4WJ7 A;  2CY5 A;  1V5P A;  3RCP A;  2MDX A;  3FEH A;  2Q13 A;  3ULB A;  1X1F A;  5HE2 A;  3PVW A;  2K49 A;  2GJY A;  2QKL A;  2X18 A;  1V61 A;  1U5E A;  1EF1 A;  1ZVR A;  2KGX B;  2YT1 A;  2VRW B;  4L6E A;  1GG3 A;  3LJU X;  2ELA A;  2KUP A;  1NTY A;  3OHM B;  5D27 A;  5LOP B;  2UZR A;  3MPX A;  4HHV A;  1W1D A;  1V5U A;  3PEG A;  3HIE A;  2MWN B;  2UZS A;  3SV1 A;  2EJ8 A;  3QBV B;  3VOQ A;  4CYE A;  2COF A;  2K2U A;  5C6R A;  2J0M A;  3U8Z A;  2LYD A;  2M38 A;  1OMW A;  4GPT B;  2YRY A;  2ELB A;  2I5C A;  2VKI A;  4HAZ B;  5CLL B;  1ZYI A;  1DDV A;  5LG4 B;  2DHI A;  2EMT A;  4GMV A;  1U29 A;  2M14 A;  4ZRI A;  1IRS A;  2YSZ A;  1Q67 A;  2XQN M;  2KIE A;  3FM8 C;  1UNQ A;  3HW2 B;  4EMO A;  3O96 A;  1X05 A;  3N7C A;  3PVL A;  3SUZ A;  2BCJ A;  4D6W A;  4A6F A;  2OQB A;  2R2Y A;  3A8P A;  2I1J A;  2D9V A;  4WVF B;  4ZRK A;  4QJ3 B;  1H10 A;  2RLO A;  3MDB C;  4IFS A;  2AEH A;  1DDM A;  1MK9 B;  2DN6 A;  4HAY B;  2CAY A;  1T77 A;  2N0Y A;  1XD4 A;  3A98 B;  2Z4D A;  2CY4 A;  2NZ8 B;  2YF0 A;  1MPH A;  2DA0 A;  2RRF A;  2ADZ A;  4BBK A;  3WYF B;  4GN1 A;  1J19 A;  1TQZ A;  2I5F A;  1EGX A;  4IOY X;  4CSQ A;  4D0N B;  1FGZ A;  1WG7 A;  5DHF B;  1K5D B;  5I2M A;  1Y19 B;  1W1H A;  1XX0 A;  3A58 A;  3ODW A;  2D9W A;  4Z2M B;  2H7D A;  4HAW B;  4TYZ A;  4XWX A;  1FB8 A;  2YVC A;  4QXA B;  2DHJ A;  3B77 A;  5J3Q A;  2YS3 A;  1M7R A;  4A6H A;  3FVC A;  3NW8 A;  2P0F A;  1LB1 A;  4L1R A;  1WGQ A;  1ZC4 B;  5JHH A;  2JP2 A;  2J0J A;  2K00 A;  3TCA A;  2DKP A;  2LUL A;  4KAX B;  3HK0 A;  5J3T A;  4HAX B;  1X86 A;  4DXA B;  4KHB B;  3BIN A;  4WSF A;  3NWF A;  1BAK A;  2RUK B;  3CXB B;  1ISN A;  2COD A;  2W2X D;  2KUQ A;  3IVF A;  2G35 A;  2GCJ A;  3D8D A;  2GUM A;  5GOW B;  4HB3 B;  3PVU A;  4K2O A;  2H7E A;  2YS1 A;  3U12 A;  2R09 A;  3UZT A;  5CLQ B;  1OY2 A;  1X11 A;  2HE7 A;  3KZ1 A;  1FHX A;  3ML4 A;  5C5B B;  1NI2 A;  1BWN A;  3A8Q A;  3KRW A;  4HDQ A;  3G9W A;  5M4Y B;  2IFS A;  2J59 M;  2DX1 A;  3ODX A;  4CHM A;  3TW1 A;  1OQN A;  3X23 A;  4MY6 A;  3NSU A;  3ZDT A;  5L81 A;  3P7Z A;  5D3X A;  2KIG A;  1BTN A;  2V76 A;  4HSI A;  4HAT B;  3F0W A;  3NWA A;  4EKU A;  1MK7 B;  1P5T A;  5I2S A;  2DTC A;  2GS0 A;  4HB0 B;  1B55 A;  4QJ5 B;  5JHG A;  4HB2 B;  4YL8 A;  1V88 A;  2D10 A;  2LOX A;  4KHO A;  2Z0Q A;  2Y8F A;  4KHB A;  2LOZ A;  4H8S A;  2DLW A;  3PP2 A;  4HAU B;  1FOE