4HB3A

Crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb3A00
3EIEA 2ZTSA 2JLRA 2P67A 4KFUA 3EZ7A 3QENA 1L7VC 4IXMA 5M04A 3K53A 5J4LA 1E9CA 1ZP6A 2ZRHA 2ECKA 1G4AE 4XOIA 3TH5A 4LV8B 3CKLA 4YXWA 1CRPA 4FN5A 1Z6AA 1P3JA 4RY2A 3SJBA 3SJCA 3OIVA 2PX0A 3EARA 1GRQA 4CF7A 1XD2A 4RFSB 1OH8A 4NL4H 5FBQB 1Z08A 4BECA 4IEEA 3O8CA 2GZDA 2CK3D 2A30A 4MDEA 3DM9B 1KO7A 3U6KA 1FX0B 2ZS9A 1TU4A 5J4VA 1XTJA 3T5GA 1Z83A 2LCFA 4C4PA 2GEVA 3KZ1E 2J1LA 5C4MA 1F5NA 1HTWA 4JL6A 2YKGA 1KI4A 3THOA 1TF7A 3WHKA 1DPFA 1RYFA 1E2FA 2QPOA 4GZLA 2BBSA 1B0UA 1HURA 1S96A 3OIYA 4P31A 4XWOA 5HKKD 1TUEA 2OSBA 2WJHA 8OHMA 1JEDA 3BAFA 3D3QA 1U81A 2ZJYA 1E99A 1TL7C 1FUKA 2FH5B 4B75A 2ZVPX 3K1JA 4M9SA 4LCBA 4B3BA 3LDAA 2B7BA 4G5QA 3W5JA 4KU4A 2ZJAA 3TVDA 5C46F 2BMJA 2GXSA 3FGNA 3DEFA 4BFUA 1SVMA 4N0EA 4G0NA 3WYAA 2ZSFA 3TAHA 4NZYA 3U7FB 5B64A 1KZ7B 2QTVB 1ZVQA 2WKQA 4QHSA 3GLIA 4X8LA 3OE7A 1GRNA 3UIEA 3AV0B 2R65A 2DPXA 3RRYA 1ESNA 1ESMA 2D06A 3T34A 4A36A 3REGA 4Q4HA 2GCOA 2WWFA 2D7DA 1R0WA 1CBUA 1SVIA 5HPYB 4BPBA 3CH4B 1W4RA 5KDDA 3RRMA 2JA1A 3LBHA 3SNHA 4OBEA 2J59A 4HLUC 2A5JA 4M21A 5E7IA 4OHVA 2RGNA 2FSHA 2REXB 1IHUA 2EFDB 3CLVA 5JEDA 1N6PA 4LHVA 2BBOA 3ND8A 1IY2A 1KY3A 3FHOA 4M1WA 1DAMA 3KXKA 3AVXA 2VP4A 3QF7A 2ZSAA 4FD2A 3BBPA 4Q21A 1JPNA 4WXRA 4QBIA 3BS4A 4NYJQ 1P2VA 5JWHA 3GLIB 2IS1A 3QPUA 4Q4LA 1N5IA 4UXJA 2CE2X 1G5RA 3NHBA 4N1AA 5HE8A 2VL7A 1KSJA 2CMKA 1ZU4A 3BRWD 5JCZA 2IYRA 1OHHA 1ZNZA 2MMCA 4RSGA 1Z29A 2J0SA 4Q9KA 3I4LA 3QXCA 3A1SA 3UMRA 1R6BX 2QE7A 2MSEB 4QXAA 3TGPA 1N5KA 3L0IB 1HYQA 3K9GA 3RS2A 3G82C 3E5HA 3D8BA 5TARA 2CEAA 4P33A 3DZ8A 4NKRA 1A5TA 4EFMA 4MGKR 4A8JA 5GJCA 4LHYA 4ZO4A 1E2JA 1TEVA 2WOOA 1R10A 2WWXA 3TNFA 5KSPA 4R71A 1IXZA 1FMLA 2ZRPA 1TEXA 3A8TA 2GBLC 1IAQA 2AD5A 1JAIA 4OI1A 3KKQA 4F7WA 3L2OB 3WYGA 2QRZA 1M7GA 1P2SA 2ERYA 4B2PA 1S3GA 2P65A 3NH6A 4KLZA 1UKZA 5L8VA 1IONA 2GJSA 1M6NA 1WCV1 1DAGA 4IDOA 1FOEB 4KVGA 2P6NA 3CH5A 4M1OA 1KJZA 2R6AA 4WVFA 4B48A 3QNUA 1G64A 1YR7A 1KDTA 3AGPA 4HAXA 2FDCA 3Q5EA 4YQFA 5FBWB 2ZI5A 1P9RA 1HV8A 5FFMA 2ZI7A 4Q1CA 1NLYA 4M1KA 1Q1EA 3HYRA 2WTUA 3SBEA 1ZNXA 2XITA 1GL6A 3IQWA 3TW8B 2FX3A 2FZ4A 2CL0X 1SKYB 1M8PA 3BORA 1II8B 3V00A 1NN0A 1YU9A 2OHFA 2KJQA 2ASEA 1ANKA 2CVFA 4B3CA 4Z1MD 4MGZR 1HQYE 4Q1BA 2XGJA 1I4LD 1RZ3A 4B33A 4A6XA 4Q1EA 2QG6A 4ESVA 1YVDA 3O47A 1OB2A 4UXHA 4DDUA 1UKVY 3ZGXA 3EZ9A 1AQYA 1O87A 1W1WA 1XNJA 3NBZC 3FHCB 4DIEA 3EX7C 4HUTA 5JCPA 3NTUA 3B78A 3NHAA 3SBDA 4CEHB 3CRMA 3SYKA 2EW1A 3FHTA 2HV8A 2WKPA 1VTKA 3EC1A 1OE0A 3CF6R 5LD2C 4B71A 3BE4A 5TDHA 3K70B 1KK2A 1KSHA 2JJ2A 2ZJOA 5IK2D 5EUQB 4EJSB 3RHFA 5DI9A 1SQ5A 2Q6TA 1G3QA 4L5BA 4BLQA 4JL8A 3ICEA 2H7VA 5G53C 3ADKA 4OQNA 2R6FA 2XSZA 3THYB 3IHWA 2BJWA 2AR7A 2IXEA 2XXAB 3RS4A 4RZUA 2RGGA 2G0TA 1SVLA 4OKSA 3GJ7A 3B9PA 2DFTA 4G5GA 1F48A 3AVOA 3NVAA 2PBRA 1UKYA 4HYYA 3QKTA 2G77B 3AF3A 3HU3A 3T35A 2WWHA 2WJVA 1E9RA 1F2TA 3A1TA 5L3RA 4DSUA 4ZPXA 1OKKA 3GCGA 2N46A 4Z51A 4RD0A 3KUCA 3MD0A 1QZXA 4JYBA 1LF5A 1F6BA 1ZMXA 4JVLA 4RKEA 3TVTA 3W34A 3ZIAA 5LD2B 5EP4A 4IVRA 4KBGA 2PZFA 2I3BA 2FE4A 4HI0E 2CNWA 