4HB3A

Crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb3A00
1P4SA 3DPUA 2QMEA 3THYB 1UKZA 2JLZA 2BV3A 3Q7QA 2RGBA 4KXFB 3IO5A 3W5IA 4PPQA 4Q9JA 3K9GA 4D26A 2WKQA 3PUWA 2ERYA 3MWKA 3UKDA 1NP6A 2ONKA 5EJEA 4DLVA 4MRNA 3WP0A 1N0VC 4RCZA 1T8TA 3K0AA 4ZDKA 3U3JA 1FNMA 1KI1A 4HB4A 1GIAA 1WBDA 3RWOA 3DO6A 3WP1B 1VG9B 4XJXA 2ZRFA 1KI9A 1CKEA 4RD0A 4G1UC 5GADl 2IX3A 3SYKA 2EFDB 1RRGA 4YMSA 1NIPA 1TUEA 5D3MA 1RRFA 3KX2A 2BEJA 2C5LA 1ETUA 2H8KA 1XJQA 5FUXA 2ZRKA 2OUKA 4C0KA 2QRNA 3OF5A 1ZJ6A 3Q3JB 4E09A 3DOFA 3PIRA 2QTHA 1KJYA 2EYQA 4B73A 1XMIA 5IDVA 1W49A 4M9QA 4AWXA 1GKIA 2YOGA 4G3XA 4DCNA 1NMYA 1D6JA 2QPTA 5C4GB 3KKOA 1ZVQA 2G9NA 2EFCB 3RHFA 2BC9A 4LK2A 1U90A 3TK1A 2BM1A 2AX4A 2XTMA 1NIJA 2O8EA 1WF3A 3MUFA 3I61A 4FWIB 2XB4A 2BMDA 3GLHA 1G7RA 1CBUA 1ZC3A 3FDIA 2IBMA 3KKPA 1M8PA 2O8BB 1RE0A 4TLDA 4W5JA 1TF5A 1P9RA 4X8OA 5BYJA 4ZCMA 1N6HA 1W36C 5H1YA 5B58C 2GCOB 4TQAA 3ZVRA 4LC1A 4F38A 1LS6A 2Z83A 2VP2A 5E3HA 1LVGA 3QKUA 3UWKA 2GHIA 4M53A 3FVQA 2D7CA 1R8QA 3B1YA 4CZ2A 1N6KA 1XPOA 4TZ6A 1E1QA 1US8A 2ZI4A 2Z4RA 3U3MA 3RS0A 4PSKA 2QY9A 2R65A 3IBYA 3EZ6A 3V4FA 4A0RA 1IN7A 1V5WA 1HE8B 4M8NE 3QKTA 1DO0A 2IXGA 1M2OB 1VCOA 4KSCA 3R9XA 1GUAA 3ZGXA 4TYNA 4NYMR 2YWHA 3MWYW 2YC4C 3RLFA 2CLSA 3HU1A 4D0LB 4WZBE 1QDEA 4H9GA 4HAWA 4O3MA 4FWTA 3TW8B 4DSOA 2QZ4A 3VR1A 2QROA 4WA7A 4BE7B 1VHLA 3RRZA 1QZXA 3WBKA 3TBKA 4WW0A 1DAHA 1UM8A 1XCGB 2IYRA 2J3EA 2QI9C 2ZRGA 3H86A 3U7GA 2IS1A 3B82A 2E1RA 1KKMA 4A15A 3SJBA 2O8FA 3MAAC 2A7QA 1E94E 1ZNYA 4F4JA 3GLFA 3DMNA 2ERXA 2QUZA 4M4SA 5AJWA 3RRYA 2VTKA 3K0CC 3NHBA 2HT6A 3QF7A 3VU9A 1SHZA 4ZI2A 2BDTA 2BWJA 4GL2A 1LV7A 1KK3A 1MR3F 3SU8A 3OFND 2SHKA 4QXAA 4DCTA 2QL6A 2VRWA 4EFNA 3KUDA 1NSTA 3TNFA 1DO2A 1WP9A 1NJGA 1N6RA 1X1RA 2HLDA 1RW4A 2W58A 2XAUA 4NYJQ 3FKSA 4HB0A 2JA1A 3FMPB 3UWOA 1EX7A 1JPJA 2CNWD 1XB2A 4QFMA 5KUTA 3W3ZB 4DLYA 3ETLA 4Q5IA 5FTJA 1AGPA 3TR0A 1RRCA 2IEZA 2AWOA 3L82B 1Q1BA 2V9PA 2O8CB 1XNJA 1KI7A 4P32A 4MKHA 5KDDA 3A1WA 2B92A 2GJSA 1MKYA 1WBBA 1T3SA 4Q9IA 1G3MA 4P33A 3B2EA 4QBIA 4M1SA 4TSFA 4JLBA 5DI3A 4AIIA 4DUGA 1AGRA 2WIBA 5KNBA 1YQTA 3NEYA 4GZMA 4BECA 4E22A 5JMTA 2J87A 3LW7A 2QAJA 3KB2A 3L8ZA 1FUUA 1RZ3A 2QORA 3THWB 1KSJA 3NVAA 5TY0A 2IYZA 4MKFA 2FSIA 4DCSA 1R0YA 2BBSA 2KBFA 1JALA 3AQ4A 2GNOA 4XOIA 5HZHA 2A9KA 5FR2A 3KFXA 4TLCA 1XJCA 1R4AA 2GWHA 2ZIAA 5JZVA 2IXFA 3V9PA 4ZKEA 1SULA 1OXVA 4JLKA 4OJKA 5FTLA 4FMDF 1XMJA 2KB0A 2VF7A 4CEHA 2ZETA 1Q1QA 1S96A 1M7GA 2I4IA 3R8FA 4IEEA 4TL9A 1F2TB 1KSFX 2X19A 5KYKA 2QT1A 3CUEF 1EESA 3AP3A 1L4UA 1WE2A 4Q03A 2OO7A 3MSXA 4DLTA 4NU0A 1E3MA 4TMVA 1P2SA 4CRWB 4JJZA 1SZPA 3VNVA 3KQUA 2QTVB 3GJ3A 4LWZA 3KQHA 4I1UA 4EIWA 3OIUA 1OYWA 1KTVA 1ZAKA 2OSBA 3QENA 2WJGA 3VX4A 3G5UA 2ZRMA 2B6HA 1PUIA 4XWAA 3ICQB 1OLOA 1CTQA 5C18A 4MGKR 5J5CA 4URWR 1KI8A 3MMPA 4NYIR 3GLGB 1EFRD 1GOTA 1EG7A 5DGXA 3DVLA 5BN5A 5CK4A 4WXPA 1W36D 4XH9B 1MABB 1UBCA 2XSZA 4JBXA 1TAGA 2YOHA 3RANA 3MWJA 1E4VA 2PX0A 1WRBA 2P6NA 1F60A 1DS6A 4BPBA 1OIWA 3K1JA 4OQXA 4EAQA 3BOSA 4US0R 3TW4A 1TPZA 3CW2A 2NZ8A 4H1UA 2A3RA 4NBSA 4XD7A 3K70C 4Q4HB 4EQ6A 1KI6A 4BFYA 4P0TA 1M74A 1NL3A 4ZI3A 5L8VA 4PAMA 3ZDQA 2ZJZA 3U44B 2OESA 2GZHA 2QP9X 3HPQA 1X3SA 1MO6A 4A2WA 4B34A 2VHTA 3WNDA 5FI0B 4GMDA 4ON9A 2R8RA 4KAXA 2VBCA 1E0AA 2WMNB 4IVRA 4KFSA 2ATVA 1VCNA 3NHAA 1GKUB 3AVUA 3NWJA 2F3RA 2ZVQX 3T1VA 4GDFA 3FGNA 3QPWA 4O2RA 4MRRA 3C4JA 4PQFA 1NBME 2A5DA 4Z1MA 1RJ9A 2IC5A 1EFHA 1VIAA 3W9YA 2CL6X 4YMUA 1K6MA 5DN6D 5FUYA 3W90A 1CULC 1YZUA 2D06A 2BMFA 2RMKA 1E2KA 3B5JA 1LW7A 1R0XA 3CRQA 4Z8XA 5HTKA 4OHZA 4CF7A 3THXA 4U5XA 5KSPA 4BUJA 4JLNA 1G8YA 2OBMA 2WJHA 3EPJA 4M9XA 4F4IA 2GAAA 1AK2A 2F3TA 1MO3A 1E9DA 5H70A 1YZGA 1N6NA 3I32A 2REBA 2ONJA 4IDOA 2AKYA 4TTQA 1DAEA 2EVWX 4QGHA 2W6IA 4MDEA 1N0UA 1DE0A 1E0JA 1ZNZA 4QG7A 3BFXA 3BE4A 3FOZA 1W44A 4KHZA 3L0PA 4AKEA 3DOEA 3FE2A 1FW6A 2E9SA 1PZNA 4W9MC 3E1SA 1B23P 2BJWA 1E1QD 4DVGA 4TYWA 4R2HA 4M1MA 1UEJA 4IDNA 4JT2A 1P7CA 2BBTA 2IXEA 1KDRA 4LHWA 1ESNA 4IRUB 3BBPA 5CK5A 1H65A 3QVUA 4EPXA 2ZRLA 4NYMQ 4IFBA 4TT3D 1VYVA 1J70A 1OFHA 2WVJA 1PLKA 1T4GA 3T5DA 3TUJC 3AM1A 1UJ2A 1DPFA 1T3LA 3KXKA 5E7IA 5EXPA 3RAPR 1P5ZB 2F1RA 4BFZA 5TXGA 4OK3A 3K0FA 4DLSA 2QSYA 2ZSFA 2B8WA 4Q7LA 3FYHA 1E9FA 3B78A 4DIDA 5KNDA 3DEFA 5FTKA 2ZU0C 3RWMB 3W8RA 2J41A 2UKDA 3LXXA 1GL7A 2Z4SA 2W0SA 4OHXA 2BM0A 4LX0A 3L2OB 2NO9A 1XXHE 3WMEA 4QGFA 3RRMA 1A7JA 4M9SA 1CR0A 3QXSA 2HLDD 2CHVA 1HE1C 2QGNA 3R7WB 3SJZA 3FKSD 3F0TA 2C2HA 5J4HA 4DXAA 5HE8A 2B7CA 3I3SR 1D9ZA 4OHVA 4D6PA 1QHSA 4ERNA 1IHUA 1NMXA 4HDCA 3BK7A 3OESA 1AJEA 1ELOA 2ZXUA 4QJ5A 4HZIA 2HYDA 2YWGA 4BGDA 1F2TA 1EWRA 3A1VA 4Q4JB 3SYNA 2C9YA 2JJ2A 4DDWA 5KO2A 1IQPA 4E03A 3V00A 2BMEA 3B8HA 3IHWA 2QN6A 2IYLD 4LHVA 4JBYA 4PTLA 3ZQJA 4DUGD 3SNHA 5LPNA 4GP7A 2GVDC 1E2GA 5C46F 3OHMA 4JL6A 3VFDA 4RJLA 5SZJA 2QAGA 3T1QA 2DWPA 3UXMA 2AK3A 3CB4A 4Q1BA 5F2EA 1OE0A 1Q57A 2CL7X 3I72A 2GCPA 4PPFA 4A0FA 5B64A 3QY0A 1I4TD 2W83A 5FFMA 3WMGA 4EUNA 3MJHA 3FB4A 1JQJC 4LYFA 721PA 1HQCA 3BB3A 3WNCA 2WHXA 3IDQA 4E07A 2J0SA 