4HAZA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(r543s,k548e,k579q)-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
202
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 59
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hazA00
4EPWA 3IO3A 1G18A 1BYUA 2ZTSA 2ZETA 4M1OA 2BCGY 1BS1A 2AL7A 1UEIA 2HCJB 3ZDQA 2W2VA 1Z28A 4TQUS 1G6HA 1TQ2A 2VLIA 4QOSA 4PC2A 2GKSA 3L8YA 2VA8A 2A5FA 2ZSEA 1OB5A 1WRBA 1P61B 1XB2A 4KYIB 4PZYA 2GK7A 1JXMA 4ESHA 3OEHD 2JAQA 2VHUA 4HAUA 2ORWA 2QORA 1FQKA 2GCOB 4FMDF 4NYJR 3W8NA 1A5TA 3M1IA 1GL7A 2Q9CA 4YLGA 3J81k 4RZ3A 2N1BA 2GILA 4OK6A 4LBYA 4DIDA 2J0SA 3TQFA 3P26A 2Q3HA 4HAVA 4AKEA 2P2LA 1S3SA 2P67A 3HP1A 3GJ6A 1H8ED 1AZTA 2OESA 2ANCA 3FFBA 4FCVA 1AQUA 3GLGB 2QT0A 2EQBA 3B9QA 4GP6A 2ZSFA 2GWHA 1KHTA 3I62A 4GI7A 1KNQA 3BBPA 3GLFA 1R5NA 1SVLA 2GEDA 2YYZA 4JVLA 2EFGA 5FL3A 5SZHB 1EG7A 5F2EA 2XEXA 3TE6A 1YZQA 2ATVA 1N6RA 3DZDA 3GJ7A 1RRPA 4LBWA 1GIAA 5LB2A 2NPFA 4LY6A 4B3BA 4DLWA 4LYJA 1LS6A 3IO5A 4CYMA 2BEJA 5FUWA 4BGDA 1XPRA 4A92A 4Q9JA 3K0SA 4IW3B 1GRNA 1SKYE 1VCMA 1N5KA 5TB5A 3CRQA 4C0BA 3B13B 3AVWA 2CHVA 2CJWA 2ZU6A 3AKYA 3RRMA 5DHAA 2VPPA 4ZCLA 1AGRA 5L3QB 3FKSD 1Q1QA 4OQXA 1D6JA 2DWQA 2P0EA 4QGGA 3I73A 1JAIA 3QE0A 4US0R 5KDDA 2DBYA 3M0EA 4Q4HA 4Q9IA 2IEYA 4HLCA 5TY0A 3SNHA 3D8BA 4C0LA 3EIQA 4G5GA 4Q7LA 1KMQA 1BMFD 2G77B 4IDHA 2ZUDA 4WZAE 2HEIA 4F4JA 2R6AA 4X8OA 2B8TA 4GOKA 5GJCA 2GVZC 4MGYR 2PX0A 1N5JA 4FCTA 2FWRA 5J4YA 1LS1A 4RCZA 4POAA 4I1SA 1W2GA 4XSHA 1S9DA 5FTKA 3GQBA 3WBKA 2JLZA 3FFAA 3PV0A 5FOTA 5AWFC 3RNLA 3QF4A 1YR6A 2Y8EA 4Z8XA 3WHLA 2G0TA 2V1UA 3DMNA 2QP9X 5FTNA 2V8OA 3K70C 5CIWA 1K6MA 1NN3A 1RIFA 4B73A 2J7KA 5JZVA 4IVRA 2KBFA 4PTLA 1W46A 2PL3A 4A2PA 5K8LA 1TU3A 2ZRLA 4RD1A 3A1VA 3W6NA 1RKBA 4LRWA 3QKTA 2BV3A 1L4UA 2ORVA 4B32A 2DFTA 1JR6A 1KDTA 2PZFA 3ZZTA 1G6OA 1XF9A 3R9XA 2J46A 5AUNB 1KO8A 3KDSE 1BMFA 4GSYA 1E9RA 2N42A 4LV8B 2CJWB 1OXSC 2QAJA 4LHVA 1S0UA 5DI9A 3ZGXA 2DWPA 3KL4A 4MQBA 4Q19A 4BASA 4OHZA 1NLZA 2VSFA 3FMIA 4R7ZA 3E2IA 4Z8YA 4NCKA 4OKSA 4V0ME 5BYJA 3WNCA 1BKDR 5CYPA 4D2IA 3IUYA 1T3HA 2RB4A 5ANRB 1CJMA 1FP7A 1TNDA 2ZSBA 4PPNA 4LI0A 1GRRA 4I4LA 1JXOA 2IYTA 2WJVA 2ZI4A 2JLQA 1Z0FA 4KYUA 1NL3A 4QNMA 2OUKA 4WAUA 2QE7D 1Z0AA 1DELA 3TSWA 2BJVA 1GAJA 1T3SA 4DJTA 1TL7C 1G1MA 1E9DA 1W0KD 1NY6A 3AH8A 4Q1BA 2O8BA 1NBMD 3UMSA 4LHWA 3PFIA 5EQTA 2ODNA 2XAUA 2EVWX 2WTUA 1II9A 4HLQB 3QEOA 5CLQA 4CF7A 4RD3A 2EYUA 5JRJA 2B7BA 3JVUA 4MYTA 1E0JA 3KQHA 5CDFA 4C9BA 4M1WA 3T1QA 3AEZA 2C9YA 2F7SA 3ETLA 4RZUA 3VAAA 2HDNB 5CB8A 2WWYA 2FFAA 4JLNA 2Z6VA 3NBFA 1YU9A 5C2JB 4N1AA 3NHAA 3GLIA 1E0AA 4MYHA 5FBWB 4G5QA 4G3XA 1KK2A 1VYTA 3OEHA 5CITA 2C03A 1CR1A 2NO7A 4XVRA 2GBLA 4IXNA 4D0NA 2O8DB 3MWKA 4IEIA 1X1SA 4LJ4A 3DEFA 4OQLA 3T5DA 1DAEA 3Q3JB 1Z29A 1G3IA 2C04A 2D62A 2WAXA 1ZD1A 1SKQA 2Z5FA 1KZGB 1LVGA 4JSYA 4PPQA 3EPLA 1IONA 1HURA 2ZYTX 3Q5EA 3AUYA 2FNAA 2QTHA 4PHFA 2LKDA 1SZPA 2IHBA 2REOA 1E94E 1US8B 4HB4A 3AB3A 2G6BA 4JKYA 3NEJA 3GLGE 2IF2A 3NVAA 5AR1A 1AIPA 3TJZA 1D2NA 1DAGA 2XJ4A 3AKEA 4LPSA 1AKEA 2ZRNA 2QE7A 3Q5DA 2CHQA 1NLFA 1E1RD 2ZRKA 4JBWA 1E2HA 2IWRA 2O8BB 2QPOA 4MH0R 4Q4HB 5HKKA 2C2HA 1QBKC 1SXJE 1FP6A 3IILA 4F91B 1N0UA 1CJVC 1PVOA 3PEVA 4TSFD 2PX3A 3OIYA 4BPBA 5KO2A 1RJ9B 4II7A 2FV8A 5FPYA 2WJYA 3CWZA 1G3RA 1KI6B 4I1VA 1RW4A 3LW8A 1QG2A 5EE9A 5FOWA 4DUGD 2W2TA 4LC0A 1W2HA 4DSNA 3BH7A 5SZJA 3W90A 1E0SA 5DE3A 3E1SA 4M1TA 4W5WA 4DIEA 3THXB 1AGPA 3EC2A 4BFYA 1ZIPA 1OFTA 2CLDX 4FI3C 4HZUB 3LAWA 4EKDA 3KZ1E 6Q21A 1E2EA 2MMGA 4JLKA 3SYLA 1JJ7A 4ZV4A 4A2QA 5KHOC 1VG1A 3NDBB 4PZLA 5B64A 4L16A 1GUAA 5HCIA 1J90A 1GL9B 4Q66C 3W8RA 1P75A 3FMPB 5H70A 2WBLC 4C0JA 1L8QA 3V4FA 2ZVPX 1G5PA 4HSEA 1AKYA 4Q4JB 2GVDC 1DAIA 2D3WA 1R8QA 2GJ8A 3OE7D 5JECA 1T8UA 3WNDA 3WRXC 2VHQA 2BC9A 4I1OA 5EXTA 2EW1A 2ZE8A 3KB2A 3DZ8A 1TX4B 2GA8A 4GOXA 3RAPR 2ZRMA 1U2RA 1Z08A 3IIJA 1UPTA 4RKEA 4BE7B 4P32A 4HUQA 1W49A 2AWOA 2IXEA 2JA1A 4PR0A 4RZ2A 1QHXA 4DCTA 3TAHA 3CPHA 3K70B 1HA3A 1OV4A 3LVQE 3SHFA 2XZOA 4PAQA 1CJKC 5B58C 1FL9A 3B60A 3I8SA 2GZDA 5DSZA 2W00A 4LJAA 3BB3A 4DBLC 2NO1A 3NKVA 2ZRIA 3TW4A 2F43A 2OE2A 2Z4RA 4BEJA 4L4UA 4TTQA 2ZITA 2P6RA 4KFRA 1IQPA 3MG9A 2ZE7A 1G4AE 421PA 4HZIA 4XJXA 2QAGA 2O8EA 4NE2A 4URZR 4GPTA 2H57A 2QQ0A 4EPRA 3VTKA 3SI7A 2ODEA 1F3OA 1LV7A 2NOAA 5HCNA 2FGJA 1Q3TA 1Z47A 4ARZB 3BFXA 1T6NA 3EZ7A 3GJ0A 3PUWA 3W6PA 4G1UC 2H8KA 2WJGA 2G88A 2AXPA 3V4RA 1IY2A 2MMCA 2JDID 2REBA 1A7JA 1UKZA 3L0OA 5GJVC 4R71A 3P27A 1Q44A 4ZIRB 5EXPA 1Z3IX 4NTZA 1E2IA 5AJWA 1KDPA 1DBSA 1I4DD 3GFOA 4EFLA 4CGZA 2ODWA 4OBEA 1CKEA 2ZJZA 1SVIA 2BM1A 2CE2X 4JLBA 4FMDB 4A0HA 4CT5A 5EXSA 4G5RA 1FZQA 2AFIE 5JCPA 3OIVA 3N5CA 3CPJB 3OEED 1IXZA 2YOGA 1YZKA 5FPSA 4HUQB 4ITRC 3TLXA 4U02A 2VQSA 2HF8A 1T0JB 4NCIA 5FTLA 2A5JA 3IBGA 1KY3A 1RE0A 3TQCA 1Z6TA 2IX3A 2ZEJA 1FQJA 1G41A 2RGEA 1GDDA 4AURA 1HH4A 3VHLB 2I4IA 1G3QA 3AF0A 4TYYA 4NYMR 4PQFA 5A4JA 3K09C 3U7EB 3B8HA 3EIEA 3KFVA 4MA4A 4NONA 2J41A 3TIFA 2CEAA 4URUR 5FFMA 4PO9A 5G53C 5LD2C 4IVQA 2RGBA 3K0FA 1T8TA 4IHQA 3RRYA 3RS2A 3UWOA 3GLIE 