2BM1A 4V0OA 1KOFA 1ETUA 4AKEA 1A2BA 4IDQA 4LI0A 1QRAA 2F43A 2NTYC 4YDHB 2ORVA 5B58C 4BRUA 2VO1A 5K8LA 1BIFA 4DDTA 4Q4JB 5TVKA 1KI8A 3LQRA 4B2LA 3ADBA 1WBDA 2PJRA 2LKCA 2WZQA 2ZI6A 5DYIA 5TXGA 4YDSA 3K9LA 5FBVB 1Z2AA 2VSXA 1GNPA 1VIAA 4D80A 5J4HA 1XCPA 4B2IA 1GSIA 3F3YA 1EFTA 3DZDA 5JBQA 3SYLA 1CEEA 3B2EA 4CEIA 1J90A 1DO2A 3SEAA 4CEIB 3U61B 4M1MA 2XB2A 2R6CA 1QHNA 2QPAA 4FWIB 4HDCA 4LBVA 5GJBA 1NLZA 5F9HA 2R2AA 4KBFA 2ZUDA 4R2HA 4XTCS 4DB2A 1KAGA 5G41A 4GOKA 4M1TA 1W44A 4HB3A 2XZOA 2XXAA 4O0MA 1VMAA 3MGCA 4G5OA 3CPHA 4HLDA 3GJ4A 4BLOA 1R0YA 1NBMD 4JBXA 2CCJA 1IBRA 4C7OB 2EFCB 2ZR9A 1PJRA 2YC2C 1Q12A 4YONB 1XZQA 3QBTA 3QQ5A 3PUWA 1E4YA 4D4KA 3C14C 5CIWA 4MUAA 3LW8A 4S2EA 1SGWA 2NO0A 4LSGA 3RC3A 2JASA 2GKSA 4Z8XA 3A4MA 4C0AC 3X1XA 1KO8A 4Q1DA 1Q21A 2LWIA 2F1HA 3IBGA 3RAPR 2V8OA 2IYZA 3KQNA 1JJVA 5D3QA 4TN1A 3WP0A 1B23P 1YRBA 1SHZA 2VLIA 2WKRA 2F6RA 1WF3A 3JZMA 4B6FA 5KO2A 5DLQC 4PZZA 4I4LA 3MRSA 1D9ZA 1IN4A 1OFTA 3C4JA 1AK2A 5JWOA 2FFQA 4MKHA 1RVDA 4XWKA 1MRNA 3AF2A 1HH4A 2JLUA 1LTQA 3FMPB 4PXAA 4EPVA 3PG5A 4KSCA 4TYPA 4A82A 1KDPA 1KMQA 2KI5A 3GJ5A 4GOXA 1JQLB 4HZIA 3QKSA 3NG1A 5JHHB 1UJ2A 2F9LA 1XEXB 2W6IA 3SU8A 4BGDA 2C5LA 3M4YA 2BBTA 3SS8A 2C8VA 2OUKA 4G01B 2ZE8A 4WOPA 4NONA 4LJ6A 3LX5A 3TR0A 2CHVA 4JT4A 1G17A 5E7JA 1N6NA 1NMZA 2NOAA 1GAJA 1ZJ6A 2GHIA 2YC4C 4LBZA 4PPGA 1IJFA 5BN4A 2IHYA 3O8BA 3HR7A 1CU1A 4DEYA 4JZKA 4WIAA 1KSGA 4ASUD 2KSQA 4BZQA 4KV9A 1G19A 1IN6A 4II7A 2QEQA 3QE0A 2P0EA 3MJRA 4Z8YA 1R8QA 1FZQA 4EKDA 5FOSA 4Q9IA 3THXA 3VR6A 4V02A 3OEHA 2OEPA 4D4JA 3DOEA 4R7ZA 4NU0A 1QHHB 1UF9A 3CIOA 3DHWC 4GOJA 2FEMA 1J7KA 1F2UB 1G9XA 4NCJA 4U02A 4ACBA 4BLTA 3TUIC 1X8JA 3T15A 5CITA 5FPKA 4JSYA 1Z6YA 4JLBA 3UANA 1KI7A 4DLYA 4KXFB 4Y0VA 2JJ8A 4FI3C 2GZAA 4NE2A 5HZKA 4A2PA 3W8RA 3T06B 2FN4A 2J3EA 4FW9A 2BV3A 4K46A 4LBWA 4FMBB 1E79D 1ZNYA 3T5DA 1Z0DA 4YMTA 3AVTA 1Z0AA 3FWYA 5EE9A 1E2GA 621PA 1CR2A 4RZ3A 4AG5A 5KSYA 3QG1A 1JR3A 2IC5A 1CJUC 2PEZA 2ZPTX 3PEYA 4Q5IA 1QF9A 4HB4A 4X8OA 3IHLA 3MMPA 4POAA 3CNNA 4BE7B 2QENA 2PZEA 3UWOA 4X8HA 2ZRBA 3IPYA 4YMWA 1VECA 4B32A 3SDZA 4B34A 5CB8A 2GESA 5EP3A 4QC2A 5F2EA 4TYNA 2IEYA 3CB4A 3LBIA 4RFVA 1NVVR 1US8B 4DSTA 2D62A 2QSYA 4WAUA 1JXMA 1I2DA 1Z63A 1XD2B 4RFSA 1XPOA 3GLGE 3ZH9B 4E07A 5LB4A 2WICA 1HA3A 3AEZA 4JSTA 2QMUA 4C0LA 5A5GA 1CF4A 1OHHD 3CF0A 4UNNA 3WMFA 1OXSC 2QP9X 3L8YA 4JLJA 1OF1A 2YWFA 3KTAB 1CJMA 2GRJA 1G7CA 4JVMA 3U2QA 3QI2A 2EQBA 2OV2A 3V4RA 2IK8A 3IIKA 3DL0A 1Z0FA 3JZAA 2XJ9A 5FPSA 3KB2A 2G88A 2BC9A 4Q7LA 3RVBA 4K8OA 3FKSD 2VHQA 2IS4A 2FA9A 2WVJA 1LB1B 3FKQA 3BOSA 1K5GA 4KAXA 3Q72A 1C9KA 2YOHA 3O8RA 3LAWA 1COWA 3X1DA 3N2EA 1RW4A 1N5LA 3VU9A 1P60A 3GP8A 4JLPA 4LJ4A 5L3QB 1ZC4A 3H0KA 4FMCF 4I81A 5DSZA 4A1FA 5EE3A 3BWDD 3REFA 4D2IA 2YOFA 1E4VA 1DG1G 4PQRA 4CYMA 4IDHA 3MWLA 2WWWA 5EQTA 2FPMA 3KJHA 2A5GA 5JJIA 4M9QA 2XZLA 1Q3HA 1XJQA 3IEUA 3BC1A 3I3SR 1A7JA 1G8HA 2QI9C 4OQXA 4Q9HA 4GBMA 1NVUQ 5LBIA 5JWRA 2XX3A 3VR2A 1P61B 4V0NA 5AWFC 2JLXA 2RGCA 4HZUB 4MQBA 4HZUA 3IO3A 4P4TA 2OBLA 1W36B 4MGIR 2V1UA 4OL0A 1MO4A 4HEJA 2Q9BA 4TMTA 4PAOA 