4HAYA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548e,k579q)-ran-ranbp1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
200
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 60
structure length 200
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hayA00
1DELA 3BFVA 4EAQA 2FSGA 4GT1A 4Z54A 2D3WA 3SBDA 3RRNA 4A2PA 1AA9A 2VSOA 3PEVA 4HDQB 3RNLA 2DY1A 2OHFA 2ZXUA 2JCSA 1B23P 3MGCA 1GNPA 4MKIA 1X8LA 2Z43A 5AUQA 2QAGB 4DCUA 1JR3D 1Z29A 2QA5A 5C4GB 5BN5A 3K0FA 5L3RA 2R62A 4C0SA 2H18A 2ZJZA 3CUEF 2F1HA 2IYVA 3I72A 4ILEA 1C9KA 2MSDB 2W83A 5KPDA 5KDLA 1IXZA 4RKEA 1WB9A 1KI1A 4JKYA 1CJMA 2FZLA 2VRWA 2FDCA 3EIQA 3A6PC 4KVGA 1T8UA 4DWJA 5CLQA 2ZI6A 2AWNA 1ONBA 5H68A 4A0GA 3CPEA 4L5BA 2JGNA 4WZ6A 5AUPB 4TQAA 1YZKA 1JR6A 1OIWA 4GP7A 1G5PA 3NH9A 1XU4A 1S9DA 4A0RA 2OM2A 2VF8A 2ZI3A 5LB4A 1FW6A 1FP6A 2QGNA 3IEUA 4JBWA 4ZCIA 2G6BA 3GLIA 3UMSA 2XTNA 1HH4A 3B1WA 1I2MA 4KFRA 1II9A 4RCZA 2ZRKA 3ZZTA 4O0MA 1LNZA 4JLOA 3U7GA 1W7AA 1BYIA 2WSMA 4HAVA 4ZCMA 1W4RA 2EU8A 4BFSA 3HU3A 3EC2A 2BHRA 1CR0A 4MRSA 2FFAA 1RIFA 1B0UA 4CEIA 2QE7D 4IHQA 2VHJA 3ZIAA 1N6NA 1DAKA 4P31A 3RSLA 2PH1A 5JSZB 2GBLC 4LI0A 2X1VA 2CHGA 3RWMB 2O0KA 4RCYA 5JWOA 5FTLA 2V1UA 4CEHA 5DISB 1R0YA 2X77A 3LLMA 4PO8A 3B78A 3U44B 2YOHA 1GKIA 1OH7A 1K5DA 2WWGA 1KO8A 4EPTA 3PEUA 1H8HD 1H8ED 2VSFA 4XVUA 1ZAKA 1Z0JA 2WMNB 1TF7A 4EPYA 2ZJ5A 3CR7A 5EE5B 2CLDX 2ZEJA 4BEJA 2LKCA 3DM5A 1E4VA 2Z0MA 4WVFA 2GCOA 2QNRA 5AJYA 4A8JC 3KFXA 3ADCA 1FPMA 3GLFA 2ZREA 1HTWA 1E0SA 1W2GA 5L3SA 2WKPA 1PUIA 2ORIA 3ZZ0A 1S8FA 1YZTA 1XEWY 1U99A 3ZS9A 1TUIA 4CVNA 1G8YA 1T5IA 1UM8A 1Z6XA 4HB3A 2H16A 2JLXA 2GCPA 4C30A 3NHBA 4DEXA 4PSAA 1FTNA 4PR0A 3WMEA 4RZ3A 1OH6A 3B2EA 2IYUA 3H1TA 1JXMA 5FOWA 2GK7A 2AFIE 3BE4A 2ZE8A 2W6IA 5FR1A 3ECCA 3ZD7A 1VCIA 4IVPA 1IN8A 4QXAA 3RS3A 2VHQA 2XAUA 4IFBA 4KO8A 1NBME 1ANKA 4UXJA 3W6PA 2QP9X 1QDEA 2IHYA 2RCNA 5EP1A 4QG7A 3KQNA 1KHTA 1VTKA 3W5IA 3WNBA 2HJGA 4Q7LA 3KB1A 3CB4A 4BLTA 4OHWA 3BD9A 4PHFA 4IDOA 4YMWA 1EFUA 2ATXA 2FFBA 1E2DA 1MR3F 3GJ8A 3QXHA 1D6JA 2ZM5A 3ADKA 3Q9LA 1W1WA 3O8CA 3LY5A 2X19A 3R20A 1WP9A 1Q21A 4N0EA 1GNRA 4LHYA 4M1MA 5FOVA 4AK9A 2QP4A 4AYTA 3C5CA 3QENA 4PSKA 4TMTA 2QT1A 3UWOA 4DLSA 1F3OA 1W5TA 3NH6A 4URYR 2FFHA 5JJIA 3EX7C 4Q5IA 4Q66C 1P2VA 5BXQC 4BPBA 1UBFA 1QHIA 4QM7A 4IXMA 5JI3E 4S35A 2O8FA 4MYHA 3HWSA 4TL7A 4TSFD 1XMJA 4Q9JA 3A58B 2HLDD 4G5SA 3R9IA 2BKEA 3B60A 2WMOB 5HZKA 1DEKA 1KTVA 2KSQA 3L8ZA 1OFHA 1IY1A 3ZS8A 4DVGA 3ZD6A 2GAOA 3ZH9B 3FHCB 2WZQA 2GVDC 3QKUA 1XFAA 1XTQA 2XEXA 4IOMA 2XNSA 3TRFA 2W0SA 4TT3A 3QIAA 2GJSA 5GVSA 1W36D 4TN1A 5FOUA 4IKEA 4U7DA 5KSOA 1IM2A 2HCBA 2BVNA 1Q12A 1M7BA 2BWJA 2A5DA 2GZAA 4YMSA 2GWHA 5B2ZA 1GVNB 1NY6A 4MRVA 1JJVA 3NBZC 3Q5DA 3R7WB 1P6XA 4QKQA 1Q22A 4D26A 5B57C 4A6XA 3WYAA 5KYKA 1HE8B 1KNQA 2IYTA 3GEEA 2PJRA 1E2QA 1XRJA 4WZBE 1UAAA 2O8BA 1OYWA 1KDTA 3FYHA 1RW4A 2J0UA 3AF1A 5EE1A 3KXLA 5BYJA 5JBQA 5LD2B 4PHGA 2DYKA 1EX7A 3TUJC 2E9SA 4DCSA 2CLSA 2BCGY 1G16A 3KB2A 1JAHA 3EZ6A 3G5UA 4D0NA 1KI9A 4OK6A 3SHFA 5DN6D 3EAQA 2I4IA 1W36C 2OAP1 1FQKA 3OFNA 4W5JA 3TW4A 4WAUA 1A2BA 4B3FX 2ZRDA 3B8HA 1G3RA 2IS6A 2VA8A 4OI2A 4TLAA 4A6PA 1KOFA 4LDJA 2BEJA 2REXB 1HEIA 4LC0A 2BOVA 1MRNA 1AM4D 2OAQ1 1ESNA 3I8XA 2NGRA 2QAGA 3TH5A 2J46A 2D06A 4FINA 4NYJQ 4RZXA 4OHYA 1RVDA 1ZM4A 4KU4A 1BMFD 2D2FA 4FD2A 1GRRA 3AP2A 2IBMA 4ON9A 3TR0A 2BBTA 4WXRA 4Q1DA 3PXGA 2YC4C 3QPUA 5D3MA 4D4LA 5JCZA 4MKFA 1KZGB 3ZYCA 1D8TA 2VIIA 2PEYA 1G8PA 4HUQA 1S96A 4CT5A 1E1RA 4QGFA 2J7PA 4L4UA 4Q4AA 2PT7A 1XXHB 1TU4A 1XPUA 3AB3A 3GLHA 5LPNA 4DCVA 4R98A 2J7KA 3T35A 2QTHA 4CF7A 1RJ9B 4TQ9A 2QMOA 5A0FA 3P4YA 2H7VA 5JFGA 1KK3A 3FKSD 1NLZA 2GCOB 4ZO4A 2V3CC 2O8BB 1Q3TA 2ZVPX 2AWOA 4DT1B 2VHUA 1FL9A 2RAPA 3KKMA 1VCOA 4BLOA 4D2IA 1ZW6A 4NE2A 2DFNA 2AXNA 1VYUA 3QQ5A 4FI3C 3W8RA 3U5ZB 3QSYA 2HJVA 5H1YA 1E0AA 1E1RD 3HU1A 4ERNA 3N2IA 5DI3A 2GVZC 2N42A 4TQUS 2ZJ2A 2D2EA 2DWOA 1XTKA 2C9OA 2B8WA 2ORWA 1Z0KA 3A8TA 3AVTA 3OEHD 3NVAA 4ZKDA 2R6CA 4Z1MA 4NDZA 5SZJA 4MDEA 2HYDA 3RRMA 1I4LD 2C8VA 5IRCD 3EWSA 3FKSA 3DOFA 1KI7A 4ACAA 4KI0A 4B71A 3D6TB 2H17A 5FUXA 2KBFA 4OKSA 1TUEA 1N5KA 5KTYA 4PX9A 3OESA 5EE3A 1BIFA 3REGA 2OFXA 2H57A 2ZRHA 4A4DA 4BFUA 4Q4HB 1ELOA 1RJ9A 3OEED 3V00A 5DN6A 3U3JA 4V03A 8OHMA 4D25A 5TV2A 2MMCA 1XD2A 4JSTA 2D7CA 1E9FA 4RZ2A 1VMAA 1LVGA 1WDTA 2KI5A 1T4GA 1SHZA 1TQ2A 4RY2A 3GPLA 3KXIA 1Z0DA 4DB4A 5GVRA 4EFNA 3HPQA 3L82B 2PCLA 2WKRA 3REFA 3BAFA 2ZRPA 3Q7QA 4XD7A 3K0EA 4UQOA 1UF9A 1F2UA 4LOAA 4FN5A 4ARZA 2AL7A 3OIYA 1U8ZA 1KMHB 1DAIA 2XNDD 5CIQA 3I1FA 3BOSA 4BQSA 1H65A 5F9FA 1E99A 2VH5R 5HCIA 2XZOA 3LA6A 5JWRA 2GXAA 1DAFA 2WAYA 2CHQA 2WAXA 2VHTA 3RS7A 2B6HA 4Q4JA 1UDWA 1ZNXA 3EIHA 4Q01A 4OI1A 2R2AA 1DTSA 1HA3A 4URZR 3LNCA 3BERA 4TYYA 1HT1E 1US8A 1IAQA 3OEEA 4LBVA 5IF9A 2GAAA 3ZVNA 5HCNA 2JLRA 5DGXA 3A1VA 1VECA 5HZHA 1N6HA 3QKRA 4HLCA 1CJVC 5E7IA 1ZU4A 4KODA 2WWIA 4HAXA 4NBSA 3K0AA 3TSOA 1W0JD 4OJKA 2OFWA 4FCTA 4QBFA 1P3JA 3NBYC 3VR1A 2Q3HA 2XSZA 2ZRBA 2W6JA 3PUZA 1R0XA 4PPGA 1Z8FA 2FEOA 5E7JA 4PXAA 1EWRA 1FFHA 4AWXA 1W48A 1GNQA 