1DELA 3EZ2A 5IF9A 1IOZA 3QF4A 4A2QA 4Q66C 5FPHA 1TEXA 2J59A 5J4KA 3HDTA 3U6KA 2CLDX 3H84A 3D31A 1H8HD 1NVVR 2IYYA 2XEXA 3ZH9B 2ZI6A 3QXHA 4LSGA 2O0HA 4CVNA 1SKYB 4U02A 1KKLA 3QXCA 1C9KA 1UEIA 2DFTA 3O8CA 4XVRA 1OPXA 1OT3A 5CM9C 1FL9A 1QHYA 2ZSBA 5FOUA 2CDNA 3EG5A 4K46A 3A4LA 1IXRC 2AXNA 1NKSA 4K81B 4P4UA 1ONBA 1NNEA 2GJKA 4N1AA 1CP2A 1VYTA 3T1TA 2VP5A 5CM8B 3LBNA 2OCBA 5J4VA 3K0AB 1W4AA 1NN3A 2W2VA 3CONA 4V02A 4B3GA 1AN0A 1KZ7B 1Z28A 4DBLC 4LJ4A 1E4YA 4NYIQ 3VR5A 4B2LA 1P9NA 221PA 4L16A 5FBWB 1OF1A 1KO4A 2XSZD 2BIFA 3QKRA 2XX3A 1Q3TA 3ZZTA 3VKWA 2CCKA 2X8AA 4Q4LA 5AJVB 5ANRB 5D3MB 1DEKA 3GQBA 3PVSA 3T06B 4ARZA 1EGAA 4HI0E 4OI0A 5DI9A 4RD1A 2P5SA 5KSOA 5L3VA 4PSAA 2R44A 3NKVA 4QHYA 4XD7D 3ADBA 2R6GA 4C4PA 2IEYA 1J99A 1JR3A 1C1YA 2AR7A 1SXJA 3CX8A 4A2PA 2DFLA 4P4TA 1P6XA 4IEIA 5DYGA 3QEJA 3SZRA 2ZE5A 2IYSA 3NIBA 4RD2A 1ZW6A 4PHHA 2Q3HA 2DHRA 1I4DD 1TQDA 4XIGS 2YWEA 4HAYA 5E7JA 4GNKA 4J0QA 5CJ2A 5JJIA 2ODWA 1E2PA 3WRYC 2OZEA 2JAQA 5LBIA 3H0KA 2E87A 2O8EB 4Z1MD 3CF0A 3A4MA 4BFVA 3GLHB 4BQSA 4B74A 3B13B 1NY5A 3KJHA 1LF5A 3N2EA 1EK0A 5TDHA 1HURA 1XTSA 2ANBA 3VQTA 3FHTA 1VKJA 3OAAA 1SVMA 2PL3A 5FBRB 2ZYUX 1FQJA 2XXAA 3FWYA 3ZQ6A 1Q0UA 2F7SA 1E9EA 2MSDB 3NH9A 1UF9A 4LHYA 4OQLA 4ASUA 1KO8A 2H92A 3OEEA 4G5OA 621PA 2RCNA 2RGEA 2ZROA 4O2LA 1Z2AA 3RC3A 4A6PA 3KQKA 4HATA 4NTZA 3WMFA 2YC2C 2YWFA 1JXOA 2G77B 2FG5A 2W2TA 1US8B 3AF1A 3GJ8A 3SYLA 1E2LA 1SHKA 3AUYA 1OFTA 3O8DA 5FOTA 5KHOC 4NCJA 1XP8A 2D62A 2RGAA 2QM7A 4QGAA 4PPGA 4ZCLA 1A4RA 2QPOA 2GJAA 3D7MA 2J9RA 4GFDA 1E0SA 2C96A 1P61B 1N0WA 1KI4A 2KI5A 3RABA 4C0SA 1F6BA 3EZFA 3C14C 5F9HA 4RFVA 4FCVA 5KNCA 1S9HA 2UZ3A 3ND8A 2ZRCA 3QBVA 3F3YA 3UG6A 4ARZB 1XD9A 2O8FB 5EZ6B 4GZLA 3W3AA 5EE0A 3PEWA 2IL1A 2X1VA 2ZEJA 4GSYA 5AUPB 3GLFB 4M1KA 1DG1G 1NY6A 1L4YA 2P65A 1ZM2A 4POAA 3U6BA 2GVZC 1LNZA 1IM2A 4R7ZA 4NCHA 1KSHA 3VU9B 3GD7A 4PR0A 4QNMA 4BEBA 4A92A 1T9HA 3QPVA 4NMMA 5SZKB 1ZM3A 4DCVA 1N6IA 2QEQA 3B85A 2JLSA 1KHTA 1IJFA 4UJ3A 2V6JA 1S1CA 3TE6A 2ZAMA 3Q7PA 1FTSA 4P31A 2Q9CA 1ZM7A 1KO7A 4HB3A 2CCJA 3UMFA 4M1TA 2XB2A 2AN9A 5G41A 1A2KC 1U99A 2K5UA 3GLIA 3BH0A 5DI3B 3CR8A 2GJ8A 2OXCA 3GFOA 3W5JA 4DSNA 2H57A 1FOEB 4C2UA 1XD2A 2JLVA 5HCNA 4TQ9A 4LI0A 2LWIA 3LH5A 3L8YA 1Z0IA 1TU3A 3GJ6A 4FXPA 1MH1A 3QXXA 3AVWA 2AD5A 3EC2A 1KZGB 1GRNA 4TN1A 2WTUA 2ZS7A 3CF6R 2WAYA 3KQNA 2F9MA 2G1JA 4PPNA 1XD8A 2CE2X 3IIMA 3OZXA 4DLZA 5KSZA 3K0EA 5JCPA 4D82A 1BH2A 3G82C 2AD1A 2RH5A 4LJ6A 4YDSA 3ZVLA 4CEHB 4G01B 3VMFA 4V03A 3GLGE 1EX6A 1FP6A 3AF2A 3SDZA 3AVOA 1N5JA 1JAIA 2VSFA 4XWKA 2ZUBA 2F43B 2GEVA 5FPSA 1G6HA 2F1JA 5KDOA 2FZ4A 2RKOA 1TQ4A 1KO1A 4KV9A 1R10A 5DE3A 3I4LA 2OT3B 4WAUA 3TAUA 1P2VA 3B7GA 4U7DA 1JJVA 2DY1A 2KJQA 2XGJA 4MYTA 1NVVQ 1Q21A 3PJRA 2JCSA 5ELXA 1ZCAA 1YR9A 1P3JA 1SKQA 4PHFA 1I2DA 4NL4H 3PR1A 4XTCS 3X1YA 4F7WA 1H8EA 4KYIB 4DC9A 1FMJA 1WA5A 3A1TA 3AP1A 4Y0AA 1A2BA 4TTRA 5JEDA 4C30A 2YNMA 4LBZA 1XEFA 3C5HA 3SOPA 2AFHE 3DMDA 3EA5A 2ZJ2A 3SN6A 3A1UA 4AYXA 2JGNA 4JLVA 1OIXA 3I5YA 2VHJA 4GOJA 3KUCA 1HYQA 2Q3MA 1FQKA 2DFNA 1KJZA 5EP2A 1QHGA 1JBKA 4W5HA 1W47A 4GOKA 2W00A 1D9XA 1NVUQ 4ZPXA 4YDHB 2HEIA 2GXAA 4L5BA 1E1RA 1R2QA 4FD2A 3HR8A 3EAQA 3ASZA 2QG6A 3SJCA 2W6JA 1RFLA 2IT1A 3WHLA 2B21A 4EQ6B 1KI6B 1KOFA 2HV8A 2IHBA 1UFQA 1G291 4UNQA 4F4CA 4TYPA 1DOAA 1K5DA 4RZUA 3I62A 2G1KA 1J8YF 1NF3A 1CRPA 3TH5A 3FMOB 1E2NA 1S9DA 1ANKA 4LY6A 3ZIAA 1NN1A 3ADDA 1VTKA 4Q01A 1RJ9B 3ADKA 4LYHA 3W6NA 4CW7A 2V6IA 1Z8FA 2NPIA 4LBYA 4JKYA 4D0GA 2VF8A 3CWZA 3IBGA 2ZRDA 4DEXA 4ZIRA 2GBLA 1VCMA 3LA6A 2L0XA 1B0UA 1S3SA 3THXB 4B47A 4FCWA 3FMFA 4GP6A 2ZREA 4L9WA 4V0MA 3L43A 5SZIA 4Q4AA 4TQUS 1SGWA 3BJIC 3PUXA 4MGZR 3ICEA 1CJMA 2IS6A 1Z0DA 1SVOA 2NO7A 3EXAA 4HEJA 2VP9A 521PA 1GP2A 1JECA 2DFKB 2FZLA 3GJ4A 4D4LA 1Z22A 4DRZA 5D3QA 6Q21A 3SBEA 1SVIA 3NBZC 1ESMA 3KXLA 2G0TA 3OAAD 4D0NA 1N6PA 1E2DA 1E99A 3LFUA 3AV0B 2ZI3A 3LX5A 3IPXA 5AJZA 1S3GA 4UXHA 4CT5A 4ASUD 3Q72A 4A0HA 2IS4A 4LCBA 1GNRA 3U3KA 4CGZA 1M1YE 4NH0A 2ZITA 4B43A 1KO5A 3B1ZA 3PITA 3B6EA 3LLMA 4PANA 1YZLA 4M0LA 4P3YA 4A9AA 1Z63A 5JECA 2ZS8A 1RYFA 3U3RA 5B57C 2C04A 1D2EA 1WMSA 2QP3A 2OLJA 3F8TA 3SFVA 5F3WB 4IVPA 2YOFA 4UQOA 3QUSA 3BB4A 1E0KA 5HKKA 3OE7A 3EZ9A 2FN4A 3IKJA 1G8HA 1R0ZA 1TMKA 2A30A 2R62A 5K8TA 1E79A 3ZZ0A 3K0FB 3DM5A 4C0AC 5DH9A 3P32A 2QNRA 4M1YA 4OBEA 5JS8A 2ZR0A 3FPAA 2IF2A 2OFOA 2BKEA 3Q5EA 3KFVA 1X86B 2J0QA 2PH1A 2VIIA 4QKQA 5CDFA 1G3QA 3X1DA 4H1VA 5HCIA 5JWRA 1VG0B 4PQYA 4BLPA 1W0JA 1O3YA 3R8CA 3WHKA 3EIQA 2H16A 2CEAA 3SE0A 1R8SA 4KBGA 4TMTA 4BFTA 1SVKA 5GJCA 4DDUA 2FFHA 2HDNB 1AKEA 2QMUA 3BORA 4IOMA 5FL3A 4JMPA 1N5IA 1NJFA 4UXIA 4HSEA 3EPKA 1RPZA 2FSGA 2P67A 3QQ5A 1HTWA 2JASA 1Z47A 2FWRA 3WYAA 1KDOA 1GWNA 2ZPTX 2WIAA 2PCLA 2VHQA 4KO8A 2VYFA 1X8LA 2QE7D 2QPAA 4Q00A 4XSGA 3EX7C 3AVTA 1LFDB 3P26A 5JBQA 1X8KA 1G7TA 4ITRC 3GP8A 3LDAA 3UATA 2F43A 4RKEA 1OKKA 2GZAA 1NRJB 5EP1A 2DYKA 1M7HA 3VKHA 4E5UA 1SKYE 3JVUA 4RFSA 1OFUX 1Z3IX 1T0HB 3KL4A 4BLRA 2QAGB 2QT0A 1E6CA 1G3UA 1Z6GA 4OI2A 2GF0A 1U0HC 4BFXA 1KIMA 1F2UA 3ZD6A 