4DIDA 1EK0A 1R0ZA 3BGWA 4KITB 4PC1A 4RKFA 3ZD6A 1K8RA 1F3OA 5TB5A 1DS6A 3ZZ0A 3PEVA 1T91A 2H8KA 2IHBA 2ZR0A 4KI0A 1XX6A 2FPKA 2VH5R 3I5YA 5EZ6B 3GLGB 4JBWA 1L8QA 4RCZA 5FTLA 2W00A 1ZM3A 4M53A 1MO3A 4DHEA 1XP8A 4TZ0A 2ZI3A 3K0CA 1N6KA 3EZ6A 4TTRA 4EIWA 4TYQA 1EWRA 1YHNA 3IQXA 2V54A 1U0LA 2Z43A 3NWJA 2QTHA 2CJWB 5KYKA 4PAMA 4LJAA 1NY5A 3F5FA 5FTNA 4M0LA 1H8HA 2ZROA 3QF4B 2IWRA 4AD8A 1IM2A 1Z47A 2Q21A 4EPYA 4MA4A 3IEVA 2XSZD 4OI0A 1E2QA 2A5YB 4LDJA 4QKQA 2O8CA 3QXHA 1DAIA 4Q4AB 1Q1BA 3AUYA 4LWZA 1JR3E 2IF0A 2OAP1 4NMMA 4PHTA 5E4FA 4LRWA 4IOMA 4BFZA 4BZXA 2YV5A 3Q5DA 4UJ3A 1SXJD 1PUJA 4D25A 4LHXA 5LB2A 1CIPA 2OESA 2GILA 4AWXA 3SC3A 4B47A 1E98A 1G5PA 4A2QA 1OXTA 1IQPA 1XPRA 5AJVB 1E1RA 4LJ5A 5GVSA 2Z4SA 4QM6A 2C96A 4IFEA 2OCPA 3K9HA 4EDHA 3Q7QA 2AWNA 2N1BA 3C15C 1IOZA 3I8XA 1SVSA 5CB6A 4B44A 4F92B 3ZDQA 4DCSA 3BH7A 5EE1A 1EXMA 3LO5A 2VHJA 3T1TA 2OO7A 3A1UA 1NVWQ 1M1YE 2K5UA 4QBFA 4TTQA 3RWOA 4LHZA 3L0PA 3G0HA 1N6OA 3DOFA 1XEWX 3NKVA 1MABB 4HB2A 3EIQA 4MRRA 2NO9A 5F9FA 1E2DA 4NCIA 3DMNA 4KO8A 2QAGB 4W5HA 4CEJA 1D9XA 4CEJB 3VKHA 5KDOA 1KI6B 4WBSA 3GQBA 1AS2A 2WAXA 4L8GA 2QA5A 3PUYA 4HATA 4P0TA 4JVSB 2PMKA 4QRHA 2Y8EA 1KNQA 3CF2A 1R4AA 4EPXA 4IXNA 2ZXUA 2DY1A 4YXWD 3GJ6A 3A6PC 2ZETA 4EQ6A 3LY5A 1FMJA 1AS3A 2CLSA 2GAOA 2QL6A 1WB9A 2VRWA 5KDLA 2PEYA 2RGAA 3UATA 1N6IA 4AURA 4URYR 5A4JA 4DC9A 5KNDA 1E0KA 3ZZTA 5CYOA 3GMTA 3KXLA 1KK0A 2UVQA 3GLFB 3TQCA 1LV7A 5DN6D 1DEKA 2O5VA 3NH9A 2V7QA 3PV0A 1V43A 1XBTA 2FPLA 1OH6A 4MKFA 3QXSA 4HDOB 5CM8B 3U7HB 1CKEA 2PT5A 5DISB 4PR0A 5KNBA 1P72A 4IOKA 2KBFA 2CL6X 4JLNA 1UBFA 4M1SA 3TLXA 1H8HD 4Q1FA 1EWQA 1TNDA 4TL8A 2ATVA 1GUAA 1NF3A 2J45A 3QPWA 2MSDB 1S8FA 4TLCA 4BEBA 1LNZA 4LGMA 4D0GA 5J4KA 1OXVA 3EPHA 1D8TA 1KI2A 2AL7A 2XOKD 4JLMA 1BYUA 2ZRMA 4MRPA 4DLUA 5J4YA 3FE2A 3ZZUA 3KJGA 3R7WA 4EPRA 2JIZA 6Q21A 3A58B 4BFYA 4JJZA 3D6TB 3K09C 3QKRA 2QP4A 4TL7A 4FIDA 5GVRA 3W3ZB 5HKKA 1GNQA 1VHTA 3EZ2A 2IYTA 5EZ5A 5FTJA 1E96A 1LS6A 2GJ8A 1ZUIA 3MUFA 4QJ4A 2C9YA 2VHCA 2FFAA 2V4ZA 3FDIA 1P9NA 2P2LA 4UNPA 5FL7D 1ZW6A 1G21E 1KKMA 2PJZA 4OJKA 4QG7A 2QGNA 3TSZA 2QPTA 3TJZA 4RVCA 4DLSA 1EFUA 1CJVC 4KYUA 2HJVA 1AJEA 2AN9A 1E94E 2H5EA 2F55A 1UM8A 2EU8A 1YZKA 4PC7A 4BEJA 2OFXA 1XRJA 5DH9A 3MWJA 4LYJA 2FGKA 4RCYA 2FJUA 3FVQA 4QBGB 1E1RD 2QQEA 1X86B 3IKJA 1FQKA 5CDFE 1QHGA 1Q20A 2V7QD 3CONA 2OLKA 1SVWA 2HEIA 2ZS8A 1LVGA 2FSGA 1II8A 4NCHA 2ANCA 2XAUA 5B30A 1T4GA 1KK3A 1G8GA 4TL9A 3ZQ6A 5DI3A 3KL4A 4GMDA 4MGYR 3QXJA 1ELOA 3VFDA 1KI6A 2C2HA 2ONKA 3MG9A 2RAPA 3R20A 3SZRA 4JVNA 3B1ZA 1E79A 1KJWA 2G6BA 1X1RA 2JJ1D 1MOZA 4NYMQ 1OV4A 2VSFA 2F3RA 2VA8A 3B9QA 3OIWA 4HLQB 1X6VA 1JBKA 4I1UA 3QIAA 1NNEA 3KQHA 3GJ8A 3B82A 3HU1A 3LA6A 2RGBA 5FI1B 1NKTA 3RS5A 2AKYA 5HCNA 1T3SA 5KHOC 1G18A 2HLDA 2RMKA 3TUZC 3QSYA 3VTKA 2XZPA 3KFXA 3OEHD 2OFOA 4IDNA 1E9FA 3VAAA 3MJHA 1Z22A 3W6NA 3CRW1 1FTNA 1TAGA 2NG1A 3LBNA 2NMVA 1C4OA 4AC9A 1AKYA 4URXR 5L3SA 4O3MA 5CK5A 2VYFA 1VG0B 2ZRNA 1SXJE 4DCUA 1XDBA 1D6JA 4HB0A 4ACAA 4NCNA 1U9IA 1IY0A 4LPSA 3L82B 3HJNA 4N3NA 4DLZA 3VX3A 4GMXA 2R8RA 2ZJ2A 2JLYA 1E0AA 