1BYIA 3EIHA 2RAPA 1R2QA 2J0QA 3DVLA 4BFUA 1XMVA 1F5NA 1N0VC 4NCHA 4U5XA 1Q22A 1CU1A 1B0UA 1P9NA 2EWWA 4Q1AA 2GAAA 3FDIA 1L4YA 5J47A 3EZ6A 4KVAA 3OIUA 3IIKA 3WBJA 2JCSA 2XZLA 3OAAD 1B23P 2QPAA 1A2BA 1SXJB 2VF7A 4PPGA 4DCSA 2PMKA 4D26A 4AD8A 3CONA 2ZYVX 2PBRA 5JWRA 4M1YA 4FWTA 3SOPA 4YQFA 1JEDA 3KUCA 1G7TA 2Q9AA 4R9UC 1ZBDA 2Q9BA 4MKGA 3TW8B 1CRQA 4FWIB 5KSOA 3VX4A 4Y0VA 4GBMA 3SE0A 1VIAA 1ZUNB 4RD4A 3X2SA 5G3ZA 1UBFA 2Q3FA 4OHXA 2QSZA 3REGA 3SDZA 2GJKA 2HXYA 1CTQA 1W5SA 1WXQA 4QJ4A 1PLKA 4PZZA 3VR3A 4ERNA 5GADl 1Q57A 4QBIA 2CVFA 2ONKA 2UZIR 1Z06A 1EFRD 2BBOA 3GD7A 4EPXA 1C4OA 3T1VA 4LJ9A 3KTAA 1A1VA 2FPKA 4TT3D 4EPVA 2QGZA 1KOFA 3UMFA 5TXGA 2OO7A 1OH8A 3GJ8A 5H1YA 2AD5A 3PITA 2IS1A 3FMFA 2W0SA 4B48A 1DPFA 1P60A 4LDJA 1OYYA 2ZJAA 1R0ZA 3GJ5A 2JLRA 3TKLA 1JPNA 3V00A 4UKDA 1QVAA 3W9YA 4F38A 3KXLA 2BOVA 2JATA 4OK3A 1NKSA 3W5JA 2A7QA 4D81A 2QMEA 3EZ2A 2W0MA 1GKIA 2H18A 1NVVQ 4WXRA 1XCMA 2ECKA 4BQSA 3U3KA 3HU3A 3MUFA 2PZGA 2WKPA 3MWJA 3EPKA 5HTKA 3NH9A 1R4AA 2B92A 4P3YA 4YDSA 4QKQA 4LYHA 4B3CA 2EU8A 1FFHA 2F9MA 4IKEA 1D9ZA 2XTNA 2ZI6A 3QG1A 4LX0A 1OXXK 2VBCA 1J2JA 4GP7A 2V54A 2RMKA 3JZAA 1BIFA 4NMMA 1OJLA 1OE0A 2O52A 4O2RA 5J40A 4D6PA 4Q4AB 4WA7A 1IJEA 4LJ6A 3THYB 1PZNA 5UKDA 2F1IA 4HDQB 2ZANA 3O8CA 4IVPA 1CEEA 2JLXA 3F8TA 821PA 2FFQA 5CJ2A 5FBVB 2NO6A 2Q0HA 3MAAC 2ZRHA 3T06B 4DWJA 1E79A 1E4VA 3AKCA 4PHHA 4MKIA 3TR5A 1Y63A 2FH5B 3KXIA 1PJRA 2IF0A 1W0JD 1G19A 2ZE6A 1UAAA 1UKEA 1W0JA 3MSXA 4JJKA 2A78A 1F2TA 2GF0A 5F3WB 2DFNA 2IS4A 3ZZUA 1KAGA 1EWQA 1Q20A 2R6CA 2R6DA 1NNEA 4AKHA 3ZD6A 2OZEA 3K0AA 1S4QA 1TPZA 2Z43A 1J8MF 5JSZB 2X2EA 1W36B 1XJQA 1DAKA 1F60A 3QG5A 4G0NA 4TYQA 4W7SA 2IBMA 1G8FA 3BAFA 4HAWA 1RPZA 4Z54A 3G82C 2YWHA 4ASUD 1LY1A 1SXJC 4BWYA 4X8MA 4YONB 1W36D 1CBUA 2FF7A 4TMVA 2AN9A 3AV0B 4GMDA 1KK1A 3BS4A 2SHKA 3T34A 1NVVR 1G9XA 2GJAA 3SQXA 1GWNA 3K9HA 2EFCB 2A30A 3UPUA 5JS7A 3QVUA 3BGWA 1KK0A 3GJ4A 1QHYA 2ZJ5A 2H7VA 3U2QA 1WBBA 4QNRA 3SEAA 1YJ5A 1US8A 2J5XA 1SVMA 4JLAA 4B3FX 3BB4A 5KOYA 1Z0DA 2RGGA 3UMRA 2EFEB 4TLAA 2ZM5A 2ZI3A 3CR7A 3QQ5A 2VRWA 2WJIA 4RD0A 1ZVQA 2QSYA 4URWR 1RFLA 4E09A 5B57C 4KO8A 3A37A 4Q21A 1VIYA 1HE8B 1Q0UA 3GLHB 2QROA 5A0FA 3RANA 3T5GA 3AVVA 2CXXA 1I2DA 3KJGA 3EA5A 1X8KA 4P4UA 1Z0KA 4B35A 3UIEA 4XWAA 1R0XA 2YVUA 2UZ3A 2ZRPA 4RKFA 4CEJA 2V9PA 1AQYA 3BJIC 2C95A 3QPWA 1UKVY 1OH7A 3ZJYA 4BFZA 5E3HA 1RYHA 3CNLA 3R9IA 4C2TA 1M2OB 2ZJBA 1X1RA 2GEVA 2OBLA 2DHRA 3CRRA 3QKRB 5FR2A 5KDLA 2WOOA 4DSTA 3B1WA 1W36C 4AKGA 3THXA 1HYQA 4TYWA 3B9PA 1ZINA 1R7RA 4B47A 3EA0A 2IK8A 3VU9A 2XZPA 1JR3D 3L82B 1T91A 2AKYA 3LQQA 4NCJA 1YRAA 1P9RA 2RGCA 1GTVA 5KPDA 3RWOA 1UBEA 2IYRA 2AWNA 4GRAA 1DAHA 3OESA 3FE2A 2ZE5A 3QF7A 4Q47A 5FBQB 1BOFA 1ZYUA 1M8PA 1VCIA 2H92A 3T12A 2GXQA 1DAFA 1CS4C 3SJZA 3TNFA 2ZQ5A 1KYIA 1Z8FA 3QXXA 4G5SA 4RFSB 5FOUA 1W7AA 4JL6A 4Q7JB 2BMDA 1TMKA 2DFKB 3K0CC 3RS3A 4M0LA 3A8TA 4A6PA 2FX3A 3CRVA 3U4QA 2OFXA 3PEWA 1VG0B 3QKRA 4GMXA 1U94A 3OE7A 2HUPA 3W34A 3KQLA 1NVXQ 1W47A 4A0RA 5FI1B 3HJNA 2FGKA 2YWFA 1YZLA 1E2DA 1SQ5A 2A5GA 2C99A 3U7FB 1GOTA 1NIJA 1XEXA 4B6FA 4LJ7A 4D25A 4QM7A 1VCNA 1VYVA 3PJRA 1UDXA 4EJSC 1G20E 3H2YA 2CE7A 4M9QA 1CIPA 1K5GA 1TF7A 4HLUA 3RS5A 1NP6A 1W4BA 2WSSD 1COWA 1NVWQ 3MJHA 4JLMA 1F6BA 3DOFA 1XXHE 2ZRAA 5J4VA 3Q7QA 1T9HA 2AXNA 4TWZA 3LQRA 1A82A 2CLSA 1BH2A 1OHHA 1N2CE 5EJEA 5JMTA 1KI1A 2H5EA 4ZDWA 3PEUA 1Q1BA 1NY5A 4PFSA 4ZCMA 4QG7A 5BN5A 2AKAB 2PT5A 3AVQA 1QHSA 2OBMA 4JL8A 3N2IA 5DHFA 4NU0A 5EE5B 1CRPA 4E5UA 1M7HA 3KTAB 221PA 5DIFA 4DLVA 3ZQJA 4UNRA 4OHWA 1DTSA 3A1UA 1DS6A 1H8HA 4OI1A 1KI9A 1VG9B 1MR3F 3F0TA 3MWLA 4KJZA 1KSJA 4YXWD 2J1LA 4V0NA 4PC1A 3NDPA 1OF1A 1XTKA 1XD2A 4RCYA 1SHKA 3U5ZB 5L3QA 2WIBA 4C0KA 2BMJA 5GVRA 4R2HA 2X19A 1YZUA 1IN7A 4JL5A 2F3TA 4TLCA 4P31A 2ATXA 5KPJA 1YE8A 3PUZA 1D5CA 2ZYWX 1FMJA 2YWEA 3NH6A 2MSDB 4IXMA 1HT2E 1UKYA 4HB0A 4HI0E 4LJ8A 3TH5A 3VHXA 3GLGA 3THYA 3BB1A 2KB0A 2G3YA 4ESVA 2PJRA 2Q3MA 3RRZA 3IDQA 1N5LA 1AA9A 2HCBA 2KSQA 4ILEA 3RC8A 1N6IA 1S1MA 4EJSB 5FTMA 2GAOA 1EESA 1GKYA 3RRNA 2FFBA 3QOFA 4LSGA 4YMSA 4YMTA 1R5OA 2WOJA 3EZ9A 5ELXA 1VYUA 3LY5A 1NRJB 3LBHA 3VR5A 4Q4AA 2R9VA 4LHYA 5H68A 3U44B 2VSOA 3L0IB 1GG2A 1X8LA 3K9LA 1G7CA 5EP2A 4YMWA 1U0LA 1AM4D 2W58A 3AVOA 1H8EA 2B7CA 3F3YA 2LKCA 2F1RA 4KFTA 1OLOA 4DRZA 4HAYA 4JLPA 4MDFA 2H16A 4M2LA 2XGJA 4ZDKA 2EFDB 1TTTA 2JASA 4LJYA 1CLUA 1D2MA 1EX6A 3FPAA 5DN6D 2FDCA 3A36A 4FMBB 4PO1A 5FL7D 2OCPA 3E70C 1W0KA 5KNCA 2PCLA 4BFVA 1KIMA 4UJ5A 2CMKA 4NHOA 2V55B 1G5RA 1R8SA 5GJWC 4TQ9A 3ZVRA 1NF3A 2ZI5A 1XFAA 3A6PC 1OXVA 1T5LA 1JECA 1KO1A 1R0YA 3H1TA 3HR7A 2VP2A 3NEYA 5IHPA 4JLJA 4UNSA 4PSAA 1OHHD 3B1XA 2CL0X 1Z5ZA 4C2UA 4GT1A 1ZD9A 1KSGA 4LYFA 4Q48A 4IOLA 1N6HA 3THWA 3Q72A 1P7CA 2BWJA 2OAQ1 4WVFA 3I92A 2PCJA 4H1VA 1E9FA 2WMNB 5TARA 5FH9A 5AK0A 2XOKA 2WAYA 3LFUA 3QSYA 1W5TA 4V02A 1Z6YA 2RHDA 2WWIA 4QM6A 2VTKA 4RD6A 1OH5A 2VP9A 5FL7A 2BBTA 2JLSA 2QAGB 4WXPA 3LO5A 4L8GA 4PX9A 5E7MA 3IGFA 2V6JA 3R8FA 5A5GA 3QNUA 3ECCA 2HJGA 5FPHA 1ESNA 2FG5A 2CBZA 1MT0A 2WJHA 5JBQA 3IQXA 1EFHA 3O47A 2BCJQ 