2RHMA 2VL7A 3ZD7A 4LBVA 2W0MA 3RVBA 1L7VC 2V4ZA 1G6OA 4DWJA 1N25A 1XX6A 4HDOB 1IAQA 2V7QA 1DAGA 2ORVA 3BRWD 2QGZA 5EE1A 2JLUA 2VHUA 4JVSB 2J7PA 2JDID 3KKNA 4HAXA 2FFBA 1G64A 3QF4B 2HUPA 1J8MF 1MO4A 1G19A 1RYHA 2GF9A 2PEYA 3UG7A 3CO5A 1BOFA 5FOWA 1Q20A 4TTPA 821PA 2C77A 2ZUCA 4RD4A 3RNLA 2CLCX 3BH6A 3E70C 1U8YA 1G4AE 3VNUA 3OEHA 1GNQA 1WXQA 1R6BX 5TVKA 1YZTA 5EXSA 1FX0B 1X8JA 3FTQA 1HY3A 2ZS9A 1U0JA 4TYYA 3EIEA 2A5JA 5EP4A 2GA8A 3MWLA 3Q85A 2Z5FA 3THOA 1T8UA 1G1MA 3FKQA 5L3RA 2FMXA 3AKDA 3CIOA 4M22A 3I1FA 1S8FA 3U7FB 4GPTA 2IYQA 3JZMA 2I1VB 1H8ED 4IXNA 1JEDA 4LHXA 3HYTA 1X1SA 4B6EA 1G8GA 3SJAA 3D8BA 2D2EA 2XOKA 4RSGA 3MGCA 4TMKA 2Q9BA 2IYUA 4O25A 4B71A 1XBTA 3QKRB 4X8HA 4BFWA 4B3DA 2VP4A 5EP3A 4B75A 4V0NA 2GCNA 1QHNA 3GLHE 4Q21A 1ZD9A 1AS0A 4FMCF 4LPSA 1BYUA 2C8VA 1W2GA 1KJWA 4PZLA 4C0LA 1XTRA 2W6JD 2RGNA 3KB1A 2EU8A 3I92A 1Z29A 3IGFA 2V1UA 1NG9A 1MRSA 1W4RA 1GRRA 2EFHB 1SXJB 3QG5A 1W2HA 4LJ7A 3WY9A 3PUYA 4PZZA 5EUMA 2QP4A 1ZD1A 4JYBA 1DAKA 3NC0C 3VTKA 4Q1CA 4MRPA 4YC7A 4QRHA 3Q8XB 3M1IA 2WJVA 3PEUA 2D4HA 1YJ5A 5GJWC 4OQMA 5C1BA 2MSCB 4PZYA 3TUZC 1TL7C 2XZOA 3PQCA 2AXPA 3ZIAD 4CEJA 1EFCA 1P62B 3LNCA 4M2LA 5LB4A 4RD3A 1RC8A 1UKVY 3Q5DA 1AS3A 3QKSA 2ZI5A 4HDQB 1UBGA 1KY2A 1VG1A 2J0UA 3CH5A 1MRNA 4CEIA 5AWFC 4TLEA 3A8TA 2XXAB 4MRSA 2WWWA 1IY2A 2IA5A 1Z6AA 1AKYA 3RC8A 4URZR 4X8MA 1SQ5A 1QVRA 3AH8A 3DZ8A 4PO9A 1SVWA 5EXXA 2WWXA 4GT1A 3GLFE 4I99A 5G53C 2PJRA 3PV0A 2CHQA 3DM9B 1XF9A 1QG2A 1W4BA 2IWHA 1E2IA 5CB8A 2A78A 4P4SB 2HXYA 5GJBA 5JJKA 3WYFA 1E9AA 1ZU4A 1ZP6A 3IHLA 3K53A 1HT2E 1TU4A 3NBXX 4Q1AA 1Z06A 1XPUA 2J1LA 3A4NA 4RZXA 3GEEA 3PCRB 2OBLA 2CBZA 3D3QA 1GKYA 4M1WA 1CJUC 2WWYA 2CJWB 1NLFA 2P3SA 2REXB 2IW3A 3GJXC 3LVQE 2ZYWX 1KK0A 2EFEB 2RGDA 2O52A 2ZJYA 2GK6A 2ORIA 3N5CA 1YVDA 1Q22A 1HV8A 3SC3A 3TVTA 1W0KA 1X6VA 2CXXA 2V54A 2Q21A 4AKHA 3L0SA 4OQFA 5HKKD 4BRUA 3Q9LA 2QENA 4QC2A 1HUQA 2OFXA 5KPJA 2I3BA 3O8BA 5EXTA 4US1R 4N3NA 2RGXA 4TSFD 2NZJA 3PUZA 5P21A 4OKSA 1JXMA 1CXZA 2BCGY 5TV2A 3B1WA 2FJUA 5FTNA 1R0WA 2C78A 2R6AA 2RGGA 2OM2A 5B2ZA 1KY3A 2MMGA 3GFTA 3K9LA 4KFTA 2NPFA 1W0JD 3QVVA 1E69A 1K5GA 1VECA 2ZAOA 5JCZA 4ZDWA 1OH8A 1E2QA 4XTRA 3AF0A 3GLIB 1XTJA 4XWOA 1TF2A 4JLDA 2NG1A 1CIPA 4FMBB 4EKDA 4C7OA 3LBHA 3ND9A 1XD2B 4AKIA 4BRWA 1DARA 4B3XA 2WSMA 4URVR 1IONA 2IYXA 3EWAA 5A4JA 1W5SA 1MT0A 3AKCA 4C0HA 4URYR 4BEJA 4BLQA 1U81A 2W2XA 2DBYA 4L8GA 1W48A 1UBEA 1OKKD 2FA9A 1PVOA 1OB5A 2BJVA 1IY1A 1Z0AA 2ZJOA 4R98A 1ZINA 1IJEA 1XEXA 3TAHA 2FFQA 1FX0A 2IUUA 2ZR9A 4PXAA 3LW8A 3TSOA 4EPRA 1CR2A 1FZQA 1WDTA 4V0KA 3JVVA 5A5GA 2V7QD 1VPLA 2CCGA 5E4FA 5UKDA 1KI2A 1PUJA 3DKPA 4QGGA 2J7PD 3VAAA 3BFVA 3EW9A 3SI7A 4B32A 1UADA 5JLJA 1PV4A 4EPVA 5F9FA 2WBLC 2WWHA 2QRZA 5JWOA 5H8WA 2WKPA 4HLUA 1CJTC 2ZSEA 4RCYA 2FV8A 2QAGC 1K8RA 3CPEA 4I4LA 4QL3A 1ZRHA 4MA4A 1TTTA 4FMDB 4BLOA 3CNLA 4PSVA 3VR4A 4LYJA 1N6OA 3OEHD 2EQBA 3LY5A 2JJ1A 5JS7A 2N46A 1A82A 1T5IA 4LUCA 4D81A 1BMFA 2EYUA 1AA9A 4I1OA 1G3IA 1P2TA 4LGMA 5H68A 4A1FA 1KAGA 2GEUA 1T6NA 3BERA 3EIHA 4URUR 2Q0HA 4XVUA 3MRSA 1QF9A 2LKDA 2GAOA 4HUQA 4PC2A 2Z0MA 4Z54A 1AZSC 5FOVA 4MDFA 1OXSC 2GEDA 1U2RA 4WZ6A 1DVRA 4FIDA 4Q9KA 1LY1A 2FGJA 1L8QA 2XOKD 1W7AA 3CX6A 3RS4A 5IHPA 1DG3A 3RS7A 2ZUDA 1KYIA 5GJVC 3QBTA 1Q1EA 3LBIA 4ABYA 4DHEA 5CJPA 1GM5A 1XTKA 4LJ8A 5CIQA 3N2IA 3CRVA 1ZM4A 3KJIA 3FFBA 3U7EB 1OH6A 4RVCA 1KMHA 5TB5A 1RVDA 1J7KA 1DBSA 5IK2A 2ZSAA 4JVMA 1ZNWA 3MLEA 3GEHA 3LD9A 2ZRNA 4QM6A 1OW3B 2ZR7A 3GJ0A 4JVLA 5HE9A 4KYUA 5BYKA 1GAJA 1G3RA 3K9HA 4PHGA 1MV5A 4QNRA 3REFA 1I4LD 2VLIA 3CZPA 4P4SA 2AK2A 3UMSA 3BGWA 3UANA 1GTVA 1KSGA 1S4QA 4HLUC 4Q9HA 4ZIRB 3PFIA 1TADA 1U8ZA 2JIZA 2HF8A 2W6ID 3SQXA 1GVNB 3LO5A 1CF4A 1PJRA 1XJ0A 4OQNA 1S0UA 4PAOA 1AM4D 1G41A 1XPRA 3RS5A 4DLXA 4Q4AB 4Q47A 4Q1EA 5G3ZA 4YQFA 3EC1A 4IOLA 5EE9A 5TARA 4JKIA 5KPDA 1YU9A 4TWZA 5AJXA 3SQWA 2NO1A 1Q12A 2XTNA 1W1WA 2CJWA 2Q6TA 1TEVA 3OIVA 3OFNA 1P73A 3AEZA 4YMTA 1ZIPA 1E32A 3CR7A 4AC9A 4C3ZA 1II8A 1SXJC 2BHRA 2ZJBA 4OK5A 5FR1A 4KFUA 4MH0R 4EJSA 2YJTD 3OIYA 4WBSA 1O87A 3BXZA 4NP6A 1KDTA 2CNWA 1Z6XA 1CU1A 2ZRBA 3U2QA 3T61A 4LYAA 3HR7A 4US2R 1VCIA 2ZRAA 3W6OA 3CPHA 3BC1A 3RS3A 4PC6A 4B3FX 3REGA 3CX7A 5FTMA 2ZM5A 3AB3A 4BFUA 1BIFA 5GVRA 4ESVA 2BBWA 2QQ0A 5DSZA 4AYTA 5BWMA 3GCGA 1SVLA 3GFPA 1JPNA 2GXUA 1OXTA 2R6CA 2NGRA 1EXMA 2ASEA 2QA5A 3AF3A 1Q3HA 2FX3A 3IEUA 4UKDA 3RSLA 5KOYA 1G5RA 4Q19A 4ACBA 3LRPA 4MKIA 5JRZA 4U00A 4UNNA 3ZJYA 1P2UA 1EFUA 2OILA 2IWRA 5HR5A 2PMKA 4BWYA 2O0KA 1E2HA 2ZJ5A 4RY2A 1G7SA 2OE2A 2IK8A 1VMAA 4B33A 1MO5A 1W0KD 3LXRA 2GRJA 2KSQA 2H5EA 2G83A 3H2YA 3U61B 4JLAA 2ODBA 3A37A 1ZNXA 2MMCA 1N5LA 2WPDA 2ORWA 1OYYA 1FTNA 2JJ2D 3BH7A 4DLWA 4UNSA 4EPWA 2FNAA 4Q48A 3M6AA 3U7HB 1Q44A 2AFIE 1Z08A 3CNNA 2Y8EA 1SVSA 4KI0A 2FFAA 4M21A 4A4DA 3I8XA 1NLZA 1IN6A 2IF0A 1NI3A 2ZJAA 4EFLA 4HB2A 5JHGB 1TF7A 2HF9A 4EJSC 1ZMXA 2R9VA 3CRMA 4KBFA 1AQUA 4Q7MB 4D4JA 2MSEB 1E96A 3IO3A 4TYQA 5J4LA 4QHTA 4EDHA 1NLYA 4IDPA 3WBJA 5M04A 1NG1A 2V55B 3C5CA 3CRRA 4RFSB 2ZI7A 2PBRA 2ZJ8A 4IOKA 4PC1A 