4KVAA 3B5JA 1RKBA 2J5XA 3QJYA 4NCKA 3FVQA 2WJHA 3CLVA 2HUPA 4NZYA 5P21A 3SYKA 2NO9A 1FNMA 3NXSA 3PG5A 3QEOA 4Z1MD 2BJVA 1E2NA 1QHSA 1G5TA 2CK3D 3SFVA 5K8LA 5JCPA 3DM9B 1OT3A 5KDOA 4W5WA 3MD0A 1NY5A 3ZGXA 2ANBA 5UKDA 4LJ4A 4QBHA 4QHSA 3NDBB 1CR1A 3QBVA 2QU8A 4LHXA 3AVUA 3EXAA 5G53C 2YWGA 1OJLA 1ZVQA 4B43A 3R8CA 4OHXA 4QFMA 1BH2A 3U7EB 1CU1A 2PX0A 1TU3A 3TVDA 3I73A 3LX8A 5LB2A 2ZJOA 1OFTA 2AD1A 2OILA 3O8DA 1Z5ZA 1XJQA 1NN1A 2ZRIA 4IVRA 2WWXA 3K70B 2BM1A 3VR6A 4CEJB 2GETA 2JJ1A 4NONA 1N0UA 1QHNA 3H4MA 4LHVA 1NG9A 3FTQA 3THYA 2ZR7A 4NKRA 2ZRGA 4Q18A 5CK5A 1G3MA 3A4LA 4D4MA 5C4MA 3LLUA 4HAYA 2JLSA 4D0GA 2ZVQX 3SJZA 1SVOA 3SU8A 3MLEA 1RC8A 1U0HC 4R71A 2GHIA 2H92A 3IBGA 3WYGA 1QG2A 4MKGA 1NIJA 4B3BA 3KQKA 2PZGA 5FBVB 1XPOA 2BCJQ 1AS2A 1ZD9A 2IWHA 4DDWA 2HT1A 3R8FA 1E9AA 3I61A 2F1IA 4N1AA 4KV9A 1BO6A 1SXJD 5FPKA 2TMKA 4QGGA 4O2RA 1M8PA 2BEKA 3AUXA 3IO5A 2OG2A 1UADA 2ZJBA 1NSFA 3JZAA 1W4AA 1E9BA 2X2FA 4C3ZA 2HXYA 1II8A 2DBYA 2ZUBA 3AKYA 4CW7A 1RYFA 3GLIE 3I32A 2QE7A 2FFQA 3IQWA 3UWKA 4LYJA 4B3GA 1TMKA 4TL8A 1OV4A 3AVOA 1GAJA 2JLWA 2R65A 4LJYA 3GLFE 1IJFA 3VKGA 3ADDA 1XP8A 3WRXC 1A2KC 4ZDKA 1EWQA 2A78A 4DCNA 4DLVA 4M9SA 2IYSA 3U3MA 1EFTA 1HE1C 5KDDA 1OH5A 1XD8A 3I5XA 1TL7C 1YR9A 3RYTC 2AHOA 5J4LA 1CF4A 1PZNA 1YZUA 1X6VA 3KUCA 3ASYA 1W4BA 3KXKA 4A9AA 3ADBA 1P2SA 3IUYA 1N6RA 2C77A 2J0UB 4IEIA 4JSYA 4NYIR 1LW7A 1WBDA 3LAWA 3TW8B 2ZYVX 4M9QA 2QUZA 1XEXA 5EXPA 1MO6A 4AIIA 1XEXB 5AJXA 4A15A 1EFRD 4TT3D 1X8JA 4B3XA 3TAHA 5FH9A 1QBKC 3KFVA 1U81A 3SFZA 5F3WB 2CJWA 1MO5A 3W3AA 1M6NA 2ZE7A 3LH5A 3X2SA 3RAPR 3UPUA 4B32A 1MO3A 4LYFA 1GILA 3X1DA 5EE0A 4PPFA 4BFXA 3MMPA 2R6GA 2V6IA 1P9WA 2ZPTX 3SI7A 2KB0A 1RZ3A 2WJJA 2W0MA 4I1UA 2NZ8A 2FE4A 5EXTA 1OXVA 2NTYC 4NCJA 5GJVC 2Q21A 3SDZA 3LBNA 1R0ZA 4XTCS 4C0AC 3QPWA 1NVVQ 2P65A 1SQ5A 4ZI3A 1SVLA 1Z08A 1DVRA 1NBMA 3JVUA 4LPSA 3GJ3A 1DADA 1WA5A 2XJ4A 2GA8A 4KBFA 1ZP6A 1KO1A 1P2TA 2HF9A 1OF1A 5FOTA 5BN4A 1NSTA 3LVRE 1N0WA 2A30A 5FFMA 4ABYA 4EFMA 3FKQA 4IDNA 1DG1G 2N1BA 4IDHA 1DE0A 3A1SA 4HB4A 5KSYA 4H9GA 3ZLJA 3AGPA 2J1LA 2VF7A 3PENA 4A2QA 3WMFA 2XZPA 5G40A 1T6NA 2AN9A 2C04A 5CYOA 5FL7D 4TL6A 4AURA 1G3QA 1E9SA 3W5JA 3QXCA 1W4CA 4ESHA 2J87A 1QHHA 1UBEA 2F43A 3PCRB 3U7HB 3DEFA 1KKLA 1PJRA 1GP2A 1EFHA 3DZDA 5FPTA 2VL7A 4NL4H 5EJEA 4LJ8A 3IPYA 3QXXA 5DYGA 5F9HA 2ZANA 1FMJA 3TVTA 3B1YA 3PUVA 5JHHB 2C98A 3P27A 2VYFA 4D82A 4EPWA 1LFDB 1W49A 3MJRA 4TMVA 2F1JA 4QGAA 2J0QA 2LWIA 3THXA 2PCJA 2PLFA 2JIZA 3CNNA 1X1SA 2PBRA 4V0LA 1E0JA 1S4QA 4IJMA 1OXTA 3SS8A 5CK4A 3H84A 1Z63A 5CLLA 1P73A 1Z6AA 2QL6A 2RGNA 3NIBA 3BWDD 4M1WA 1SVMA 1LY1A 1JAIA 3TMKA 2EW1A 2RMKA 3VR3A 2ODNA 1DG3A 2IYYA 1P61B 3EW9A 3JZMA 2KBEA 4Q00A 4F4CA 2IF2A 2IK8A 1YZGA 2RHDA 4LV6A 4Q02A 4D0LB 2O8CA 1XCMA 5TY0A 1KI6A 3Q7PA 1ZBDA 3I3SR 1SVKA 2O8EB 4R7ZA 1UPTA 5BQ5A 4YDHB 2J9RA 1EG7A 2JATA 3KQLA 5CM9C 2IC5A 5FUYA 3L0SA 2XOKA 1G17A 3CO5A 3W34A 4QJ3A 3RC8A 1TF5A 1UFQA 3BB3A 1N2CE 2ZRNA 1MRSA 5HKKA 1W2HA 1PLKA 2N46A 3DO6A 2QQEA 3AKDA 4E07A 1NKSA 1IN4A 4HLQB 3CM0A 2WWWA 1JECA 2ZQ5A 1N0VC 3KKNA 5AJVB 3CF0A 1VPLA 2CNWD 1D5CA 1Z0FA 1M7HA 1Z83A 3TQFA 1TADA 1TTTA 4PSVA 2IS4A 1KDOA 2FF7A 3DMNA 4XIGS 4L9WA 1V43A 4ASUA 2EWVA 1P7CA 1NVVR 4C7OB 4GP6A 4GNKA 1UEJA 2QPOA 1H8HA 1L8QA 2PLRA 3K9GA 4C7OA 3TR5A 1HYQA 1R5BA 1KSFX 1Q44A 4GBMA 4I99A 1KYIA 1Z0IA 3T06B 3O47A 3AGQA 1NI3A 4JT4A 1G7RA 4BASA 2HYIC 2REOA 2WOOA 3UG7A 3IBYA 4DC9A 2EVWX 1OHHD 3UK6A 2YWFA 3QKSB 1AZSC 3QXSA 4URUR 4EDHA 4L15A 2YKGA 2AX4A 4V0NA 1JALA 1P62B 1SZPA 1GZSA 1G1MA 4QJ5A 2GILA 1E2LA 3OF5A 1R5NA 3EA5A 3U3OA 3O8RA 4OL0A 2CVFA 3NEYA 1RRPA 2ODEA 1W0KD 3I5YA 2ZRMA 1GM5A 2FZ4A 2IEYA 3HR8A 4OHVA 621PA 1GKUB 2DB3A 2G0TA 4UJ3A 4DLXA 5G3ZA 4HB2A 4JVLA 5KSZA 3PVSA 4AKGA 4FMCF 2OSBA 1G6OA 3CKLA 5SZKB 2YYZA 3BGWA 2ZRFA 3RLFA 1SKQA 2Q9AA 5EUQB 5HE8A 1U2RA 3A37A 4B76A 4A8JA 2V7QD 1KJWA 1R5OA 2GRJA 1K6MA 2EYUA 2HEIA 4JS0A 1KDPA 4OK5A 4POAA 2GJKA 4EJSB 4V0ME 1OB5A 1VIAA 2AK2A 4DLWA 1MH1A 2QPAA 3I62A 4MGKR 3K53A 5FOSA 1I4TD 1LB1B 1Z0AA 4BFVA 4OQXA 3B7GA 4RFVA 2XZLA 4HZUA 3TLXA 1SXJB 3UMFA 4PAOA 3U44A 2PX3A 4Q47A 3QVUA 1AZTA 1COWA 2XX3A 1G19A 2O8EA 2REBA 1KI6B 3PEWA 2R44A 4EJSC 4JVSB 4US0R 2OCAA 2GF9A 1NJGA 2ZYTX 5JS7A 3AVPA 1DAGA 2PEZA 3SEAA 2FV8A 1NN5A 3WNCA 1MKYA 2YC2C 3CONA 2VP5A 1XTJA 3CRMA 2CVHA 2I3BA 4ACBA 4MYUA 2UKDA 1QZXA 4A0FA 3A4NA 3TSWA 3GJ0A 3GP8A 3T34A 1G41A 2OESA 2RGDA 1JR3A 1KO4A 2P67A 1XZQA 3DHWC 3LBIA 1FNNA 1IN7A 1P5ZB 4G01B 3THXB 2B92A 1EX6A 1GRNA 1WXQA 4M1SA 4PHTA 2J7PD 2HT6A 4MYCA 4M8NE 1TQDA 3RRYA 4RFSA 1U98A 2FX3A 1JJ7A 5SZIA 4PC7A 2IA5A 4HYYA 4BFWA 3MG9A 4JMPA 1G7SA 3QI2A 1DO0A 4LPKA 4OBEA 4HLUA 4P0TA 5DI3B 1SVIA 1R8SA 2XB4A 4LJ7A 4PQFA 4ZI2A 1OSNA 1ZINA 4G5GA 5EUMA 1F2TA 3WBJA 3BBPA 5K8TA 4DIDA 1P9RA 5FPYA 3VHLB 1Q57A 3GLHB 1CJKC 1YZQA 4LHWA 4M21A 4QNRA 1XBTA 1KSJA 3P4XA 5JS8A 5L3QA 1N5LA 1T3SA 1WQ1R 1J8YF 3IQXA 5SZHB 2FSFA 3KQHA 4XWAA 2CCGA 3OEHA 1QVAA 1LS1A 4PZZA 1TNDA 3K0AB 3OFND 3C15C 1K5GA 1QF9A 2P0EA 3AVQA 2GEDA 3LXXA 4NYMR 5DNYB 2VHCA 5KO2A 3CWQA 1Q1ZA 1CTQA 3GCGA 