4RSGA 2X2FA 1FMLA 2KWIA 4MRPA 3GLFB 4A4DA 2IYVA 3EWSA 1G5TA 4H1UA 4PAOA 1LNZA 1E0KA 4FW9A 4M9SA 1SXJA 3DL0A 3LV8A 2FPLA 5IK2A 1VKJA 2PH1A 3B2EA 1ZAKA 4C7OA 4XD7D 5C4MA 1TEXA 1ZCBA 2YV5A 1N6LA 2CHGA 3L43A 1P2TA 1N3BA 3VNUA 2BHRA 4I99A 1KMHA 3OAAA 4HATA 1AS2A 3BH6A 4MYCA 1XTQA 3SFZA 1IY0A 2B6HA 2HYDA 4PC6A 2BBSA 3ZS8A 3AF3A 4PSVA 1X8JA 4IFEA 3K1JA 1TQ6A 4HYYA 4M22A 3CRW1 4LHXA 2QNRA 1TQDA 1XD8A 2IXGA 2B8WA 1ZNYA 3IQWA 1NSTA 1COWD 3N2EA 3R20A 5FPTA 3TSZA 4FMCF 4NP6A 2L0XA 2VF8A 2CCGA 1O3YA 2QZ4A 4L5BA 3TK1A 5SZKB 1DG3A 4HDOB 4K81B 1N25A 1E98A 3LDAA 3ADBA 3MLEA 3L8ZA 2FEMA 3TUJC 4EFNA 1HUQA 1M6NA 4NYMQ 5JEEA 4ON9A 4HLUC 3RSLA 1HQCA 2A5YB 1OFHA 3CF2A 3CKLA 3IEUA 2X1VA 1NKTA 3C8UA 3O8RA 2XOKD 4PO8A 4OI0A 5EP4A 3Q85A 2ZJOA 1X6VA 3CF0A 2CCJA 5EE1A 4DCVA 1GNPA 4RZXA 1PUIA 4R98A 3W5IA 5DO9A 1LTQA 2QRNA 2P6NA 1E9SA 1E2FA 1XWIA 2XITA 2WMOB 4A8JC 2IW3A 2NPIA 5KU1A 3WMEA 5JLJA 3D7MA 5JI3E 3TBKA 2ZI7A 1SVOA 3I1FA 4IOJA 3C14C 2E87A 2PJZA 2GXUA 2IT1A 2Q6TA 1S96A 2PLFA 1N5IA 2X77A 1E2NA 2VIIA 3X1YA 4TT3A 2WSSA 3EZFA 1HQYE 2ZJYA 3I4LA 1UM8A 4E07A 2DY1A 2QENA 1NMXA 2JLYA 1P2UA 2WWHA 4OJQA 3ZVNA 2GETA 3FGNA 4QXAA 1E79D 1QRAA 4HLDA 2XSZA 4LWZA 4MYUA 3UG7A 4B75A 4CEIA 4GZMA 4ZI3A 2FSGA 1WB9A 3WY9A 3QI2A 3FTQA 4B74A 4LK2A 1T5IA 3P4XA 4TTPA 3BORA 4IJMA 2ZSAA 3EASA 1KI4A 5DI3B 4MKHA 1J7KA 4C0AC 2O8DA 2IUTA 4M4SA 4X8HA 2D7DA 1OIWA 1C9KA 3X1WA 1KAOA 5EE0A 2F55A 3UXMA 1NBME 2EFHB 3AVPA 1KSFX 4Q01A 5EUMA 3C5CA 1MOZA 3QPVA 3QVVA 3K70D 4MRNA 2ERXA 1L7VC 2F3RA 3LW7A 4BLPA 4TL9A 5F98A 4XVUA 5JJIA 1TUEA 1XPUA 2WWXA 5GJBA 3LXRA 3VKWA 3S1AA 3ICQB 4Q4JA 1QF9A 3UANA 4EJSA 2IHYA 5IT5A 3AF1A 3QBTA 4PXAA 1SHZA 2VH5R 3DPUA 5BN4A 4A8JB 3A1SA 4JSTA 3GJXC 1KGDA 2I1VB 3NC0C 2GTPA 4Z1MA 1P62B 2GXAA 1OW3B 2CDNA 2BJWA 8OHMA 1F48A 1XEWX 1ZJ6A 2J0UB 4KXFB 3FHOA 2JLWA 3E5HA 3U3JA 4PHTA 5K8IA 1N6NA 2A5DA 1ZM7A 3AP3A 4HEJA 2V4ZA 1U8YA 1XD9A 1Z83A 5CLLA 1II8B 2W6IA 2Z4SA 4BLOA 4YMVA 2J9RA 1OXTA 2A2ZA 3WRYC 1JALA 2J7PA 3C41J 2BBWA 2DR3A 1RJ9A 2C96A 2VEDA 1ZMXA 1OKKD 4GZLA 4Q1DA 2JJ2A 4Q7MB 2V3CC 2V1XA 4L15A 1Z6GA 3L0SA 1TU4A 3CO5A 5HE8A 2ASEA 2RGDA 4DSUA 1UDWA 5CM9C 4TZ0A 3I5YA 1Z0JA 2R65A 1CJTC 2BMFA 3T15A 5BWMA 3RWMB 2WKRA 2XNDD 1KI6A 3T61A 4PAMA 4DLSA 5IK2D 3DKVA 1G16A 1DOAA 1E2PA 2RGNA 1KJZA 4JMPA 3KJIA 4NKRA 3AF4A 2OEPA 2WM9B 3WP1B 2ZRBA 2D4HA 3RDPA 1G4UR 3VNVA 2WWFA 2RGXA 2NZ8A 3EXAA 1VHLA 4H9GA 5E95A 5EZ5A 2XB2A 4DSOA 2VP0A 5EP3A 4OQNA 1Z0IA 3LRPA 1P4SA 2OLKA 3FWYA 5CIQA 1OIVA 4RFVA 3RHFA 1ODFA 4TSFA 2ZJ8A 4KFUA 5IDVA 4DEXA 4DT1B 4QJ3A 2FSFA 4D0LB 4TLDA 3VX3A 4V0KA 1E1RA 2CL7X 3CUEF 4EQ6A 3B5JA 1FNNA 1U8ZA 1E4YA 1XTRA 1JNYA 4QC2A 2C78A 4PPFA 3H4MA 1VTKA 1OH6A 2HJVA 2GZHA 4DCNA 4DLRA 4LOAA 1U98A 2X8AA 3GFPA 2D2EA 1G3UA 3CF6R 5FPKA 2ZR9A 1VECA 5TV2A 3PUVA 4MGZR 4XVQA 5JEDA 3C16C 3H84A 3U4QB 4PSKA 1XMJA 1N6KA 2YOFA 4M21A 5J4LA 1RZ3A 4C0QC 3LA6A 4CDGA 4K46A 4MRRA 3B1VA 5J5CA 5FBRB 3WXMA 3P4YA 3C5HA 2XTZA 5H8WA 1NMYA 1IY1A 4HDCA 3EWAA 4Q9LA 2W2XA 3KJHA 4IDPA 1G8GA 1NLYA 1V5WA 1LFDB 2XXAA 3K0CA 1KK3A 1PUJA 2FZLA 4AG6A 1IN8A 2FOLA 4C0SA 1ZCAA 2F1JA 3ONWA 3BERA 4XWKA 1KJWA 2FJUA 5DYGA 5AJZA 3BE4A 3EX7C 2WZQA 4GOJA 4HUTA 1E2LA 1ONBA 3DDCA 5LB4A 3VU9B 1Z22A 1KJYA 2QT1A 3TUZC 3NBXX 2OT3B 3W6OA 2IS6A 5AUPB 2WSMA 4MDEA 4AYXA 1DADA 4LUCA 2XNSA 1GNQA 2J0VA 4EIWA 3CX8A 3RS4A 2ZS8A 1PLLA 2RGAA 4MITA 2REXB 5FUXA 2QU8A 2MSEB 2P6UA 4CRWB 2VP4A 1Y3AA 3W3AA 4OK5A 3CR8A 1XEWY 1ZRHA 4AKIA 4AI6A 4MRVA 1NN1A 2XXAB 4D4MA 1GZSA 3TAUA 5TDHA 3JVVA 4EDHA 1UFQA 1XTJA 1FNMA 3CB4A 3AM1A 3VKGA 4M1KA 2I3BA 2CNWD 1QDEA 1N0WA 1ZC3A 3QF4B 4ZKEA 4B76A 4O3MA 4S35A 1DG1G 4KVGA 4QGFA 3HR8A 2DYKA 1LF5A 5LBIA 2PZEA 3PCRB 4LZZA 4TTRA 4X8LA 4ACBA 2IUSA 4DLXA 2D06A 2NQ2C 2G83A 1GM5A 4DVGA 5FOXA 4LV5B 4KV9A 4ZO4A 3UK6A 1ZM2A 2QMHA 4OHYA 3LH5A 1H8HD 4V0LA 2IEZA 3GLIB 1XEXB 1KI7A 1AZSC 2QTVB 3WMFA 1G291 1R0WA 1Q12A 1EWRA 4TLBA 1KKMA 4BRUA 4IOMA 4L9WA 2YWGA 4JT4A 1C1YA 5CYOA 4CEIB 1XX6A 5BXQC 2YOHA 3ND9A 1J70A 4FXPA 3TUIC 3QPUA 4JS0A 3HU2A 2VL7A 1AS3A 2P65A 5JWOA 3IPYA 4UNPA 3IKJA 3QEJA 2ZRDA 1D9XA 4Q4LA 1R6BX 2AK3A 2B21A 2OFWA 2KBEA 3KUDA 5SZIA 4BFXA 4DDVA 5KNDA 4PQYA 2FN4A 4C4PA 1OKKA 2ZSDA 1E3MA 1QHIA 4BLTA 4B6EA 4JKIA 3MFYA 1F2TB 1JI0A 3KQNA 2VHTA 2IC5A 1E6CA 1P72A 5FBLB 3FVQA 4ZDJA 2ZPTX 4JIMA 2E9SA 1MO3A 1SVKA 3BFVA 3B78A 3WYFA 1UEJA 2IYZA 4A6XA 3X1DA 1HV8A 2XJ9A 3ZYCA 1G3MA 2ZIAA 4W5HA 5CK4A 1YZNA 4NBSA 3DMDA 4JBYA 3KX2A 1E69A 2W83A 4Z1MD 5L3VA 3I61A 2O5VA 1OYWA 2GNOA 4O25A 1Z63A 1ESMA 1KNXA 3LBIA 3H86A 1W48A 3GJ3A 2GJ9A 4FIDA 3SBEA 4A15A 3K9GA 4MUAA 4B44A 2WKQA 1UF9A 4A8JA 3T35A 1EK0A 4FN5A 2ZRJA 3U6KA 1S9HA 5BQ5A 4LYAA 2R6FA 1II8A 3D31A 3CX7A 1EFUA 4F92B 5G3YA 1XJCA 3U61B 2J0UA 2Z0MA 2GESA 1NIPA 1TUIA 3RYTC 1LW7A 1QHHA 3QJYA 4DB4A 1ZW6A 3R9WA 2OCAA 1E9EA 1F2UB 1DARA 3QENA 4URVR 1WE2A 1N6OA 1E9CA 4F4IA 3KQUA 4KLZA 3DKPA 2BKUA 2CNWA 2DCUA 4Y0AA 1U99A 2GCOA 3PEYA 1IN6A 3SJBA 1WQ1R 2GXSA 3SZRA 4IDNA 2LWIA 5KSYA 4ZI2A 3VR4A 4NL4H 5C4GB 3NTUA 4EAQA 2OG2A 3CM0A 2PMDA 5DISB 4EUNA 4AIIA 3PQCA 1GL6A 