2G1KA 1DG3A 1YE8A 2GTPA 1SXJC 2JGNA 2W0MA 2WIAA 5JI2E 1Z6XA 3CR7A 2CHGA 3AP1A 5FTKA 2B8TA 2WSSD 1PLJA 3I8SA 1Z5ZA 3CWQA 3R7WB 3DKPA 1GIAA 1QG2A 4LC0A 4PZYA 4JLOA 3LWNA 4NHOA 1XFAA 1TQ4A 4C30A 4B3FX 2OXRA 2E1RA 2ZYUX 4JJKA 4GL2A 1M34E 4TLDA 1EFHA 1AZSC 5KPJA 2V9PA 4PSAA 1HE8B 4HDQB 1VIYA 4Q9JA 5SZKB 5CYPA 4XVUA 4DLXA 4PPFA 1LFDB 2W6JD 2VP0A 1E9EA 2DWQA 3MCAA 5J40A 5SZJA 2VF7A 2VEDA 3QUSA 3IO5A 4C0KA 3AKDA 4IW3B 1E3MA 3UG6A 1FQJA 4IVPA 2YZ2A 2KWIA 3KUDA 2VHTA 4URVR 4TQUS 2WBLC 4LJ9A 4QHTA 3KQLA 3WRYC 1E2MA 3KJEA 4QJ3A 3K70D 1XTQA 1U94A 4F4JA 2DBYA 4B74A 3LXXA 1M74A 4XD7A 1K5DA 1UEIA 3UPUA 1IN7A 1ZD9A 4JMPA 3K0AB 4Q7MB 4LOAA 2F9MA 1GKYA 1Z3IX 5G3ZA 2HCBA 4B35A 3PXGA 1XD8A 3RS3A 2GK6A 2IX3A 4TMZA 3VR5A 2O52A 3RWMB 4CW7A 1HY3A 2OM2A 1F60A 2XB4A 4Q03A 4R2IA 5JS7A 4TT3A 4KFRA 4MYHA 3FB4A 3AP2A 1E32A 3W9YA 1W48A 3RSLA 4CT5A 3B1VA 2ZR7A 2ORIA 2CJWA 1RJ9B 2X8AA 1M2OB 4IHQA 3X1WA 2Q3MA 2ZRLA 2QGZA 1N6RA 5JSZA 2HT1A 1AGPA 2QROA 4KHZA 2YINC 3WHLA 1FW6A 1RKBA 3DM5A 2IYLD 1CULC 5JMTA 1XEWY 5FPHA 3KKOA 4A0HA 2IYYA 1IXSB 3GLFE 3RS0A 1GL9B 3BIFA 3MWKA 1U8YA 2V6JA 3P4YA 5DGXA 2QE7D 4UNRA 3R9WA 2HF9A 1XCGB 2GNOA 4US1R 4FCWA 3P20A 3W8NA 1W2HA 1W4CA 3HWSA 1R7RA 4PPNA 5G3YA 3X1ZA 1XPUA 1SKYE 1DAHA 3GLHE 1I4DD 1W0KA 4P4UA 1R5NA 2WMOB 4XIGS 2BIFA 2REOA 2CHQA 2Z0MA 2FFHA 4L9SA 2IUTA 4RD2A 1W2GA 2RGXA 1IN8A 1SXJB 1RJ9A 3U44A 3NC1C 4Q7KA 3RRNA 2ZJZA 3G5UA 4Q02A 1S2MA 4PTLA 2QORA 3U60B 1H8EA 3BJIC 1Z8FA 3PQCA 3RC8A 1G6HA 2ZI9A 2BHRA 2GAAA 2IS2A 2ZU0C 3CX6A 4A0GA 4TYWA 4LUCA 3TR5A 3WNBA 1BH2A 5DHFA 3UMSA 1OLOA 3BXZA 2D2FA 3RANA 4ASUA 2O8FB 1JNYA 4ZCLA 1JECA 2XNDA 2V1XA 3ECCA 5DNYB 2WJGA 4LY6A 2HJGA 3P32A 4LYHA 4WZ6A 1NIJA 4V0LA 1KTVA 3PVSA 2QBYA 1N0VC 2Q9AA 4P4SB 4I99A 2CLDX 2IYQA 1VDZA 4DSOA 1VHLA 4AKHA 4PC6A 1U0HC 1BOFA 3HU2A 5HZHA 3J81k 2PLFA 4DLVA 5AUPB 4JYCA 1SXJA 1V5WA 1QHXA 5BQ5A 3V9PA 1BO6A 2WAYA 3EIHA 4ESHA 2G0NA 2EVWX 2NO6A 4DVGA 2YYZA 3U7EB 4BFXA 1JQJC 4HLUA 4ZIRB 3K0AA 2RGNC 4LJYA 4DBLC 1P2UA 4NBSA 4H1VA 3FMOB 2QY9A 4D82A 5K8UA 4A0FA 2CVHA 2YNMA 5SZIA 4A2WA 1XTIA 4TLAA 1QHSA 2PX3A 4LC1A 1YZNA 3BB3A 1XXHB 1XU4A 3FMIA 5TY0A 4Z1MA 5GADl 1G1MA 3DO6A 2J7PD 2ZRCA 5CK4A 2GJKA 1U2RA 3AP3A 2J7PA 4V0KA 3W6PA 5JRZA 5A0FA 1GG2A 1KAOA 3VMFA 1ONBA 2AXPA 5C4GB 1DADA 1IXRC 1E2LA 2G3YA 1HT1E 2P3SA 5KUTA 2WWIA 5JI3E 4FINA 4IVQA 1E2KA 2WPDA 1OIVA 4YC7A 3A1VA 4Q19A 4ABYA 4C0BA 2IUSA 2MMGA 4EPTA 1HE1C 3B1XA 1U99A 3QKRB 1WE2A 5H1YA 5IF9A 1W36C 4MDFA 4C0QC 4YMSA 4ZV4A 2OT3B 1KZGB 2GXAA 1NSTA 4DLWA 2P5SA 5CDFA 4Z54A 4CGZA 3FYHA 1Y3AA 2VSOA 4B3GA 4PHGA 1Q1ZA 3WXMA 1DARA 3L0OA 1YQTA 5HTKA 3KX2A 1KMHA 4AYXA 3U3KA 3VR1A 1T3HA 3P1JA 2GBLA 4OHWA 1CLUA 1J8YF 1ZD1A 4KYIB 2OBNA 3DKVA 3ADDA 3LX8A 2PH1A 1NN3A 1YR6A 3AQ4A 3QJYA 1TADA 4KJZA 3VX4A 3AKYA 4GZMA 2VP9A 4K81B 3T61A 1AIPA 1KI3A 2H57A 1W7AA 2IYXA 4C0JA 2OE2A 4BFWA 1TUIA 3F0TA 4DSNA 4TLEA 4AYWA 4U7DA 2QZ4A 4AKIA 1R0XA 4XSGA 3WBJA 1LY1A 2JAQA 2R6GA 1M7HA 2F1IA 1GM5A 5L3QA 1HEIA 1A1VA 1G3RA 2BDTA 4GFDA 2WHXA 4LYFA 1MO6A 1E2NA 3I5XA 1IN5A 1W0JA 4DUGA 2ZANA 1Q44A 4P3YA 4YLGA 