4LYAA 3PQCA 1XTIA 2WVJA 3KJHA 4JT2A 3SC3A 4DJTA 4RVCA 2IYQA 1OIVA 1ETUA 2ZSDA 3IILA 4B73A 4LV5B 3ZVRA 2EYQA 4ZDWA 1AJEA 1XEFA 3CX8A 3KDSE 4FWIB 4TWZA 3GFOA 5GADl 4B35A 1J99A 2J41A 1W44A 2JJ2A 4DUGD 2PZEA 1W46A 2FG5A 3DVLA 2WJIA 1ZC3A 1ZUIA 3EZ2A 4TLEA 1LS6A 1G3IA 2V8OA 4TMKA 3ZQ6A 5LDDC 3FOZA 4DLTA 2W2VA 2XOKD 4I81A 2NO0A 1HQYE 3SHWA 2C96A 4EPRA 1TX4B 4M2LA 5BYKA 3LDAA 1YZNA 3KJEA 4Q4JB 1YJ5A 2PJZA 3BORA 4TSFA 4BRUA 2J45A 3VFDA 2X2EA 1IJEA 3FFAA 3KTAA 1SKYB 3P20A 4R2IA 4U5XA 4BUJA 2FWRA 4JVNA 3T5GA 2FEMA 4BLPA 821PA 2VEDA 5JJLA 1NLFA 1QVRA 3PIRA 1T9HA 2JEOA 4GDFA 3QEJA 1ZM7A 4LBWA 4TYQA 1LF5A 4U02A 3HP1A 1SXJA 3NC0C 4XSHA 4HZIA 3WBKA 1L4UA 2XGJA 5JEEA 3B13B 1BOFA 2OXRA 2BC9A 1FTSA 3OAAA 1YE8A 1Z47A 4JLJA 1G18A 1YKSA 2IUUA 1P72A 2R6DA 5TVKA 4JLNA 4KSCA 3SQWA 2BMDA 3BK7A 3E2IA 4Q48A 1X3SA 2YNMA 2GZDA 3PV0A 1OLOA 1XTSA 4TMZA 5LD2C 1C1YA 4QC2A 2HDNB 1AK2A 1W5SA 2AFHE 2VO1A 2ZE5A 3RC3A 2A5YB 3Q85A 1MABB 1YZLA 5KPJA 2WWHA 1KZ7B 1BS1A 1T5LA 5HKKD 4JKIA 4H1UA 3I92A 2Z4SA 2ZRAA 2JDIA 1CR2A 1ZUHA 2IXFA 4HSEA 4NP6A 2OCBA 4ZV4A 1VDZA 2GXQA 3JVVA 2ZR9A 5BWMA 1G9XA 4MRRA 4TLCA 2O52A 3DZ8A 1T91A 2ZSBA 1II8B 3WYFA 3K0CA 4HLUC 4FCWA 4E5UA 2NPFA 5H8WA 1CXZA 2ZAMA 4DSOA 1F5NA 2ZYUX 2QM8A 2HXSA 5C46F 1NVWQ 4F91B 5A5GA 2AKYA 3BFKA 4PO9A 3A36A 4TLDA 4FMDF 2OO7A 1FMLA 3OHMA 2DFKB 2QMHA 2EFHB 4CDGA 1EFRA 2O0HA 2FH5B 3SN6A 1G4AE 4YDSA 2JDID 2OBLA 4KYUA 3OIVA 4TTQA 4B2LA 3EZ7A 1YU9A 3AF4A 4BZPA 4PAQA 2YWEA 1ZD1A 4XD7D 4URWR 4A0HA 1D9ZA 2V1XA 4IVQA 2FPKA 1DBSA 1MV5A 4NCHA 3LFUA 1KKMA 1ZD8A 3NDPA 4KSBA 4JLKA 3AF3A 2JLUA 4GZMA 1GG2A 5L3VA 2WJYA 1IXRC 3IHLA 4IDPA 4BECA 2QM7A 5KNDA 4Q9IA 1W36B 1NN0A 4P3YA 3VX3A 5CIWA 2Z5FA 3IEVA 1NL3A 1X1RA 4M53A 1KJYA 2ZS8A 3EZFA 2BM0A 3CF2A 4A82A 4KFUA 1ZCAA 4EKDA 2NPIA 1X8KA 4WIAA 5JZVA 4D4JA 4IXNA 2ECKA 3QNUA 5FI0B 3CX7A 5EZ5A 2QPTA 1Z2AA 4C0BA 4JBYA 3LW8A 4LYHA 1HY3A 3MWYW 4GL2A 5JECA 3OE7A 2LKDA 2VSXA 1Q1QA 4DIEA 1U8AA 2ERYA 2KWIA 1Z6TA 4NYIQ 4DDVA 5HTKA 4FIDA 4G1UC 1D9XA 2NOAA 5E3HA 3NWJA 4Q1BA 2ORVA 2BBSA 3U7FB 3CWZA 5DHFA 3R9WA 1N6OA 3GLIB 3TAUA 3D31A 1ZIOA 3PR1A 5G3YA 2ZU6A 1R8QA 2AK3A 4ASUD 2MSEB 2XJ9A 1EK0A 2J3EA 3CZQA 2QTVB 4HUQB 4HI0E 1YVDA 5DSZA 3QF4A 3PUXA 3DKVA 1KI3A 4Q19A 1FX0B 3I4LA 2NZJA 4RD0A 2D7DA 1XCPA 3NKVA 4M0LA 1AIPA 2FJUA 2IYXA 2ZI7A 1IY2A 3LW7A 4B47A 4FXPA 5DH9A 4JLVA 2CHVA 4GOKA 1E94E 1EGAA 1Q20A 1ZMXA 3RSOA 1FOEB 2JJ1D 2C03A 2YHSA 2BMJA 3M4YA 3MJHA 1YRBA 1J7KA 3GLHE 3AEZA 2KE5A 2IWRA 3RWOA 4B48A 2JASA 1SULA 1UKZA 3OE7D 2ZUDA 3A4MA 4HDCA 3IKJA 3E5HA 1E2KA 3EPLA 1IONA 4U00A 5TXGA 4BZQA 4YXWA 421PA 2OZEA 4UNQA 5E4FA 3HPRA 1CJUC 4MKHA 1M1YE 2QTFA 4Q1AA 4EUNA 3P1JA 2ASEA 4MGYR 3AKEA 4IEEA 1UKEA 4XSGA 4GOXA 2QENA 5FBWB 1P4SA 3K1JA 3FDIA 4NPHA 3RDPA 2VP0A 2BKUA 2ZR0A 5TB5A 1CLUA 1S1CA 1T0JB 3GQBA 5EE9A 4Q1FA 5CDFE 2JLQA 2G77B 4IDQA 2V7QA 2DWQA 1DAEA 1XTRA 2WBLC 1CRPA 4FCVA 4KAXA 4Q4HA 1YR7A 2F1RA 3D7MA 1D2EA 4I1SA 4A36A 1F60A 4Q9LA 1Z2CA 1ZM3A 3V4FA 4MH0R 3GLGA 2WIAA 2WSSA 2FNAA 1IQPA 3P32A 3HJNA 4PZLA 1RE0A 3K9HA 3K8YA 5H70A 1VG1A 1KSHA 3U4QA 1MABA 2OBMA 4RKFA 5J4YA 2V9PA 2K5UA 4C0HA 4NCNA 5F2EA 5EZ6B 4A8JB 1XJ0A 1P2UA 3CRW1 2JIZD 1BYUA 3IIJA 1MT0A 3DKPA 2CE7A 3RS2A 4W5HA 1F2UB 4J0QA 1FP7A 3C16C 2P6NA 4OK3A 4MA4A 4OQFA 2W6JD 1OPXA 2ONKA 4GMXA 3CIOA 1HQCA 2QMUA 3HYTA 3KJIA 2RGNC 1PLLA 4BLQA 5J4VA 2G1JA 1G291 121PA 1DOAA 4EQ6B 3U3RA 1IXSB 3W90A 2CE2X 4X8MA 3QBTA 2G83A 3TK1A 3EPKA 221PA 4BFTA 4DSTA 4F4JA 5AUNB 1T0HB 2WWFA 4X8OA 1E2FA 4XJXA 2QI9C 4EIWA 1ZCBA 5F98A 3C8UA 2X8AA 4NU0A 1U90A 1U9IC 2VTKA 1NMZA 4YONB 3PITA 1G6HA 3TSZA 3W8NA 3FE2A 1TEXA 5IDVA 3UXMA 5C18A 4RD4A 2OCPA 1NBMD 4M1OA 2WWYA 3MAAC 2CBZA 4DSNA 1E4YA 3BFXA 2WTUA 1DS6A 4WZAE 1WMSA 1OE0A 2O0JA 2NQ2C 4LJ6A 3LRPA 2JLVA 4TL9A 3K09A 3T5DA 5HR5A 3U61B 4FMBB 5JRJA 1D2MA 4JLBA 1NVXQ 1SXJE 3A1UA 2EFGA 3K09C 1G5RA 2ZI4A 1QHXA 5C1BA 1Z6GA 1GL7A 2GXUA 4M1TA 3N70A 3Q72A 2YJTD 3OAAD 3V9PA 1XB2A 4XH9B 1KAGA 3L0PA 2CL7X 4ARZB 5EXXA 3WRYC 2JJ2D 4C0QC 4DLZA 1NMXA 1XMSA 1M2OB 4PPNA 5AUOB 2XTMA 3SR0A 2YINC 4KBGA 4YMVA 3KTAB 5FL7A 1OW3B 1UEIA 1J8MF 4D6PA 1QRAA 4DRZA 2FSIA 2IS1A 4OI4A 5CB6A 2Z6VA 3LV8A 5CJPA 3Q3JB 5AR1A 2CNWA 3FB4A 3RANA 2DWPA 3F5FA 3C4JA 2C95A 3IDQA 3B6EA 2WHXA 4ZDIA 1NLYA 3HDTA 1Z07A 4K46A 1GIAA 2HCJB 3GJ4A 1BKDR 1J2JA 3CH5A 2QEQA 1P60A 3H2YA 2RGXA 1IBRA 2IHBA 3EARA 4ZPXA 2ERXA 4DXAA 4AKHA 1NG1A 4Q4AB 4G5QA 5EP4A 3QXJA 4D80A 4TZ0A 1KI2A 5GJWC 3D3QA 1KJZA 4LJAA 3THWA 1NN3A 4QBIA 1XXHE 2GJAA 1JPJA 2OV2A 1E32A 5D3QA 1IN6A 4IOKA 5FPHA 6Q21A 1UKVY 3ZVLA 3WNDA 3NBXX 3GLFB 3IHWA 1Y63A 1AKEA 2EFDB 2GESA 4QL3A 3WY9A 5KOYA 4LUCA 1NF3A 2YWHA 1JB1A 5EQTA 3N5CA 1E79A 1OXXK 3F8TA 3M1IA 2GDJA 2W2XA 1YQTA 4JVMA 3VR4A 4HUTA 1Z6YA 1PV4A 1G7CA 3FMPB 5ELXA 4NTZA 1U0JA 2NO1A 1E1QD 2VP9A 3HR7A 3IIKA 4CIDA 4F7WA 3HU2A 2IUSA 1M74A 2C9CA 4EQ6A 4KLNA 5DYIA 1KDRA 4WBSA 3TIFA 4DHEA 4UNSA 1S1MA 2FGJA 4OQNA 4CEIB 2F3TA 2DPXA 1II0A 4CEJA 3CX6A 2C2HA 1XF9A 1VYTA 1O3YA 5KNBA 4TTPA 3SJAA 4QGHA 2ZS9A 3BH0A 2FSHA 4NYJR 4Y0AA 4CEHB 3KKPA 4KITB 