4LHZA 2GETA 2CMKA 2G0NA 4AYWA 1II0A 3M4YA 1F2UB 1EFRA 4FINA 3VR2A 1KI3A 2GK7A 3FFAA 3KZ1E 4MRVA 4V0LA 1R5OA 1T0JB 4LRWA 2XJ4A 1FFHA 2WAXA 3KJGA 4QBHA 3GEIA 4HLQB 5G40A 4YMWA 3NDBB 1J90A 2YHSA 1ZD8A 1ZIOA 3TGPA 3BIFA 1EFTA 3AGPA 3U4QA 2HT1A 4TMXA 3I73A 5FBQB 4O0MA 1RRPA 3NG1A 3MCAA 3DKVA 1XEWX 2J7KA 1U8AA 4D4KA 4Y0VA 4QBGB 1XU4A 3C8UA 5KDLA 4MGIR 3B1VA 3LWNA 4TL6A 1TQ6A 1YHNA 2HJVA 2O5VA 4NCKA 4II7A 1C4OA 3RS2A 1IXSB 2PZFA 3PEVA 4A8JA 2WJYA 2ZTSA 4N0DA 1CS4C 4W5WA 2QMHA 1W5TA 4C0QC 1RKBA 1YR7A 3NC1C 1JR3E 2JJ1D 4DKXA 2QQEA 1SXJE 1GDDA 2O0JA 3K0CA 5DN6A 1PLJA 1XZQA 4ZO4A 1BMFD 4L4UA 3N70A 2ZRIA 1CEEA 1GITA 1NBMA 3W6PA 3R9IA 2XZLA 4CIDA 1JR3D 3E2IA 3W34A 4NHOA 5CB6A 1SXJD 3IQWA 2D2FA 5DNYB 3CM0A 3BAFA 1E9CA 2QBYA 4LV8B 2PLFA 5FOXA 2JLYA 3RDPA 1GG2A 2IYWA 3L0IB 4JJKA 4FI3C 4LZZA 1BS1A 1GRQA 1ZUHA 3MFYA 5JRJA 3UPUA 3P4XA 3UIEA 5L3SA 3H4MA 3TSZA 3K8YA 2ZU6A 5FI1B 3KTAA 4ZCIA 2H1LA 1FMLA 1G7CA 4M9ZA 4JSTA 1KDPA 1P75A 2FOLA 4JBWA 4DDVA 5L3QA 2UVQA 1QHIA 3EA0A 4CT4B 2FPMA 5IK2D 3ZZUA 3AVYA 2FSFA 1W4CA 2FE4A 4PC7A 5CYPA 2BOVA 4YXWA 4LJ9A 2J45A 2TMKA 3OEED 3TMKA 4UNRA 4CEJB 5LDDC 5EE3A 3BB1A 4NZYA 4TT3A 1VDZA 2F9LA 3ECCA 3QKSB 4PFSA 1G16A 3HU2A 2J0UB 2OCAA 4CEIB 1XMSA 2J0VA 4MKGA 4A8JC 5E7MA 3C16C 2JIZD 2XNDA 3TIFA 3S1AA 4AURA 4B2IA 3RRNA 4ACAA 4R71A 3HU3A 4JZKA 5BW8A 3F5FA 5KTYA 2V8OA 1NMZA 5K8UA 5DIFA 4KITB 1PLLA 3QI2A 1GILA 5AUNB 1DAIA 2P6UA 4B3BA 1J2JA 3EPHA 5TMPA 2ZRJA 5BN3A 2JATA 5FH9A 1YKSA 1ZYUA 4DCUA 2ZANA 1YR8A 1FP7A 2PCJA 1XXHA 4KCGA 1II9A 1N2CE 2GBLC 4BLSA 1Z0KA 1N6LA 4URXR 1FUKA 1XEWY 1Z0JA 5K8LA 2B7BA 4HUTA 4LJAA 3M0EA 4IFEA 4BFSA 3QIAA 5J40A 1E9SA 4F93B 1UBFA 2ZRPA 1G4UR 5JSZA 3PEYA 2BCJQ 3A36A 3K09A 1OXUA 2HXSA 2WJIA 2X77A 4DB2A 2YV5A 2FF7A 2X2FA 5AJYA 5FPTA 2PZEA 2XNSA 3LV8A 5IRCD 4UXJA 4A36A 3P20A 3GLIE 2O8DA 3RYTC 1XRJA 4V0OA 3V4RA 2B8TA 3O47A 1YRAA 4ESHA 4OI1A 4DT1A 3E5HA 3ZVMA 2HYIC 1R5BA 2N1BA 4HZUA 3OIWA 3SR0A 4I81A 1BO6A 3WYGA 3VR3A 5CYOA 2F1IA 3ZVNA 5HPYB 2VHCA 4I1VA 1NN5A 5J47A 4Q7KA 4S35A 2AL7A 2VSOA 2BVNA 4DZZA 3KDSE 3WRXC 4L9SA 1CLUA 4MGYR 4PO8A 2XITA 3NBYC 2DCUA 2GXSA 3THYA 2IUSA 2WPDD 3AKEA 5AUQA 5EZ5A 1H8HA 2FH5B 2ZI9A 4OHWA 4S2EA 3CBQA 1HH4A 3C41J 4TL7A 4Q18A 3R20A 5J4YA 4KODA 5DISB 2PEZA 4JLPA 2WZQA 5JFGA 4B2PA 2A5YB 2CVHA 2ANCA 1D2NA 4PX9A 1N5KA 3T15A 4C7OB 3IIKA 3QPUA 3W8NA 4NCIA 4KVGA 2P2LA 2PLRA 3DZDA 3NDPA 4MYCA 5LD2B 4FW9A 3P27A 2UZIR 1S1MA 5BN4A 4UJ5A 1D8TA 2YINC 1ZUNB 4HAVA 4YLGA 1Z0FA 2CVFA 2ZVPX 4G5SA 1F48A 5EUQB 3SHWA 2G6BA 2G88A 4FN5A 4Q02A 3RSOA 2OBNA 2BEKA 1XEXB 2OHFA 3UK6A 4MUBA 3VX3A 2PX3A 3K09C 5HZKA 2WSSA 3PXGA 2FGKA 1U98A 1P72A 2EW1A 3AUXA 4NCNA 4A6XA 4LPKA 4Q1FA 2VPPA 5FPKA 2FDCA 5A0FA 3TQFA 1OFIA 1IXZA 2PT5A 4DB4A 3DDCA 1CR4A 4ILEA 2NIPA 4IVQA 4BLTA 2F1HA 3NEJA 1UKYA 5DYIA 4MITA 1G8PA 1OH5A 5FBLB 4WOPA 2GJ9A 4TZ0A 121PA 1YZNA 4AK9A 4JSYA 4RD6A 4MYUA 5FUWA 4LV5B 2JLQA 3TUIC 1Y63A 2OEPA 2JLWA 2WKRA 3PENA 1LS1A 1XCMA 2OG2A 4R2IA 4JLOA 1VIYA 2QM8A 4B76A 4PC3A 4GBMA 4GRAA 2O8BA 3K0SA 1MOZA 2P5TB 4QOSA 4ZKDA 1KK2A 2C9CA 1E1RD 1E2JA 1ZCBA 2GCOA 1KK1A 4AG5A 2ZE8A 4DIEA 2N42A 1EWQA 5CITA 5FL7A 4AKGA 3C15C 4JVNA 3MD0A 1HT1E 1Q1ZA 2WWFA 2BMJA 2ZYVX 3O8RA 2F6RA 3HJNA 1E2EA 5BQ5A 4JLJA 4HUQB 4RZ3A 3T12A 2WM9B 4TLBA 3LQQA 4WZAE 4LOAA 3EASA 1LB1B 1ZC4A 1NSFA 1Z6YA 4PQRA 3T1OA 3R9WA 1IBRA 1OH7A 2WWIA 1NBMD 1OJLA 2VP0A 2XZPA 3AF4A 4NPHA 3SBDA 4D4MA 2VSXA 4MYHA 1GNPA 3VHXA 3CNOA 4V0ME 3J81k 2YVUA 2DB3A 1ZBDA 5E95A 3BD9A 2D7DA 4RKFA 3QOFA 1KMHB 1P9WA 2CHGA 1TX4B 4R9UC 1NN0A 1NVWQ 8OHMA 3EZ7A 1TQ2A 3T35A 2IHYA 3X1ZA 2NTYC 2QU8A 1OB2A 4OL0A 4DDTA 5AUOB 2EFGA 1G17A 1G5TA 1U0LA 5SZHB 4QHSA 4IHQA 5DO9A 3QSYA 4OYHA 2WOJA 2C99A 2ATXA 1TUIA 4OK6A 1YRBA 3GJ7A 1DTSA 1M6NA 4D2IA 1COWA 2FEOA 2OXRA 4XVQA 2IS2A 3U5ZB 2KBEA 2KE5A 1IN5A 3X1XA 4HAZA 4M1OA 4YXWD 2OCYC 5DLQC 5C4MA 2JLRA 4TMWA 3IIJA 4Q7JB 4PO1A 2IYTA 2GDJA 1AS2A 1NKTA 2ZE6A 3LAWA 3ZYCA 2OAQ1 2OFWA 2A5FA 4NKRA 4DLUA 5FUVA 2O8CA 2CK3A 2IYVA 1IY0A 2VA8A 1YE8A 2RGNC 2X2EA 2OV2A 3U60B 3NXSA 1U94A 3AP2A 2XNDD 2R2AA 3SS8A 3IPYA 4YONB 1II8B 4EJSB 4Q9LA 3A6PC 4HYYA 4CYMA 3CF2A 5AR1A 3K9NA 3WNBA 2YKGA 2C03A 2A2ZA 1QVAA 3DL0A 5CLLA 2ZE7A 1XTQA 5JJLA 3OE7D 2RHDA 3THWA 2A5GA 2J5XA 4LJYA 3TJZA 5CDFE 1E79D 1GFIA 4PHTA 1KAOA 4EPYA 4KJZA 3TQCA 4AY2A 4W7SA 3ONWA 1HA3A 4QJ4A 5FOSA 1VHTA 1Y3AA 1U9IA 1T3HA 3X1WA 1IN8A 3KQLA 3SHFA 4NE2A 4RZ2A 4Z51A 1JNYA 3U3OA 3P1JA 4IKEA 4DEYA 2I1QA 3VHLB 4C9BA 5KU1A 4AD8A 1G8FA 2CL0X 2GKSA 4C0JA 1UKEA 5AK0A 2AHOA 1R5NA 1T91A 3TSWA 2WWGA 3WXMA 2Q3FA 2DWOA 2ODNA 1JQLB 3CKLA 1XTIA 2FPKA 1FPMA 4BZQA 1ODFA 4UNPA 4BZXA 3EPLA 4HAUA 1OHHA 1WB9A 4IOJA 4CDGA 4ZV4A 2DR3A 1OIVA 1Z07A 5LB2A 1W46A 1ZM9A 4TMZA 1DAMA 2V1XA 3FHOA 4D25A 1V43A 3BFKA 1QHHB 1G9XA 1Z5ZA 3B1XA 3QJYA 2KWIA 3K70D 1OXXK 2VQSA 2EWVA 2OAP1 5C2JB 2BKUA 2WMOB 3QG1A 4EPTA 2XTZA 3GJ5A 3GLGA 2P6RA 3G0HA 3NH6A 5EQTA 3L0OA 5FPYA 3TRFA 4BASA 2JLXA 3TLXA 3MG9A 4GOXA 1MABA 2V3CC 4QM7A 4K8OA 4JS0A 3AVPA 2H18A 1UPTA 4X8LA 4B35A 3DHWC 3JZAA 