A;  2DHK A;  1M7E A;  5DI9 B;  2FJL A;  1MIX A;  1DYN A;  1UPQ A;  3BJI A;  5JLJ B;  3QWM A;  1WJM A;  1P6S A;  4QJ4 B;  2KCJ A;  2W2X C;  5HE3 A;  3D8E A;  3HQC A;  1QQG A;  4NSW A;  2RSG A;  1DBH A;  3SO6 A;  1WJ1 A;  4A6K A;  1EVH A;  1K5G B;  1I2H A;  3ODO A;  4DX8 A;  4DIX A;  1GC7 A;  3PG7 A;  3TFM A;  1BTK A;  4A5K A;  1I7A A;  2D11 A;  5HE1 A;  2COC A;  1KI1 B;  4GXB A; 
#chains in the Genus database with same CATH homology
 2AL6 A;  4K17 A;  3TO1 A;  1NU2 A;  1KZ7 A;  3ULC A;  1ZC3 B;  1MIZ B;  4Y94 A;  3AU5 A;  3AU4 A;  3TVV A;  5KQ1 A;  1WGU A;  2DX5 A;  1Y5O A;  3GYP A;  1FHW A;  1V89 A;  5D3Y A;  2COA A;  4B6H A;  2Y7B A;  2N23 A;  2QKM A;  2NMB A;  1U2B A;  2D9Y A;  1E5W A;  4YON A;  4TKN A;  4F7H A;  4C0A A;  1RRP B;  5JP4 A;  1KZG A;  1EAZ A;  1AWE A;  3D8F A;  5LON B;  3SNH A;  3DXD A;  1WI1 A;  3KY9 A;  3SYX A;  3KRX A;  5FI1 A;  1WVH A;  4KVG B;  3DXC A;  1UNR A;  3GYO A;  2I1K A;  2RVB B;  4DBB A;  3PSC A;  2DKQ A;  4PNK A;  2HTH B;  4PQ0 A;  4HB4 B;  3ZVR A;  1X1G A;  2P8V A;  2OTX A;  2EC1 A;  1XR0 B;  4Z2N A;  1FHO A;  5DHA B;  1UNP A;  3VIA A;  1SGH A;  4HAV B;  5C5B A;  5KCV A;  2L1C A;  1RJ2 A;  3AJ4 A;  1TXD A;  1Z87 A;  1XOD A;  1U5G A;  1MAI A;  2E2X A;  4KHA A;  3T06 A;  2DYQ A;  1J0W A;  3PZD A;  2UVM A;  2VSZ A;  2Y8G A;  1P3R A;  2D9Z A;  1W1G A;  4DX9 0;  5EFX A;  5HE0 A;  4GZU A;  1U27 A;  1MKE A;  2IYB A;  1LW3 A;  1ZM0 A;  1U5F A;  1N3H A;  2YS5 A;  1SHC A;  2RNR B;  3M1I B;  4GMX B;  3V5W A;  1XCG A;  2Z0O A;  2DFK A;  3DXE A;  2P0H A;  1UEF A;  2ZPY A;  2L2I A;  2GCL A;  2LG1 A;  2D4Q A;  3U7D A;  1QC6 A;  3OAN A;  2LKO A;  1DRO A;  3CIK A;  5D3V A;  2MKR A;  2PZ1 A;  5KQ4 A;  2D9X A;  2MFQ A;  5J3Y A;  4F7U P;  2D2Q A;  3KSY A;  4K81 A;  2YT0 A;  1U5D A;  4F7G A;  5DIF B;  1H4R A;  5C16 A;  3P6A A;  3F5R A;  3FSS A;  2RGN B;  1XKE A;  5FI0 A;  1V5M A;  4EJN A;  1TJ6 A;  2CRF A;  1PLS A;  5D3W A;  1NTV A;  4MT7 A;  5C79 A;  2DYN A;  1PMS A;  1FAO A;  4ZRJ A;  1ZSQ A;  2Z0P A;  4P7I A;  2ROZ B;  1GC6 A;  3QIJ A;  1PFJ A;  5DH9 B;  4HDO A;  4CHJ A;  4K2P A;  2R0D A;  1AQC A;  4A6F B;  3WA0 A;  4MK0 A;  4NY0 A;  1UPR A;  2EMS A;  4IAP A;  1DDW A;  2W2W A;  2P0D A;  2K2J A;  1FGY A;  2ROV A;  2J0K A;  4WJ7 A;  2CY5 A;  1V5P A;  3RCP A;  2MDX A;  3FEH A;  2Q13 A;  3ULB A;  1X1F A;  5HE2 A;  3PVW A;  2GJY A;  2QKL A;  2X18 A;  1V61 A;  