3T1TA 3GEIA 3GMTA 5K8IA 4AG6A 2PMKA 3WHLA 3X1XA 2RB4A 3QPVA 4CGZA 3KX2A 2HV8A 4NYMQ 4II7A 1VCMA 2IYRA 1OXUA 1JEDA 1N3BA 2KJQA 3FMFA 4AKEA 1GL9B 1R2QA 3DOEA 1TQ6A 2FOLA 2W00A 5BN3A 4Q21A 1KMHA 4IFEA 3AUYA 4QRHA 1WCV1 1Q1BA 1R6BX 2DHRA 5FTNA 2VPPA 3QG1A 2F55A 2XXAA 1UKYA 2ZIAA 2WSSD 3ICQB 4LRWA 2L0XA 5KHOC 1DAHA 4M4SA 4G5OA 4M9ZA 1CKEA 5C2JB 2H1LA 4ESVA 3T61A 4M1KA 4LWZA 3QY0A 3T12A 4PTLA 1E2PA 4NCIA 2GJ9A 4IW3B 1P75A 2WOJA 4UNRA 1ZRHA 3PUWA 2ZAOA 4LHZA 1A5TA 4HB0A 3BRWD 3DPUA 1YHNA 2JA1A 3BH7A 4BGDA 2GF0A 4KHZA 5FTMA 3RHFA 2W2TA 1RRGA 4HEJA 1OYYA 2BMEA 1PLJA 2C99A 4YC7A 2OEPA 4FMCB 3ZDQA 1XWIA 1KAOA 3DDCA 5DI9A 2A2ZA 1VG8A 3VQTA 4A2WA 1N25A 1XMVA 1SKYE 2H5EA 2F6RA 1NP6A 3ASZA 2ZRCA 1HUQA 4QNMA 2AD5A 3LWNA 4MQBA 3L2OB 2D4HA 4P32A 4RD2A 4N3NA 2NMVA 3F0TA 4Z8YA 1KO5A 1RRCA 4ZIRA 4CYMA 4R9UC 4GSYA 4BFZA 3A1WA 1G3UA 3FMOB 2F9LA 2RGBA 4TZ6A 5IK2A 1VKJA 2A9KA 1E98A 3S1AA 1E96A 4DDTA 3H0KA 4GZLA 5AK0A 2OUKA 3EWAA 3S1AB 1PVOA 4ZDJA 1AN0A 2D62A 5KU1A 1KNXA 3HYRA 4KLZA 4QHYA 2ZSAA 4XVQA 2ZE6A 4HZUB 3M0EA 3NG1A 5EP3A 2ZYWX 4ITRC 1KK2A 3GFPA 3SJBA 1A4RA 1XXHA 1AQYA 4V0KA 3VMFA 2G1KA 1K8RA 5FUVA 3T1QA 1U0LA 1CIPA 5JRZA 2O8CB 3ETLA 5EXSA 5L3QB 2W6ID 4HDOB 1OIXA 3GJXC 2CK3A 3CR8A 4QBGB 2P2LA 1CR4A 3VHXA 1T3HA 1S0UA 3LQRA 2CMKA 2IT1A 4PZYA 3K70C 5FUWA 1E1QA 4TTRA 3SZRA 2Q0HA 3K9NA 1OFIA 1R7RA 521PA 1DARA 4M9XA 2DFTA 2O8DA 4B6EA 1UJ2A 1TF2A 2W58A 1KK0A 1R10A 3MFYA 4HLDA 5FL3A 1QHHB 2F43B 5IK2D 3LVQE 2ZJYA 1NNEA 3ICEA 2VQSA 4LCBA 2HF8A 4TYWA 2QG6A 1OKKD 1S9HA 2GEVA 4JYCA 4KJZA 1V5WA 1VHTA 1S3GA 2CXXA 4JIMA 4MGIR 2JLZA 4C4PA 4K8OA 2PT5A 1HT2E 2PMDA 4PPQA 1LF0A 3DMDA 4XTRA 3EG5A 2XXAB 1E69A 2EWWA 1F2TB 1W0JA 4G3XA 3C41J 4V02A 5J4KA 1E2IA 4DLUA 4B44A 3B82A 3ZQJA 1ZC4A 2QT0A 4JLMA 3VTKA 2RKOA 4MGZR 2IW3A 2I1QA 1ODFA 1SXJC 3CRQA 1VIYA 1ZM9A 3E1SA 5FI1B 2R8RA 1SHKA 3BB1A 4B33A 4PC6A 4Q1EA 2OXCA 3CNLA 3EASA 2G88A 1I2DA 4WOPA 4AD8A 4AG5A 4D81A 1YR8A 3BS4A 3MUFA 1E3MA 5JLJA 2V55B 2F7SA 4RD1A 2ZJAA 4UXHA 3UMRA 2YVUA 4UKDA 1TEVA 2OE2A 1MO4A 5IT5A 1NVUQ 2O5VA 2QRNA 1JI0A 1EXMA 5HE9A 3RS4A 1E9DA 3TJZA 3C7KA 1U8YA 2J0VA 1DPFA 4JLDA 3K9LA 4Q4LA 4C0JA 2WPDA 4B3DA 1NIPA 1MOZA 2ZU0C 4Q03A 1NJFA 3R9XA 1TAGA 2RHMA 1SVWA 2Y8EA 3RRZA 4QHTA 4P4SA 5J40A 3K0SA 2GXSA 2EQBA 3FFBA 4YQFA 5J4HA 4JLAA 5FTJA 1N6PA 1G64A 3CNOA 1S2MA 3H86A 3W6NA 1Z28A 3X1WA 3AM1A 1IHUA 2D74A 2RGAA 4D4KA 3FHOA 1E6CA 1GUAA 3QKRB 1WE2A 4O25A 5FBRB 5CDFA 4CRWB 4BE7B 2IX3A 1JEEA 4LBYA 5FOXA 4OI0A 1JBKA 1J90A 2JJ8A 4UNNA 2VP6A 2ONJA 1VYVA 2VLIA 3TNFA 4H1VA 4X8HA 1AGPA 1ZM2A 2RGCA 4JL5A 2FGKA 1IY0A 4JL6A 4P4TA 1WBBA 1JNYA 2HLDA 5JSZA 4M1YA 5CM8B 4G0NA 3R7WA 4Y0VA 3GLGE 5JWHA 2B7BA 2P6UA 2SHKA 3V4RA 2ANCA 4NMMA 1KY2A 1OB2A 3EC1A 2Q3MA 3SYNA 2QBYA 1CEEA 3QOFA 1D2NA 4PHHA 2FPLA 3VR2A 3W6OA 1AKYA 4LSGA 1ZNZA 1GITA 1QHGA 4GMDA 1T3LA 4DLYA 1CJTC 1M7GA 1WRBA 3T15A 5L8VA 3J81k 4AI6A 5J47A 1NKTA 2CJWB 2FA9A 3FMIA 5FTKA 4I1OA 4TMXA 1OHHA 3LBHA 4B75A 2GZHA 5B64A 1FZQA 2QMEA 1Q3HA 4X8LA 2Z83A 1ZUNB 2IXGA 3GJ5A 4JYBA 4E22A 3RABA 4HAUA 2WPDD 3PUYA 2CL6X 2ZTSA 3CF6R 3PEYA 1GL6A 4EJSA 4OJQA 3WP1B 4DCTA 4R2HA 1E9RA 2FN4A 4PC3A 1VCNA 3THOA 2VBCA 3AQ4A 2C78A 3RS5A 3UIEA 3AVVA 1KI8A 1Q0UA 4Q7KA 4N0DA 2H8KA 2MMGA 2JAQA 5DLQC 4E09A 4MUAA 1E79D 1CRQA 1E9CA 4RJLA 1SVSA 5KSPA 5D3MB 1CULC 5JMTA 2ZETA 4MITA 1KO7A 1PUJA 2Q6TA 4HAWA 4BWYA 2WIBA 4LC1A 4JZKA 4LJ5A 4UXIA 2A7QA 2ZRJA 2BBWA 5B30A 2P5SA 4KFSA 4UJ5A 2B7CA 2CCKA 3LO5A 4WA7A 3M6AA 2V54A 3Q8XB 1LTQA 4Z8XA 4AYWA 2QY9A 4PFSA 2R6FA 2R6AA 4TMWA 5E95A 3PJRA 4GOJA 1LV7A 2OT3B 1KIMA 2GNOA 3AH8A 1GSIA 4LBZA 4JJZA 4DT1A 1FUUA 1VG0B 3K70D 3VU9B 1F6BA 3B1XA 5M04A 2XB2A 5AWFC 3FGNA 3SE0A 1A1VA 1W0KA 2C9YA 2XSZD 4TYPA 4XWKA 4RSGA 3ZVMA 3MCAA 1KGDA 3TE6A 5GJBA 3GEHA 5JJKA 1COWD 2B8TA 1M34E 3NEJA 1EFCA 2OCYC 3U6BA 1XDBA 1AS3A 2QRZA 4B74A 2NIPA 2UVQA 2UZIR 3QKSA 1E0KA 1EESA 5B58C 2WKQA 1FQJA 3FWYA 2AKAB 3UKDA 3L0IB 4L8GA 3WHKA 1E2EA 1GTVA 1JR3E 1U9IA 5K8UA 1RRFA 1G8HA 1W47A 3B1VA 2IF0A 5CITA 1GKYA 1JQJC 4MYTA 3DL0A 1L2TA 1US8B 1XNJA 2YOFA 3CPHA 3GJ7A 4JL8A 1JXOA 3EPJA 3T1VA 1QG4A 4A92A 4BLSA 4PANA 4URXR 5ANRB 4Q9KA 1Q1EA 1XCGB 5FR2A 4IOLA 4TLBA 1N6LA 2IL1A 3X1ZA 4IOJA 4TYNA 2CDNA 2WICA 3AP1A 3TBKA 4OYHA 1G21E 3CW2A 1KMQA 3B1ZA 3SJCA 1KSGA 3VNUA 2BV3A 2GBLA 5KUTA 1OXSC 3IIMA 2QROA 1ZU5A 4S2EA 3RS0A 3UANA 1JQLB 2O8FB 3EPHA 3U3KA 4Q7MB 4FW9A 2OBNA 2QSZA 4ZIRB 2IYLD 2ZI9A 1E2JA 3L8YA 2C5LA 3TUZC 2EFCB 5E7MA 4DB2A 4XVRA 3U6KA 1Z22A 3W9YA 2GEUA 4BRWA 3UATA 2A5FA 1UDXA 1XMIA 2FPMA 1CP2A 2YZ2A 4RFSB 4P33A 4DDUA 5A4JA 3SQXA 2IXEA 2ZJ8A 3MWKA 4QM6A 2E87A 4KFTA 3ZZUA 2CLCX 3K0FB 3GFTA 4C2UA 4YLGA 3AV0B 3KKQA 2ODWA 1YRAA 2I1VB 4PC2A 3QF7A 3QE0A 2GK6A 4L9SA 3SOPA 2RH5A 3LXRA 4PQYA 1XEWX 2XITA 5JHGB 2MSCB 3LQQA 3BC1A 5G41A 2UZ3A 5DIFA 1DAMA 5TARA 3NTUA 3SBEA 2IS2A 4RD6A 5DO9A 4HATA 4DEYA 3EA0A 5TMPA 5CJ2A 4XOIA 3THWB 3AVWA 1A82A 3VX4A 4F4IA 1TPZA 1TQ4A 3VR5A 1HURA 2ZSFA 5FPSA 1RYHA 2BMFA 3SYLA 4B6FA 3O8BA 1YR6A 4V0OA 3KUDA 1N5IA 3X1YA 4BLRA 2NG1A 2QP3A 3KQUA 1N5JA 3T1OA 5J5CA 