3P4YA 4DLRA 2GESA 3KXIA 2YYZA 4C0BA 5JHHB 2VP6A 2Z6VA 3BWDD 4Z8YA 3PG5A 1U9IC 5JI3E 3CLVA 5DHAA 3KJEA 3FMIA 4IJMA 1E2MA 2G3YA 2ZSDA 4Q1DA 4Q4HA 4TLAA 3GMTA 2AKAB 2QSZA 3T34A 1W36B 3HPRA 4JL8A 3LX8A 3IUYA 2VEDA 2GXQA 4QJ3A 1OSNA 3U44A 4OJQA 1F5NA 4ZDJA 4MUAA 3D6TB 1D5CA 2WSSD 1BKDR 1KGDA 4FCTA 4KVAA 3U4QB 2GILA 1DADA 3VR6A 4N0EA 4YMVA 5DHFA 2LKCA 5IT5A 2GZDA 1DAFA 2AWNA 2REOA 1AIPA 5G3YA 2NO6A 5LD2C 3KKMA 3UMRA 5JEEA 1I2MA 1LTQA 3QEOA 3TVDA 1NVXQ 1CR1A 3AGQA 4NONA 1A1VA 2H17A 1E98A 2H7VA 2WJJA 3HP1A 2NOAA 1R7RA 4A8JB 1UDWA 1IN4A 3CPJB 4HLCA 2P0EA 3SEAA 2RGCA 1Z6TA 2ECKA 2XJ9A 3X2SA 2HCJB 4BZPA 5JI2E 2Z43A 3NBFA 1AZTA 4C2TA 4KLNA 1JJ7A 1E2FA 1P60A 1XDBA 1Z2CA 5FL7D 2J46A 2ZRHA 4B44A 1UDXA 3MJRA 1JEEA 2GTPA 2OLKA 4L15A 5K8IA 3AVVA 2HJGA 3SFZA 1OV4A 2IUTA 1F3OA 2PT7A 2OCPA 3AKYA 3LVRE 2QBYB 1JB1A 1ZU5A 4B6FA 4G5GA 4LJ5A 1UAAA 3CH4B 1QRAA 5L3SB 2ZQ5A 4I1SA 2BBOA 2C98A 1S2MA 1TNDA 4D80A 3KTAB 1JAHA 4GMXA 1KNXA 1XMVA 1G18A 1WCV1 4PAQA 4IDQA 3VKGA 4G5RA 3ZS8A 5L3QB 1HEIA 3B9PA 2RAPA 5GVSA 2WOOA 4LDJA 1RIFA 2PMDA 4JYCA 4NYJR 4AG6A 1T5LA 2C95A 4KSBA 3A58B 4IXMA 2QMOA 3H1TA 1BYIA 2ODEA 5FBVB 1YZQA 4FMCB 1XCPA 4DSTA 1GZSA 1G21E 2DWQA 4WIAA 4EFMA 4NDZA 4B3CA 3TR5A 4LBWA 2CE7A 2LCFA 3ZLJA 4XSHA 1A5TA 1COWD 5CLQA 1QG4A 2PZGA 4A82A 2F55A 1KNQA 3R7WA 2NMVA 2D3WA 3T5GA 2EWWA 4TL8A 3S1AB 2VO1A 2R6DA 1CJVC 2D74A 3QXJA 2WICA 2HCBA 3BS4A 3FHCB 4KU4A 1JR6A 3PUVA 3I8SA 3C7KA 2WV9A 3CRW1 4IDHA 1HQYE 4WVFA 2CK3D 2Q9AA 1FNNA 3TKLA 1N3BA 4GI7A 4Q4JA 3AVXA 1XFAA 2FEMA 4JT4A 1G20E 1VYUA 4JIMA 1CJKC 3HYRA 5JWHA 3GPLA 2FU5C 1L2TA 1G5PA 4WXRA 2R6FA 1XXHB 4G0NA 3LQRA 4KFRA 1WQ1R 4A0GA 1XWIA 4LV6A 4KLZA 4DJTA 1E9BA 2YZ2A 2JJ8A 3CWQA 1KMQA 421PA 4F91B 4JL5A 4G5QA 4MQBA 3IEVA 2QE7A 5JSZB 1QBKC 4JLMA 2ZYTX 3NTUA 1GL6A 1QHHA 1M7BA 3QE0A 2O8DB 2DPXA 1YZKA 2C9OA 1CRQA 4ZDIA 2FPLA 4LC0A 3AVQA 2JEOA 4B48A 5KSYA 4AI6A 5B30A 5F98A 1E9RA 2QTFA 4OHYA 3CZQA 4OI4A 2FSHA 1VG8A 4DT1B 4DSUA 2NO0A 4IW3B 3I5XA 4F92B 2VH5R 3EARA 1AQYA 1YR6A 4HZUB 3QNUA 3B60A 3KKQA 5CIWA 5EE5B 3A1SA 1JI0A 3ASYA 3IILA 1GSIA 1XZPA 3LLUA 2PJZA 3ADCA 2NQ2C 4QBFA 1ZUIA 3IQXA 4HLDA 3EWSA 5BXQC 3ZS9A 3K70B 1D2MA 1LF0A 1M34E 1QHXA 1Z83A 2JDIA 1GL9B 3B9QA 2RB4A 1OHHD 3HWSA
chains in the Genus database with same CATH superfamily
1P4SA 4B3RB 5JPCA 4FLMA 1S7GA 5B3KA 2I4NA 3WK6A 2Q50A 3PC3A 5EKUA 3TPFA 3CEHA 4RLFA 3BXGA 5LBUA 1JG7A 2O7RA 3LQ4A 1N4AA 4O4JA 4HNAB 3W5IA 4L4XA 4U2BA 1VFNA 4IV8A 1MB0A 2WKQA 3WKCA 5BN1A 2P9QA 3JZIA 1JE1A 1U7TA 1XWWA 1BU8A 2F1OA 1T8TA 2UYGA 3K0AA 3P5SA 4UHFA 3S2FA 1JH8A 3I23A 1NRIA 3SLKA 3VSCA 2YFQA 3QYJA 2ZWVA 1PR2A 1GIAA 1YAHA 1B6TA 1M75A 4YEDA 4BJHB 4WY8A 1B0PA 3DO6A 1QZTA 2FCAA 2KLHA 1CKEA 1Z8HA 2I1WA 4KXNA 1RCTE 1C7ZA 1XL0A 4IJKA 4RA9B 5TIIA 1UK7A 4GH5A 1M8JA 1EFVB 4AJKA 1IEQA 5JVDB 4O1IA 2BEJA 3O73A 1M73E 4KQEA 5KIAA 1ETUA 1GCUA 2HCFA 2D1YA 3WLTA 3B6ZA 1PFYA 5KHLB 4G26A 1BVYF 1T6ZA 2LE0A 5BN5B 1C8KA 3IOMA 2VZ9A 1OLXB 4MW5A 1FJXA 3BMCB 3WL7A 2V97A 1Z12A 5HA5A 2QTHA 4IFTA 1KJYA 4L8WB 1YU6A 1NVAA 4WN9B 5LWHA 5BPHA 1EJ2A 1Y34E 7REQB 1J2YA 4O63O 4AWXA 4XIJA 1YIDA 3JAWA 4G3XA 1FSPA 2Q1XA 2ZYRA 1D6JA 4RKQA 4HWKA 1ZVQA 4N5MA 2BR5A 4F2DA 3JXEA 2EFCB 4OCZA 4P4LA 2BC9A 3HXLA 1RAFA 1U90A 1NVGA 3VPGA 2CNLA 2AX4A 2XTMA 4GUAA 3TCXB 3ER8A 3WSWA 4M89A 4J43A 2IODA 4CMKA 1DKLA 3I61A 3UFXA 1CBUA 1VA5A 4DCPA 3KKPA 4M9RA 3TS1A 4Q3DA 3ZN2A 4C6HA 1A72A 2XD4A 4OQ4A 4X8OA 4YDQA 3SSNA 2DHDA 3HJHA 3QPBA 5JZOA 1U1GA 1W36C 2ECPA 2VDMB 5K3OA 2G8NA 2X23A 3QX8A 4F5WA 4LRTB 4EVSA 5TF4A 5REQA 2Z83A 2VP2A 3Q0EA 4NZPA 5DCYA 1MORA 1OBHA 1BE1A 2IZ6A 1QYXA 1FTQA 2WUDA 3C5EA 3FVQA 5DLPA 3UWKA 1OAOC 1R8QA 4NARA 1QO7A 3BT7A 2CFCA 5ISMA 3L8DA 5G0TA 4Y6GB 5FD8A 2Z4RA 1LKZA 4PSKA 3IBYA 3JWPA 4GYWA 3YASA 1SCUA 3NT4A 1LH0A 2XMQA 1YCFA 3KO8A 3QKTA 3HXOA 4WCFA 2VDQB 4KSCA 5AXAA 1L5NA 1DJLA 5IYZA 4FNAA 4NYMR 4IQ4A 4BWVA 4D56A 4TYNA 1WP4A 1W1IA 2CLSA 4HGRA 2JGRA 4UDXX 3QMVA 1B3RA 1TGVA 3IPLA 4M1EA 3TW8B 3V8QA 1EQ2A 4ER6A 3IQZA 1WPQA 1BWRA 3W2EA 3WBKA 4UUQA 3GEBA 3H86A 1YXMA 2IYRA 2ZRGA 1JKJA 2QI9C 4MV3A 5A62A 4YJGB 1RAAA 4W1SA 5KBYA 3I2KA 1ILEA 2F1KA 4FFMA 3EZLA 3MAAC 3OZEA 3GLFA 3DMNA 2ERXA 2GQ0A 3SYRA 1LW6E 5IP5A 5AJWA 2HIGA 3PFHA 4AYTA 2V96A 8ADHA 2O19A 4HQLA 5D5PA 3QF7A 2TMYA 3MCWA 1CUJA 3VU9A 1SHZA 4ZI2A 2BDTA 3RASA 5E6RA 2XMGA 2XVXA 4J90A 5CH3A 2ZUTA 4EUSA 3W5UA 1QHEA 2SHKA 1E8DA 2QL6A 3EZXA 3HZRA 1EYZA 4XCXA 5AHXA 1WP9A 1NJGA 2EW8A 4WD3A 3D5QA 1GFZA 1JSRA 3E9RA 4NC9A 3WWDA 1VL8A 4IDFA 4ARVA 2UUCB 2VDWA 1GPMA 1RWMA 3OBBA 3MWDB 1JPJA 2CNWD 4QFMA 5KUTA 1X13A 1SZDA 3ETLA 4RYLA 2AWOA 3DLCA 1JDJA 4G5XA 1HO3A 2P27A 4F2GA 1NW6A 4R9VA 2VJOA 3O3CA 1RPAA 2PSJA 4UATA 4D9EA 1QZUA 3H04A 4MROA 9MHTA 2M6SA 3RBAA 4E5NA 1T3SA 3HKDA 4QBIA 4TSFA 1C4WA 2OV1A 4ZC1A 3UV7A 3OQ6A 1TFRA 3ZY2A 1TJPB 1YQTA 2BUCA 2YJ5A 3MJSA 3N8DA 2QAJA 3GEMA 4MR8A 2VQEB 2EBFX 4XUEA 4TWAA 1FUUA 2PKQP 5J43A 1K6XA 4WCFC 2QORA 2H5IA 5ARBA 1L5HA 1DX6A 1ZEJA 3NVAA 3JWGA 1VKZA 4G4JA 2FSIA 3KSBC 3QTLA 2BBSA 2KBFA 4OFWA 3P0JA 