1U5E A;  1EF1 A;  1ZVR A;  2KGX B;  2YT1 A;  2VRW B;  4L6E A;  1GG3 A;  3LJU X;  2ELA A;  2KUP A;  1NTY A;  5D27 A;  5LOP B;  2UZR A;  3MPX A;  4HHV A;  1W1D A;  1V5U A;  3PEG A;  2MWN B;  2UZS A;  3SV1 A;  2EJ8 A;  3QBV B;  3VOQ A;  4CYE A;  2COF A;  2K2U A;  5C6R A;  2J0M A;  3U8Z A;  2LYD A;  2M38 A;  1OMW A;  4GPT B;  2YRY A;  2ELB A;  2I5C A;  2VKI A;  4HAZ B;  5CLL B;  1DDV A;  2DHI A;  2EMT A;  4GMV A;  1U29 A;  2M14 A;  4ZRI A;  1IRS A;  2YSZ A;  1Q67 A;  2XQN M;  3FM8 C;  1UNQ A;  3HW2 B;  4EMO A;  3O96 A;  1X05 A;  3N7C A;  3PVL A;  3SUZ A;  2BCJ A;  4A6F A;  2OQB A;  3A8P A;  2I1J A;  2D9V A;  4WVF B;  4ZRK A;  1H10 A;  2RLO A;  3MDB C;  4IFS A;  2AEH A;  1DDM A;  1MK9 B;  2DN6 A;  4HAY B;  2CAY A;  2N0Y A;  1XD4 A;  3A98 B;  2CY4 A;  2NZ8 B;  2YF0 A;  1MPH A;  2DA0 A;  2ADZ A;  4BBK A;  3WYF B;  4GN1 A;  1J19 A;  1TQZ A;  2I5F A;  1EGX A;  4IOY X;  4D0N B;  1FGZ A;  1WG7 A;  5DHF B;  1K5D B;  1Y19 B;  1W1H A;  1XX0 A;  3ODW A;  2D9W A;  4Z2M B;  2H7D A;  4HAW B;  4TYZ A;  4XWX A;  1FB8 A;  2YVC A;  5J3Q A;  2DHJ A;  2YS3 A;  1M7R A;  4A6H A;  2P0F A;  1LB1 A;  1WGQ A;  1ZC4 B;  5JHH A;  2JP2 A;  2J0J A;  2K00 A;  3TCA A;  2DKP A;  2LUL A;  4KAX B;  3HK0 A;  5J3T A;  4HAX B;  1X86 A;  4DXA B;  4KHB B;  3BIN A;  4WSF A;  1BAK A;  2RUK B;  3CXB B;  1ISN A;  2COD A;  2W2X D;  3IVF A;  2G35 A;  2GCJ A;  3D8D A;  5GOW B;  4HB3 B;  3PVU A;  4K2O A;  2H7E A;  2YS1 A;  2R09 A;  3UZT A;  5CLQ B;  1OY2 A;  1X11 A;  2HE7 A;  3KZ1 A;  1FHX A;  3ML4 A;  5C5B B;  1NI2 A;  1BWN A;  3A8Q A;  3KRW A;  4HDQ A;  3G9W A;  2IFS A;  2J59 M;  2DX1 A;  3ODX A;  4CHM A;  3TW1 A;  1OQN A;  3X23 A;  4MY6 A;  3NSU A;  3ZDT A;  5L81 A;  3P7Z A;  5D3X A;  1BTN A;  2V76 A;  4HAT B;  3F0W A;  4EKU A;  1MK7 B;  1P5T A;  2DTC A;  2GS0 A;  4HB0 B;  1B55 A;  5JHG A;  4HB2 B;  4YL8 A;  1V88 A;  2D10 A;  2LOX A;  4KHO A;  2Z0Q A;  2Y8F A;  2LOZ A;  4H8S A;  2DLW A;  3PP2 A;  4HAU B;  1FOE A;  2DHK A;  1M7E A;  5DI9 B;  2FJL A;  1MIX A;  1DYN A;  1UPQ A;  3BJI A;  5JLJ B;  3QWM A;  1WJM A;  1P6S A;  2KCJ A;  2W2X C;  5HE3 A;  3D8E A;  3HQC A;  1QQG A;  4NSW A;  2RSG A;  1DBH A;  3SO6 A;  1WJ1 A;  4A6K A;  1EVH A;  1K5G B;  1I2H A;  3ODO A;  4DX8 A;  1GC7 A;  3PG7 A;  3TFM A;  1BTK A;  4A5K A;  1I7A A;  2D11 A;  5HE1 A;  2COC A;  1KI1 B;  4GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...