1OT3A 2GJAA 3C41J 2IT1A 2CCGA 2GETA 3UWKA 4IKEA 2ZU6A 3ZS9A 3AVQA 1Z2CA 5JHGB 1FPMA 3EWAA 2F43B 1XXHE 1N6HA 1W46A 2QU8A 4ON9A 2G83A 3TSWA 5BN3A 5IDVA 2DWOA 3QF4A 4D4MA 3GFOA 1KHTA 3PCRB 5ANRB 1N5JA 3H1TA 4E5UA 4D26A 4FMCB 2WWYA 3BK7A 4CT4B 1RE0A 1S9DA 2OILA 1XJCA 3OAAD 3GFPA 1VYUA 5CM9C 3PUZA 1FTSA 2FNAA 2IWHA 2Z83A 1NG9A 3AVVA 4DCNA 4DEXA 3NDBB 3SR0A 4QM7A 3WBKA 3VNVA 3DDCA 5BW8A 4QGHA 3FOZA 4NYIR 2VBCA 3B6EA 1WBBA 5FI0B 4EFNA 5B57C 1E0JA 2BWJA 4I1OA 4PO8A 1CR0A 4F38A 4GRAA 2C99A 1TPZA 3AF1A 2XTNA 1NG1A 1ZUHA 3K70C 1RC8A 2FEOA 1BKDR 5DI3B 4W5WA 3WMGA 5AJWA 2JCSA 4FCVA 3K0CC 2B21A 2FF7A 1PUIA 4M9XA 1XMVA 4ZDJA 2QT1A 4PQFA 3NEYA 3A36A 3C8UA 2VPPA 2AK2A 4BQSA 4CVNA 4TQ9A 5FL7A 3QVUA 1G7RA 1L4YA 4BZPA 4F4IA 4D81A 1T3LA 4EAQA 2Z4RA 3VR3A 2AWOA 1YRAA 3AVUA 2J0VA 4XVQA 4PAQA 1JEEA 2QM8A 4V0MA 1R2QA 1RFLA 1AM4D 1TQ6A 4ILEA 1CXZA 4IOLA 3HP1A 2ZRGA 3W5IA 2FSFA 3GFTA 1UBGA 3MAAC 3PEUA 2QP3A 4E03A 1SKQA 3GLFA 3IBYA 1OIXA 1VG1A 2PZGA 4IDPA 1ZUNB 4V03A 1UEJA 1OIWA 1MO5A 4PO9A 4EPWA 2P6UA 2PMDA 3B85A 3OIUA 3GJXC 2O8EA 2NZJA 3IGFA 2CK3A 1AKEA 2L0XA 5AR1A 4TMKA 3HR8A 2ZJ8A 2GEUA 3UMFA 5H8WA 1GP2A 2C9OA 3UKDA 4D6PA 2GCPA 4N0DA 1IJEA 1ZAKA 1P62B 2JATA 1GKUB 1UKEA 4FMDF 3RSOA 2HT6A 4Q9LA 3SYNA 3D7MA 2B8WA 2IW3A 2GEDA 5FL3A 5IHPA 1A82A 2RH5A 4LV6A 1XCMA 3AF0A 1T5LA 2J0UA 4NTZA 3BB1A 1ZC3A 2GF0A 3TW4A 3NXSA 2OBMA 2ZUCA 2W2XA 2VIIA 3S1AA 5IK2A 3R8CA 1KO4A 4MYUA 1GFIA 5G40A 3CPEA 2B92A 4PHHA 2I1QA 5EP1A 4GDFA 1YKSA 2ZYWX 5SZHB 3AVYA 5FUYA 4GT1A 3BD9A 2ZSBA 3Q9LA 1KGDA 5FR1A 2F1RA 2O0HA 4ZI3A 5BN5A 3EPJA 3TUJC 3IILA 2HF8A 1CJKC 4C7OA 2BKEA 2GXUA 5KNCA 2B7CA 4AYTA 1RRFA 1T5IA 4AG6A 2IUUA 1U98A 2ZRAA 2FGJA 4W7SA 2IEZA 3CRVA 3KKPA 4OQFA 2ZJ5A 3EC2A 4DJTA 1G8YA 4DLRA 4JT2A 5H70A 1FNMA 2Q9CA 2R9VA 4MITA 1GITA 2C03A 2MSCB 1XWIA 2EFHB 2HLDD 2HXSA 1ZU5A 5FR2A 2IXFA 4CEHA 1KY2A 2DHRA 3KB1A 3KQKA 4LPKA 2O8EB 1BS1A 1J99A 2SHKA 4WXPA 2VP2A 4NYMR 5EXXA 4C3ZA 4TMVA 1G5TA 1DAEA 3RLFA 1W49A 2EYQA 3ZVNA 4OQLA 1W0KD 4RD1A 5D3MA 2AHOA 1Y63A 1TU3A 1NL3A 2JLWA 5LDDC 2ZE7A 5DE3A 5KSOA 5UKDA 4TTPA 5EXSA 1II9A 2AK3A 3BB4A 4Q01A 1G7SA 1XEFA 4TSFA 5JZVA 3WNDA 3VHLB 1RIFA 5DIFA 1F2TB 4XJXA 3NDPA 1FNNA 4QJ5A 4OHZA 2DB3A 3ZLJA 1OW3B 1Z0IA 5KPDA 1ZYUA 2VF8A 3K09A 1DE0A 4GPTA 1CS4C 1N0UA 4DT1A 3VKWA 3E2IA 5KU1A 1D2MA 2BOVA 2YJTD 5EE0A 4RD4A 4NDZA 2O8DB 4C0HA 5EXTA 2O8DA 3I72A 1L2TA 1PVOA 4EJSC 3CZPA 4G5RA 3AGQA 2VP6A 4TSFD 1G41A 3WP1B 2EFEB 3HDTA 5HE9A 3BFVA 1AZTA 1WMSA 3CRQA 3M6AA 4OK5A 1XB2A 1OB5A 3U3RA 4Q7JB 3DPUA 1X8LA 2NGRA 3ZS8A 1QVRA 1SZPA 3AH8A 4NCKA 3T1OA 2NPIA 2ZEJA 3ZVRA 4GSYA 3PJRA 5FPTA 4ZCIA 5LPNA 2A78A 4XWAA 4FXPA 1OXUA 2Q3FA 2GJ9A 1T8TA 3OEED 2NO7A 1SULA 4JKIA 1XEXA 3HYTA 3CZQA 3H84A 3W3AA 1P2TA 3H2YA 4O2LA 5AJXA 4BFSA 5FUXA 4AY2A 1NMXA 3ZIAD 2HYIC 2RCNA 1TTTA 1TMKA 2J5XA 4DDVA 1SVKA 2BM0A 3OEEA 3B5JA 3TKLA 2W2VA 4US0R 3B1YA 5BYJA 3W90A 4F93B 1OFUX 2WWGA 5JEEA 3OHMA 3TK1A 1DO0A 2BMDA 3CWZA 1N2CE 2JDIA 4DWJA 3TSOA 2BMEA 4TMWA 5BYKA 1T9HA 2ZRJA 2Z6VA 4M9ZA 4M22A 4OJQA 5AK0A 1P4SA 3C5CA 4HAUA 1UDXA 3RYTC 4Q00A 2X77A 3C7KA 