3FHTA 2F3RA 1VG9B 5L3SB 4IRUB 4B3CA 1N6IA 1O87A 3AF0A 5JI2E 4Q7JB 2EFEB 2NO6A 4V0MA 2VP4A 1Z3IX 2AR7A 1Y3AA 2R9VA 1SGWA 3QKTA 5TDHA 2ZSEA 2J0SA 4P4SB 1VHLA 2VP2A 1IOZA 3NC1C 4C0LA 4B2IA 4P4UA 2CCJA 4AKIA 1KY3A 4LZZA 2RGEA 3ZIAD 4PQRA 2GJ8A 3VNVA 2E1RA 1KK1A 4LGMA 2CL0X 4GRAA 1QHYA 4GI7A 2P5TB 2WV9A 4UNPA 2IUTA 4W7SA 3D8BA 3BIFA 5FBQB 4M22A 2XNDA 2QBYB 1ZNWA 4W9MC 4EPVA 2ATVA 1E9EA 2IYZA 4YXWD 2IYWA 3QF4B 2FU5C 3IGFA 4LJ9A 4MRNA 1HV8A 4G5RA 1XD9A 3SNHA 4E03A 3IPXA 2O8DB 3WP0A 1G8GA 1I4DD 2GTPA 4NHOA 1Z06A 2ZROA 721PA 4C0KA 3I8SA 1U94A 2V4ZA 3CZPA 3NBFA 4XWOA 5EP2A 4C9BA 2BBOA 2IEZA 1WF3A 1BMFA 2A5GA 2Q9CA 1GWNA 4LX0A 1P9NA 3AP3A 3AF2A 5AJZA 1A7JA 2G9NA 1AGRA 2ZUCA 4GFDA 1R0WA 3TGPA 4MDFA 1L7VC 4B34A 1GFIA 5KNCA 1ESMA 2AXPA 3G82C 3P26A 4K81B 5BW8A 1OH8A 2OLJA 2YOGA 3IO3A 3VKWA 4YMTA 4FWTA 2B21A 2WM9B 5JEDA 4C2TA 2Q3FA 1NRJB 3MSXA 3EZ9A 1DO2A 4KYIB 4RD3A 2Z4RA 3TUIC 4MUBA 3VAAA 3CPJB 2YV5A 3F3YA 2OFOA 4OQLA 5CB8A 2JLYA 1X86B 5LBIA 1C4OA 1NMYA 1E2MA 2QGZA 3LX5A 3BH6A 4DBLC 1N6KA 4DLRA 3RVBA 1JPNA 1RFLA 3E70C 4O2LA 5CYPA 3BJIC 4Z51A 3TQCA 5FBLB 2P6RA 1GRQA 1T8TA 2F9MA 4F93B 1OKKA 2FMXA 4JJKA 1FUKA 4F38A 2GCNA 2XTZA 3BXZA 2QAJA 4URVR 2WJGA 3B9QA 4Q1CA 3W3ZB 2QN6A 3KZ1E 3ONWA 2ZITA 3L43A 4NH0A 3B85A 2PL3A 3OIUA 3FPAA 4QJ4A 3OIWA 4EFLA 5AJWA 3OZXA 1XPRA 3CH4B 3U4QB 3G0HA 3K0CC 3UG6A 3ZJYA 4I4LA 4WW0A 3VKHA 4FMDB 2ZRLA 4BZXA 1OFUX 4PC1A 3U2QA 1ZIPA 4AY2A 2ZI5A 4ZKEA 2ZS7A 4F92B 2LCFA 2DCUA 3KL4A 5DE3A 1G8FA 2BIFA 3A1TA 3GJ6A 4JLPA 2RGGA 5GJCA 2BDTA 3N2EA 3LD9A 4CT4B 2DR3A 1CS4C 3KJGA 3VU9A 4US2R 4GPTA 3AVXA 4LK2A 5HPYB 2OLKA 3C5HA 3ND9A 3ND8A 4JBXA 4KCGA 4BFYA 4OQMA 3THYB 1KI4A 1L4YA 4BEBA 1E2HA 1XJCA 4DKXA 5IHPA 3WMGA 4DSUA 3BB4A 2QQ0A 4AYXA 4ZCLA 2PZFA 3KKOA 1AQUA 1F48A 1IN5A 1G7TA 4KXFB 3MWLA 4PO1A 4Q9HA 4DUGA 3QVVA 3C14C 3CBQA 4L16A 4EPXA 4DZZA 2WJVA 4MRPA 2QORA 4PAMA 2J59A 3MRSA 1G4UR 5DHAA 2NO7A 4QOSA 1FX0A 3Q5EA 1RPZA 1R4AA 4WXPA 1GDDA 3QUSA 2DFLA 4CZ2A 2P3SA 1J70A 1ZNYA 3CRVA 2G0NA 1XX6A 4LV8B 1GOTA 1UBGA 4OHZA 2QZ4A 1E2GA 4LY6A 2GKSA 2BJWA 2QSYA 3CRRA 3GLGB 2CEAA 1XD2B 3PFIA 1UBCA 1S3SA 1ZYUA 3B9PA 4RZUA 4YMUA 1XZPA 3L0OA 1ZJ6A 1G20E 4I1VA 2ODBA 3MWJA 1AS0A 3WXMA 3TKLA 2G3YA 2A3RA 3AVYA 4US1R 4O3MA 2A5JA 1H8EA 3EIEA 3U60B 2Q9BA 3AKCA 4B2PA 3NHAA 4HAZA 3GD7A 1CBUA 4AC9A 2QAGC 4A1FA 3QG5A 2V6JA
chains in the Genus database with same CATH superfamily
1DELA 1QFYA 3OOYA 1DCFA 2I3ZA 3RRNA 4KC0A 1AA9A 1AKNA 2NUAA 3S7TA 3BXFA 2PR2A 5CNJA 2JCSA 4YRKA 1B23P 3U40A 3K2EA 2RK6A 2Z43A 3UHPA 2VAMA 2QAGB 4RV5A 2VDWA 4DCUA 1L7MA 4BCCA 1E3DA 3P97A 3HXOA 1NR5A 2QA5A 2PKCA 3LO8A 2LDBA 3HCCA 3K0FA 4JUFA 5ALGA 3W0LB 4J1NA 3FN4A 1AZWA 3CUEF 3CUTA 5JALA 2OORC 4TTAA 3TCNA 5JXGA 3DMGA 1X1TA 4RH1A 1TYBE 4N5NA 3A4TA 3UAOA 1LCIA 1CQIA 1KI1A 3QUAA 4EHJA 4C43A 1H2AS 3K1YA 3S8YA 4EY5A 3VXKA 3HDYA 2AWNA 1ONBA 5H68A 1TM2A 3GLRA 2J3IA 4L5BA 3KR9A 1GY8A 4WZ6A 4EDFA 2Q3LA 2HA0A 3B9BA 4TQAA 4U4AA 2FZWA 3FZYA 3M5CA 1L4HA 1OIWA 5LQNA 4NZNA 5LZ2A 1UAGA 4ZCRA 4UZSA 1HYHA 2UUOA 1THMA 3KHSA 3OZAA 3OQJA 4QGBA 5IJZA 1VKOA 2GZSA 1SIBE 1ORTA 4JBWA 2G6BA 5AHKA 3SHOA 4DA9A 5ADUS 1HH4A 1RNLA 2M9MA 2YY5A 3HXTA 3WK5A 3KPJA 4CMIB 2HH9A 1I2MA 2V58A 2X1LA 1XLTA 5AKXA 3ZZTA 3PWTA 2QTGA 3TLAA 2IP2A 1CUBA 4HYEA 5H59A 2IY8A 1BYIA 2WSMA 1MZVA 2W2LD 3UJAA 1W5FA 1W4RA 5ARCA 4ZCMA 1DJNA 3EOBI 1U5CA 4QVIA 4CV0A 1SUWA 4MRSA 1JVBA 4TUYB 1RIFA 2WF6A 1B0UA 1UBMS 3UM9A 4MW5A 2IHTA 4WCFA 3QWAA 1JG4A 5G4KB 1UXIA 2Y27A 3L0YA 1LPSA 1UEXC 1V7QA 2DPLA 1F1JA 3NWOA 3OC6A 4LI0A 2X1VA 1F6WA 4DFDA 4DTCA 2ILVA 1G0NA 3RWMB 5BVHA 3KAJA 5JYDA 2WINI 5EL0A 5FTLA 4CEHA 5DISB 3Q6MA 1F38A 2Q9UA 3DOUA 1N2GA 1PR4A 1SPBS 1STOA 1V2GA 2R751 1PZMA 4R1MA 4RH0A 1FJ2A 2YOHA 3OCCA 3UXYA 4BO4A 2FPRA 4JXXA 3PEUA 1H8HD 2A9QA 2FSUA 4X54A 4EPYA 2W37A 1O9HA 3I04M 4YA6A 1NT2A 5CGZA 1XOIA 1I24A 1MEEA 3GXBA 3G5MA 3PWSA 4LAFA 4OXRA 2LKCA 5JCXA 1K9VF 3LL4A 2IBTA 4OM8A 4O4JB 4O63O 3VKFA 3N74A 1ZRSA 3AONB 2DETA 3E53A 3DEYX 2B2CA 1KF0A 1HTWA 1E0SA 2ZREA 3D1LA 3QHQA 3U4IA 5DGDA 2WKPA 4JJ6A 4URFA 4YJ2B 4CVNA 1U99A 2FMTA 2AI1A 1Q92A 2BFCB 1UM8A 3AI3A 3PDIA 4MW7A 1QUFA 4F71A 1Z36A 2XVAA 2YJNA 3LUDA 4CG3A 2ZG6A 3NHBA 4G4GA 3LUPA 4PSAA 2CC2A 2SKEA 2AJLI 3C7TA 4MMYB 4R1QA 3WMEA 4RZ3A 5JR3A 5IWAB 4JYMA 1Q1GA 3B2EA 1HNXB 3DL2A 3H1TA 3NOVA 4Y2JA 1JXMA 5FOWA 2CMHA 4XM2A 3CUVA 5DBFA 1FSZA 2ZE8A 2VXOA 3BE4A 1EGQA 3UV3A 1POXA 1FQOA 4QXAA 2XWBF 3RS3A 3UUWA 2OGWA 1JU4A 3DNFA 4G9BA 2P9FA 2OV6A 4YPFA 1WHSA 1QTRA 3A4IA 3QE2A 3TMYA 2NVBA 2QLFA 3WNBA 2HJGA 2VJMA 4MAAA 3A6EA 3BMNB 5T41A 3CB4A 3TRKA 3D5TA 3D7LA 4G5FA 2XYVA 4OHWA 1T4DA 4PIPA 4RHCA 3W4KA 2FUNB 1QYCA 3SVTA 4PQEA 2HDWA 2QL5A 2WVGA 2ATXA 1AY0A 1EE1A 1WXIA 1MR3F 4Q24A 2ERCA 3DGFC 3UUGA 3QXHA 1D6JA 2XUPA 3Q9LA 1KDVA 1W1WA 3GEMA 3AIOA 4B4WA 1DV2A 3HLTA 4XB1A 2VSNA 1YKFA 3EDMA 2L42A 5AIBA 3UV6A 1Q21A 3HR4A 4G37A 2FQYA 4LHYA 4M1MA 4R40A 5K8JB 5DASA 1GZ6A 3N1UA 4PSKA 4AYTA 1XTUA 2XT9A 3UWOA 1F3OA 1EXNA 1M6YA 1W5TA 4HNGA 4URYR 2FFHA 4QSHA 5JJIA 1UC8A 3F5DA 4Q5IA 4I9HA 4C5AA 4MO2A 