4HAXB

Crystal structure of crm1 inhibitor ratjadone a in complex with crm1(k579a)-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
131
Chain Sequence
IHFEPVVKTMEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/antibiotic
total genus 34
structure length 131
sequence length 138
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4haxB00
1U29A 2FJLA 4IOYX 3GYOA 4GZUA 2IFSA 1E5WA 2AL6A 2DTCA 4L6EA 2N23A 4YONA 3PVLA 2DKQA 1MK9B 5HE1A 3SV1A 5J3YA 2DHIA 4NY0A 1UPRA 4WSFA 2IYBA 1NU2A 2E2XA 5JHGA 5L81A 2P0FA 3VOQA 3D8DA 4XWXA 1EAZA 3TCAA 3WYFB 2L1CA 5LONB 1I7AA 2M38A 2KUPA 5HE2A 3KY9A 4Z2NA 1ZVRA 1KZGA 3TW1A 3PG7A 1DBHA 1MPHA 2DX1A 1DROA 4BBKA 1RJ2A 1TJ6A 1OY2A 3OANA 3ODOA 1X1GA 2I1JA 2MDXA 3ODXA 2NMBA 1WGUA 4HATB 1BWNA 4KHAA 3O96A 4KAXB 3D8FA 3F0WA 2P8VA 5D3WA 4CYEA 3MPXA 1GG3A 3QIJA 1MIZB 1MAIA 2MKRA 2Z0PA 4HAYB 5C5BB 2V76A 3KRWA 3DXCA 1FAOA 1ZM0A 3VIAA 2G35A 1WI1A 2M14A 3HQCA 5HE0A 1EVHA 1U5FA 4K81A 5D3YA 3SYXA 3UZTA 3KZ1A 4KHOA 1QC6A 5DHFB 4HHVA 2I5CA 2NZ8B 5DIFB 1P5TA 1U27A 1FGYA 5CLQB 2I1KA 1ZC3B 3U7DA 1XODA 1WGQA 2OQBA 3ZVRA 2J0MA 1M7EA 3T06A 2RGNB 4TYZA 2UZSA 2DA0A 1GC6A 2KGXB 2W2WA 2COAA 4EKUA 1NTVA 3HW2B 2R0DA 2D9WA 2VRWB 3SO6A 1RRPB 4HAZB 3ULBA 2D2QA 1PMSA 2DLWA 4DX8A 4GPTB 1X86A 5LOPB 3A8QA 3SNHA 4KHBB 4TKNA 2LOXA 2ROZB 2K2JA 2HTHB 1J0WA 5C5BA 1P6SA 3P6AA 1OMWA 1AWEA 4CHJA 2LYDA 3KSYA 3G9WA 4CHMA 1FGZA 2PZ1A 2YS1A 1SHCA 5J3QA 1PLSA 3FSSA 3GYPA 1Y19B 1XD4A 1I2HA 2YRYA 4DX90 1Z87A 3AU4A 5C16A 1IRSA 1U5DA 2EMSA 4B6HA 2YS5A 1KZ7A 4ZRKA 4WJ7A 2COFA 4ZRJA 1BAKA 5D3XA 2W2XC 5GOWB 2HE7A 2H7DA 3AU5A 3DXDA 2MFQA 3RCPA 1OQNA 2Y7BA 2P0HA 1K5DB 2GJYA 2D10A 1FHOA 2D9YA 1J19A 1H4RA 4F7HA 1NI2A 2J59M 4HB2B 2JP2A 2RUKB 1W1HA 3PSCA 2RNRB 1UNPA 2DX5A 2CY5A 1UEFA 1Q67A 4HAWB 1TQZA 3A98B 3PVUA 4F7GA 1FOEA 2XQNM 2QKLA 1TXDA 1H10A 4HDOA 4A6KA 2J0KA 2D9VA 5C6RA 4Z2MB 1LW3A 4K17A 2K00A 4P7IA 2D11A 1V5PA 5C79A 1X11A 3CIKA 4HAXB 1X1FA 3M1IB 4ZRIA 1ISNA 1U5EA 1XX0A 3AJ4A 1FB8A 2ADZA 2ELBA 2L2IA 4NSWA 2CAYA 4HB4B 1PFJA 2K2UA 2I5FA 5DHAB 2DFKA 1EGXA 1NTYA 4HAVB 3WA0A 3ULCA 4MY6A 1K5GB 2CY4A 2LOZA 2YF0A 1ZSQA 4HB3B 1V89A 2CODA 1FHWA 1DYNA 5D27A 5J3TA 5D3VA 2ELAA 2RSGA 3PZDA 1V5UA 5KQ4A 2RLOA 1ZC4B 2DN6A 4YL8A 5KQ1A 5JP4A 5HE3A 3TVVA 5FI0A 2GCLA 1MIXA 2YSZA 2D9ZA 3BINA 3IVFA 2X18A 4K2PA 1UNRA 1EF1A 2QKMA 2Z0OA 2DHJA 1SGHA 2GCJA 1LB1A 1W1DA 3LJUX 2W2XD 5JHHA 2UZRA 3CXBB 2P0DA 4HB0B 1QQGA 3BJIA 3TO1A 3NSUA 4DBBA 4IAPA 4F7UP 2D4QA 2LULA 4GMXB 4IFSA 2H7EA 1W1GA 3A8PA 1N3HA 2BCJA 4GN1A 3PVWA 2DYNA 4EMOA 4EJNA 5CLLB 3DXEA 2YT1A 1Y5OA 2EC1A 3D8EA 4A6FB 5DH9B 3F5RA 4A6HA 2VSZA 3QBVB 3U8ZA 3MDBC 3V5WA 4HAUB 2EMTA 1XR0B 2KCJA 1B55A 2Z0QA 1V5MA 3QWMA 3TFMA 4DXAB 1AQCA 5FI1A 1P3RA 4WVFB 5DI9B 2OTXA 1DDVA 1WJMA 2DKPA 3PP2A 4PNKA 4KVGB 2YVCA 2ZPYA 3X23A 2DYQA 3N7CA 4GXBA 2RVBB 2Y8GA 4PQ0A 5JLJB 3SUZA 2YS3A 3PEGA 2LG1A 4D0NB 1WVHA 4K2OA 5EFXA 5KCVA 1GC7A 4HDQA 2J0JA 1V88A 4H8SA 1M7RA 3HK0A 2COCA 1MK7B 1WG7A 1V61A 2YT0A 1FHXA 1BTKA 1X05A 2CRFA 4Y94A 2D9XA 1DDMA 1MKEA 3KRXA 2DHKA 3FM8C 2N0YA 2VKIA 2GS0A 3ODWA 1U5GA 4A5KA 2AEHA 2UVMA 2Q13A 3ZDTA 1WJ1A 3ML4A 4MK0A 1KI1B 2Y8FA 2ROVA 1XKEA 4C0AA 2MWNB 2LKOA 2R09A 4MT7A 1UPQA 4A6FA 3FEHA 1BTNA 4GMVA 1UNQA 1XCGA 3P7ZA 2EJ8A 1U2BA 1DDWA