2GNOA 4QWWA 2JIRA 3ZV7A 7YASA 2VQ6A 5FR2A 1ONSA 3PE4A 4WLVA 3PX3A 5AVOA 9LDTA 3DV0A 5JUWA 5DT9A 3IIEA 2IXFA 3ZU6A 2X0RA 4IDCA 1UINA 2BFCA 4RULA 3ZBPA 4X1YA 2RAVA 5HKBA 2IVFA 1SB9A 2JS7A 5DM2A 2QVCA 3PWTA 3UA4A 1M7GA 2I4IA 4G1FA 4ABTA 3R8FA 4TL9A 5KCMA 1KSFX 1FU7A 1HLPA 5BQPA 2BFPA 4MVJE 4M7OA 1O89A 3OVMA 1UXJA 4Q03A 2OO7A 3FSGA 5E38A 4PFJA 1MFZA 1UDCA 3O5AA 2BSXA 3OPVA 1Y98A 4Z3KA 2HCTA 2OMEA 4KN8A 1KS9A 4ZOCA 3AW9A 1DIRA 5LA6B 2YV1A 1MU0A 2WLTA 2ZBPA 3K6JA 5E1BA 4JI1B 3WWEA 1UZAA 3PPIA 4MVJD 3IDSA 1SZPA 4KYTA 2VT6A 4OP1A 5CXQA 1GYQA 2AN3A 3DL4A 4GKBA 3KQHA 1YGYA 4G0XA 4EIWA 1L9KA 1KYTA 1SA0B 1F0YA 1OYWA 1TC1A 3DFMA 2HA5A 3I0NA 5CVVA 3PFKA 5LCXA 4JI6B 4AF8A 5EJ8A 4OJNA 3EUEA 2XUZA 1TYCA 2ZRMA 3G5UA 3OTHA 2IPOA 4J0GA 2GD2A 5DRYA 1B14A 1QIFA 2G71A 1D1PA 3O6VA 4J75A 4XWAA 1V6AA 2FK7A 3D81A 3BXXA 5BOVA 4URWR 4FE3A 1KI8A 2ZBVA 3GRVA 3MAGA 2IDMA 3OIDA 4Z9XA 4E4RA 5MF6A 4RABA 1GOTA 1O97C 2VPTA 5ALKA 3WNZA 3FPCA 5T6MA 4E7OA 1BH6A 4WXPA 1KR5A 4D45A 4CDMA 1UBCA 4DA7A 3OJ0A 3MWJA 1VJRA 3CINA 3QFRA 1EFPA 3MMNA 3A1EA 3C8MA 2EZ4A 3NTQA 4AY4A 5THQA 4OQXA 1J22A 1SBZA 3ODGA 4H1HA 2JCXA 1YHZA 1TMGE 3DFIA 4EAQA 1A5AB 2OHJA 4QU8A 5EZQA 2NZ8A 3D5EA 1NAHA 3KCQA 3K70C 4H7JA 4DAEA 3ZLUA 3QP9A 2X6TA 4BFYA 4OG2A 5IM5A 1E0DA 4YAWA 1KQPA 1YB2A 3A4VA 3ZW9A 2CGEA 5AJUA 1GCAA 1NBAA 2DX7A 4M0EA 2YWDA 4UULA 3C74A 4B34A 3WNDA 4O0LA 5FI0B 1MV8A 5DTEA 4GMDA 4FE4A 4E5DA 4KFSA 4E1VA 4YCBA 4HDNB 3VM6A 1GKUB 2Q4TA 3KKEA 3DZHA 4OMFG 2PDAA 3P94A 3CLKA 3JQDA 3N58A 4R8MA 1S4MA 4GDFA 2BTQA 3OZVA 3AIIA 3EGEA 2ZKLA 1YFLA 4PQFA 2J9ZB 1RJ9A 5EWJA 5C0OE 1NDQA 1JKXA 3JZDA 3KCNA 2IC5A 4FW8A 3C6MA 4JWKA 5FWNA 5AOVA 1EFHA 2HA0A 8ATCA 2Z1MA 3R5TA 1OTHA 1VSBA 5G1PA 5FUYA 4R1QA 3ESYA 3CRQA 4DV6B 2BMFA 1W25A 3B5JA 3HCCA 2RG1A 4ZICA 3WGZA 3THXA 3OP1A 4CF7A 1EP3B 5FXMA 1Y1TA 3V6MA 4BEWA 5A4AA 4EJFA 5KSPA 4BUJA 3I4FA 3KWJA 4IVNA 4JLNA 3VRHA 1BGWA 2OXIA 4FKZA 2DSNA 3EPJA 2H29A 1WOMA 2OY0A 1DJMA 2HK9A 2NAFA 1MZVA 3D1LA 2F3TA 6REQB 3UAWA 4LTDA 2A1TR 5ETJA 3D8NA 4IDOA 5TR9A 2J32A 4FXOA 4TTQA 4P36A 1DAEA 2A0XA 2FN8A 3DT9A 3DE2X 4N9WA 3RUEA 4B0PA 1TM4E 2W6IA 3OQJA 4COKA 3D8SA 3HUUA 2QF7A 4BMOB 5JATA 3FOZA 1W44A 2P2SA 1JEJA 3QEMA 3WGJA 3FE2A 1FW6A 2O0MA 1G8MA 2M9MA 4I4NA 3DE0X 3E81A 3IUQA 5C1OA 3TXAA 1SY7A 2MSWA 1NBIA 4FGKA 1H0KA 2XXBA 3LFHA 3T3OA 4JT2A 2HRRA 2O6HA 5JZBA 1KDRA 2NUBA 3E9CA 1XDGA 4LHWA 2B8EA 4PIVA 1ESNA 4IRUB 5CK5A 1WCIA 4QO8A 4KIGA 4MWCA 5MFPA 1NWHA 2NV6A 1ZFNA 2R751 2ZRLA 3RS8A 2IZ0A 4IFBA 4NYMQ 1TJ5A 2I5PO 1OFHA 3D8HA 5KWIA 1I3MA 2X3FA 1DPFA 5A71A 3PXUA 3RAPR 2OCDA 2H3HA 3GGDA 1OAKA 1Q0ZA 5TXGA 2PRIA 3NDJA 4X7BA 5ENVA 1AHHA 1KEZA 4JR2A 4EABA 3DJYA 1R8XA 5FTKA 1JDSA 1I0LA 4RQBA 3KR2A 1KQGA 5DTJA 1QGDA 2W0SA 1JFFB 4ZQGA 3F5DA 4RPKA 2BKLA 3STXA 1VIDA 3L2OB 2C5FA 5HEKA 3L0CA 2P5YA 4M9SA 5D7BA 1QH1B 2ID7A 3NCTA 4FSDA 1Z2EA 5L6LB 4YROA 1D7OA 2HXGA 5IHXA 3E4CA 1HE1C 2YV3A 3SJZA 2YHUA 1R00A 4MS4A 4HH0A 1G9TA 2QRLA 4DXAA 3PWZA 2ZIXA 2AC4A 5HE8A 2FRXA 3M6VA 3MLAA 2IY7A 2ZJ7A 1Y6GA 1M1XB 4NNOA 4H3VA 1IHUA 2P6PA 5K09A 4K8RB 1GR0A 5LLSA 1QB8A 4UE2A 3QW2A 2PUWA 4ZEOA 1QH8A 1Q0QA 4HZIA 1N75A 3VTAA 2B83A 1EWRA 1O94D 4Q4JB 3SYNA 2XWJI 4QEDA 3AZOA 1IQPA 1Z6PA 1KYWA 1XZLA 2BMEA 1DIOB 4PTLA 3U0BA 2IYLD 2ZUWA 3TRFA 3ZQJA 4DUGD 2AKEA 4GP7A 5KNBD 3AEQB 2GVDC 1E2GA 5C46F 2QYHA 1QIDA 3DWFA 4LZAA 4JL6A 3V4SA 3VFDA 2XHEA 3ZZMA 3DZIA 1FDUA 4LDAA 3BHNA 2AK3A 4HNQA 4Q1BA 4DEVA 5F2EA 1SH7A 1XRSB 3VPHA 5T5QA 2WM8A 3I72A 4EFDA 2FKNA 5MGBA 3ZZ1A 4HX5A 3A6JA 5FFMA 4BJ1A 3ST7A 5C8YF 1RYMA 2HU7A 2QQGA 5JCJA 4F1WA 3BB3A 1WHTA 2KLBA 1J0CA 1NHGA 4DAOA 2B5WA 1JEAA 4J7XA 3EZ2A 1U28A 2AX3A 2QN2A 4A2QA 1T13A 3RR2A 1QO0D 5J4KA 4EGSA 3U6KA 3PF9A 1N8NA 2Z56A 1PZFA 2QZSA 4FNGA 2XEXA 1JP7A 3BEDA 2I4TA 4Z49A 3P9NA 3F6BX 1WDKA 3HSSA 3PHHA 1U3VA 3F49S 3MT9A 3QXHA 1MZPA 1UEIA 3T5BA 1W4LA 5KYXA 2JFHA 2F67A 4IIFA 3A06A 3RO7A 3QX3A 2P2GA 1XRPA 1QHYA 3ZU4A 2ZSBA 3QPDA 3WA7A 3A4LA 2AXNA 3ZE8A 4U6SA 1C9JA 2ZZNA 4KV7A 5EJ5A 2OBFA 2GJKA 5C81A 2EQAA 2Y67A 2NP6A 3QLJA 4B83A 4D79A 4N1AA 2EJWA 4J9VA 4UE6A 2AOUA 2WE8A 1SXQA 1SKBA 2VN8A 1Q7EA 4O33A 1L7MA 4PSCA 5BSEA 3LUCA 2YZGA 3LBNA 4BU1A 3RJMA 4MI6A 1XZFA 1W88A 4I6JA 1CEXA 1NN3A 1W4AA 1Y5MA 3ACCA 3F4BA 3G5AA 1Z28A 4GOLD 4ZQBA 2D0DA 3PNYA 1UMKA 2QRJA 1PGNA 1ORWA 4ND7A 2K4MA 4F6CA 3VR5A 3DCYA 4X24A 221PA 2CYAA 4PZUA 3PC8C 3QMPA 1KO4A 3A3PA 3PBKA 5I7AA 4GPIB 4REOA 5EXDA 3SEZA 1UR5A 2G82A 3ZZTA 5CXSA 2CCKA 5AJVB 1XZKA 2HU2A 4KGVA 3ZK8A 4YLYA 3KOXA 2FRDC 2XQIA 1VBKA 3GQBA 1GU0A 4ARZA 3AUAA 4NATA 1KGSA 5B3AA 3O1HB 5AW1A 4B40A 2F8SA 3RU9A 5DGDA 3UJ7A 5DP2A 3C6ZA 2FSVC 5K01A 3DUFA 2R6GA 4C4PA 9ATCA 1MNAA 3PHCA 1GZUA 4F2PA 1C1YA 1PIWA 1SXJA 3K5HA 3L7MA 5AHKA 3G89A 4LXHA 5H81A 4A2PA 3H6HA 4GOOD 3SZRA 2ZE5A 4OA5A 3TTYA 5JSUA 2QLJA 4WERA 1DEHA 2DHRA 4RXMA 1TQDA 3DW3X 3ABQB 2CV1A 3HXKA 2YWEA 1RQXA 4GNKA 4RTNA 4DY4A 3T7KA 3ZCVA 2ODWA 5CB4F 1ENOA 1XALA 1JIQA 4FBGA 1T9KA 3QA9A 5LBIA 1E7RA 4JOBA 4NQRA 2E87A 5TSDA 2O8EB 1EIWA 3QUAA 4Z1MD 1C3JA 2NQTA 