4Q47A 3L0SA 2F7SA 5JSZB 5F98A 4ERNA 1G8PA 3NBYC 4LJ7A 3K9NA 1D2NA 4L15A 3ZD7A 4NP6A 3O8DA 1GOTA 4URZR 4TQAA 3P26A 1G8FA 1VG9B 2J7KA 1EG7A 3BFKA 4MYCA 1HT2E 2WM9B 4PX9A 3A4LA 1NVXQ 3IUYA 3LXRA 5F3WB 2WMNB 2H17A 1UFQA 1KI9A 2VP5A 5L3SB 4A4DA 1ZCAA 1E2IA 3EASA 4M4SA 4OI2A 1YZQA 3GEEA 1OH5A 1E1QA 2R6DA 5FH9A 2RKOA 2WPDD 3ZJYA 4FWTA 4PZLA 3V4FA 1E2HA 1E9DA 1MT0A 4LBYA 4A15A 1G3MA 1R8SA 4QBHA 4GNKA 4DXAA 3LVRE 1TF2A 4JL5A 3NEJA 1DAKA 1CJTC 1UDWA 2C95A 3EG5A 4UQOA 4L9WA 3U5ZB 1Q0UA 2OLJA 2FMXA 3TAUA 1SHKA 4H9GA 3ADCA 3THWB 5CLLA 2PT7A 4WZAE 4C9BA 2GK7A 1KK1A 5CJ2A 4KLNA 1FP6A 2WJYA 2I1VB 2ZJBA 4Q66C 1GVNB 4KSBA 5DHAA 3KKMA 2YHSA 3CO5A 5JLJA 3U3MA 3N5CA 4LK2A 2QSZA 4H1UA 2H1LA 3MSXA 1NY6A 2YWEA 4P4SA 1S4QA 5AJZA 3K0SA 4MRSA 1F2UA 1NN1A 3P27A 2P5TB 1A4RA 1E2PA 1YZUA 3A4NA 4IFBA 5JFGA 3ETLA 2ZREA 1ZRHA 3QVVA 3WNCA 3CX7A 4L4UA 5HCIA 3PUXA 4DRZA 3OZXA 3SE0A 2QQ0A 3SFVA 4U5XA 1W47A 3Q85A 3VR4A 3LH5A 3NBFA 1R5OA 3GLHB 2JLVA 1DELA 5FTMA 1XZPA 1OYYA 4B43A 4AI6A 1BYIA 2G1JA 1XD9A 1P6XA 4E22A 3GD7A 3SQXA 2DFNA 3TRFA 1P73A 4OQMA 1YJ5A 3RRZA 1D5CA 2OCAA 2KBEA 4LHWA 1EX6A 1H8ED 2O8FA 2ZVQX 3QY0A 3W6OA 1E6CA 2BBWA 4F4CA 2ATXA 3C5HA 4WW0A 3ICQB 1Z07A 2UZ3A 1HUQA 5CIQA 3Q8XB 2ZYTX 3E70C 1KSFX 1VCMA 4UKDA 5FUWA 2PCJA 4G1UC 1S3SA 5HR5A 1NRJB 2QRNA 1GILA 2J0QA 3T1QA 3VQTA 2GCOB 3KDSE 4Q1AA 1E9AA 4LV5B 1W5SA 1N25A 5IRCD 2RHMA 2GVDC 5FPYA 3R9IA 2ZE6A 3ZYCA 4TLBA 5E3HA 4CZ2A 1EFRD 2XOKA 1YR8A 2W0SA 2NO1A 3SOPA 4HSEA 4M8NE 1DBSA 821PA 1TQDA 3WY9A 2BCGY 4R9UC 2D2EA 3H4MA 1XMIA 4PPQA 5BXQC 4OYHA 1KMHB 1OFIA 3KTAA 4BLSA 2V6IA 2KB0A 1EESA 2C98A 2OAQ1 2YVUA 4MUBA 1ZM9A 1OXXK 1P5ZB 1UADA 1Z06A 2CLCX 1C1YA 4LX0A 4NYIQ 1XTSA 1E69A 2OCYC 4JBYA 4LZZA 4MH0R 4PSVA 1EGAA 4JLDA 1X8KA 1RRPA 5K8TA 1AA9A 1RYHA 4TZ6A 5EJEA 2ZRIA 2AKAB 3GLHA 3PR1A 4QNRA 3OESA 2WJJA 5DN6A 1P75A 1BMFD 3LFUA 2VTKA 4KFSA 3THWA 4D4LA 1NIPA 2AXNA 4TT3D 2QNRA 4AK9A 2IYSA 1JR3D 2ZS7A 1AS0A 3LQQA 2LKDA 4B76A 3S1AB 4Q4AA 2RGEA 3AF4A 3LLMA 2GDJA 5FBLB 1MABA 1WA5A 2N42A 3QEOA 1YZGA 2FFBA 3B13B 3N2IA 4PANA 3SN6A 3A37A 3C16C 3CUEF 2PL3A 2QAGA 3FFBA 1PV4A 2ZITA 4XVRA 5AUNB 1X3SA 4L16A 1IY1A 1VPLA 2FOLA 1US8A 3A1WA 2IL1A 1GZSA 2J46A 2ORWA 4DB4A 2GA8A 1ODFA 4E09A 1Q57A 4URWR 4KVAA 3I92A 2W83A 4DLTA 2A2ZA 1ZIOA 1DTSA 5AUOB 3LVQE 2IA5A 1P7CA 4Q18A 4JLVA 2NPFA 1OH7A 2QBYB 4LJ8A 2BJVA 5FOWA 1XMJA 1G3UA 1YZLA 3IDQA 4GI7A 2J0UB 1W36D 1NBME 1NN5A 2VHUA 4NYJR 5L3VA 1Q22A 1GWNA 1UBEA 4CDGA 1G6OA 2NQ2C 2W2TA 2FV8A 2QMEA 2Z5FA 1KYIA 2X19A 4HUQA 1J70A 2HUPA 4BRWA 2DCUA 1SVOA 2ZUBA 3NC0C 4ITRC 1YR9A 1XJ0A 2CE7A 3IPXA 1WP9A 3GPLA 2DR3A 1NJFA 2O0JA 1DVRA 2V55B 3BFXA 2ODWA 4QNMA 5K8IA 4OHYA 4TMXA 4QL3A 1NMYA 3SJZA 4R98A 4BFVA 1U8AA 2QT0A 3WYFA 3GLGA 4EQ6B 2A5FA 2H16A 4EFLA 1OFHA 4NH0A 3I32A 4HAWA 1GDDA 1WDTA 1Z0JA 3M1IA 1S1MA 2Q0HA 3LD9A 3SHWA 3LNCA 5C18A 3DMDA 2IYWA 3PUVA 5E95A 3H86A 3K0EA 2ANBA 1JJ7A 1VYVA 3HPQA 4WZBE 3QBVA 2F3TA 2XJ4A 4XH9B 2WJIA 4W5JA 2Q3HA 4EJSA 1S1CA 4ZDKA 4PQYA 1NKSA 3FMFA 1D2EA 1J2JA 3LW7A 2GCNA 2H92A 4BLPA 4C2TA 2JLZA 1KO1A 1XTKA 2V3CC 1GKIA 1KDRA 