chains in the Genus database with same CATH superfamily
1U29A 3OHMB 2FJLA 4IOYX 2KIGA 3GYOA 4GZUA 2IFSA 1E5WA 2AL6A 2DTCA 4L6EA 2N23A 4YONA 2DKQA 3PVLA 1MK9B 5HE1A 4DIXA 3SV1A 5J3YA 2DHIA 4NY0A 1UPRA 4WSFA 2IYBA 4D6WA 1NU2A 2E2XA 2YT2A 5JHGA 5L81A 2P0FA 4QJ4B 3VOQA 3D8DA 4XWXA 1EAZA 3TCAA 3WYFB 2L1CA 5LONB 1I7AA 2M38A 2KUPA 5HE2A 3KY9A 4Z2NA 1ZVRA 1KZGA 3TW1A 3PG7A 1DBHA 1MPHA 2DX1A 1DROA 4BBKA 4CSQA 3FVCA 1RJ2A 1TJ6A 1OY2A 3OANA 3ODOA 5I2MA 1X1GA 2I1JA 2MDXA 3ODXA 2NMBA 1WGUA 4HATB 1BWNA 4KHAA 3O96A 4KAXB 3D8FA 2R2YA 3F0WA 2P8VA 5D3WA 4CYEA 3MPXA 1GG3A 3QIJA 1MIZB 1MI1A 1MAIA 2MKRA 2Z0PA 4HAYB 5C5BB 2V76A 3KRWA 3DXCA 1FAOA 1ZM0A 3VIAA 2G35A 1WI1A 2M14A 3HQCA 4KHBA 5HE0A 1EVHA 1U5FA 4K81A 5D3YA 3SYXA 3UZTA 3KZ1A 4KHOA 1QC6A 5DHFB 4HHVA 2I5CA 2NZ8B 4GNKB 5DIFB 1P5TA 1U27A 1FGYA 5CLQB 2I1KA 3HIEA 1ZC3B 3U7DA 1XODA 1WGQA 2OQBA 3ZVRA 2J0MA 1M7EA 3T06A 2RGNB 4TYZA 2UZSA 2DA0A 1GC6A 2KGXB 2W2WA 2COAA 4EKUA 1NTVA 3HW2B 2R0DA 2D9WA 2VRWB 3NWDA 3SO6A 4GOUA 1RRPB 4HAZB 3ULBA 2D2QA 1PMSA 2DLWA 4DX8A 4GPTB 1X86A 5LOPB 3A8QA 3SNHA 4KHBB 4QXAB 4TKNA 2LOXA 2ROZB 2K2JA 2ZKMX 2HTHB 1J0WA 5C5BA 1P6SA 3P6AA 1OMWA 1AWEA 4CHJA 2LYDA 3KSYA 3G9WA 4CHMA 1FGZA 2PZ1A 2YS1A 1SHCA 5J3QA 1PLSA 3FSSA 3GYPA 1Y19B 1XD4A 1I2HA 2YRYA 4DX90 1Z87A 3AU4A 5C16A 1IRSA 1U5DA 2EMSA 4B6HA 2YS5A 1KZ7A 4ZRKA 4WJ7A 2COFA 4ZRJA 1BAKA 5D3XA 3DCXA 2W2XC 5GOWB 2HE7A 4L1RA 2H7DA 3AU5A 3DXDA 2MFQA 3RCPA 1OQNA 2Y7BA 1ZYIA 2P0HA 1K5DB 2GJYA 2D10A 1FHOA 5LG4B 2D9YA 2Z59A 1J19A 1H4RA 4F7HA 1NI2A 2J59M 4HB2B 2JP2A 2RUKB 1W1HA 3PSCA 2RNRB 1UNPA 2DX5A 2CY5A 1UEFA 1Q67A 4HAWB 1TQZA 3A98B 2Z4DA 3PVUA 4F7GA 1FOEA 2XQNM 5I2SA 2QKLA 1TXDA 1H10A 4HDOA 4A6KA 2J0KA 2D9VA 5C6RA 2RRFA 4Z2MB 1LW3A 4K17A 2K00A 4P7IA 2D11A 1V5PA 5C79A 1X11A 3CIKA 4HAXB 1X1FA 3M1IB 4ZRIA 1ISNA 1U5EA 1XX0A 3AJ4A 1FB8A 3NWAA 2ADZA 3U12A 2ELBA 2L2IA 4HSIA 4NSWA 2CAYA 4HB4B 1PFJA 2K2UA 2I5FA 5DHAB 2DFKA 1EGXA 1NTYA 4HAVB 3WA0A 3B77A 3ULCA 4MY6A 1K5GB 2CY4A 2LOZA 2YF0A 1ZSQA 4HB3B 1V89A 2CODA 1FHWA 2K49A 2KUQA 1DYNA 5IRSA 5D27A 5J3TA 5D3VA 2ELAA 2RSGA 3NWFA 3PZDA 1V5UA 5KQ4A 2RLOA 1ZC4B 2DN6A 4YL8A 5KQ1A 5JP4A 5HE3A 3TVVA 5FI0A 2GCLA 2Z14A 1MIXA 2YSZA 2D9ZA 3BINA 2X18A 3IVFA 4K2PA 1UNRA 1EF1A 2QKMA 2Z0OA 2DHJA 4OT1A 1SGHA 2GCJA 1LB1A 1W1DA 3LJUX 2W2XD 5JHHA 3A58A 2UZRA 3CXBB 2P0DA 4HB0B 1QQGA 3BJIA 3TO1A 3NSUA 4DBBA 4IAPA 4F7UP 2D4QA 2LULA 2FJUB 4GMXB 4IFSA 2H7EA 1T77A 1W1GA 3A8PA 1N3HA 2BCJA 4GN1A 3PVWA 2DYNA 4EMOA 2KIEA 4EJNA 5CLLB 3DXEA 2YT1A 1Y5OA 2EC1A 3D8EA 4A6FB 