4DCPA 2MWMA 3UAXA 4YUZA 4FR5A 5D86A 5AKYA 4QM7A 2B8JA 4RWEA 3KQPA 3S28A 3N2GB 4LQ4A 1Q1AA 3L6EA 5EJ8A 5E6UA 4TSFD 2GKOA 2PSSA 3IUPA 3N6VA 3TTUA 4TXNA 4LHSA 3A58B 4FPXA 2HLDD 3SSAA 1H3EA 4BP9A 2WMOB 1K88A 5HZKA 1KTVA 4R5HA 1SU7A 2ZIXB 4X7MA 5HOQA 5L51A 3CQ9A 2J3KA 4PLYA 1IY1A 1DI0A 1T1SA 3AEXA 3CEJA 3ZS8A 5CXXA 5LP6A 3ZD6A 5EMHA 3NWPA 2V0CA 3BXOA 3IOMA 2BCEA 2ARKA 1USVA 2VZEA 3GZTB 3ZH9B 4FE4A 5LZ9A 1SHTX 2XGSA 2GVDC 1K6IA 3QKUA 1XTQA 3F2IA 4B09A 4IOMA 2XNSA 1RXYA 3GN1A 4KI7A 5CVCA 2W0SA 5AJTA 5KWVA 3DBHB 5ALTA 2D2IA 3ELBA 3DTVB 1Z2DA 5FOUA 3ZJUA 2Y1KA 3ZWPA 5KSOA 2HCBA 2X14A 2Y2UA 1J2EA 2BWJA 5KQSA 2NSHA 2X2OA 4YMSA 2GWHA 1Y34E 1GVNB 3KYBA 3ECSA 4LY3A 5H83A 3NBZC 3DKKA 3JARA 4GPBA 4TYMA 3T7SA 2FSSA 4D9BA 1QB7A 3U1VA 4H7HA 2QTVA 5KYKA 1FRFS 2WUFA 1MVOA 3O4VA 4XD2A 3VBEA 2IYTA 1KQ3A 1W85A 2CJFA 1XRJA 2B4AA 2Z57A 4RE5A 1RXEA 4IRXA 4W1PA 2NSDA 4CM4A 2IH2A 1J0EA 3AF1A 3UT0A 4DRXA 5EE1A 5BYJA 2WP8J 4PHGA 3VYRB 3A14A 1H9BA 1EX7A 1DFGA 1QFJA 2P4UA 4DCSA 4X64B 3PVCA 4A6DA 4DBVO 3CVOA 3EZ6A 4FYXA 1JHQA 1KI9A 5BYAA 2PR7A 2A9OA 3LBFA 1FTGA 4NAVA 4GKBA 1WJGA 4C4YA 1CE8A 4ID9A 3LBAA 3U4CA 5CIYA 2BGWA 4RA6A 4I50F 4MI6A 1Y6JA 3OFNA 4MI9A 4B35A 4CMCA 2XDAA 1A2BA 2HBRA 4BYMA 1OAKA 3DE4X 3OICA 1DLIA 1XJ5A 2HI0A 4OI2A 4MB6A 1VL6A 3C3YA 4HPXB 3PD7A 2BEJA 5JXJA 4LC0A 1Y9EA 4NBWA 3DQPA 1OXKB 2X8LA 3DHVA 1GXSB 3QHPA 5BV8A 5AXBA 4NYJQ 1E60A 4OHYA 4M0UA 5FPQA 4KQKA 1OPRA 3VA7A 1V48A 2WAAA 5CW1A 1M3SA 3AM5A 2GWRA 3AXTA 4KQEA 4ON9A 2WB2A 1AQIA 4WXRA 4H7JA 3PXGA 5C53B 3DD1A 3IIEA 3QPUA 2PPLA 4PYLA 5D3MA 4D4LA 4E3WA 4F2PA 4FGJA 5JCZA 4QUDA 3NTRA 5LIRA 2VIIA 2JGFA 2PEYA 1GYPA 2VQDA 3T3GA 2P9TA 3GOQA 4L4UA 2TSYB 2EAUA 4N8EA 4Q4AA 1EUDA 2GCGA 3K05A 1EVZA 1XPUA 3KXDA 1Z35A 3ILXA 2CKMA 1SOAA 1Q95A 3GLHA 1M0SA 1YCFA 4IP0A 2D13A 4NNJA 2QTHA 4CF7A 1RJ9B 2QMOA 2BSQA 4NBTA 4ZQEA 2PM8A 3I1JA 4UAJA 3LF2A 2PGLA 2GCIA 4MK4A 1KK3A 2VPZA 3GXOA 1C0LA 4G1FA 1SQSA 2EWMA 4JUAA 5JBIA 5FCDA 3G8AA 2DLNA 5F35A 3OCYA 4HRVA 4JGIA 1YRWA 4G0OA 4Q7EA 4D6YA 3OEWA 4EAAA 2OM6A 1X42A 1L4FA 3IMCA 4RESA 4BLOA 2WIGA 5EHQA 3QQ5A 3IBSA 2FG6C 3UO8B 1BS2A 3QSYA 1QF7A 2F48A 5CTJA 2WABA 2HJVA 3CXUA 2MR6A 4PGMA 4TWAA 1TI7A 2C5EA 4ERNA 1T5OA 4ZEVA 1L5HA 4CXMA 2N42A 4YRJA 2C8KA 1BX0A 3ON5A 4FFBB 3RODA 3L8CA 4NZZA 4BQNA 3PYXA 3TIVA 1XTKA 5ED0A 3D54D 2FEXA 4OHMA 3CW9A 5KVVA 1QGUA 1H3NA 4ZKDA 2GA9A 1V7ZA 2VAXA 2AMJA 2GHTA 5FA8A 2HYDA 5IRCD 5ICEA 4YHBA 5IM5A 3DOFA 3ZY3A 4BGEA 2AZTA 4EY6A 4B71A 1PFUA 5E2AA 2IV3A 1RZUA 3UT5B 1HNWB 1N5KA 5FWNA 4PX9A 5KTYA 1K2WA 3E18A 3H9QA 4WMLA 2PU5A 5EE3A 2FOIA 3AI7A 2RHBA 2CKDA 2OFXA 2H57A 4BFUA 3AR9A 2YVQA 2P9ZA 2A88A 3T7CA 3OEED 2YL2A 3V00A 2VHYA 3PNKA 2GAIA 1ZSVA 5GAJA 2Y1GA 4L3VA 2PVSA 4EHFA 1QTNA 3I76A 1HYBA 2MMCA 4C01A 1VMAA 3BSYA 3OJ0A 3SF0A 1GUZA 2X3FA 4L8YA 3EUEA 1AO0A 2P78A 1XMXA 4DZRA 3NM5A 4DB4A 2J9GA 4EFNA 5DHPA 4E15A 5KX5B 4KO1S 1TU0A 2ZUSA 1XL1A 3BAFA 3IUBA 4D99A 1B6RA 1J9ZA 3DBRA 4DREA 1BS9A 1K4YA 3VC7A 2H2FA 4I7EA 3DZIA 2WAMA 4B3RB 1F2UA 1I3CA 1ZN7A 1CIVA 1ZHHA 2GN1A 3N05A 1U8ZA 2WVHA 4NS4A 1YFJA 4E2YA 5BSEA 3K2BA 4BNIA 2HSWA 3LGSA 4OQPA 3RJ9A 1QIGA 2CNLA 1Q91A 5DXFA 1W4LA 3ZKWA 2B3DA 3DKRA 5AM3A 5CDSA 2H07A 4MDYA 5HCIA 3T52A 5D8DA 3PFBA 2GXAA 2VYVD 3MBKA 2G63A 1S01A 2WAYA 2CHQA 4JQOA 4NULA 3MINA 2HA6A 2XXBA 1QFSA 2POCA 3E2PA 3EIHA 1KYYA 1DTSA 2PX2A 5C5CA 1Y6QA 3HJCA 4JBLA 1KJNA 3Q1KA 3VU3A 3HJGA 1KWGA 5M29A 3PQDA 2PUCA 3OI7A 3ETHA 1Y37A 1P7ZA 4Y1RB 2VQ3A 2PU7A 3BXXA 3IXMA 1XAGA 3KQMA 1YCHA 1Q0PA 2JLRA 4GEGA 5DGXA 3A1VA 1TC2A 1T3TA 1BVUA 2ORED 1I4OA 1AD2A 4MVJE 5BP7A 4HLCA 4X7PA 4UTZA 2G76A 5E7IA 4DRYA 4DWOA 2D59A 4BL5A 3SFTA 1HRDA 4L7VA 4OJKA 1JWLA 1P3JA 3EVDA 3NBYC 3VPGA 3VR1A 2OZKA 2XSZA 4GOMD 4ZZ1A 1R0XA 4KHPB 2QGFA 4XEUA 4X94A 3S44A 1YGYA 5JAOA 2QTLA 1T2AA 4AWXA 3L7CA 1Z6QA 3DE0X 3HB4X 4FQ7A 4NCKA 3STHA 3HCOA 1AKUA 3CLVA 1NHGA 1PQWA 3AIKA 5KYXB 2R7KA 3S5JA 1SOVA 1VSBA 3T9AA 1SUBA 1P4RA 1S2NA 1EA5A 3FPLA 4II3A 4NOKA 1V1MB 1O1YA 4OAPA 3QEOA 4G1EB 5CB4F 2BJVA 4C7JA 1QHSA 1LJUA 3F97A 2A0UA 1GA4A 5K8LA 1ML3A 2QR5A 3W8EA 2OL4A 5JCPA 1LGYA 1OT3A 3DXYA 4RLHA 1CVIA 4W5WA 4BNLA 2QX6A 1JH8A 3HGQA 1OR8A 2ANBA 1HT3A 2GN9A 3BK2A 3Q6IA 1ZD5A 4QHSA 5B1EA 3BQ9A 2BDUA 3C3WA 3CO0S 4RKRA 4XPIB 1XA0A 2PQ6A 1JFRA 2CXPA 3LY7A 5G53C 4B8WA 1OJLA 3AR7A 1Z4LA 2BTQB 3EDCA 3ORSA 4HTAA 2XYRA 4QFMA 1ZHOA 2RARA 1CU1A 5LB2A 2E37A 2V7WA 1RYBA 1OFTA 2AD1A 1S02A 2OILA 1IDOA 1T2CA 1Z5ZA 2W2KA 3G2NA 1K8XB 3L4KA 5G4KA 1TD1A 1QPZA 2BM1A 1XDUA 4ZEXA 1L7OA 2GETA 2JJ1A 3VHXB 3FH0A 3VR6A 4NONA 5SY4A 1N0UA 2OV4A 3S40A 2HF7A 1QHNA 4WLNA 5K09A 1XVVA 1NG9A 3THYA 1VLJA 3LLUA 3SXJA 2FR8C 1R4MA 2ZVQX 3FDFA 3QZUA 5EKDA 1ULHA 3GFBA 1W4ZA 5CB4A 2GHIA 4C87A 3WYGA 3ZHSA 2X0KA 1QG2A 3L4BC 4MKGA 3GT7A 3LOPA 4FYIA 1NIJA 3CEHA 4M7OA 4B3BA 3KQKA 2PZGA 4KR9A 3H7AA 4ER0A 1AS2A 2UZ4A 4OXQA 3T0IA 4DDWA 3ESCA 5EGSA 1DTWB 1PFGA 3EOZA 8ADHA 1E9AA 3R8FA 3I9NA 3RROA 3I61A 3BICA 3DDUA 1A77A 1SM4A 1IPHA 1UP4A 2FF5A 3LXMA 4G5HA 3TLEA 5K45A 1T24A 4QGGA 1PYOA 1ZMRA 3AUXA 3IO5A 3HBNA 3JYQA 