3SQMA 4C5AA 3NHFA 4B74A 3EC7A 3V8VA 1Z16A 1F6DA 4G8DA 1V1MA 5HRUA 2X9LA 1HURA 3ECSA 3AZQA 5EMLA 7ADHA 3VQTA 1Y8CA 3W9UA 3SHOA 3GG9A 3P52A 2Z98A 3QA3E 1PWXA 4DQKA 2QRVA 5G4KB 3S6JA 2F7SA 1AC5A 2A9PA 4UZEA 4UCFA 1Y81A 4PN3A 1G63A 1PDOA 1OGJA 3IEXA 4IWNA 4N54A 3TVYA 2ZROA 4O2LA 3MRTA 4EY7A 1C3EA 3FYUC 3LYLA 4WHMA 3I0MA 4TKMA 3R75A 4NTZA 1A2OA 1BEZA 2YC2C 4OHUA 4PZAA 3SYLA 2G77B 2OUIA 2W2TA 3E48A 1H2XA 1U3WA 4OBWA 1ZVJA 3G0BA 3R76A 1QQ6A 5KHOC 2HSJA 2D62A 5KYWA 1X92A 1TZJA 1PZGA 4V1CB 4QGAA 3RWBA 1ECFA 4PPGA 3WI7A 4RTJA 2QPOA 2VJCA 2GJAA 2J9RA 4ODIA 3W8DA 3UGJA 3EJ6A 4I1YA 3OQ1A 4K1LA 4JX9A 5T57A 6AT1A 1XZ8A 5EWMB 4U2GA 9LDBA 1S5PA 1N0WA 1KI4A 1RI5A 1SBCA 2KI5A 2Q7XA 4HYTA 5EWLB 4ER0A 1U5AA 4UHCA 5F9HA 3G0CA 1YF3A 5CH8A 3L05A 3QBVA 3D9QX 3F2VA 4MQ6A 2A33A 3BF8A 1LBIA 3AWIA 4KUGA 1ULAA 4W6QA 5K51A 4GZLA 3W4KA 3C5VA 3E23A 2FWAA 2YN4A 1W75A 4M76B 4M1KA 4H7FA 1GN8A 4MRMA 4QBKA 2RI1A 1NY6A 4BUCA 1L4YA 3AT1A 1FFYA 1S7CA 3MT7A 3FPEA 4P82A 2GVZC 1ISSA 2Q8PA 3A1CA 4EGAA 4MS3B 1KSHA 4UVIA 4PR0A 1ZOSA 4Y2GA 2R4TA 2I4RA 2JBAA 2AMJA 3I9JA 3QPVA 4G0MA 2BONA 4ZZ1A 2NP7A 1NBOA 3N6VA 1ZM3A 4G0QA 4MV5A 3N2LA 5K45A 2GYYA 2XDQA 3BTOA 2A58A 2NNWB 3WLKX 4E14A 2PE5A 1TK2A 1UMDB 3KUXA 3OKCA 4QFDA 4O3FA 2P68A 2QRUA 2AI2A 1IJFA 4L4RA 1N2HA 3SVLA 3URKA 1KFJB 3F6PA 3TE6A 2BFDB 1MB3A 4OQPA 4AX8A 4ZGBA 4BQRA 5A4IS 2OZKA 4G0WA 3JAKB 4FJ1A 4HB3A 2XB2A 2F59A 2CZGA 3TDNA 2AN9A 4WSOA 1U99A 2Q3CA 3IV9A 3C8HA 5G41A 1L6RA 1GQOA 4X93A 4C21A 4HOYA 3EEOA 2BH9A 5AT1A 2FETA 3ADPA 1GCGA 3CR8A 2GJ8A 1EGHA 1IE3A 3EVTA 3OO0A 4AKSA 4ZO7A 4J4HA 4DMCA 1JVBA 1ULHA 2H57A 1M0WA 1SKAA 3NBKA 5EJIA 3BILA 3ZDEA 5I01A 1CJBA 5CLGA 2PRJA 3CFYA 4N47A 4LI0A 3LH5A 2E55A 4B82A 1JA9A 4GGPA 5K6AC 4DNXA 3SJUA 2X9NA 1A8SA 1KZGB 3EC2A 3HCRA 3RT7A 2Y92A 4YWJA 4H17A 4UHJA 3V7FA 1EZ1A 3BXHA 3V7YA 1C3LA 3RYCB 2O3UA 2P7HA 1P33A 1A9QA 4TX1A 5EIXA 5I7UA 3WZMA 2BGGA 2ZYAA 1W85B 3BD8A 2AJBA 4F06A 3LKZA 1LBSA 1KZ6A 1X80B 2OGTA 3OZXA 5BT8A 5KVAA 1H85A 3P8ZA 1T4MA 1FXUA 4D82A 5FUBA 1P1RA 4LJ6A 1B6RA 4FKMA 4MLCA 4FFLA 5FFFA 4G01B 3T7DA 4AY3A 4OX9Y 4V03A 5DNDA 2XZTA 1E1CB 3AF2A 4N5HX 3SDZA 3G8CA 4ENRA 1Y9EA 3CIFA 5CFOA 1T1GA 1LSUA 5HRAA 3O74A 4YR7A 1TAQA 1PJTA 3IA7A 1G6HA 2F1JA 2H4HA 3NATA 1ULTA 2D1SA 2R2GA 1YOBA 3LC0A 1SU8A 1JN0A 2FZ4A 3F6SA 1TQ4A 3ICCA 4NABA 4F72A 3MZ0A 5GONF 1R10A 2NSDA 3KPWA 2OT3B 5CT4A 1ZMRA 1P2VA 2JEZA 4BGEA 1E3SA 4PG8A 2MT9A 3KJQA 1M6HA 4HNGA 4UNIA 5KSYA 1U2GA 2NUTB 5IBRA 4YAUA 4KX3A 3TQOA 4MYTA 3CG0A 3PJRA 3SK0A 4KOAA 1N7HA 2W6OA 1PBTA 1P3JA 4J3NA 1WEHA 3ETEA 4FGSA 4U39A 1ORHA 1MJGM 3X1YA 4BX2A 4EA8A 4F7WA 4NX2A 3ZTTA 3OJOA 1JU9A 3GGGA 4LXGA 4NE9A 4DC9A 1CZNA 1JAZA 1WA5A 3HY3A 4R1MA 1EE9A 1P6QA 1A2BA 1MX5A 2R48A 4QUGA 5EMHA 4X85A 2R7AA 3PQ8A 3QFTA 4K6GA 4C30A 3SOPA 2QW0X 2YASA 4YRQA 2FPGA 3A1UA 2J4CA 3UUGA 4JLVA 3ILYA 1D2HA 4G84A 3HUEA 1FQKA 1NUHA 1G42A 1JBKA 4CMJA 4I36A 4DCGA 3W7VA 1B73A 1YTLA 2TRSB 3BHJA 2AEFA 4HEA6 1ZJJA 2A0YA 1NVUQ 4FGJA 4F21A 1UT6A 3DEZA 4EJ2A 4RTSA 3TOXA 2ZBUA 3PLRA 4FD2A 3RK1A 3ZC3A 3WLLA 3LVBA 3RUCA 4LECA 4GUDA 2ODQA 2XRYA 3D6MA 1DBQA 2XD9A 4QQKA 1KOFA 2HV8A 2OVFA 3IHTA 2IY9A 2NO4A 3RTBA 4CKEA 2HSDA 1NUAA 4AJ2A 3UWDA 2G8LA 3DLHA 3FN4A 4YJKA 2GFHA 3ZHOA 4F4CA 3O82A 5DGCA 1HQKA 3KPYA 5ALIA 4BNZA 3VPBA 3O3MB 3I62A 1NI4A 4AZSA 3JX9A 2G1KA 4HVTA 2NLOA 3KD2A 5KTOA 3ROKA 2PSSA 4IIVA 5KOJB 4P4NA 1FTGA 2PQMA 3QVJA 4Y98A 5A7FA 1E2NA 2P6OA 1S9DA 3OLZA 1ANKA 4LY6A 5BMOA 3MCVA 4Q01A 3C3DA 2XR1A 3QJGA 3ADKA 4JC4A 1JG4A 4BX3A 4D0GA 2NPIA 2YQZA 3BYZA 2GI4A 1MJGA 2AR9A 4BAZA 4BO7A 2PQ0A 1EVIA 5GINE 2ZG6A 5B12A 5HNKA 1UKCA 4N03A 4XWGA 1Y8ZA 4NFLA 2P2CA 4B47A 4FR5A 4GP6A 4L9WA 1YL5A 4IILA 5SZIA 1WDWB 4D4HA 3RB8A 1RCUA 1JHYA 1SGWA 1U4SA 1VMKA 4JD5A 1CJMA 4TV9A 3SC4A 3VU0A 1Z0DA 4GQBA 4ALMA 2D2VA 3RD5A 1WW3A 5LZ5A 3B1KA 2ZBQA 3KE9A 1L5WA 1GP2A 1P3DA 2FPOA 2JIBA 5E6SA 4AP5A 5BMVF 4JJ7A 3OZ7A 1Z22A 5GZ3A 1P7YA 4DRZA 1NPYA 4BGUA 1FZTA 5DMXA 3KXLA 4MQEA 2VPYA 2W37A 4IMJB 4EG3A 2ZCJA 1E2DA 3CRZA 3A4YA 1ISHA 1SEVA 3LFUA 4W7IA 4JDPA 2XMZA 5D5QA 3WGNA 2P62A 4A0HA 1S3FA 1YMUA 2IRWA 3BDVA 2CLKB 3TOVA 5DKFA 3FD8A 4LCBA 3U3KA 4CGZA 1M1YE 4NH0A 4CETA 4MTCA 1I3LA 4V38A 4EYKA 2RI0A 4NPAA 2QDXA 2JAPA 1N9GA 3CU5A 1NKVA 1GUFA 3LLMA 4M0LA 4P3YA 4C5BA 2X7HA 4A9AA 1IK6A 4OYYA 1I7NA 3AI2A 3UV3A 4Q15A 2DPGA 2ZS8A 3FUWA 3COSA 1B74A 2C04A 1QP7A 4KXYA 1D2EA 1TU0A 1EDOA 3F8TA 5F3WB 5LQNA 2AC7A 4OQYA 2YOFA 3QUSA 3V4LA 4LYDA 3BB4A 3DYBA 1E0KA 1TKRA 1H66A 2DJ5A 1YA4A 2OZVA 2FN4A 3DO8A 3EZ9A 1HE5A 2D00A 1H6DA 4F4UA 1R0ZA 4NMWA 1L1FA 4UAJA 3DM5A 4UEJA 4QYWA 3GELA 4TN5A 3P32A 1IB6A 3A3YA 3GHHA 4C01A 1PV2A 4MO9A 3SKXA 2IF2A 2OFOA 3UC9A 2R6JA 2Q6LA 1AUPA 1DMRA 3HWX1 4GMHA 1FFAA 2GEKA 2PH1A 2WV7A 2FW6A 3S2ZA 1VMEA 2C8LA 1T1RA 3X1DA 5I4IA 3QOYA 1CK4A 1VG0B 4JKOA 5B5SA 1O3YA 4V24A 1I3OA 3UC5A 4A0QA 2FSSA 1Q7RA 1H05A 1K06A 4M98A 1YJ8A 3L4JA 2H16A 2OG1A 1NBEA 1R8SA 1XRRA 2MR5A 4KBGA 4P53A 3FF4A 3SE0A 4IZIA 4QARA 1L7RA 3AIMA 4JMPA 3M6LA 4UXIA 1N78A 4HSEA 1Z68A 5SYMA 