5DH9B 3F5RA 4A6HA 4OSNA 2VSZA 3QBVB 3U8ZA 3MDBC 3V5WA 4HAUB 2EMTA 1XR0B 2KCJA 2GUMA 1B55A 2Z0QA 1V5MA 3QWMA 3TFMA 4DXAB 1AQCA 5FI1A 1P3RA 4WVFB 5M4YB 5DI9B 2OTXA 1DDVA 1WJMA 2DKPA 3PP2A 4PNKA 4KVGB 2YVCA 2ZPYA 3X23A 2DYQA 3N7CA 4GXBA 2RVBB 2Y8GA 3HSAA 4PQ0A 5JLJB 3SUZA 2YS3A 2K8EA 3PEGA 2LG1A 4D0NB 1WVHA 4K2OA 5EFXA 5KCVA 2NBVA 1GC7A 4HDQA 2J0JA 1V88A 3NW8A 4H8SA 1M7RA 3HK0A 2Z13A 2COCA 1MK7B 1WG7A 1V61A 2YT0A 1FHXA 1BTKA 1X05A 2CRFA 4Y94A 2D9XA 1DDMA 1MKEA 3KRXA 2DHKA 3FM8C 2N0YA 2VKIA 2GS0A 3ODWA 1U5GA 4A5KA 2AEHA 2UVMA 2Q13A 3ZDTA 1WJ1A 3ML4A 4MK0A 1KI1B 2Y8FA 2ROVA 1XKEA 4C0AA 2MWNB 2LKOA 2R09A 4MT7A 1UPQA 4A6FA 3FEHA 4QJ5B 1BTNA 4GMVA 1UNQA 1XCGA 4QJ3B 3P7ZA 2EJ8A 2KR0A 1U2BA 1DDWA
chains in the Genus database with same CATH topology
1U29A 2FJLA 4IOYX 3GYOA 4GZUA 2IFSA 1E5WA 2AL6A 2DTCA 4L6EA 2N23A 4YONA 3PVLA 2DKQA 1MK9B 5HE1A 3SV1A 5J3YA 2DHIA 4NY0A 1UPRA 4WSFA 2IYBA 1NU2A 2E2XA 5JHGA 5L81A 2P0FA 3VOQA 3D8DA 4XWXA 1EAZA 3TCAA 3WYFB 2L1CA 5LONB 1I7AA 2M38A 2KUPA 5HE2A 3KY9A 4Z2NA 1ZVRA 1KZGA 3TW1A 3PG7A 1DBHA 1MPHA 2DX1A 1DROA 4BBKA 1RJ2A 1TJ6A 1OY2A 3OANA 3ODOA 1X1GA 2I1JA 2MDXA 3ODXA 2NMBA 1WGUA 4HATB 1BWNA 4KHAA 3O96A 4KAXB 3D8FA 3F0WA 2P8VA 5D3WA 4CYEA 3MPXA 1GG3A 3QIJA 1MIZB 1MAIA 2MKRA 2Z0PA 4HAYB 5C5BB 2V76A 3KRWA 3DXCA 1FAOA 1ZM0A 3VIAA 2G35A 1WI1A 2M14A 3HQCA 5HE0A 1EVHA 1U5FA 4K81A 5D3YA 3SYXA 3UZTA 3KZ1A 4KHOA 1QC6A 5DHFB 4HHVA 2I5CA 2NZ8B 5DIFB 1P5TA 1U27A 1FGYA 5CLQB 2I1KA 1ZC3B 3U7DA 1XODA 1WGQA 2OQBA 3ZVRA 2J0MA 1M7EA 3T06A 2RGNB 4TYZA 2UZSA 2DA0A 1GC6A 2KGXB 2W2WA 2COAA 4EKUA 1NTVA 3HW2B 2R0DA 2D9WA 2VRWB 3SO6A 1RRPB 4HAZB 3ULBA 2D2QA 1PMSA 2DLWA 4DX8A 4GPTB 1X86A 5LOPB 3A8QA 3SNHA 4KHBB 4TKNA 2LOXA 2ROZB 2K2JA 2HTHB 1J0WA 5C5BA 1P6SA 3P6AA 1OMWA 1AWEA 4CHJA 2LYDA 3KSYA 3G9WA 4CHMA 1FGZA 2PZ1A 2YS1A 1SHCA 5J3QA 1PLSA 3FSSA 3GYPA 1Y19B 1XD4A 1I2HA 2YRYA 4DX90 1Z87A 3AU4A 5C16A 1IRSA 1U5DA 2EMSA 4B6HA 2YS5A 1KZ7A 4ZRKA 4WJ7A 2COFA 4ZRJA 1BAKA 5D3XA 2W2XC 5GOWB 2HE7A 2H7DA 3AU5A 3DXDA 2MFQA 3RCPA 1OQNA 2Y7BA 2P0HA 1K5DB 2GJYA 2D10A 1FHOA 2D9YA 1J19A 1H4RA 4F7HA 1NI2A 2J59M 4HB2B 2JP2A 2RUKB 1W1HA 3PSCA 2RNRB 1UNPA 2DX5A 2CY5A 1UEFA 1Q67A 4HAWB 1TQZA 3A98B 3PVUA 4F7GA 1FOEA 2XQNM 2QKLA 1TXDA 1H10A 4HDOA 4A6KA 2J0KA 2D9VA 5C6RA 4Z2MB 1LW3A 4K17A 2K00A 4P7IA 2D11A 1V5PA 5C79A 1X11A 3CIKA 4HAXB 1X1FA 3M1IB 4ZRIA 1ISNA 1U5EA 1XX0A 3AJ4A 1FB8A 2ADZA 2ELBA 2L2IA 4NSWA 2CAYA 4HB4B 1PFJA 2K2UA 2I5FA 5DHAB 2DFKA 1EGXA 1NTYA 4HAVB 3WA0A 3ULCA 4MY6A 1K5GB 2CY4A 2LOZA 2YF0A 1ZSQA 4HB3B 1V89A 2CODA 1FHWA 1DYNA 5D27A 5J3TA 5D3VA 2ELAA 2RSGA 3PZDA 1V5UA 5KQ4A 2RLOA 1ZC4B 2DN6A 4YL8A 5KQ1A 5JP4A 5HE3A 3TVVA 5FI0A 2GCLA 1MIXA 2YSZA 2D9ZA 3BINA 3IVFA 2X18A 4K2PA 1UNRA 1EF1A 2QKMA 2Z0OA 2DHJA 1SGHA 2GCJA 1LB1A 1W1DA 3LJUX 2W2XD 5JHHA 2UZRA 3CXBB 2P0DA 4HB0B 1QQGA 3BJIA 3TO1A 3NSUA 4DBBA 4IAPA 4F7UP 2D4QA 2LULA 