3WIUA 1YV9A 4AP5A 4J8PA 4LOJA 1E9BA 4RZIA 5EHNA 4C3ZA 4EEZA 1T0UA 1II8A 1G9SA 3SMQA 3FFTA 1SQGA 1WEKA 4IIYA 1UIRA 1ORWA 1J1IA 2QOEA 2K7ZA 2WF7A 2ZAYA 4MA5A 3AKYA 2R6JA 2X6RA 3FYCA 1EWTA 4NV0A 5CW2A 4TN5A 3RUPA 1L5SA 2O3SA 3H5OA 1P45A 4R8MA 3WKDA 1BHSA 3PX2A 3HKBA 3ANYB 4LYJA 4IIVA 2JFVA 4R5MA 5FBHA 4ESEA 1TZMA 4TL8A 2QXYA 1L6RA 1E3QA 1GGVA 3AVOA 1UZMA 4R0VA 4DR1B 3Q7RA 2R65A 2Z95A 3V1UA 4JI8B 4WFQA 1PS8A 4G2TA 1IJFA 2IZ6A 3ZX5A 1QP8A 4ROTA 4RVGA 4E0BA 1WETA 1XP8A 2YHBA 3DHYA 4A0SA 1JDNA 2JFYA 2FPSA 1Q50A 1VMDA 3GGGA 1AHNA 4G85A 3TZKA 1YVPA 4L4YA 2LP4Y 3LA8A 1OH5A 5KDDA 4HWSA 3I5XA 4RPGA 2C83A 1ATZA 3RYTC 1CF4A 5ENDA 5B1DA 2FRDC 2VYND 2B61A 2FPPA 5B6PA 3KXKA 3GNQA 3ADBA 3L1IA 3ESXA 3OJOA 1N6RA 3AR2A 3Q2OA 4DRXB 2VYVA 2W11A 3AY3A 3LAWA 2Z9BA 4HYTA 4N82A 5TS2A 3SHQA 3TLGA 4L7QA 3FY4A 3NHSA 3OZFA 1XNGA 1MO6A 4PLVA 4I36A 2J3DA 5EXPA 1XAJA 1XEXB 3C3EA 4OFXA 2P40A 3WTBA 1JDPA 1QQ7A 3C6ZA 1P4AA 3EXHC 4RZHA 1TTHA 2YJ5A 2PXAA 3AY0A 4F96A 4CV3A 2P1RA 3QPCA 2GQ0A 2IPMA 5F3WB 2J5KA 3W3AA 1M6NA 1FS4A 3ES9A 3W7AA 1A76A 3UPUA 1GILA 4Q12A 3X1DA 5IH3A 5EE0A 4OHRA 2H4YA 2VNAA 1GRVA 4LFCB 1R0KA 3DMFA 4UTPA 4GUDA 2ZPTX 1TYCA 1WSWA 3WV5A 2P6OA 4CKEB 2JHCA 2NZ8A 3RBZA 1K08A 3ZCSA 1PCXA 4O8CA 1ZO8A 4Z9FA 1VI6A 4NCJA 4DJEC 2OHIA 1YMVA 4TXLA 1CD5A 1LJLA 2VTVA 3E2MA 2OXTA 1R0ZA 2BELA 2C4HA 4V3BA 4QOHA 3TCXB 3HKDB 1Z08A 3WL4A 2R1ZA 3JVUA 1C8KA 4LPSA 5E38A 3RUEA 1IBMB 3PD0A 2QQ5A 4HWPA 1N9KA 1DBVO 1B0AA 5A3RA 1WA5A 4FWBA 3TG8A 1ZBQA 4RMGA 4RZSA 2A9VA 1OF1A 1V5FA 3HJBA 5FOTA 1T5TA 4JASB 2JK0A 5HGJA 2BR3A 4EFMA 4YAFA 4JENA 5F5NA 3TQOA 2XCRB 3MPOA 4O8ZA 3TTTA 1J0XO 4IJ5A 4HB4A 5LM3A 1YXMA 1FU4A 2E7ZA 3CCBA 2JFHA 3ZLJA 3GDGA 4XVHA 4L6AA 2XZPA 1T6NA 3NUGA 1MB3A 3K9BA 3T3OA 1O54A 2C04A 2Y4NA 2E2WA 4HQ0A 3BL5A 5FL7D 5E1OA 4AURA 4B6JA 1I0LA 1PSWA 1YI0A 2OC4A 4YTEA 3GQVA 2Q2OA 1UBEA 2V74B 1XZKA 4HBGA 1PJRA 4L8WB 1GP2A 2F62A 1JF8A 4S24A 1QR6A 4TVSA 2VL7A 3RUAA 5KTRA 4NL4H 3K30A 4LVNA 4HWKA 1QIIA 3ACCA 2FRVA 4OQQA 3QMMA 4FGUA 3U37A 5DYGA 4X44A 3TJRA 5F9HA 5HF6A 2YASA 3PUVA 5HQ3B 1WNTA 2C98A 2D7JA 5KAMA 4B6GA 5JNVA 2B1GA 4KXMA 2CNKA 5JCOC 2XKBA 3GGJA 4INPA 5I8PA 2QXUA 4LXIA 4HGZA 2WU8A 3RK1A 2FW8A 2ZSHA 1HOXA 2PLFA 3M70A 3CNNA 3UGJA 2PBRA 3ME5A 5TGTA 5GIPE 3AC0A 4IJMA 4QPDA 3CF4A 4XLZA 1MT3A 2VPTA 5CK4A 4GKJB 2ZFUA 2O3TA 2ZRQA 2OCGA 3NIWA 3QU4A 1EBFA 2GPJA 3JQAB 3E7WA 2Q41A 4LDNA 4WOJA 3THRA 1LY1A 5EZQA 3PD1A 3H8JA 3TMKA 1AUVA 4ZHQB 4NE7A 3GVPA 5BR8B 2EW1A 1ADFA 3W6ZA 5MF6A 4ZI7B 4FEGA 3R9KA 2ZCVA 2IYYA 3FROA 4B6OA 1HDGO 4F6CA 2QZJA 4Q00A 2NU9B 3WLAA 4F4CA 4NBNA 3N53A 4XUDA 4EY7A 1H1LA 4HNTA 3CLKA 4LV6A 4R8KA 1BOOA 4Q02A 1SK8A 1V2HE 2HMAA 4DJDC 5BUSA 2BGTA 1ZBDA 3MSCA 1W1UA 5I51A 2NLOA 1UPTA 2PD3A 4XFJA 2J9RA 2GERA 4YDHB 1HE3A 1L5ZA 1S4MA 3AJDA 3QWFA 1GZUA 2XAAA 4EKGA 2XOKA 4J2HA 2JFBA 2F3UA 3JYLA 3PEEA 1K63A 3QWIA 1YGPA 3HL0A 1NBOA 1W2HA 3NHJA 3I9MA 1PLKA 3DO6A 2QQEA 3DKIA 3AKDA 3HO1A 3DMTC 1NKSA 3FBTA 4HLQB 2HA4A 3V1MA 1N0VC 3ANTA 3LKZA 3CZ9A 2YICA 4HQLA 4QUBA 4Q6BA 4B4OA 5ITVA 2Q2NA 5IW8A 3AHHA 4W8GA 1JHMA 1Z0FA 1EGVB 2FSVC 2REQB 2YHIA 1A5SB 3WA7A 4OQ4A 5I6DA 5I7OA 2FF7A 3DMHA 1XA3A 1RAIA 4XIGS 1V43A 4ASUA 5DBIA 3R5HA 4OREX 4B0PA 4XX0B 4C7OB 1X7HA 1P9OA 3B7WA 2P9BA 4GNKA 2RK4A 2CYBA 2QPOA 3CMCO 1FVXA 1L8QA 2CLFB 2PLRA 3NJ4A 3P2MA 4IBOA 4IUDS 3TR5A 4HEA1 4LEIA 1R5BA 4D97A 5ICSA 3HEMA 4I99A 1EJBA 4YV0A 1UXKA 1Z0IA 4LMAA 4LOKA 1BNCA 1NI3A 2WE8A 1IK4A 4GMKA 2B1QA 2EG9A 4FC6A 1FYDA 3UUEA 1G60A 1TGYA 3FFWA 5IULC 1Z2OX 1XKLA 3QKSB 4IFTA 3VAZA 3H75A 3D5EA 1GRCA 3JV7A 4EDHA 2YKGA 4CM9D 2AFIA 5A6SB 1PFWA 1P4HA 3G6KA 4MW0A 4FGZA 4QO8A 2GILA 4JEIA 3U7RA 1U8EA 2H1HA 4EITA 1K7YA 1GEGA 1AKWA 2JD2A 3QSGA 5KJFA 3OSUA 1MVLA 3DO5A 5B3JC 2CVFA 4AJ4A 1RRPA 1NTOA 2ZRMA 1PL8A 3G0GA 1QE5A 4AY3A 1Z7GA 4NJEA 1GKUB 4DCCA 2B5VA 4UCQA 5BSWA 1RYEA 4OGLA 3IHTA 4Q9NA 4DLXA 3ACDA 4GXNA 5DTEA 3PUHA 3ZKAA 4H0NA 4W7IA 4AKGA 2BL4A 4ZU6X 3CKLA 5KIAA 1L1EA 1LDEA 1H66A 1SURA 2YYZA 3BGWA 4RCVA 4KUEA 1UWCA 1NLUA 2I4MA 1TM7E 2YWXA 3RLFA 3S99A 1AKTA 1ZIDA 5DM70 2V7QD 5ELLA 3Q87B 3V80A 5FLKA 2RK3A 2EYUA 1I4WA 2VWGA 4OK5A 1BDIA 2CZGA 4POAA 2GJKA 2Z8XA 5FP0A 2XB9A 3SD7A 4V0ME 3EVGA 6REQA 2JHAA 1OB5A 3IJEB 1VIAA 2AK2A 2XMQA 4BMZA 1PNQA 3I62A 4HO1X 4ZVPA 2QYOA 2R47A 1PAUA 2CFRA 4R84A 2PUVA 4O2BF 3PX7A 1JXAA 5ALIA 3EXEB 5JCJD 1JQ3A 3B7GA 3F6SA 3M5DA 3DT8A 2Q29A 1EVQA 5J43A 3EGDA 1OBFO 5K03A 3WISA 1SO8A 4KH1A 3QVUA 2P2CA 2QRVA 1A8PA 2P5UA 1G19A 3OQVA 1Z7YA 3D3NA 2ZOSA 1A27A 3GLUA 1FDWA 2R44A 3BKXA 2J9XB 3EVEA 4JVSB 4US0R 5EPOA 2C3UA 1TZ2A 4JP2A 5EOVA 3NOOA 1JEYB 2CMGA 3N2ZB 4W1RA 4YV2A 3NVDA 1ND6A 3AVPA 2PEZA 4CUZA 1JP7A 2C57A 3WB9A 3W79A 1IBLB 4CETA 2XADA 3PWKA 4B3MB 1A4UA 3ZU2A 2J6CA 3FCSB 1X80A 2R60A 2DFDA 3Q9NA 1ZIXA 2I3BA 2XD4A 5E6SA 4CKYA 4F46A 4O2AA 2HMWA 5A2QA 3ZDEA 4A0FA 1GO2A 3CJRA 1YULA 2YCLA 3MT0A 3TSWA 3UY4A 3GP8A 2RGDA 2QVGA 2GSWA 3F6EX 1ZL0A 1LK5A 2P67A 3BSSA 3KJXA 3LBIA 3B6ZA 1P5ZB 3QW4B 4G01B 4JJAA 3WKEA 2AC4A 5AFSA 1WZCA 1I2BA 4BJ5A 3IDZA 3CISA 4M8NE 1EIZA 1TQDA 2JRCA 