1YR7A 4C3ZA 4LBVA 4ZKDA 4KITB 4K8OA 1SVWA 2P5SA 3AKDA 1CR4A 4WZBE 2BM0A 2FSHA 4QHSA 3CH5A 1Z2CA 2BMEA 2NO9A 521PA 4D4LA 4QBHA 1GILA 5L8VA 2AFHE 2VHCA 3EG5A 3X1ZA 3TR0A 3R8CA 2NZJA 3B85A 1Q21A 2VYFA 3CW2A 2QA5A 3KJEA 3RLFA 4CEHA 4NYIR 3FYHA 2ZXUA 1KI2A 1SKYB 2ZS9A 1OXUA 2RHMA 2P5TB 5E7IA 2Q21A 2IYUA 3ZZ0A 3CZPA 1XJ0A 3KKMA 3TVTA 3JZMA 5D3MB 2MSCB 1DO0A 2HV8A 3K0EA 2ZI9A 2UVQA 1NJFA 1T0HB 2QMUA 1ZD8A 2O8EB 1E2KA 1E9BA 4MUBA 1QHGA 1W1WA 2P3SA 4B43A 1GFIA 3OZXA 2JIZD 4B3DA 3CRMA 1RVDA 2FSIA 3P1JA 3Q9LA 4W9MC 1XZQA 2NO0A 3FKSA 3TRFA 2QY9A 4TMXA 1RRCA 3EAQA 3HWSA 2FMXA 3CWQA 2IWHA 3A58B 3DM9B 2OBNA 1ZUHA 1G8YA 4MGIR 1II0A 1KO4A 2QPTA 4LBZA 1KTVA 4W5JA 1JB1A 2DFLA 1TF2A 4OI2A 5JHGB 3OHMA 4JYBA 5HPYB 3CLVA 5G41A 3MGCA 4IOKA 1MABA 3QKSB 4NH0A 1ZM4A 3SBDA 3LWNA 1YKSA 4Q1EA 3CX6A 1CULC 3SHWA 1NSFA 4V03A 3ICEA 3Q8XB 1QHNA 2BVNA 4Q9KA 1PV4A 3K9NA 1EFCA 5HZHA 3OIWA 2J87A 2QP3A 4MKFA 4MRSA 1JJVA 3QXSA 2GCPA 2C98A 3A4NA 2JGNA 4UJ3A 3U3OA 5LDDC 2HT6A 2GCNA 1G7RA 3CNNA 5L3SA 3CNOA 2AK2A 4KU4A 1E99A 1O87A 2C9CA 4OL0A 4Q03A 2AD1A 4C7OB 4G01B 1WDTA 1WCV1 1EGAA 2E1RA 4JLDA 4B34A 2OXRA 2HLDD 1KZ7B 3QUSA 2NMVA 5JCZA 1CR0A 4PC3A 2YC2C 2KI5A 2O0JA 3SJCA 4KLNA 1XXHB 4N3NA 1P2SA 3N70A 3I8XA 5CM8B 2IYWA 2IYQA 4LV6A 5C18A 1ELOA 2XTMA 3MJRA 1E2MA 2ZR7A 1SVSA 2GRJA 2OXCA 1FUKA 3SYKA 2YINC 1W4RA 3QIAA 3VMFA 2RH5A 3KFXA 4D4JA 3PR1A 5AUOB 2A9KA 2DPXA 4US2R 4DLYA 3NIBA 2FE4A 1XU4A 4ZPXA 4FINA 1NVUQ 3C7KA 4DLUA 3RVBA 4BLQA 5JI2E 1NJGA 4AYWA 1IN4A 1SXJD 3BD9A 4M1MA 2WVJA 1X3SA 2JJ1D 4JLOA 3C15C 1IBRA 5DLQC 1MO5A 3AP2A 4Q1CA 4S2EA 3VR2A 4DUGA 2ZRGA 2OILA 4B71A 1E2GA 2IXFA 1MRSA 3MMPA 1I4TD 2GZAA 4IRUB 2UKDA 4C30A 4D4KA 4KODA 1U9IC 4XH9B 1OPXA 1YR9A 721PA 1E1QD 3LX8A 4V0MA 5HR5A 1D8TA 3B7GA 2WICA 1PLJA 3VQTA 2J59A 3K53A 2OV2A 2G1KA 4QBGB 1AJEA 4KI0A 1ETUA 2CL6X 3LNCA 1SULA 1G21E 4I81A 2VP5A 2GHIA 1AS0A 3GFTA 1CR2A 4TMKA 1HTWA 4D0GA 4JVMA 5JS8A 2J45A 5J4KA 1FW6A 3MWYW 2JJ1A 3PVSA 3M6AA 2ZJ2A 2IUUA 1A2KC 1KKLA 1G64A 1JAHA 1IJFA 3L2OB 4E22A 2ZS7A 1JQJC 1AK2A 1EX7A 4TYNA 4TYPA 2GJSA 4B2LA 2CVHA 1KO5A 3SN6A 1XPOA 1U81A 4KBFA 3U44A 3QBVA 1IXRC 2IYXA 3GMTA 2FPMA 4KCGA 1M1YE 1QHHB 2JJ2D 4TQAA 5KNBA 4BLSA 2GBLC 3UWKA 2D7CA 2WWGA 1TF5A 3LLMA 2WJJA 5JWHA 3WHKA 1T3LA 4TMWA 3PXGA 3L0PA 1EFTA 2QGNA 2QM8A 1XMSA 4P4TA 3SC3A 3G0HA 3DOEA 2ZRCA 5IF9A 1GKUB 4MGKR 2AX4A 4CW7A 1NG1A 3BC1A 2GK6A 1UADA 4QBFA 3NG1A 4KFSA 4PHGA 3BFKA 4D82A 4M8NE 1IOZA 2C5LA 1OIXA 5EE3A 3X1XA 4E03A 621PA 3FHCB 3R7WB 3EARA 3DHWC 4NZYA 1YRBA 1TEVA 2JEOA 4M9ZA 4NPHA 3SR0A 4HZUA 3T1TA 2ODBA 4I1UA 2TMKA 1U0HC 3TMKA 3BWDD 1XD2B 3K09A 3Q7PA 4BFWA 1VCOA 2BEKA 4UNNA 4ASUA 4P4SA 4GNKA 4U00A 4DB2A 5JJLA 3PIRA 2WHXA 1Q3HA 1TAGA 4JVNA 4WBSA 2NIPA 1U90A 2V6IA 3GEHA 3W3ZB 3KKQA 4EPYA 5HZKA 4N0DA 1VG8A 1JPJA 3AVTA 1ANKA 1N6PA 3OEEA 3WP0A 2QG6A 2VHJA 4QGHA 4WOPA 2QM7A 3OFNA 5D3QA 5EUQB 1E96A 4WZ6A 4CIDA 4BECA 3UG6A 3VR1A 4M53A 2QBYB 2N46A 1E2JA 1DAMA 1E9AA 1R5BA 1E2QA 2QI9C 3M4YA 1P2VA 1L2TA 1CF4A 2OCYC 4WW0A 1DO2A 4TN1A 4TMTA 1IXSB 2PEZA 1EFRA 1GNRA 2ZR0A 1ZUIA 3RS0A 3ZQ6A 4A0GA 1XBTA 3GLFE 1CP2A 2IA5A 2J3EA 4DLTA 1Z6XA 1P6XA 2WV9A 4IDQA 3IIMA 4D80A 2RKOA 5EP1A 5K8TA 4YDHB 1YQTA 3HYTA 1YZTA 4R2IA 5HKKD 1W4AA 2BIFA 3CH4B 1QZXA 4M1SA 2R2AA 4RD2A 4Z51A 3FKQA 1FTNA 1X86B 3NWJA 3QXJA 4TL7A 2F6RA 1RC8A 3QY0A 1M7GA 1T4GA 3BIFA 3SYNA 4DHEA 2YC4C 3KXKA 1U8AA 3ZLJA 1XDBA 3WNBA 1KI3A 3ADDA 3SU8A 2FFHA 5K8UA 4UXJA 1YVDA 4BFTA 3NBYC 1NBMA 4BFSA 1ZU4A 1P5ZB 5AJVB 2PT7A 1KDRA 3B82A 1XMIA 1F2UA 4RY2A 1VHTA 5BYKA 3CZQA 4B33A 5P21A 2AHOA 4TL6A 1M7BA 2IYLD 4FMCB 5J4HA 3U7GA 4RVCA 4QJ5A 5CDFE 4B3GA 1XZPA 5C46F 1E1QA 4OQMA 3RS7A 2H1LA 5M04A 4DEYA 3D6TB 2LCFA 5KYKA 1AN0A 1ZNXA 1JEEA 1KO7A 1MKYA 3HPQA 3HU1A 4HAXA 4Q00A 5TMPA 2ANBA 1Q1EA 1S2MA 1XCGB 3EC1A 1QG4A 4IFBA 2O8FA 4UNQA 1XP8A 4BZPA 4RJLA 4RFSA 4LGMA 1TQ4A 2EWVA 2OAP1 4JZKA 1ZM3A 2YHSA 4US1R 4FCWA 4KHZA 2BKEA 5FI0B 2QP4A 4XIGS 2ZU0C 1R10A 2ZVQX 3LVRE 2NGRA 1ZP6A 1FUUA 3H0KA 2YJTD 3B6EA 1WBDA 2QTFA 4Q02A 2ZYUX 2O8FB 4DKXA 5DN6A 4AWXA 4PANA 5FTJA 1ZNZA 5HE9A 3MD0A 1ZNWA 3LLUA 1G8HA 4BRWA 4KSCA 1VMAA 4OQFA 3V9PA 1LB1B 3ZIAA 3ZVLA 3U6BA 1KY2A 2YNMA 3P32A 4Q9HA 1NN0A 1IN5A 2HYIC 1XTIA 4ABYA 4V0OA 3UATA 4NCNA 2CLCX 2D2FA 1I2MA 4CEJB 4AY2A 2R6GA 3AUXA 4UXHA 2NG1A 4GFDA 4M9XA 4CZ2A 3AQ4A 1GVNB 1J99A 3AGQA 3KKPA 4BZQA 5KSZA 5F9HA 5FR1A 3RABA 2ZAMA 3TSOA 4Q7KA 1WA5A 2R44A 4YC7A 4DC9A 3GEIA 2IYYA 3QKUA 2FEOA 3ZS9A 1DVRA 3AP1A 4QL3A 4KAXA 1BO6A 3WYAA 3WYGA 3ZH9B 5DNYB 3SS8A 2QN6A 5DI3A 1ZU5A 3O8BA 4URYR 1ZC4A 4XTCS 1G8PA 3A1TA 4KBGA 3THOA 4EQ6B 5KTYA 1NG9A 3K8YA 3B1YA 4OHVA 2I1QA 4CVNA 2QBYA 2QQEA 1VPLA 2K5UA 1OB2A 1MO4A 4N0EA 1JQLB 1KI8A 1KSHA 1YHNA 2FA9A 4ZDIA 2JIZA 1OSNA 4B2IA 2GEUA 5F9FA 4BEBA 1TADA 1J8YF 2W6ID 1ZM9A 4NYIQ 4EFMA 1K8RA 4LPKA 3GEEA 5FUVA 3ZVMA 3KQKA 4GL2A 1MH1A 4JBXA 2IL1A 2OHFA 4LCBA 2VSXA 4YXWA 3IEVA 2R8RA 2Z83A 5FOVA 3VFDA 2QUZA 5JSZA 1Z2AA 121PA 3ASZA 3K0AB 3FB4A 3PUYA 2DWOA 1LF0A 2R62A 4B3XA 4AYTA 3ZIAD 2ZRFA 1GSIA 5JHHB 2C9OA 3C4JA 2ZUBA 2D74A 