4GMXB 4IFSA 2H7EA 1W1GA 3A8PA 1N3HA 2BCJA 4GN1A 3PVWA 2DYNA 4EMOA 4EJNA 5CLLB 3DXEA 2YT1A 1Y5OA 2EC1A 3D8EA 4A6FB 5DH9B 3F5RA 4A6HA 2VSZA 3QBVB 3U8ZA 3MDBC 3V5WA 4HAUB 2EMTA 1XR0B 2KCJA 1B55A 2Z0QA 1V5MA 3QWMA 3TFMA 4DXAB 1AQCA 5FI1A 1P3RA 4WVFB 5DI9B 2OTXA 1DDVA 1WJMA 2DKPA 3PP2A 4PNKA 4KVGB 2YVCA 2ZPYA 3X23A 2DYQA 3N7CA 4GXBA 2RVBB 2Y8GA 4PQ0A 5JLJB 3SUZA 2YS3A 3PEGA 2LG1A 4D0NB 1WVHA 4K2OA 5EFXA 5KCVA 1GC7A 4HDQA 2J0JA 1V88A 4H8SA 1M7RA 3HK0A 2COCA 1MK7B 1WG7A 1V61A 2YT0A 1FHXA 1BTKA 1X05A 2CRFA 4Y94A 2D9XA 1DDMA 1MKEA 3KRXA 2DHKA 3FM8C 2N0YA 2VKIA 2GS0A 3ODWA 1U5GA 4A5KA 2AEHA 2UVMA 2Q13A 3ZDTA 1WJ1A 3ML4A 4MK0A 1KI1B 2Y8FA 2ROVA 1XKEA 4C0AA 2MWNB 2LKOA 2R09A 4MT7A 1UPQA 4A6FA 3FEHA 1BTNA 4GMVA 1UNQA 1XCGA 3P7ZA 2EJ8A 1U2BA 1DDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U29 A;  2FJL A;  4IOY X;  3GYO A;  4GZU A;  2IFS A;  1E5W A;  2AL6 A;  2DTC A;  4L6E A;  2N23 A;  4YON A;  3PVL A;  2DKQ A;  1MK9 B;  5HE1 A;  3SV1 A;  5J3Y A;  2DHI A;  4NY0 A;  1UPR A;  4WSF A;  2IYB A;  1NU2 A;  2E2X A;  5JHG A;  5L81 A;  2P0F A;  3VOQ A;  3D8D A;  4XWX A;  1EAZ A;  3TCA A;  3WYF B;  2L1C A;  5LON B;  1I7A A;  2M38 A;  2KUP A;  5HE2 A;  3KY9 A;  4Z2N A;  1ZVR A;  1KZG A;  3TW1 A;  3PG7 A;  1DBH A;  1MPH A;  2DX1 A;  1DRO A;  4BBK A;  1RJ2 A;  1TJ6 A;  1OY2 A;  3OAN A;  3ODO A;  1X1G A;  2I1J A;  2MDX A;  3ODX A;  2NMB A;  1WGU A;  4HAT B;  1BWN A;  4KHA A;  3O96 A;  4KAX B;  3D8F A;  3F0W A;  2P8V A;  5D3W A;  4CYE A;  3MPX A;  1GG3 A;  3QIJ A;  1MIZ B;  1MAI A;  2MKR A;  2Z0P A;  4HAY B;  5C5B B;  2V76 A;  3KRW A;  3DXC A;  1FAO A;  1ZM0 A;  3VIA A;  2G35 A;  1WI1 A;  2M14 A;  3HQC A;  5HE0 A;  1EVH A;  1U5F A;  4K81 A;  5D3Y A;  3SYX A;  3UZT A;  3KZ1 A;  4KHO A;  1QC6 A;  5DHF B;  4HHV A;  2I5C A;  2NZ8 B;  5DIF B;  1P5T A;  1U27 A;  1FGY A;  5CLQ B;  2I1K A;  1ZC3 B;  3U7D A;  1XOD A;  1WGQ A;  2OQB A;  3ZVR A;  2J0M A;  1M7E A;  3T06 A;  2RGN B;  4TYZ A;  2UZS A;  2DA0 A;  1GC6 A;  2KGX B;  2W2W A;  2COA A;  4EKU A;  1NTV A;  3HW2 B;  2R0D A;  2D9W A;  2VRW B;  3SO6 A;  1RRP B;  4HAZ B;  3ULB A;  2D2Q A;  1PMS A;  2DLW A;  4DX8 A;  4GPT B;  1X86 A;  5LOP B;  3A8Q A;  3SNH A;  4KHB B;  4TKN A;  2LOX A;  2ROZ B;  2K2J A;  2HTH B;  1J0W A;  5C5B A;  1P6S A;  3P6A A;  1OMW A;  1AWE A;  4CHJ A;  2LYD A;  3KSY A;  3G9W A;  4CHM A;  1FGZ A;  2PZ1 A;  2YS1 A;  1SHC A;  5J3Q A;  1PLS A;  3FSS A;  3GYP A;  1Y19 B;  1XD4 A;  1I2H A;  2YRY A;  4DX9 0;  1Z87 A;  3AU4 A;  5C16 A;  1IRS A;  1U5D A;  2EMS A;  4B6H A;  2YS5 A;  1KZ7 A;  4ZRK A;  4WJ7 A;  2COF A;  4ZRJ A;  1BAK A;  5D3X A;  2W2X C;  5GOW B;  2HE7 A;  2H7D A;  3AU5 A;  3DXD A;  2MFQ A;  3RCP A;  1OQN A;  2Y7B A;  2P0H A;  1K5D B;  2GJY A;  2D10 A;  1FHO A;  2D9Y A;  1J19 A;  1H4R A;  4F7H A;  1NI2 A;  2J59 M;  4HB2 B;  2JP2 A;  2RUK B;  1W1H A;  3PSC A;  2RNR