2ZYIA 2FUNB 3WISA 2FDRA 1HTWA 3DQZA 5AP9A 1Z47A 1HFEL 3V55A 3WYAA 3L7AA 1IBMB 2ZPTX 4Q39A 1KVQA 2PCLA 2QLFA 4FQ5A 5DSXA 4XYGA 1NVEA 1X8LA 2V6FA 1NXVA 2QE7D 4XSGA 2VC2B 3KXDA 3P26A 4WCVA 3L7BA 4ITRC 1ZD2P 4E88A 1XZDA 3DMPA 3OT5A 1RQPA 2BI8A 4IUDS 3H99A 3WK4A 4CEJB 1NRJB 1GLVA 5EP1A 2NTVA 4E5UA 1HNWB 3ELUA 4O8CA 1Z3IX 1T0HB 3H2KA 1P5FA 2VAVA 1GGEA 3DBOB 3EIWA 4UAUA 2O7QA 2RJ3A 1U0GA 3DWGA 4OI2A 4OLBA 4DLNA 4EYGA 2X86A 4TKUB 4F9TA 5JRDS 2VL7A 4AUMA 4LBVA 1V5EA 2W0MA 3IE1A 3L6EA 1G6OA 1JLLB 3KJZA 4RKRA 1RJFA 2ENWA 2D5BA 3DBRB 2IDJA 3DOOA 1SBYA 4EHBA 1OLUB 2W2KB 1Z5PA 5IF3A 2QGZA 2QWXA 2QY6A 3CTMA 1AZWA 1PWZA 2JLUA 1MAHA 4BKOA 1G8KA 2JDID 1NR1A 1RAHA 4HAXA 2FFBA 2FLWA 1LLDA 3B3JA 3VSEA 1KIFA 4MUEA 1WS6A 2WWRA 4FFVA 3WX0A 6ABPA 1CIJA 2J3QA 4TUYF 4B5LA 2BYTA 4JBNA 1U8FO 2VATA 3QTTA 1RWOA 1MQSA 3MJEA 5AW8A 3BXOA 2ILTA 3NHUA 3CO5A 3OTIA 3L4EA 1CV2A 3MELA 1P7VA 5AKGA 4BNKA 1PEAA 3I12A 4JBGA 2DOKA 4TSRA 3R5FA 2ECFA 3TRJA 4MHOA 3U9SA 2FAXA 4BY9E 1P9OA 1GNQA 1PKEA 2AW3A 3OEHA 5C8YA 2ZIVB 3ORHA 1Z5GA 1I3NA 1VYHA 2ZVJA 5EXSA 4B7CA 1ICEA 1R0SA 1WDMA 4GWKA 2W8BB 3IE0A 5A0TA 1T6BY 2YYSA 3KBOA 4TYYA 3MWLA 3SD7A 1N32B 3THOA 1E3WA 5CT8A 5K0LA 1OJ7A 3CIOA 2QTCA 2X6QA 1FY2A 1VGQA 3EOZA 3PT9A 3DLAA 3KIPA 2WM3A 2XQVA 4URHA 5DF1A 5LZ8A 4B2YA 3U7FB 4GPTA 1XGKA 3T0IA 5CCBA 3JZMA 5DT2A 2GM3A 1NJ2A 1HWYA 3MIIA 1N2JA 3M4ZA 1YFJA 2ZQZA 3DKKA 4L5YA 5C52B 4B6EA 1G8GA 2H1CA 4C43A 2XOKA 1EUDA 1X9GA 3JQBC 1GO2A 2OZLA 3GCXA 3LE8A 4RJIA 4TMKA 5E3JA 4F2WA 2C88A 4X8HA 2O07A 4BFWA 2C0QA 1HK7A 3NGMA 4IG4A 4B3DA 1FFCA 1YZFA 2HPAA 2PWZA 2VP4A 1XKLA 3IP7A 3TMAA 4IP0A 4YJHA 2B7LA 2O3JA 1H22A 1HKHA 4Z3DA 1KJNA 2I99A 2B2CA 2GB4A 3ANMA 1RXWA 4X90A 2G6TA 3ETHA 4HQRA 1XTRA 4L5AA 1GR1A 2WT9A 2Z95A 2VAXA 3DHYA 3PD1A 4JEHA 3MJCA 1Z29A 5KYYA 3ZHXA 3IGFA 1JNXX 4RY0A 2HLNA 4AN1A 4CIWA 5JYDA 3ZS8A 2EFHB 4PLCA 1AKTA 1M2VB 4HC4A 3PUYA 3T9FA 1IXYA 2C2XA 1C8BA 3GG2A 1E4EA 4HL6A 5DM4A 4OQDA 3IAXA 3ZS9A 3NV9A 1D3AA 2WF8A 4KQMA 4R6WA 1DQPA 2VDVE 4P54A 4OATA 1K0UA 1RQRA 4KK3A 3UTDA 4YC7A 4ENWA 3CW9A 4KFCA 5CBKA 3EVBA 5LOVA 2WJVA 3PEUA 4JEIA 2D4HA 4FYXA 1YJ5A 2E18A 2GH1A 4OQMA 1F7UA 4Z99A 3FSJX 4B4WA 4JB2A 4LXIA 5GAJA 4BC0A 3EF0A 4XX0A 2AXPA 5CYFA 3SJ7A 1ZKDA 1CR6A 1AV7A 4FD3A 1P6UA 2XCSB 3SZOA 3RAEC 1UKVY 2H0RA 1MEOA 3C3AA 4HDQB 3X43A 3U0VA 1AK9A 1B8OA 2AOWA 3CH5A 1PTJC 1CD5A 1MRNA 2XECA 4Y2UA 1GTZA 4CEIA 1C7RA 1CYEA 2GWRA 2FMIA 3JYNA 3KLPX 1B1CA 1VFPA 1EA7A 3V32A 2OC4A 2XXAB 4MRSA 1X15A 3C70A 1KH1A 4Q4CA 2WWWA 4PX3A 2IA5A 4ZT7A 3UQZA 3GDFA 1QVRA 2JFYA 4WOCA 4E11A 5LN1A 3GLFE 1G0OA 4UHEA 5HOQA 2PJRA 1JLHA 2XV1A 1E2IA 4TTJA 3HXTA 1PJQA 4LQLA 3QWHA 5AOAA 1MJFA 1ZU4A 1ZP6A 1VPDA 3IHLA 5FNVF 4Q1AA 5FPPA 5HBRA 3EFOA 4KMRA 2CF6A 5JQGB 1XPUA 3QZUA 5ES3A 4WEOA 1CUAA 2QRQA 1I8TA 1CY0A 1YCDA 2FJPA 2RC5A 3GEEA 3KU1A 3AFOA 3LOPA 3O1LA 1Y7IA 2WG0A 4O2BB 4RK1A 4P38A 4M1WA 1A71A 3VNQA 3JQ6A 1GAQA 3D43A 3AF5A 5B36A 2WWYA 2JFOA 5TEWA 3WYCA 4R84A 2HA7A 3JWJA 1ZDMA 2IW3A 3MJVA 2O0LA 3SG0A 4EHIA 4L6IA 3ZD8A 4F9GA 1KK0A 4LX8A 2A6PA 3D64A 2Z3WA 1PJ2A 5LP1A 1IVSA 1TZ2A 3K94A 2GK6A 3QVXA 1OTYA 1YVDA 2QG9A 1HV8A 3DDWA 2HIHA 3NZEA 2YBDA 2YHIB 4HNSA 3TVTA 2CXXA 3VSAA 3RFXA 2FWJA 1V5GA 2PHZA 5T3YA 4OQFA 5DWQA 3CWCA 1WU7A 1XLUA 1HUQA 1L3IA 1NNLA 2OFXA 2PNFA 4IJUA 5KPJA 1I14A 1D4OA 4M99A 2QX9A 4FEAA 4TSFD 3PWSA 4HDRA 2PLNA 3W5DA 2O5RA 4IHAA 5DOZA 1JXMA 1U0RA 2WJPA 3B1WA 3DVAA 2XIJA 1WCYA 2PJDA 3GAMA 4QXPA 5ESDA 4R9SA 1TIPA 1I5OA 2W22A 2G28A 5CNMA 1Y6RA 4KFTA 1RBQA 2NPFA 1W0JD 2JFBA 2WIGA 2ZXFA 1K5GA 1VECA 3TG8A 3WDSA 1M1NA 2PUFA 3EVZA 2VRNA 1NGSA 2PLAA 3IVXA 3RYFA 4I8IA 5CFPA 4P1ZA 5JVDF 1Z4OA 3W0LB 2R8EA 2ZUFA 1D07A 3F9IA 4X62B 4OB6A 5IJ9A 1J1UA 1CIPA 4FMBB 1GD1O 4EA6A 3GDOA 4JFRA 3GFQA 2XEDA 4C7OA 3UN1A 1XD2B 5JDIA 1KEEA 3EBLA 3GZJA 3KOYA 4LE0A 3ZD9A 3U7RA 5A4JA 3FOFC 2R66A 2A1UA 2CHUA 1QVZA 4Y30A 3TD9A 4ZYLA 4ZOQI 3ESAA 1T4CA 4LNUB 3RFVA 4QNNA 2VNKA 2I3AA 3DFUA 1P0MA 2HQOA 1NTOA 1P1JA 3WKBA 1C4XA 2X0KA 3DB2A 2OCKA 2DBYA 3ENVA 1W48A 1UBEA 1CERA 3PFFA 4L8GA 4RY9A 2RKBA 3VDQA 2RD2A 2DEUA 4E31A 5CFRA 5AKJA 1YS4A 3HN6A 1IJEA 1RWVA 5G2OA 1FMCA 1C9MA 4JXJA 3TAHA 3OETA 3QUBA 3CHYA 4CV0A 3LW8A 2GZ1A 1AXRA 4IDDA 1FZQA 2XCOA 5THXA 2R00A 4KPGA 2HQ1A 1V41E 2Q2WA 2L42A 2V7QD 1MMFB 1VPLA 3O95A 3UFXB 9ABPA 2YV2A 2HA4A 5DTIA 1KI2A 1U7OA 1VL1A 4OHPA 2YWJA 3DKPA 1QMPA 2FW1A 2HJ9A 2CYCA 4PVDA 4BMZA 3SI7A 2E89A 3A6ZA 4UM9D 5B7PA 3KSAC 5FV7A 3AO0B 4EPVA 5F9FA 1O96A 5JWOA 2CNOA 4BO5A 2Z8YM 3AL2A 2ZM6B 4KR7A 1QG0A 5SICE 4HLUA 4AUEA 4CCYB 5A3JA 1CJTC 2I7CA 4R1NA 4I4LA 1SNYA 1K8RA 4J16A 5IT4A 2ZIEA 1TTTA 5A5VA 4FMDB 4BLOA 5K5EA 4UFPA 4NZNA 4U4AA 1ZH6A 3UMYA 1PR1A 3IMKA 1N6OA 3GL9A 3LY5A 4J6FA 2X4GA 4R2LA 3P0IA 3KVRA 2HMSA 5JS7A 1L5KA 1L8OA 4IJVA 2PMFA 1DWOA 1C3VA 3N76A 3PDWA 4LUCA 5DK6A 3ZXIA 4A7PA 2NAPA 1O6FA 2EYUA 3PS9A 2GEJA 3TG2A 4NENB 4ZYUA 4ZT5A 1KOLA 3HGMA 4MMYB 2CMDA 5M3BA 5GONA 1L5GB 1HRDA 1T6NA 4KDCA 3EIHA 2B61A 5E9WA 3GH3A 3W2HA 1YQXA 3D0RA 3MRSA 4XVUA 1XDZA 1I7LA 3IVAA 5AW0A 4HUQA