5DGXA 5TVKA 4A82A 5DYIA 1V43A 4P4SB 2PLRA 4ZCIA 1WMSA 4O2LA 2A3RA 3NXSA 4UXIA 1Z6AA 2CCKA 2WPDD 3NC1C 3ADKA 4IEEA 5KUTA 1U9IA 2ORIA 3I3SR 1EXMA 1JR3E 2KJQA 2V7QD 3LXXA 1XNJA 4U7DA 4FD2A 2ZROA 4XSGA 1XXHA 3O8DA 2JJ8A 3U60B 4NDZA 3R7WA 1P73A 4YMUA 1MRNA 3DO6A 1DE0A 3KB1A 5B30A 3IHWA 3AGPA 2QRZA 1YZGA 4G5OA 4QHYA 2FZ4A 1RRFA 3LD9A 5E4FA 2XX3A 4XOIA 4JLVA 4LC1A 1WP9A 5CJPA 5JFGA 4QRHA 3MCAA 5L3RA 3GLHA 1Q1ZA 4DXAA 1QVRA 1H65A 1M34E 2OFOA 4QGAA 5KDOA 5FUYA 1XCPA 2JDIA 3OF5A 3HPRA 1KMHB 4LJ5A 1JBKA 4HB2A 5DH9A 4DCUA 1FTSA 4BUJA 2YZ2A 2GDJA 3AVUA 2ZAOA 3QKSA 3AVYA 4F4CA 1IAQA 1G17A 3GLHE 4DT1A 1YR8A 2RCNA 4JYCA 4GDFA 3TGPA 5EXXA 2V7QA 2GF9A 3DM5A 1FX0B 3PUXA 5FOSA 1CXZA 3CBQA 4KSBA 4DDTA 4DDWA 4PC7A 2O0KA 1HY3A 5CK5A 1MO6A 1UJ2A 3EPJA 3B1ZA 4TLEA 4DLZA 3RC3A 2W6JD 2HT1A 1W4CA 2OSBA 5C1BA 1GRQA 3ASYA 3NBZC 4B2PA 3KKOA 3GCGA 1ZIOA 4PQRA 2QMOA 4C0HA 3ZD7A 1UBCA 2ERYA 2WPDA 2IS2A 3PG5A 1NN5A 3EW9A 2HLDA 4HAZA 4OI4A 3GP8A 3BH0A 2G0NA 4L9SA 4BLRA 3U3RA 4O0MA 2WWWA 1G7SA 4JJZA 2ZREA 3T1OA 3IHLA 4TL8A 5G40A 2DB3A 2WIAA 4F7WA 3D3QA 1S8FA 1I4LD 2AR7A 3TVDA 1FX0A 4QFMA 2O8CB 2QAGC 2C77A 1HT1E 2CK3D 3K0FB 1HE1C 1NI3A 3A4MA 1VDZA 5L3SB 1XTSA 1RYFA 4A1FA 4AC9A 4XWOA 4P0TA 3VR6A 4WIAA 4XD7A 1Z07A 3S1AB 1E32A 3GPLA 5AUQA 2EYQA 2QEQA 4QHTA 2VP6A 2OCBA 4DDUA 1MV5A 3ADCA 5CB6A 3I72A 3AVXA 1DEKA 2PEYA 4LHZA 3A1WA 5AJYA 3LX5A 2G9NA 2RGNC 4BZXA 1S3GA 5JRZA 3HYRA 2F9LA 1CJUC 2VO1A 3MRSA 3QXHA 1JR3A 2HF9A 4UQOA 5B2ZA 4AG5A 3CIOA 2ONJA 5LD2B 5KSPA 1FOEB 4P33A 4OYHA 5IRCD 3OFND 1FPMA 3PENA 3U7HB 3BRWD 4A2WA 5AJXA 4EPTA 2XSZD 2JLVA 2BDTA 2XNDA 3HDTA 3WMGA 1MABB 3BXZA 3CPEA 1IM2A 4Q1FA 1GITA 3AF2A 3NHBA 3UKDA 4OJKA 4Q5IA 3FOZA 1UBGA 2FU5C 3I32A 4TZ6A 4DZZA 1OFUX 3EPHA 3FHTA 1OFIA 4IDOA 3I5XA 5GVSA 2O8CA 2C8VA 1HEIA 1W44A 4Q18A 3U3MA 1P9WA 2W6JA 4NYJQ 4A0FA 1A4RA 3P20A 4ARZA 3VKHA 2YKGA 5E7JA 1XRJA 2KE5A 3SFVA 1WF3A 1GP2A 3FMOB 4TMZA 4ZIRA 3A4LA 3BOSA 3IBYA 2CK3A 4JVSB 1K5DA 3SJAA 4ACAA 2F1HA 4JT2A 4A9AA 4AK9A 5LPNA 2G1JA 4CEHB 5EZ6B 3THWB 1OT3A 1SGWA 1XEFA 5BN3A 5JJKA 3QXCA 5D3MA 3RSOA 4J0QA 2JLUA 2ZUCA 2HXSA 2H17A 2O0HA 4CT4B 2OM2A 3KKNA 2J7PD 3G5UA 1U0JA 1IHUA 1S1CA 3BK7A 1D2EA 4URXR 2QL6A 3ND8A 4HB3A 1P3JA 4A36A 1RRGA 2OLJA 2IYSA 4XTRA 2NTYC 1M74A 4F93B 2XB4A 1KDOA 3SQWA 3LBNA 1NMZA 3F5FA 3IPXA 3REFA 2F43B 5BW8A
chains in the Genus database with same CATH superfamily
5A4AA 2G6TA 3BXFA 3PIIA 1FQOA 3UB3A 5AFSA 1XMOB 4BRZA 2BCGY 1I3OA 1PR2A 3N74A 4FGLA 2IX9A 4QVIA 1DXYA 4PM4A 4ARSA 1YS7A 2POCA 2DJ5A 1G6HA 1HDEA 1AUXA 3AEUA 4PC2A 3OMXA 5GGYA 1J07A 2VA8A 1Y4AE 3I0NA 4WDQA 1WRBA 2EL9A 1P61B 5K0EA 2WV7A 2BI7A 1WDMA 3WKDA 3KQMA 2VNJA 4I0WB 3AHJA 1UMBA 2GK7A 1QSGA 2MR5A 4H3KB 3JQAB 5CCBA 4FFBA 3TINA 1H94A 3UMBA 3UAWA 1FQKA 2GCOB 3BHMA 3D9QX 2HK8A 4C4OA 4CJXA 5KYWA 1O97C 1I3LA 2QVZX 4WV3A 5F7ZA 4ZTBA 3P26A 4RF3A 3PXDA 4ETWA 5JXJA 2Y1CA 4HAVA 4GZ3A 4B3IA 4OX9B 1R4NB 2H00A 3PA6A 3GJ6A 2CN1A 2P9BA 1EMDA 4KOEC 3HBFA 2OESA 3U5TA 2D0PB 2Y6UA 1HRDA 4JQOA 1V4BA 4Z49A 5I3CA 3B9QA 2ZSFA 4FI3F 4K87A 4Q12A 3TZHA 1N9ZA 3AU9A 1KC3A 3GAZA 5C34B 2J48A 1V5EA 2VNIA 2XY4A 4OFZA 2ZSJA 4QTYA 2YYZA 2XNJA 3WGMA 4B09A 2EFGA 5FL3A 5IULC 5TC4A 4LE1A 3WTBA 4YMLA 1GUZA 1MEJA 2J3DA 3BMCA 1YZQA 4HQ0A 2XE7A 3GJ7A 3I9V6 1IHOA 4LBWA 4G8JA 1C7EA 3IT0A 3DLCA 5EJ8A 5B7GA 5TQJA 1FBTA 3IO5A 1M3SA 3OC6A 4XJVA 1ZL0A 5IMSA 1SKYE 1BROA 1N5KA 1VCMA 3EDRA 3CRQA 3MILA 2J0EA 2HJHA 3RVPA 3UOGA 4PF1A 1QVZA 2EZTA 1Y0BA 4Y9SA 5DHAA 2VPPA 3LWDA 2FPGB 3K8OE 5E6SA 2DWQA 5DRTA 3NW9A 3ORFA 3QE0A 4US0R 5LZ8A 3GRUA 2DBYA 3KJQA 4Q4HA 5IVPA 4RESA 3I09A 4GU5A 2BGUA 4CG3A 4CKWA 4CE6A 3D8BA 3EIQA 4Q7LA 2NU8A 2QN1A 3QVSA 2APJA 3HG7A 3S27A 1TEZA 5A9SB 2FCAA 2R6AA 4X8OA 3CVUA 1GUFA 5ETJA 1J56A 2PKRA 2QLNA 4RAQA 4EY8A 3HXMA 2GVZC 2ZULA 2QVCA 3H9UA 4BVHA 3MYYA 1W2WB 4B40A 3IKLA 1NYLA 2EQAA 3F7TA 4BNYA 1N5JA 1TFUA 4NPCA 2FWRA 1RJGA 3C85A 5J4YA 2Q5HA 2FRDA 4DLLA 8ADHA 2XUOA 1QNFA 2VJDA 3KKEA 4RA6A 4I1SA 2ZSHA 3FVVA 2NU9B 2BGWA 2CFRA 3OP4A 1S9DA 1RWVA 4O33A 4RJ2A 3GQBA 1UOPA 2BJHA 1O97D 2QTVA 4N7JA 5ISMA 1O0BA 2XUIA 2L69A 1JIVA 1OCEA 2X0RA 1RWBA 1WLYA 3B89A 3QF4A 4BU1A 2FW8A 2X3FA 3VC7A 3HGMA 1GXSB 1VMEA 4YRCA 4Z8XA 3RASA 2G08A 1Z5PA 3H9CA 2V1UA 4AMZA 1XTTA 2QP9X 4U2KA 5CIWA 5FTWA 2RI0A 3AFHA 3PC8A 2OQVA 4HXEB 4ODIA 4B73A 3II6X 1TYDE 5ARDA 3H9GA 3E9NA 4PTLA 1PJSA 3KKLA 3P71T 4HEA6 3V1TC 3ZCVA 3L5OA 2OCIA 4PZCA 4UBOA 5SY6A 4I1PA 3W6NA 4YT2A 4UTPA 4CMAA 2DERA 2E48A 1L4UA 3H65A 2DFTA 2PQ6A 4ZEWA 2OWDA 2PZFA 2RC6A 5CNMA 3T4UA 1XF9A 4IUYA 5H3CA 3KCQA 1IHYA 2Y71A 5LQJA 1XU9A 5AK5A 4GSYA 4MWZA 2VYVA 1NDUA 2O2EA 4DOMA 1EVLA 3CQ9A 1ZCZA 5JVDA 4KGVA 1ZMTA 5HYVA 3VZPA 4LHVA 1NRIA 4EA8A 4KRFA 1CUZA 5DI9A 1D03A 2EKBA 2OQRA 2ZBGA 2WD7A 1NUUA 3ICWA 2NUPB 3LBYA 4EF4A 1WTCA 1CLEA 1NLZA 3NTQA 4R7ZA 3E2IA 3KLBA 5E3IA 3EEIA 4OLAA 3HKCA 1YZFA 2GN8A 2P2SA 3VNSA 2V0CA 5ANRB 3TZCA 3OPYI 4U0JA 4PPNA 1MFPA 4LI0A 4NQRA 4QTTB 2PLNA 2QI9F 4H60A 3ASVA 3GN1A 3R24A 5BSGA 4G1BA 3RTDA 2OUKA 2CV2A 4V3BA 4D8TA 4C87A 2PUFA 2BJVA 5F64A 2IP4A 