B;  1UNP A;  2DX5 A;  2CY5 A;  1UEF A;  1Q67 A;  4HAW B;  1TQZ A;  3A98 B;  3PVU A;  4F7G A;  1FOE A;  2XQN M;  2QKL A;  1TXD A;  1H10 A;  4HDO A;  4A6K A;  2J0K A;  2D9V A;  5C6R A;  4Z2M B;  1LW3 A;  4K17 A;  2K00 A;  4P7I A;  2D11 A;  1V5P A;  5C79 A;  1X11 A;  3CIK A;  4HAX B;  1X1F A;  3M1I B;  4ZRI A;  1ISN A;  1U5E A;  1XX0 A;  3AJ4 A;  1FB8 A;  2ADZ A;  2ELB A;  2L2I A;  4NSW A;  2CAY A;  4HB4 B;  1PFJ A;  2K2U A;  2I5F A;  5DHA B;  2DFK A;  1EGX A;  1NTY A;  4HAV B;  3WA0 A;  3ULC A;  4MY6 A;  1K5G B;  2CY4 A;  2LOZ A;  2YF0 A;  1ZSQ A;  4HB3 B;  1V89 A;  2COD A;  1FHW A;  1DYN A;  5D27 A;  5J3T A;  5D3V A;  2ELA A;  2RSG A;  3PZD A;  1V5U A;  5KQ4 A;  2RLO A;  1ZC4 B;  2DN6 A;  4YL8 A;  5KQ1 A;  5JP4 A;  5HE3 A;  3TVV A;  5FI0 A;  2GCL A;  1MIX A;  2YSZ A;  2D9Z A;  3BIN A;  3IVF A;  2X18 A;  4K2P A;  1UNR A;  1EF1 A;  2QKM A;  2Z0O A;  2DHJ A;  1SGH A;  2GCJ A;  1LB1 A;  1W1D A;  3LJU X;  2W2X D;  5JHH A;  2UZR A;  3CXB B;  2P0D A;  4HB0 B;  1QQG A;  3BJI A;  3TO1 A;  3NSU A;  4DBB A;  4IAP A;  4F7U P;  2D4Q A;  2LUL A;  4GMX B;  4IFS A;  2H7E A;  1W1G A;  3A8P A;  1N3H A;  2BCJ A;  4GN1 A;  3PVW A;  2DYN A;  4EMO A;  4EJN A;  5CLL B;  3DXE A;  2YT1 A;  1Y5O A;  2EC1 A;  3D8E A;  4A6F B;  5DH9 B;  3F5R A;  4A6H A;  2VSZ A;  3QBV B;  3U8Z A;  3MDB C;  3V5W A;  4HAU B;  2EMT A;  1XR0 B;  2KCJ A;  1B55 A;  2Z0Q A;  1V5M A;  3QWM A;  3TFM A;  4DXA B;  1AQC A;  5FI1 A;  1P3R A;  4WVF B;  5DI9 B;  2OTX A;  1DDV A;  1WJM A;  2DKP A;  3PP2 A;  4PNK A;  4KVG B;  2YVC A;  2ZPY A;  3X23 A;  2DYQ A;  3N7C A;  4GXB A;  2RVB B;  2Y8G A;  4PQ0 A;  5JLJ B;  3SUZ A;  2YS3 A;  3PEG A;  2LG1 A;  4D0N B;  1WVH A;  4K2O A;  5EFX A;  5KCV A;  1GC7 A;  4HDQ A;  2J0J A;  1V88 A;  4H8S A;  1M7R A;  3HK0 A;  2COC A;  1MK7 B;  1WG7 A;  1V61 A;  2YT0 A;  1FHX A;  1BTK A;  1X05 A;  2CRF A;  4Y94 A;  2D9X A;  1DDM A;  1MKE A;  3KRX A;  2DHK A;  3FM8 C;  2N0Y A;  2VKI A;  2GS0 A;  3ODW A;  1U5G A;  4A5K A;  2AEH A;  2UVM A;  2Q13 A;  3ZDT A;  1WJ1 A;  3ML4 A;  4MK0 A;  1KI1 B;  2Y8F A;  2ROV A;  1XKE A;  4C0A A;  2MWN B;  2LKO A;  2R09 A;  4MT7 A;  1UPQ A;  4A6F A;  3FEH A;  1BTN A;  4GMV A;  1UNQ A;  1XCG A;  3P7Z A;  2EJ8 A;  1U2B A;  1DDW A; 
#chains in the Genus database with same CATH topology
 1U29 A;  3OHM B;  2FJL A;  4IOY X;  2KIG A;  3GYO A;  4GZU A;  2IFS A;  1E5W A;  2AL6 A;  2DTC A;  4L6E A;  2N23 A;  4YON A;  2DKQ A;  3PVL A;  1MK9 B;  5HE1 A;  4DIX A;  3SV1 A;  5J3Y A;  2DHI A;  4NY0 A;  1UPR A;  4WSF A;  2IYB A;  4D6W A;  1NU2 A;  2E2X A;  2YT2 A;  5JHG A;  5L81 A;  2P0F A;  4QJ4 B;  3VOQ A;  3D8D A;  4XWX A;  1EAZ A;  3TCA A;  3WYF B;  2L1C A;  5LON B;  1I7A A;  2M38 A;  2KUP A;  5HE2 A;  3KY9 A;  4Z2N A;  1ZVR A;  1KZG A;  3TW1 A;  3PG7 A;  1DBH A;  1MPH A;  2DX1 A;  1DRO A;  4BBK A;  4CSQ A;  3FVC A;  1RJ2 A;  1TJ6 