2YMQA 4MYCA 3V8RA 4CN8A 3ZHUA 5IJ9B 5EHXA 3DDSA 2QS9A 3C5WP 4OP2A 4R2LA 4PC7A 3IA7A 4V2IA 1T8RA 1ZEJA 3LX6A 5DMXA 3MG9A 4BFWA 3NLLA 3WGMA 2DXIA 3WGIA 3VZRA 3OUTA 5DI3B 1KFJB 1SVIA 2XB4A 5IU6A 1ZINA 2V7PA 4D45A 5EUMA 1U7ZA 1JIJA 3IAAA 1A9RA 2C4VA 1ZRNA 1O96A 1W35A 3GLHB 3G1TA 2VZ0A 4M21A 2RFLA 1JXQA 3LJKA 1KSJA 3ORHA 2O0MA 3WKCA 3ZWQA 2A0KA 5L3QA 4RHYA 1QKIA 1V1RA 3KQHA 2I87A 1LNQA 1MB9A 4PZZA 5I9IA 1EVYA 1LRKA 2R48A 4B4KA 3AJ8A 3C15C 4YDRA 4HGOA 3KG2A 2NU9A 3K4HA 4QOGA 4YAIA 5KO2A 4C07A 1Q1ZA 2XVMA 4LYAA 3DE7X 3HP7A 3KJHA 4PNZA 3UXHA 2Q8PA 4HFRA 2IYQA 1JQEA 5EWMA 4KKXB 1ODKA 3OHSX 4B73A 1TOAA 1TO2E 2FY8A 3KPWA 3R3XA 3KDSE 1F4VA 2GUGA 4EO4A 3F7NA 1HPLA 4IYRA 1WCIA 3FDZB 2PZEA 3OUUA 5BQOA 3HZRA 1ZUIA 1NBEA 3INYA 2QUBA 3JQFC 4QEDA 1JILA 4CIVA 4TLEA 1REQB 1G3IA 4XQEA 4C6SA 2BF7A 3A3NA 3FD8A 4MB0A 2CYCA 2L2QA 3KOYA 1KEEB 4BO0A 4K9MA 3CUKA 4ROSA 3FOZA 4B5LA 3OHPA 1NI5A 1C9YA 5BSVA 3HWRA 2HD4A 5JW6A 5D1HA 2NNLD 4M2LA 4RVNA 4EPRA 2B4KA 1YZNA 5GOZA 1YJ5A 2CF5A 3AUTA 1B1CA 2XKJE 4TSFA 4DR6B 1IM5A 3KTAA 4MEJA 4U5XA 2EP7A 1SKYB 3JZDA 3TR6A 1I1OA 3FIJA 3FLBA 4LJSA 4A27A 4F72A 2X2PA 1GV0A 4JVOA 2BP7B 3RTBA 4CM5A 2Q6OA 3HBFA 2XRFA 1QVRA 2WIKA 3OTIA 2NZYA 3QEJA 2Q5IA 2ILTA 3ETNA 4XSHA 4YJ2F 2Z1MA 4FFNA 1EP9A 4RHUA 4OMCA 1L4UA 5CNKA 4YAKA 5K3SA 3N76A 4AZ0B 2BC9A 4JLJA 3OAAA 1Z47A 4OJMX 2QM0A 3KJZA 3TQTA 1YKSA 1Y4SA 2W6MA 1AB5A 1PWXA 1BG6A 2NV6A 2ZT7A 3DBLB 4TKMA 4YJHA 3TTYA 3BK7A 2JGLA 1QGZA 3E2IA 1EVEA 4LHEA 3W5BA 2EGUA 4UHCA 3ZU3A 5EAIA 3U7JA 1V3UA 1XFDA 1KPIA 2HSGA 3LECA 3BQMB 1ETHA 2Y1CA 3KBOA 1TW2A 2A1UA 5I4BA 2XRZA 2G82A 1MABB 5KPJA 1FTWA 1ID1A 3H05A 3SR3A 4H1UA 4HQNA 1TE2A 3REQB 3BHNA 4HSEA 5KCZA 5DZSA 2OCBA 1R00A 4UEOA 4ZV4A 4AO6A 2Z58A 1P81A 1FK8A 2QD4A 3ZE0B 1QIFA 4H16A 1CZHA 4TLCA 4MVCA 4F4HA 3DZ8A 4EJFA 1NVFA 1FFXB 2YUIA 1II8B 2ZSBA 4OHUA 4WX2B 3VVBA 3WYFA 3JQ8A 1U1GA 1NX6A 1ZVJA 4OA8A 4X7RA 2IV2X 4BLWA 5A9RA 1YB4A 3OJLA 3U17A 3BZUA 5K6AA 2JARA 2ZAMA 5FUQA 2VNSA 3PC3A 1F5NA 4RNDB 2HXSA 2QM8A 2HKIA 2NNWB 4YRMA 1L5NA 1IWBB 3GT4A 1BD4A 1DINA 1G8MA 1Q7BA 3BFKA 4XIYA 2BGKA 3PHHA 1B6SA 4GDMA 1O03A 4FMDF 1FMLA 5LJLA 1O77A 2R11A 1KETA 3MM4A 1V11A 2FH5B 1QZUA 1TO1E 1M5RA 3BKWA 1R12A 1VB3A 3MRXA 1OX4A 1AHIA 4OHCA 5EJMA 1E9VA 4BZPA 3G0OA 4DIFA 2FR0A 4PAQA 5E7QA 4XD7D 4URWR 2V1XA 1XYVA 4HNAB 3M4ZA 3AW8A 3NP9A 3WLTA 4DWVA 3IAUA 2PO5A 2RI0A 3F4BA 1WV1A 1ZD8A 3KLPX 3NDPA 3GNSA 4Z4CA 4KSBA 3TD2A 4WK0B 1SC6A 4GZMA 3E4DA 1IXRC 3TZEA 2UYCA 4E94A 1W0CA 3M1LA 2C4KA 3RADC 1EP3B 2WRZA 4Q9IA 4LFBB 5H5JA 4N47A 1NN0A 4BGUA 5HRUA 2Z5FA 1USKA 1X1RA 2NVOA 4M53A 3WGTA 1DWOA 1GLGA 3WL5A 3EZFA 4ECEA 4CQNA 2YVAA 1ZCAA 3UFBA 2YHIB 1VMEA 4DHWA 4MWBA 4QYTA 2RAVA 1FDSA 3A6JA 1U9ZA 2PNFA 5GONB 2V5VA 1TAUA 4XXHA 1IEWA 3OE7A 2LKDA 3UMVA 5JZOA 2VSXA 1M2VB 1Q1QA 2QY6A 4H7IA 1U8AA 2QYTA 3ZXUB 5ALPA 2B34A 3MS4A 4FFBA 1GTSA 1BFKA 1JMKC 1GXSA 2O1WA 3DB2A 1C9JA 4FIDA 4UU1A 4ZRMA 5E3HA 1I2CA 5C7YA 4IQ0A 2ORVA 2EC5A 1PEAA 4KWHA 3CWZA 2YYSA 4EB6A 3U7FB 2GM9A 4BKOA 3R9WA 1IY8A 4EI7A 3GLIB 3D31A 2X23A 1IZ8A 3PR1A 4RQTA 4B3HA 3PEFA 3GUUA 2ZU6A 2AK3A 2AUMA 1NMSA 2EKBA 4N7JA 4RMIA 5BXYA 1U7TA 2IX9A 3NX4A 3KEFA 1KYXA 2XE7A 3DR5A 3R1IA 4FUTA 4O2BB 3DLAA 4FMPA 2WYIA 5DSZA 5EZYF 3PUXA 5JCJA 4N48A 2OCLA 4N76A 3I4LA 3ILYA 4S1OA 1Q83A 1HI9A 2PT6A 3G2MA 3VPBA 1DKOA 3NKVA 1R15A 1EVKA 1UQRA 3TLMA 2PWZA 3FUWA 2FJUA 1V4NA 1OMOA 1IY2A 2ZI7A 4G0XA 4B47A 2M6SA 3OQHA 4JLVA 2X7JA 3IAEA 3ZLUA 5B3JA 1FOEB 3G0BA 5JSKA 3U49A 3KQYA 3CW8X 1BTOA 1XNRB 1JS1X 1UBHS 2YHSA 4J0JA 4X6UA 2C2XA 4IDBA 1GFWA 3PLNA 3PZBA 3UQZA 3AEZA 1X9GA 3VV2A 5KB3A 4S04A 2DQ4A 2JHGA 3IE0A 2JASA 4NC9A 3K5WA 2H7CA 1KQGA 1UKZA 1FYXA 4YP0A 3BTOA 4MHTA 4HDCA 1QKJA 3E5HA 1H4TA 1E1KA 3E48A 4JI4B 2RAFA 3EPLA 4U00A 4UZFA 5TXGA 4BZQA 1JRLA 3U4AA 2QLBA 5F7XA 1XRPA 2HHCA 2A6PA 4E14A 1QG6A 4XDYA 1EUZA 2QTFA 3P1JA 2WTAA 3GD5A 2IOYA 3B51X 4IEEA 1TEZA 1UKEA 2FFJA 4MVYA 1S8AA 2WT4A 2QENA 4GOXA 2GGSA 4TWJA 4WZAB 5DRYA 3WGQA 3HCWA 1M6EX 4NPHA 5AJUA 4KQHA 4TMFA 2I4OA 3RBVA 1EHIA 1T0JB 1FP2A 2VS1A 1LDBA 2D1SA 1GPWB 1MC4A 2HLHA 2I9PA 3FPSA 1ORDA 1IU9A 3KV1A 2G77B 1Q7EA 1YDGA 4Y1EA 4IDQA 4O4LB 2NU8B 4C0XA 4EF5A 2QN9A 2GPYA 1ORRA 2WBLC 1U3WA 4DPLA 4DQUA 2AR0A 3R0IA 1YR7A 3F6YA 3FMGA 2XYHA 2I2WA 4AQDA 5E3IA 3T3MB 3FTCA 1D2EA 3PUJA 4I1SA 1AK1A 4QXPA 2FKNA 3FFXA 3FRJA 3ETEA 4KV7A 3OETA 4ZICA 1Z2CA 1ZM3A 3V4FA 4BJ3A 5EWLA 2WIAA 2WSSA 1FBNA 3DYBA 4L28A 1ZICA 2PS3A 3A9UA 2EXXA 1IQPA 3MWGA 1I6MA 1SA0B 4D8YA 3K8YA 3FOAA 2C61A 4G8BA 4A6EA 2C20A 3I9OA 4YPOA 1U0FA 1VHWA 3BULA 2P0YA 2OBMA 5A3VA 2CJXA 1YWGO 4OY3A 4Z9BA 3OZCA 5GWXA 1Z5WA 5JMWA 3DOIA 4QGSA 4NCNA 3RUHA 4YP5A 2RHTA 1XJ0A 2DQZA 2PJDA 4TOIA 3JQDA 2CE7A 1C7FA 3RS2A 1QIJA 7REQA 5TJHA 4W5HA 1B3RA 1L1FA 4XLLA 1PWYE 1F2UB 4DNFA 5A6VA 3KYJB 3RFTA 1K7FB 4HLNA 3C16C 1J2RA 3EG9A 4OK3A 3KT8A 2W6JD 4OQYA 1W73A 4W9NA 1VL2A 2QMUA 3O8OB 4OUKX 1NQWA 2IDMA 5TT1A 3KJIA 4CUJA 1HFJA 1PLLA 2ZIFA 3SY8A 2CNOA 1LSJA 3VO8A 4BV3A 5BWLA 4YMHA 2J67A 1DOAA 3EVAA 1I10A 1X7YA 4NCBA 3GUVA 4OLAA 2JGKA 1SQFA 2B5OA