3KQVA 4DJTA 2M98A 2NADA 4XLTA 4YP5A 5FF9A 1G1MA 2I7DA 1E1DA 4IDCA 3UMGA 1NBMD 3UMSA 5JZMA 3A9SA 5KB3A 1CK4A 4XW2A 1YOBA 2H8GA 3BSYA 3OQHA 2XAUA 3P0HA 3E3LA 1VI6A 3PXUA 3EGEA 4HOYA 2WTUA 4RD3A 2YV2A 5JRJA 4MYTA 4DYVA 5ARBA 1L3CA 3OMLA 1KDYA 4XR4A 1OXBB 2PGXA 1YCHA 2F7SA 4RZUA 2HSWA 3VAAA 3VO2A 2WWYA 1A8SA 3JQBC 4I4CA 5KYWB 1LPOA 2FZGA 3NUZA 4JLNA 4LVUA 4OA8A 1YU9A 4P4NA 4Y9UA 5AKKA 4JFAA 1W75A 3RAJA 4ND5A 2YXEA 4Y1RB 1E2UA 2ZB7A 3DBOB 3QUCA 3DDUA 3N75A 1E0AA 1WP4A 1NVAA 2UYQA 4MYHA 1JEYB 3OBIA 1J5PA 5CVJA 4KGXA 1RHUA 3LOPA 1CR1A 1I9GA 3EGDB 4XVRA 2R5FA 4KWEA 1PR5A 2HA2A 4HGZA 4KDFA 3G1UA 3IDAA 4LJ4A 3T5DA 5ABPA 5C7OO 5CVTA 5F76A 3ETNA 3OWOA 3GEGA 3OE5A 2HH9A 4F60A 2C04A 3C6YA 1YJBA 1ZD1A 3B2QA 5E6RA 1RZRD 1XUOA 1IONA 2ZDHA 3LUAA 1XV5A 2YWCA 1DHRA 3Q5EA 2FNAA 3EUFA 4TV9F 2LKDA 7AT1A 2IHBA 1ETHA 1L4HA 2I8CA 3CJTA 2G6BA 3BIOA 3L0CA 4JKYA 3NEJA 2OKGA 3ONVA 3D6MA 1NVGA 1NULA 2CDRA 3NVAA 4OB6A 4OFBA 4FEEA 3TJZA 4H17A 1PWXA 3ZEAA 4QPJC 3HL4A 5JC1A 2XJ4A 4OGGA 2PTHA 1AKEA 3CSUA 5DGIA 2M1ZA 2VZEA 3GHHA 5A1JA 1E1RD 2XDQA 3F46A 2IWRA 2DBVO 3ZR4B 3HKEB 2QPOA 5HKKA 2C2HA 3CMMA 3N39C 1JHOA 1AT1A 5EYPB 2LW7A 1PVOA 3HVKA 3PEVA 2HJ9A 4BQIA 2P3LA 1W6UA 2BFDA 2C20A 1UXGA 1CUVA 2FEXA 4IIJF 4BQPA 4MIEA 5FWYB 1W19A 3DFZA 3KB8A 1YB7A 2PX8A 2VZLA 4L2IB 2PYIA 2VJOA 2AMYA 1MNAA 1STOA 1VHDA 4AJLA 3UJ3X 3MRXA 5EE9A 1XDGA 3V2HA 1S7GA 1RBZA 3CE6A 1I5OA 4DSNA 2J9XB 4H27A 2OZLA 4ZICA 3BH7A 1UMDB 1QYRA 1UBJS 4JEMA 4W9NC 1ID1A 5DE3A 3PDIA 5BSWA 4DPKA 3D7NA 1DT3A 5IUNC 5EJMA 5LP6C 4KN6A 4ZANA 1KZHA 2FN7A 3THXB 1IOLA 3M6FA 1DWOA 2VHWA 1N0HA 4EKDA 4JB8A 1P19A 3C6XA 3TLCA 4JLKA 3L02A 3R3SA 1K3FA 4GE0A 1EXDA 1C7QA 3DVQX 1KY5A 3QFRA 4FFOA 3AY6A 4A2QA 1ULZA 5KHOC 1AQ6A 1ZXBA 1DJQA 4RXUA 4P08A 3RIMA 4OREX 1HL3A 1B14A 2IYFA 3MGAA 5FLYA 4CI9A 1GL9B 3K1AB 3VNQA 3EXIB 3ZIDA 4DRXA 4YUXA 1P75A 2YHAA 1JG3A 3BRWA 4Y3UA 2UVDA 1XK6A 1MJGM 2JGDB 1TW3A 4FFLA 1W9HA 3VBCA 1AKYA 4Q4JB 1EFVB 1AB5A 2B35A 4XAQA 3INRA 5KMGB 4KQFA 4YB8A 5AKEA 1HMPA 1XVLA 2E6KA 3RAFC 2ZE8A 3OTQA 4BDTA 2HDHA 4IHAA 4J16C 2ZRMA 1FFXB 1R18A 1Z08A 3IIJA 3O8OA 4N82A 3GJYA 3QKWA 4PWZA 4BE7B 1W5AA 4C4TA 4UCWA 4HUQA 1W49A 1YVUA 3FTEA 3PU6A 3K70B 1HA3A 1I8TA 2XLBA 1CWUA 4PAQA 3NBQA 3IS3A 1SD5A 5EG5A 4W8GA 5B58C 3WMRA 3B60A 3GRCA 4DRYA 2ZOSA 5DSZA 1QIDA 2W00A 2HBRA 3AYXB 2ZSUA 3BB3A 3I76A 1OX4A 2ZRIA 2Z4RA 3LWBA 1EM6A 3KTDA 1AO0A 5BMOA 1MAHA 1WSBA 8AT1A 3TFQA 4AY6A 3K35A 4MWOA 3MG9A 2XE4A 4RK0A 3RF7A 3I2KA 5T8KA 1QO9A 3BDVA 2E4VA 3A1FA 2O8EA 5A5EA 2FRXA 3I05A 2C7QA 1BGVA 3GL9A 4CKEA 1FY2A 2ODEA 3SI7A 4YFVA 3G2HA 3D3EA 1SOMA 2NOAA 2ZZKA 3DKRA 4BGVA 1C8LA 1Z47A 2W8BA 4IDGA 3BFXA 4RIFA 3GJ0A 3EZ7A 4OLJA 3ZBPA 2HA7A 2IDKA 2SKEA 3AZPA 1NXPA 1BHO1 3PC8C 3W6PA 3IH5A 3R0QA 4BQRA 4EA6A 5C35A 1ZN2A 2KMLA 3VAYA 1VHQA 3ZDFA 1RHRA 5FNVF 4BEVA 4O08A 3H5OA 1L7DA 4I4TB 4R1UA 5GJVC 2WNIA 1Q15A 1Z3IX 4CM5A 1TYEB 1I4DD 2W98A 3D6AA 1Y6ZA 3MFQA 1QDLB 2F8TA 4QXRA 4XX1A 5KNDH 3ZHCA 5G4KB 2ZJZA 3QPBA 4BMNA 1QIKA 4C4SA 5LQKA 3E9MA 2XKJE 1WMAA 1SA0B 4U2BA 4HQFA 2WVGA 3EVEA 5BNWA 4RH1A 2AFIE 2ZBRA 2ZYGA 3OEED 2WM3A 3GBPA 4REMA 2YOGA 4ME6A 1IUNA 1GT6A 1YZKA 3Q2KA 1I6LA 3SGLA 2Y3IA 1WDWB 4ITRC 2W2KA 3CUKA 3OQ1A 2HF8A 3VKUA 4YP1A 1XHEA 3B3GA 1RAEA 1Z4LA 3NGLA 5P8WA 2VQ6A 1G41A 2P7IA 4GZ5A 4HDMB 2GCIA 1K75A 1F8XA 5H0IA 2QRMA 4Z4CA 2I4IA 3OU7A 8GPBA 3AF0A 4NYMR 1E3IA 1GQSA 3G9QA 2GAJA 3QW4B 4PQFA 3UCFA 3U1BA 2BEVB 3VPCA 4EUFA 3UCXA 4M7OA 1PEKE 5DTIA 3X2EA 4GOOD 1DSSG 3B8HA 2CZGA 3EIEA 2HO4A 2J41A 3NHLA 2CEAA 1R6VA 4Y2SA 5FFMA 2VBFA 3DTVA 5LD2C 3EEYA 5EHQA 4IVQA 2VBIA 4KQXA 2I2FA 3G79A 3BICA 3TL6A 3L06A 1HFJA 3L4BC 1K88A 3REQA 1R2QA 3RFVA 2J0QA 3M6IA 1QE3A 3OOEA 3N0VA 4NOLA 2FLVA 4EYOA 5CA0F 2G9ZA 3AW8A 3UWKA 3CPSA 4U5XA 4M36A 4QOGA 4V2UA 4JR2A 2EWWA 1ZESA 1P9NA 3KZMA 2XUKA 4MEBA 2GAAA 3FDIA 1L4YA 4Q1AA 4G56A 3KYJB 5BRAA 2RBKA 5D85A 2Q3JA 4ZEMA 3ZKWA 5G0WA 2NVUA 4FLEA 5MHTA 3V3KA 1VFPA 2QPAA 2XE8A 3LPCA 2DH5A 3O1JC 4QPPA 2XT9A 4CN8A 3QPDA 2PMKA 3NS7A 2TECE 4MARA 4CM6A 2ZYVX 2PBRA 4DMFA 5B6PA 5CA0A 3DE3X 4UE6A 4TS1A 5GP1A 4QLOA 3C5WP 3H4IA 4R9UC 4QEKA 3WL4A 2EJUA 5T64A 4C89A 3DVSX 3C0KA 4ROSA 1W5EA 2UUPA 3E23A 1CY0A 4GBMA 4LGYA 4ISCA 4C5BA 1EYZA 4DM7A 4RD4A 1YDFA 2NZXA 4OA5A 4IIGA 2QHXA 4RPCA 5G3ZA 5A3QA 3V48A 2I5PO 1JF8A 2GEBA 2PSJA 1QGAA 4CNBA 2HXYA 3BJEA 1V39A 1WXQA 2UAGA 1HDZA 3OCZA 5GADl 1Q57A 1Y6JA 4M0EA 3D6VA 2UZIR 1M6WA 1BWPA 1EFRD 1TEHA 1GPYA 1LNQA 4LWPA 4O4JA 4V0SA 2HMAA 1WXDA 2UZ4A 4EAAA 5FOQA 1UQTA 1A1VA 2D0OB 5JNUA 2FPKA 1WPXA 4TT3D 1PNOA 2JZNA 2POQX 3WLIA 4J7CA 4UUQA 1XE3A 1U02A 1OH8A 4JC4A 1GVHA 5A5DA 4JJ4A 2IS1A 3FMFA 5EJIA 4YT5A 3ROTA 1JLMA 3TOVA 4B48A 5GINE 1V8FA 4DDMA 4HNAA 1YIDA 1JR2A 3EZGA 4LDJA 3WQRA 2EG5A 4DY6A 5HHTA 3ZDAA 5K0ZA 1U7UA 4X97A 3MELA 3ZQUA 1YKFA 2PBZA 2JATA 4G2NA 4OK3A 1HDXA 3AUKA 3E3NA 2EARA 1NKSA 1P0PA 2JFGA 3H1AA 3HN7A 4WLUA 4YASA 4D1YA 5JT1A 2W0MA 3D81A 1GPWB 2H18A 2HDOA 3IBTA 3GZNB 3OD5A 4WXRA 2ILVA 2ECKA 3GRRA 4ZGGA 3U3KA 5CB4B 1WWKA 3PGMA 2SECE 2GN0A 3GGPA 1KKUA 4K9DA 4A6DA 