A;  1OY2 A;  3OAN A;  3ODO A;  5I2M A;  1X1G A;  2I1J A;  2MDX A;  3ODX A;  2NMB A;  1WGU A;  4HAT B;  1BWN A;  4KHA A;  3O96 A;  4KAX B;  3D8F A;  2R2Y A;  3F0W A;  2P8V A;  5D3W A;  4CYE A;  3MPX A;  1GG3 A;  3QIJ A;  1MIZ B;  1MI1 A;  1MAI A;  2MKR A;  2Z0P A;  4HAY B;  5C5B B;  2V76 A;  3KRW A;  3DXC A;  1FAO A;  1ZM0 A;  3VIA A;  2G35 A;  1WI1 A;  2M14 A;  3HQC A;  4KHB A;  5HE0 A;  1EVH A;  1U5F A;  4K81 A;  5D3Y A;  3SYX A;  3UZT A;  3KZ1 A;  4KHO A;  1QC6 A;  5DHF B;  4HHV A;  2I5C A;  2NZ8 B;  4GNK B;  5DIF B;  1P5T A;  1U27 A;  1FGY A;  5CLQ B;  2I1K A;  3HIE A;  1ZC3 B;  3U7D A;  1XOD A;  1WGQ A;  2OQB A;  3ZVR A;  2J0M A;  1M7E A;  3T06 A;  2RGN B;  4TYZ A;  2UZS A;  2DA0 A;  1GC6 A;  2KGX B;  2W2W A;  2COA A;  4EKU A;  1NTV A;  3HW2 B;  2R0D A;  2D9W A;  2VRW B;  3NWD A;  3SO6 A;  4GOU A;  1RRP B;  4HAZ B;  3ULB A;  2D2Q A;  1PMS A;  2DLW A;  4DX8 A;  4GPT B;  1X86 A;  5LOP B;  3A8Q A;  3SNH A;  4KHB B;  4QXA B;  4TKN A;  2LOX A;  2ROZ B;  2K2J A;  2ZKM X;  2HTH B;  1J0W A;  5C5B A;  1P6S A;  3P6A A;  1OMW A;  1AWE A;  4CHJ A;  2LYD A;  3KSY A;  3G9W A;  4CHM A;  1FGZ A;  2PZ1 A;  2YS1 A;  1SHC A;  5J3Q A;  1PLS A;  3FSS A;  3GYP A;  1Y19 B;  1XD4 A;  1I2H A;  2YRY A;  4DX9 0;  1Z87 A;  3AU4 A;  5C16 A;  1IRS A;  1U5D A;  2EMS A;  4B6H A;  2YS5 A;  1KZ7 A;  4ZRK A;  4WJ7 A;  2COF A;  4ZRJ A;  1BAK A;  5D3X A;  3DCX A;  2W2X C;  5GOW B;  2HE7 A;  4L1R A;  2H7D A;  3AU5 A;  3DXD A;  2MFQ A;  3RCP A;  1OQN A;  2Y7B A;  1ZYI A;  2P0H A;  1K5D B;  2GJY A;  2D10 A;  1FHO A;  5LG4 B;  2D9Y A;  2Z59 A;  1J19 A;  1H4R A;  4F7H A;  1NI2 A;  2J59 M;  4HB2 B;  2JP2 A;  2RUK B;  1W1H A;  3PSC A;  2RNR B;  1UNP A;  2DX5 A;  2CY5 A;  1UEF A;  1Q67 A;  4HAW B;  1TQZ A;  3A98 B;  2Z4D A;  3PVU A;  4F7G A;  1FOE A;  2XQN M;  5I2S A;  2QKL A;  1TXD A;  1H10 A;  4HDO A;  4A6K A;  2J0K A;  2D9V A;  5C6R A;  2RRF A;  4Z2M B;  1LW3 A;  4K17 A;  2K00 A;  4P7I A;  2D11 A;  1V5P A;  5C79 A;  1X11 A;  3CIK A;  4HAX B;  1X1F A;  3M1I B;  4ZRI A;  1ISN A;  1U5E A;  1XX0 A;  3AJ4 A;  1FB8 A;  3NWA A;  2ADZ A;  3U12 A;  2ELB A;  2L2I A;  4HSI A;  4NSW A;  2CAY A;  4HB4 B;  1PFJ A;  2K2U A;  2I5F A;  5DHA B;  2DFK A;  1EGX A;  1NTY A;  4HAV B;  3WA0 A;  3B77 A;  3ULC A;  4MY6 A;  1K5G B;  2CY4 A;  2LOZ A;  2YF0 A;  1ZSQ A;  4HB3 B;  1V89 A;  2COD A;  1FHW A;  2K49 A;  2KUQ A;  1DYN A;  5IRS A;  5D27 A;  5J3T A;  5D3V A;  2ELA A;  2RSG A;  3NWF A;  3PZD A;  1V5U A;  5KQ4 A;  2RLO A;  1ZC4 B;  2DN6 A;  4YL8 A;  5KQ1 A;  5JP4 A;  5HE3 A;  3TVV A;  5FI0 A;  2GCL A;  2Z14 A;  1MIX A;  2YSZ A;  2D9Z A;  3BIN A;  2X18 A;  3IVF A;  4K2P A;  1UNR A;  1EF1 A;  2QKM A;  2Z0O A;  2DHJ A;  4OT1 A;  1SGH A;  2GCJ A;  1LB1 A;  1W1D A;  3LJU X;  2W2X D;  5JHH A;  3A58 A;  2UZR A;  3CXB B;  2P0D A;  4HB0 B;  1QQG A;  3BJI A;  3TO1 A;  3NSU A;  