2AD1A 5E7MA 1HQCA 1ZM2A 5KSZA 3I73A 3PEWA 4B3DA 1VYTA 2ERXA 4M1YA 1W0JD 2BEKA 2GWHA 3HPRA 5EE5B 3K0FA 3CR8A 1FP7A 1ZD8A 5TV2A 2QUZA 2HCJB 4C0SA 2A7QA 3PIRA 5DYGA 3NIBA 2A3RA 4CRWB 4RZ2A 3I61A 1J8MF 2QMOA 4Y0AA 3OFNA 4I1SA 1W4BA 2JJ2D 3N70A 5H68A 5P21A 4UNQA 4PHFA 5C1BA 2W6ID 3AVPA 1E9BA 3SJAA 1A2KC 5ELXA 2DFKB 4A8JB 1JAHA 4B6EA 4ZI2A 5BWMA 2BKUA 4JKYA 3VU9B 4ZDIA 2CCKA 2GF9A 1JPJA 5KOYA 3MFYA 4B73A 5JJKA 1U8ZA 4URUR 1LF0A 2AFIE 3I1FA 3F8TA 3WRXC 2XNDD 2A9KA 1U0JA 2FG5A 2OG2A 4ZCMA 4Q4HB 1K6MA 3U3JA 1R5BA 2D3WA 1S9HA 4UXIA 421PA 3FFAA 5JRJA 3WMEA 3Q3JB 3X2SA 2JDID 2PLRA 3IIMA 1W4AA 4DZZA 1N3BA 1DOAA 2UZIR 5EXPA 3KKNA 1N6LA 3OAAA 2O0KA 1COWD 3CBQA 2BEJA 2ZRFA 3ND9A 3QPVA 2IYUA 3CPJB 1W5TA 4J0QA 1Z6TA 4ZDWA 5FOXA 1VCIA 221PA 1JI0A 3FKSA 1UPTA 2CDNA 2EYUA 2YOGA 3QG5A 1T8UA 3VKGA 3RS7A 4UJ5A 1QBKC 4KFTA 3EPLA 2FU5C 3NBXX 2ZIAA 3LRPA 2QAGC 2OZEA 4O25A 2REBA 1OSNA 5EP2A 2XEXA 2C77A 1NBMA 3RABA 1FFHA 1II0A 2CXXA 2OFWA 3I62A 1VG8A 4JLKA 1E9SA 1KO5A 2ZE5A 5DO9A 1G20E 3K0FB 3R8FA 4QGGA 2GVZC 1QG4A 2X1VA 3E1SA 1ZCBA 3UK6A 2QMHA 2RB4A 1PLKA 2GXQA 1NSFA 1OJLA 4OK3A 2OXCA 2R44A 3BH6A 2C9CA 2VQSA 5CLQA 1KI1A 2XTZA 4PFSA 4A6PA 2D4HA 1OYWA 4DT1B 1T0JB 4IOJA 3U6BA 4JIMA 4HLCA 3EA5A 1FUUA 3EW9A 2I4IA 3TQFA 3TBKA 4D0LB 1YZTA 3QXXA 2P6RA 3IIJA 4BASA 3AKCA 2O8CB 2ODBA 4X8MA 1FL9A 4RJLA 3L43A 1G7TA 2WSMA 1GL7A 2X2EA 5B2ZA 3UXMA 3D31A 3FTQA 5FOVA 4DKXA 5J47A 2W58A 3RNLA 1QHIA 4ARZB 2ONJA 4NPHA 2XNSA 3GEHA 2D7CA 1Z0KA 3JVUA 3T1VA 2O8BB 1CRQA 3MWYW 2J9RA 2IXGA 1CP2A 2J87A 3B60A 4RD6A 2QN6A 2KE5A 2E87A 4QHYA 2AX4A 1XTRA 3P4XA 2QTFA 4YMVA 5C2JB 2ZRKA 4JS0A 4MRNA 2G9NA 4EUNA 4I1VA 3TIFA 3ZVMA 3GEIA 4LYAA 3CRRA 1OKKD 2ZI4A 4MKGA 1ZIPA 521PA 4KODA 4TL6A 4XTRA 5J5CA 2NZ8A 4XSHA 2HXYA 3CM0A 1I4TD 121PA 2EWWA 1VKJA 3EWSA 1U90A 1KNXA 3ZVLA 4A8JC 1KJYA 1MR3F 2HDNB 1G4UR 2ZAOA 2NIPA 3EA0A 3R9XA 5JECA 2CBZA 1L4UA 3ASZA 4FMDB 3ZQJA 3GJ0A 1NJGA 3X1YA 4OHXA 1EX7A 1QHYA 3PITA 4Q48A 1PZNA 3PENA 3SQWA 2ZSEA 5EUMA 1MV5A 2O8BA 1TQ2A 1AQUA 4HAZA 3OE7D 1Q3TA 3M0EA 4QOSA 3U4QB 4A0RA 4TWZA 4Q4JA 5FOUA 4G3XA 1TX4B 1E2EA 1MRSA 5FUVA 2WSSA 2BVNA 5IT5A 4PSKA 3KXIA 5FOTA 1CTQA 1QDEA 4IRUB 1P9WA 4O2RA 4JLAA 3KQUA 3LLUA 3U3OA 4RD3A 5TMPA 1XMSA 5GJWC 3VHXA 4IJMA 3KFVA 3BERA 4ARZA 4PC3A 1NVVQ 2A5DA 1UBCA 5JJLA 1O3YA 2QM7A 4OI4A 4V0ME 2EWVA 3CX8A 3TE6A 3GLIE 2JLQA 1S0UA 3UG7A 1H65A 3QOFA 2C78A 3DVLA 4BFTA 3THYA 2ZYVX 4GP6A 4HAVA 5KTYA 1AN0A 2R62A 4HAYA 4IEIA 3JVVA 4RZXA 5D3MB 4A92A 1ZNWA 4FCTA 3FPAA 4BLRA 2ZM5A 1DAFA 4BUJA 1GRRA 4PC2A 4WA7A 5AJYA 4D0NA 1G16A 3QKUA 5CJPA 1KDOA 3SI7A 4ZKEA 1X1SA 4M2LA 1LW7A 3GJ3A 3AM1A 3B1WA 4G5SA 4OK6A 3LV8A 4AKGA 1WRBA 1U9IC 2C04A 2WV9A 3PFIA 3AB3A 1UAAA 4UNSA 2BMFA 2J41A 2ZQ5A 3BH0A 1ZM7A 1MKYA 1TF5A 2RHDA 2W6JA 1KKLA 1ZBDA 3K8YA 4GP7A 1BMFA 3U44B 3AVWA 5JS8A 1EFCA 721PA 1JB1A 1QHHA 4AIIA 4ZIRA 4US2R 2DYKA 2ODNA 1WQ1R 5AUQA 3KJIA 1VCNA 4QGFA 1CR4A 2IYVA 1Q1QA 2YWHA 1JXOA 3EZFA 3QKSB 2GZHA 4U00A 3T12A 4P32A 4DCTA 3VNUA 2F1JA 1XXHA 3B7GA 2FWRA 2WOJA 2H18A 2DWPA 5FBRB 2EFGA 3ONWA 4F91B 3OFND 2ZRDA 2D74A 