4CIVA 4ZREA 1QIGA 3EPKA 4BRSA 4R2MA 3ZTWA 3R1IA 1B3RA 1H3NA 1MRZA 3LPMA 5KYTA 3NRBA 2BGLA 1NVMB 4FXOA 3PX7A 1GCOA 3Q7EA 2BEUB 2PKCA 5JDIA 2ZSIA 3HY4A 1H5UA 4OM8A 2AIRA 1QC5B 2O1XA 1HFEL 1FFSA 1O6CA 1EUQA 5KQPA 1IUKA 1UBHS 2ZI6A 3QG1A 1HL7A 1H5QA 4MHSA 4I8DA 4YQYA 4C43A 3F6SA 3JQ6A 4F11A 5K6TA 1IWPB 2RMKA 1D4AA 3JZAA 4Y67A 2YHUA 1D2CA 4MRMA 5JJBA 1I7QB 2O52A 3LZDA 2Y0CA 3BGSA 4Q4AB 3A9UA 4L50A 4FR0A 1X1EA 4XGIA 5UKDA 1TO1E 2VSQA 3FYSA 4HDQB 4KXWA 3U40A 1QVWA 4IVPA 5KREA 2JLXA 4E11A 821PA 1K4YA 2JBAB 4QYTA 2FXVA 4BBAA 3DTYA 3OICA 1B8UA 4PHHA 1Z38A 1QDUA 1JVNA 4MKIA 1Y3DE 1SQ0A 3PGJA 4RK7A 1RAHA 2QW8A 3KXIA 2VQFB 1UOQA 4DR1B 1N4AA 3PNOA 2AOWA 2HWXA 5KJFA 4G5FA 3MTGA 3AIKA 2WFMA 2HU8A 3EDYA 4RV9A 2NM0A 3K1ZA 5G0VA 4KQ2A 3MSXA 1QGYA 4RWZA 3UHOA 4DDKA 1WQ4A 2VYNA 3PL1A 5IAKA 3ZZUA 1ZD3A 3T99A 1Q20A 3TTSA 2R6DA 1HPLA 2JI8A 4RKQA 3ZD6A 3IQGX 2I6FA 1TVCA 4M0MA 4ZARA 4H1HA 1YI0A 1S4QA 2KPOA 2AYZA 1RRKA 2O2IA 3R6TA 4HRXA 4ZOEA 2C61A 2H06A 1TO2E 2YJ5A 3ELYA 4BQNA 1W36B 2WJ6A 1F60A 4G0NA 2YCLA 3PI7A 4TYQA 4WFIA 1G8FA 4HAWA 4O4LB 1Z88A 3AETB 4ASUD 1LY1A 1SXJC 1NU8A 5KOJB 3KZOA 1W36D 4BNVA 4IUDS 1D1SA 4IQ8A 4XX0B 4DA9A 3NHPA 4XGQA 2PVSA 4ZK2A 2XGGA 4CLHA 1YB4A 3R0VA 1I24A 1GTG1 1QX3A 2GJAA 2N3ZA 3L6RA 3V2IA 3FNIA 3DBRA 2ZP1A 2EFCB 3SQXA 3DLTA 2QJOA 3HRIA 2X15A 3ZJ4A 5JS7A 4JUFA 2IJGX 7REQB 1KK0A 5LMCA 2ZJ5A 2TS1A 4HX2A 4R8KA 1YJ5A 1US8A 3RT9A 1UANA 2J5XA 5ELMA 3ZW8A 1YV9A 4B3FX 1Y3BE 3MCWA 4FYPA 2RGGA 4Y6GB 3CR7A 3QQ5A 5F35A 4BXOA 2AUNA 1SIBE 1X15A 1RYMA 3IAM6 3ZCRA 1RI3A 4RD0A 2X0DA 4LA4A 3H8SA 3CKMA 4OU5A 1NI4A 3GLHB 2DQYA 2HGSA 2P27A 3LT0A 3RANA 1Z4QA 1UBUS 4PYIA 4IIVA 1I2DA 2HU7A 4YIHA 4L8VA 2VT6A 4B35A 1Z0KA 3A10A 4MR7A 2DWUA 2OA0A 3WKBA 1AQNA 2JH8A 3WWCA 2ZRPA 4PYOA 1QQ5A 1Y98A 2PJDA 3IAHA 3ZTYA 2V9PA 5DNVA 2C95A 3ESYA 2IYAA 3MJSA 3RH0A 3NZEA 2X0NA 2XQIA 3VSDA 4CGYA 2ROQA 1GZ6A 4QATA 4RVNA 1M2OB 2H4YA 3CRRA 1QAQA 3QKRB 3D6FA 1KIFA 2GFQA 4HH3C 2G1PA 2AJLI 3STHA 2DSTA 3D2AA 1GLVA 5B7QA 1QQ7A 1XZEA 2BM9A 3B1WA 4IIHA 4E14A 4I46A 3EEOA 4B80A 4TYWA 3EJ6A 1C3XA 4WLVA 2MYTA 1BEUB 2PUHA 4MGEA 3IUBA 3TTXA 2VYVD 1QGUA 4B47A 2VTBA 1PL7A 2DUJA 4GLLA 2IK8A 5EFZA 3UOWA 1Y9ZA 5L6MB 4CCYA 3DKIA 4UCFA 1MHPA 1JKMA 2E6UX 2FMFA 5HKAA 1P80A 1EVKA 1GTVA 1QH9A 4EJ2A 1UBEA 2OHXA 4B7ZA 4P3XA 3IXLA 4J6EA 3E6AA 3LWZA 4ZPJA 3UTCA 3ZY3A 3FE2A 5KJCA 3E7PA 5FBQB 5I4CA 1M8PA 3T12A 4PVDA 2NP7A 1DAFA 1HT0A 3BCHA 3SJZA 1EAYA 1DFIA 1XN1A 1Z8FA 1YFKA 2CYCA 2ZQYA 3BMQA 3NVDA 5FOUA 4C6HA 4Q7JB 4IIEA 2ZT7A 3RS3A 2RG1A 2ZJ4A 4YRMA 5I4IA 3R5FA 2FX3A 3FI0A 5DYNA 3U4QA 4X3OA 1PFYA 1E59A 3T5AA 1LNSA 5CLJA 1YBHA 5AIBA 1G8MA 3UT5B 1XNRB 1LC3A 2HUPA 1ZGZA 3E1GA 3M49A 5BWNA 1UQRA 2VUTA 1VL0A 3BTOA 3EW7A 3S29A 1UP6A 3H11B 1POXA 5FI1B 4EHIA 2HMUA 4ESEA 1NM5C 1YZLA 4RETA 5BUCA 1A7UA 5SY4A 1D2GA 3U7FB 4QNNA 3ZE1B 4QWMA 3TCXB 1XEXA 4B6FA 4LJ7A 4QM7A 1VCNA 1V6CA 2R86A 2QTRA 3PJRA 1ECCA 4RTNA 2GBGA 1DC3A 1Y6GA 2HIAA 2BDUA 4RK4A 2CE7A 4DIBA 1X1AA 3BIJA 1X7YB 1F4LA 4H1TA 2AN5A 4M9QA 4WHMA 4DV6B 2B98A 4HLUA 3OKPA 4GQBA 1NP6A 5IS2A 1NVWQ 3Q7SA 2PA0A 3DE5X 1F6BA 1V6AA 2EW8A 3B6ZA 3ELBA 3ZLVA 4DREA 4Z4IA 1N2CB 3D8NA 1JHVA 1L5HA 1M66A 1SUPA 1SG0A 3BMXA 2C29D 3HCPA 3KDPA 3OZ7A 1QGED 3KYIB 1OT5A 1FLNA 2D54A 3HB0A 1T4CA 3R5JA 4XA8A 2I3GA 4E5DA 4IR7A 3ISJA 4WEQA 1DZIA 4GVPA 3BXOA 4QOHA 3FWPA 1ENZA 1G20A 4H4EA 3UT5A 2OBMA 5LLSA 1HKUA 1P29A 3OIGA 3RYIA 1QS0B 1M7HA 4QAQA 1VLLA 2GD6A 4WXEA 3VOTA 4MCIA 3UFXA 3ZQJA 4OHWA 4DLVA 3A1UA 1RMTA 5EUBA 1H8HA 3UWPA 3WJ2A 1ADYA 4OI1A 2GLXA 3BHIA 4MQMA 3MWLA 4BVFA 1HLPA 4WD3A 4X7BA 5FFFA 1RJDA 3S7ZA 4CU5A 4YXWD 4KO1S 3BCRA 3IULA 5AVJA 1KMCA 2J1LA 2AOVA 4V0NA 3WYBA 3TZQA 2QUIA 3GO4A 4RCYA 5EJ5A 4HO1X 1ODCA 4JCCA 3I04M 1JHQA 2Z2XA 4TUYA 1GTRA 5IWCA 2X19A 4BKOA 1IN7A 1U04A 2O2DA 3AL0C 1WU7A 4I9HA 3G2IA 4RAOA 2ATXA 4TLCA 4UHJA 3DE1X 5CA1B 1NM5A 4D46A 1X8XA 3MCUA 4U7TB 1AKRA 1DG9A 1T9AA 2JFFA 4CIBA 4IXMA 1HT2E 1HYBA 1LQ2A 3C48A 2I6GA 4TPKA 1USIA 3TH5A 1U9JA 1MH9A 3VHXA 3OSZA 1MC5A 2KB0A 4GPIB 4AWBA 3GLGA 3THYA 3RT7A 1HFKA 5LJIA 2WUGA 5EINA 4ZU6X 1JMYA 3IDQA 1N5LA 1AA9A 5H16A 2KSQA 3RC8A 3AOEC 4TTJA 4J9VA 1B43A 3DB2A 5FTMA 2GAOA 5AW0A 2HA5A 4WFQA 2FFBA 3QOFA 4FFSA 3W8FA 2PH7A 4YMSA 4ERXA 1A9RA 1TCVA 5BSRA 5C32A 4TKUA 3KUKA 3CUWA 3ADOA 4HEQA 1NRJB 2JD0A 2FSSA 3DEAA 5EWMA 3UGTA 3VR5A 5IKOA 5H68A 3ET4A 4OQYA 2L19A 1A8IA 3L0IB 4LSZA 1GG2A 3FM9A 2HEGA 1X8LA 3TRJA 1G7CA 3TYXA 4LE2A 4K3UA 2G80A 1UFKA 3U48A 3OZVA 3DFMA 3QVGA 1BCRB 2CYAA 3PHJA 4K9RA 1DBVO 5EPOA 1K89A 1LPAB 1E1YA 1NV9A 5I7EA 4AY4A 3MRTA 4FQ8A 3U49A 4PLCA 2AJDA 1JB9A 2H16A 3LLSA 4M2LA 1XQWA 2NWQA 4PGGA 3S2YA 3GAMA 4B3HA 4DA8A 2YVAA 1YWGO 2EFDB 4QD3A 1PNRA 3WOHA 1TTTA 1BTOA 4CI0B 2FDCA 2BF4A 2B5WA 3A36A 1SURA 1OY1A 4FMBB 3CVXA 5K3SA 1WMBA 4QX6A 3NHYA 4PXSA 5JVDF 1JE1A 1W0KA 2A9OA 3B6JA 5F9MA 1KIMA 4RHTA 4LWOA 4JHXA 3EXHB 2PUJA 5EEHA 3TLKA 1JTEA 3S8EA 1ZZGA 2V55B 3BJZA 4ZI7B 3UT0A 2D8AA 1XFAA 3AB7A 4CF6A 1T5LA 2OCKA 2ZWIA 5CRIA 2C8KA 4L22A 2VDWB 2VP2A 1YDHA 1E3TA 4PSAA 2JGKA 1CUSA 3K20A 1CQZA 