4DBB A;  4IAP A;  4F7U P;  2D4Q A;  2LUL A;  2FJU B;  4GMX B;  4IFS A;  2H7E A;  1T77 A;  1W1G A;  3A8P A;  1N3H A;  2BCJ A;  4GN1 A;  3PVW A;  2DYN A;  4EMO A;  2KIE A;  4EJN A;  5CLL B;  3DXE A;  2YT1 A;  1Y5O A;  2EC1 A;  3D8E A;  4A6F B;  5DH9 B;  3F5R A;  4A6H A;  4OSN A;  2VSZ A;  3QBV B;  3U8Z A;  3MDB C;  3V5W A;  4HAU B;  2EMT A;  1XR0 B;  2KCJ A;  2GUM A;  1B55 A;  2Z0Q A;  1V5M A;  3QWM A;  3TFM A;  4DXA B;  1AQC A;  5FI1 A;  1P3R A;  4WVF B;  5M4Y B;  5DI9 B;  2OTX A;  1DDV A;  1WJM A;  2DKP A;  3PP2 A;  4PNK A;  4KVG B;  2YVC A;  2ZPY A;  3X23 A;  2DYQ A;  3N7C A;  4GXB A;  2RVB B;  2Y8G A;  3HSA A;  4PQ0 A;  5JLJ B;  3SUZ A;  2YS3 A;  2K8E A;  3PEG A;  2LG1 A;  4D0N B;  1WVH A;  4K2O A;  5EFX A;  5KCV A;  2NBV A;  1GC7 A;  4HDQ A;  2J0J A;  1V88 A;  3NW8 A;  4H8S A;  1M7R A;  3HK0 A;  2Z13 A;  2COC A;  1MK7 B;  1WG7 A;  1V61 A;  2YT0 A;  1FHX A;  1BTK A;  1X05 A;  2CRF A;  4Y94 A;  2D9X A;  1DDM A;  1MKE A;  3KRX A;  2DHK A;  3FM8 C;  2N0Y A;  2VKI A;  2GS0 A;  3ODW A;  1U5G A;  4A5K A;  2AEH A;  2UVM A;  2Q13 A;  3ZDT A;  1WJ1 A;  3ML4 A;  4MK0 A;  1KI1 B;  2Y8F A;  2ROV A;  1XKE A;  4C0A A;  2MWN B;  2LKO A;  2R09 A;  4MT7 A;  1UPQ A;  4A6F A;  3FEH A;  4QJ5 B;  1BTN A;  4GMV A;  1UNQ A;  1XCG A;  4QJ3 B;  3P7Z A;  2EJ8 A;  2KR0 A;  1U2B A;  1DDW A; 
#chains in the Genus database with same CATH homology
 1U29 A;  2FJL A;  4IOY X;  3GYO A;  4GZU A;  2IFS A;  1E5W A;  2AL6 A;  2DTC A;  4L6E A;  2N23 A;  4YON A;  3PVL A;  2DKQ A;  1MK9 B;  5HE1 A;  3SV1 A;  5J3Y A;  2DHI A;  4NY0 A;  1UPR A;  4WSF A;  2IYB A;  1NU2 A;  2E2X A;  5JHG A;  5L81 A;  2P0F A;  3VOQ A;  3D8D A;  4XWX A;  1EAZ A;  3TCA A;  3WYF B;  2L1C A;  5LON B;  1I7A A;  2M38 A;  2KUP A;  5HE2 A;  3KY9 A;  4Z2N A;  1ZVR A;  1KZG A;  3TW1 A;  3PG7 A;  1DBH A;  1MPH A;  2DX1 A;  1DRO A;  4BBK A;  1RJ2 A;  1TJ6 A;  1OY2 A;  3OAN A;  3ODO A;  1X1G A;  2I1J A;  2MDX A;  3ODX A;  2NMB A;  1WGU A;  4HAT B;  1BWN A;  4KHA A;  3O96 A;  4KAX B;  3D8F A;  3F0W A;  2P8V A;  5D3W A;  4CYE A;  3MPX A;  1GG3 A;  3QIJ A;  1MIZ B;  1MAI A;  2MKR A;  2Z0P A;  4HAY B;  5C5B B;  2V76 A;  3KRW A;  3DXC A;  1FAO A;  1ZM0 A;  3VIA A;  2G35 A;  1WI1 A;  2M14 A;  3HQC A;  5HE0 A;  1EVH A;  1U5F A;  4K81 A;  5D3Y A;  3SYX A;  3UZT A;  3KZ1 A;  4KHO A;  1QC6 A;  5DHF B;  4HHV A;  2I5C A;  2NZ8 B;  5DIF B;  1P5T A;  1U27 A;  1FGY A;  5CLQ B;  2I1K A;  1ZC3 B;  3U7D A;  1XOD A;  1WGQ A;  2OQB A;  3ZVR A;  2J0M A;  1M7E A;  3T06 A;  2RGN B;  4TYZ A;  2UZS A;  2DA0 A;  1GC6 A;  2KGX B;  2W2W A;  2COA A;  4EKU A;  1NTV A;  3HW2 B;  2R0D A;  2D9W A;  2VRW B;  3SO6 A;  1RRP B;  4HAZ B;  3ULB A;  2D2Q A;  1PMS A;  2DLW A;  4DX8 A;  4GPT B;  1X86 A;  5LOP B;  3A8Q A;  3SNH A;  4KHB B;  4TKN A;  2LOX A;  2ROZ B;  2K2J A;  2HTH B;  1J0W A;  5C5B A;  1P6S A;  3P6A A;  1OMW A;  1AWE A;  4CHJ A;  2LYD A;  3KSY A;  3G9W A;  4CHM A;  1FGZ A;  2PZ1 A;  2YS1 A;  1SHC A;  5J3Q A;  1PLS A;  3FSS A;  3GYP A;  1Y19 B;  1XD4 A;  1I2H A;  2YRY A;  4DX9 0;  1Z87 A;  3AU4 A;  5C16 A;  1IRS A;  1U5D A;  2EMS A;  4B6H A;  2YS5 A;  1KZ7 A;  4ZRK A;  4WJ7 A;  2COF A;  4ZRJ A;  1BAK A;  5D3X A;  2W2X C;  5GOW B;  2HE7 A;  2H7D A;  3AU5 A;  3DXD A;  2MFQ A;  3RCP A;  1OQN A;  2Y7B A;  2P0H A;  1K5D B;  2GJY A;  2D10 A;  1FHO A;  2D9Y A;  1J19 A;  1H4R A;  4F7H A;  1NI2 A;  2J59 M;  4HB2 B;  2JP2 A;  2RUK B;  1W1H A;  3PSC A;  2RNR B;  1UNP A;  2DX5 A;  2CY5 A;  1UEF A;  1Q67 A;  4HAW B;  1TQZ A;  3A98 B;  3PVU A;  4F7G A;  1FOE A;  2XQN M;  2QKL A;  1TXD A;  1H10 A;  4HDO A;  4A6K A;  2J0K A;  2D9V A;  5C6R A;  4Z2M B;  1LW3 A;  4K17 A;  2K00 A;  4P7I A;  2D11 A;  1V5P A;  5C79 A;  1X11 A;  3CIK A;  4HAX B;  1X1F A;  3M1I B;  4ZRI A;  1ISN A;  1U5E A;  1XX0 A;  3AJ4 A;  1FB8 A;  2ADZ A;  2ELB A;  2L2I A;  4NSW A;  2CAY A;  4HB4 B;  1PFJ A;  2K2U A;  2I5F A;  5DHA B;  2DFK A;  1EGX A;  1NTY A;  4HAV B;  3WA0 A;  3ULC A;  4MY6 A;  1K5G B;  2CY4 A;  2LOZ A;  2YF0 A;  1ZSQ A;  4HB3 B;  1V89 A;  2COD A;  1FHW A;  1DYN A;  5D27 A;  5J3T A;  5D3V A;  2ELA A;  2RSG A;  3PZD A;  1V5U A;  5KQ4 A;  2RLO A;  1ZC4 B;  2DN6 A;  4YL8 A;  5KQ1 A;  5JP4 A;  5HE3 A;  3TVV A;  5FI0 A;  2GCL A;  1MIX A;  2YSZ A;  2D9Z A;  3BIN A;  3IVF A;  2X18 A;  4K2P A;  1UNR A;  1EF1 A;  2QKM A;  2Z0O A;  2DHJ A;  1SGH A;  2GCJ A;  1LB1 A;  1W1D A;  3LJU X;  2W2X D;  5JHH A;  2UZR A;  3CXB B;  2P0D A;  4HB0 B;  1QQG A;  3BJI A;  3TO1 A;  3NSU A;  4DBB A;  4IAP A;  4F7U P;  2D4Q A;  2LUL A;  4GMX B;  4IFS A;  2H7E A;  1W1G A;  3A8P A;  1N3H A;  2BCJ A;  4GN1 A;  3PVW A;  2DYN A;  4EMO A;  4EJN A;  5CLL B;  3DXE A;  2YT1 A;  1Y5O A;  2EC1 A;  3D8E A;  4A6F B;  5DH9 B;  3F5R A;  4A6H A;  2VSZ A;  3QBV B;  3U8Z A;  3MDB C;  3V5W A;  4HAU B;  2EMT A;  1XR0 B;  2KCJ A;  1B55 A;  2Z0Q A;  1V5M A;  3QWM A;  3TFM A;  4DXA B;  1AQC A;  5FI1 A;  1P3R A;  4WVF B;  5DI9 B;  2OTX A;  1DDV A;  1WJM A;  2DKP A;  3PP2 A;  4PNK A;  4KVG B;  2YVC A;  2ZPY A;  3X23 A;  2DYQ A;  3N7C A;  4GXB A;  2RVB B;  2Y8G A;  4PQ0 A;  5JLJ B;  3SUZ A;  2YS3 A;  3PEG A;  2LG1 A;  4D0N B;  1WVH A;  4K2O A;  5EFX A;  5KCV A;  1GC7 A;  4HDQ A;  2J0J A;  1V88 A;  4H8S A;  1M7R A;  3HK0 A;  2COC A;  1MK7 B;  1WG7 A;  1V61 A;  2YT0 A;  1FHX A;  1BTK A;  1X05 A;  2CRF A;  4Y94 A;  2D9X A;  1DDM A;  1MKE A;  3KRX A;  2DHK A;  3FM8 C;  2N0Y A;  2VKI A;  2GS0 A;  3ODW A;  1U5G A;  4A5K A;  2AEH A;  2UVM A;  2Q13 A;  3ZDT A;  1WJ1 A;  3ML4 A;  4MK0 A;  1KI1 B;  2Y8F A;  2ROV A;  1XKE A;  4C0A A;  2MWN B;  2LKO A;  2R09 A;  4MT7 A;  1UPQ A;  4A6F A;  3FEH A;  1BTN A;  4GMV A;  1UNQ A;  1XCG A;  3P7Z A;  2EJ8 A;  1U2B A;  1DDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...