5ECYA 4ZVOA 5E38A 4A3SA 1IRIA 1ZD9A 3E9EA 2XA1A 3L1UA 3Q15C 1KSGA 1A1SA 1H2BA 3WNZA 3NGMA 3WV5A 1JKXA 5C3MA 2W2LA 1LFAA 3Q72A 4O4LA 3B5EA 2BWJA 4BBPA 3I53A 5IARA 1ACJA 1D0SA 1R3DA 3UB2A 1KH3A 2WMNB 3DHVA 3GUYA 3ABSB 4NZZA 1DXOA 4D74A 4DC1A 5AK0A 2WAYA 1JGTA 4YECA 5HG0A 1Y4SA 1MOPA 4X54A 2Y0BA 2EBFX 3COJA 4K0KB 2VTKA 1ISJA 1ZNQO 4F4DA 1OH5A 2IGBA 3T3HA 1I4WA 1WB6A 2FW0A 3N3BC 2CKDA 1V2HE 3DHYA 5IJ9B 3TLBA 3NHKA 2HJGA 5FPHA 3ETCA 1ESNA 1FS4A 3I9FA 4YPFA 3LGAA 3Q9SA 1ECJA 2C4VA 4FE7A 1FFWA 3KWLA 4HN9A 1LGYA 2DU8A 2XDWA 3H4TA 4JYMA 2DEUA 2UUAB 5JNSA 3U3DA 4RSGA 4EGAA 3WYDA 2DSNA 3EWSA 1DC5A 4HN4B 1ATIA 1G5TA 5AVWA 3P9CA 2R8OA 5DNWA 5IT0A 2BGNA 3L8EA 1SXJA 1NZFA 2D5AA 5B1SA 7MHTA 1I0LA 3H1GA 4GUDA 5F23A 3W8EA 1VKJA 3EVFA 4QTZA 3KJXA 1VJDA 4C7OA 2H4ZA 3SIPA 3L92A 5C4MA 3ZGZA 1IPEA 1ZCBA 4MCJA 1K7CA 3W0LB 2FWMX 1Q0RA 1WY5A 1P81A 3OUTA 4I99A 1KMHA 2GM9A 3HB4X 5BW5A 1N32B 3GUCA 2AEEA 3F4KA 2B6HA 5K1ZA 4PC6A 3TW0A 1TVEA 4R05A 3WGUA 1CYEA 3TSAA 5AW8A 1EZ4A 1PV2A 3PF8A 4WA8A 2ZM6B 3FKJA 5IJWA 1YRLA 3C5EA 3AF3A 3U4GA 4EOGA 4RTRA 4IFEA 1LPBB 3K1JA 2R79A 4IVNA 2VF5X 3G9UA 2PBLA 4D3FA 4DNOA 1EH5A 3CRW1 2GSDA 1TQDA 4ARBA 3N2EA 3OKFA 1ICEA 3IQWA 1NSTA 3NHMA 1OLSA 5FYDA 4FCCA 3JSXA 1OTHA 4MVXA 3ZWBA 3AZQA 4B6PA 5H5JA 3E7FA 2CCGA 1NF8A 3MBKA 4L5BA 1KQOA 1KS9A 3BGOS 4OL9A 1N25A 1E3QA 1E98A 1VHJA 3BFPA 4I3FA 3ROKA 4I55F 3TUJC 2XEDA 3LLCA 1OMOA 4I5IA 4UQPA 4ZVSA 4NYMQ 2G8LA 3UGKA 5F2NA 3HDQA 3CKLA 2A5YB 1OFHA 2C3MA 1EQAA 2Q2WA 4P2BA 4XQ0A 4WK0B 3TR6A 4JJIA 3O8RA 4L8LA 5EP4A 3L8FA 3L7BA 2E85A 2GZMA 4NABA 3CF0A 2XVZA 4IJUA 1ZN8A 4GYYA 3CEHA 5F3RA 1TJ5A 4Q3KA 5WRFA 1V3QE 2YJ4A 1A0OA 1UDRA 2QRNA 4CKXA 1LRLA 1XWIA 4CR7A 2H48A 2WMOB 2RK6A 1IHPA 3CT6A 1RJEA 5IH7A 3WMEA 5JI3E 1DWUA 2A57A 2ZI7A 1B6SA 4HQRA 5TRTA 4P0QB 1HXHA 4IXDA 3RGWS 3NWEA 1F7UA 4IKOA 2C3UA 1S96A 2Q6TA 3HP4A 4ONEA 1N5IA 2C4WA 2BFFB 2VIIA 1C3OB 2VT7A 2GA9A 2X77A 4M87A 4NCXA 4TT3A 3I4LA 4Y2RA 4AMUA 4E07A 4YV7A 5F1YA 1NMXA 5J2TA 3A0UA 4AF6A 2IPOA 5LXTF 3UFXB 4QXAA 2HWKA 4ARUA 4GGPA 4J2HA 4DG9A 2OBYA 1JKFA 2VJLA 3DG9A 4HLDA 5SYNA 2FPSA 2ZIXA 1UZLA 3HCDA 5BW4A 2HMWA 5A7FA 4LWZA 1KGSA 3SC2A 1JJBA 4IXWA 5CPBA 2QRPA 3E9RA 4LZLA 1VMIA 4LOLA 4PLWA 2AQ8A 1FDSA 3K5IA 3QI2A 3WY9A 1YF3A 1FVFA 4LK2A 4G36A 3ENNA 4JT9A 2PX6A 3V6MA 2ZBDA 1L5HB 3PYMA 1WXHA 2ZSAA 3P9NA 1KI4A 3L8HA 5JAUA 3SAJA 4L0QA 5DLDA 3CSDA 2XGOA 2O8DA 3TBFA 1V48A 5KWVA 4M4SA 3L3BA 1UT6A 1BAPA 3O74A 2G06A 4LRTB 1GN8A 3GPCA 4Q1VA 1KAOA 4RQBA 2F55A 4K9NA 2EFHB 3C1TA 3U7QA 3ZDZB 1A2QA 5ECDA 4H7HA 3G2NA 5EUMA 4C4RA 3C5CA 1JQBA 1XZLA 4C20A 4H1WA 3LW7A 3Q3HA 4D9BA 3TFWA 4RM2A 4YN3A 5D1NA 2BKLA 5F98A 4UD2A 1Y37A 3F3KA 1QOPB 3LC1O 3H5WA 2Q9UA 2ZCVA 4PZAA 4Y6PA 4Q9DA 2FW6A 2OHJA 4S1PA 1OZAA 2XCIA 4OKIA 4ZO8A 1U28C 1ULTA 4TRJA 3UANA 2C7GA 2IHYA 1FVXA 3WGYA 2D5BA 2O3JA 4PXAA 3DPUA 3VYWA 1PQ4A 4R1PA 4A8JB 2D5IA 3BE5A 1LLCA 1KGDA 3NC0C 4KYTA 4TXLA 4JP5A 4G24A 1N7HA 4PEVA 8OHMA 3AXTA 4YJ2F 1F48A 1ZJ6A 3O91A 3U3JA 1GD1O 3EH1A 5K8IA 4I5DA 1SHJA 1N6NA 1ZM7A 2ZTVA 3TZLA 5ALKA 1KEEA 1U8YA 1XD9A 1Z83A 3BJRA 3GFBA 2W6IA 3LPDA 3PI6A 3IQHX 3A3OA 4EO4A 2A2ZA 4WKGA 1AHIA 1YRYE 3OHSX 4N49A 1RJ9A 1PYGA 3OEWA 4MROA 1OKKD 4Q1DA 5E1DA 1B26A 2JJ2A 5MF6A 4Q7MB 1TIBA 2V1XA 4E7OA 1GQ2A 3L0SA 1KZ6A 1NAIA 2Y99A 3CCFA 3VR0A 3AR4A 3M6WA 1JQKA 1UOEA 1JHRA 1Z0JA 4KR2A 4BMVA 2BMFA 4XXHA 4YJ2B 2YUTA 3RWMB 3WGNA 1IDN1 3WIBA 1XRSB 2XNDD 2BW0A 3T94A 4BLUA 4BNDB 5JYDA 3S81A 5A3VA 4CLDA 5IK2D 1CIJA 5FEUA 3DE6X 1E2PA 1QGOA 2RGNA 1KJZA 3BM5A 3FA2A 1VMDA 4JMPA 5AKYA 1M2OA 4ISBA 3AF4A 3RJTA 2OZKA 2WM9B 1Z75A 5CVVA 3GNQA 3WP1B 4Z99A 1IHXA 1T4CB 4H9GA 2RGXA 4N01A 5E95A 5EZ5A 3FOWA 4YRTA 3R74A 4GHWA 3UMYA 1SBIA 2VP0A 3X43A 4NAVA 2MINA 2QV0A 4FS8A 3LRPA 2WWVD 3FWYA 2OLKA 3TPCA 2Q28A 4PQEA 1D4ZA 3GUZA 1OIVA 1A4XA 4RFVA 1N2ZA 3RHFA 1C7IA 4ZGBA 4NDNE 4QDUA 4DJEC 1M34B 2WIKA 1Q7TA 1PJLA 2J6IA 3OJOA 2B99A 3MBIA 4DT1B 2FSFA 3OFKA 3G13A 5KX5F 1Y81A 5YASA 5AI9A 4KNWA 3KSRA 5DYWA 1ULHA 4HH4A 3CUEF 4M8LA 3MRVA 5SYMA 4YDQA 4R8VA 1JNYA 4QC2A 2C78A 4PPFA 4A2CA 4DCNA 1U8UA 5LOVA 1U98A 3JWHA 4LDZA 3E7XA 2KQUA 4M9UA 2A92A 3O9VA 3N7AA 4KQIA 1PFGA 4UVGA 5KMGA 1PEYA 3CF6R 3SLKA 3N2LA 1EFVA 3VU3A 1FEZA 2PFSA 3DP9A 4DV1B 2ZR9A 4WK4B 2OK7A 1VECA 2P78A 3OPNA 5TV2A 3PUVA 4DC0A 4XVQA 3C16C 3H84A 5A3RA 3U4QB 1XVIA 3R41A 4LDPA 3BG5A 3EXIA 1RZ3A 1MVNA 2SCUB 2X9GA 4PLHA 3DAPA 3JD2A 4MRRA 1PN3A 5CJJA 1VMKA 4GWKA 1AHPA 3BMQB 5FBRB 2DPYA 3RQIA 3AHEA 4NX2A 1JDBB 4DUPA 3LPNA 1D8AA 2Y1WA 1TUBA 5A4DA 1SB8A 3F9IA 3HM9A 2W2XA 4ZOLB 1N2SA 1N9GA 5AHOA 3K0CA 3N8HA 1PFWA 2YV4A 4ZAZA 2ZUVA 3PFBA 4DV0B 2J5RA 3IAS6 5AJZA 4WY5A 3WG9A 4A0QA 3EX7C 4YT8A 1FTQA 1RWMA 3B9BA 1NVBA 4LS3A 3NR2A 3DDCA 2HHHB 8MHTA 5H59A 5J2TF 5FAXA 3TEMA 4LZNA 2Q5OA 3KNZA 1FYFA 2VA9A 2ZTUA 5JMPA 3RTGA 4H0NA 4L2IA 1DRVA 2WSMA 2XNKA 4HWKA 4MO9A 5T3YA 1JT9A 1GNQA 4C3OB 3DLAA 3CX8A 3OM8A 5A05A 1GTMA 2BFDB 3O94A 4LNUB 5BP7A 3VYSB 2EG9A 2QL5A 4K05A 3F6YA 1GPLA 1KE1A 2YXPX 2RGAA 3MGKA 4MITA 1REQB 3ZZMA 4K03A 2XDQB 3T7TA 2I8LA 1E3WB 1VQ1A