2DFLA 1EFRA 2IF2A 2ODEA 2JEOA 4C2UA 2YWGA 2FSIA 1LS1A 1G3IA 4B3XA 4DCVA 4MRVA 1N0WA 5GJVC 2CNWD 2OCBA 1NLFA 2JLSA 3AUXA 3OF5A 1FX0A 4A9AA 3CW2A 1RRGA 1WXQA 4ZKDA 4W9MC 3RDPA 1T0HB 1CR1A 1NI3A 2X2FA 3EXAA 4S35A 4DUGD 2XTMA 3U7GA 3THXB 4XD7D 1JR6A 2HYDA 4CIDA 3EPKA 1OPXA 4QFMA 1RPZA 2JIZD 3U4QA 1PLLA 2E9SA 4DDWA 1AGRA 1ZINA 4QGAA 4PO1A 1JALA 2CL7X 2BCJQ 2UKDA 3ASYA 2WIBA 3CNLA 3MLEA 4MKIA 2FZLA 3SFZA 3B8HA 4HUQB 2B6HA 2ZAMA 1MH1A 3SHFA 4TYYA 2TMKA 1RRCA 2JJ1A 2QAJA 1E1QD 1GTVA 1QVAA 1E0SA 1KIMA 4BWYA 1GNRA 1I2MA 3QEJA 2IBMA 3AKEA 3CNOA 1G291 1XF9A 1Z6GA 2AFHE 2RGDA 1T6NA 1Z28A 4KCGA 3EAQA 4MYTA 2ZSDA 1M7BA 1VCOA 1NP6A 4YMUA 2IS6A 2PCLA 1ZM4A 3L8ZA 3TMKA 3Q7PA
chains in the Genus database with same CATH superfamily
1GARA 3EDCA 3X43A 1RFGE 4II3A 4I4NA 4L75A 4INZA 1VSUA 1NUQA 1OA0A 2JEZA 1PR0A 4YCAA 2ECKA 1A3CA 3DBHB 4XOIA 3MS4A 2MIIA 4C22A 3LOPA 3OVMA 2H00A 1MX3A 4YXWA 1YQUA 1BS2A 1K6IA 1DRWA 2PX0A 3KTFA 4RV9A 3RT9A 1XD2A 4CF7A 5KTPA 5FBQB 3NKLA 4J2TA 5TRTA 4PGFA 5HW0A 3STVA 3WRXA 4BECA 4IEEA 4ER6A 3O8CA 2VEOA 1UIRA 3I58A 1XTJA 4HEQA 4KIUA 1JQEA 2WAOA 3KJZA 3TSAA 5FX2A 5LU9A 1SU4A 1ZOLA 4MYSA 1HTWA 1CEYA 4NJOA 1T6YA 1KI4A 2J3QA 3THOA 4FYMA 2XOEA 3DHVA 1IC6A 2ZM6B 1RYFA 4V2IA 3GP8A 2QPOA 4ZQHA 5I7SA 3TZBA 4TS9A 3BX1A 2FUG6 3DMFA 4BO4A 1YFKA 8OHMA 3H5IA 1E99A 3A11A 4IG4A 5IXSA 4BN0A 1YB6A 2BMWA 3CLKA 4X3OA 4AJKA 4C4ZA 1I7SB 3AJRA 5ARDA 5TGTA 4ZJZA 2CF5A 3ZYZA 4B3BA 3AKZA 5AW7A 3KTDA 4FLEA 1H0HA 3TIGA 1LX6A 4OHKA 4F96A 1SVMA 4N0EA 2C54A 3NDJA 3WYAA 4Y2PA 4ODIA 2VUTA 3TAHA 5IT4A 4N5HX 4BNLA 5B64A 4TT8A 2C2ZA 4C0XA 2RAUA 2WKQA 3ICVA 2ISSD 1Q0TA 3GQVA 3MXTA 4X8LA 4JYZA 1WKVA 1RWBA 4DR2B 2VWHA 2PK3A 1NQWA 1NBEA 1ESNA 1ESMA 1F0YA 2P9FA 4OQPA 2ZSUA 3V2HA 4BCBA 3JTMA 3REGA 4ZYVA 1C7RA 1Q7RA 4MS1A 5CLHA 3J81A 4L0CA 4R5MA 4JFRA 4IFIA 3L4SO 2ODPA 4W7IA 4I55A 4BPBA 4FLMA 1R4ZA 1W4RA 3A3PA 3ETJA 5AICA 2X41A 3CEJA 3C8ZA 5ESWA 4EHFA 3RRMA 1HF3A 1FEZA 2XRFA 1V48A 3EIUA 3QK7A 4NBKA 2YX1A 3SNHA 1ML3A 4BNJA 4CM5A 3RTEA 4YI3A 5JQGB 1GQQA 1TVKB 2FSHA 5KNCH 1IHUA 1MO2A 4EI7A 4LHVA 1UJ5A 4IDCA 3UWPA 4Y9UA 1VOTA 3AK4A 3EUFA 3ND8A 3AESA 1IULA 1KY3A 2IELA 1BE8A 4Z9AA 1CUZA 2Y68A 3S29A 2WSBA 3AVXA 2VP4A 4AJNA 3PS9A 4FD2A 3H7IA 4Q21A 1SELA 3QH4A 1DWQA 3IVMA 4KK4A 5ECGC 1FTGA 3PPWA 4JC8A 2C07A 3DYVA 4G24A 1O0SA 2I3DA 3ZK8A 1N1EA 2WJ4A 3K6KA 4NECA 3V4ZA 4XRGA 3OQIB 4DLAA 2PX4A 2IS1A 1KMIY 1N5IA 1J09A 1KMNA 4MOWA 1WEKA 2VL7A 5ICGA 3DB1A 1KSJA 3FKJA 1ZU4A 3BRWD 1AE1A 2IYRA 3HR4A 5A04A 2RSLA 3I9NA 3GX1A 4MTCA 4RSGA 1DLJA 2AH5A 2ZGVA 1U2PA 1E4EB 4Q9KA 1R16A 2H0RA 4MJLA 4RKQA 2F00A 3L4EA 2PFKA 4J6EA 5HQ3B 3S5UA 5KVAA 5LFAA 2DY0A 3TGPA 4KW7A 4HRVA 3L0IB 3RS2A 4NBVA 1B73A 3HVHA 2IKQA 4DJEC 4ETWA 2AA3A 2C3YA 1IVSA 5IAKA 2CEAA 2PBFA 5PNTA 1JKJB 3OZSA 4KX5A 3UZUA 1A5TA 4U9IS 1DJMA 1NVDA 2E5LB 3KWLA 1XAJA 5DASA 4EYKA 3PHJA 2I71A 4GOOD 1HBJA 1M9NA 2Y1OA 3BICA 3ZIDA 3E7PA 2GRUA 2QRGA 3KU1A 2Q4BA 1IXZA 3MT9A 2DECA 3KPYA 4ZEWA 4ALMA 2ZRPA 1TEXA 4NBUA 4PYJA 2HRRA 5ALRA 2GBLC 2W2KB 1H05A 1XYYA 4OI1A 3RU7A 4L6AA 3VR4D 1YT5A 3QM1A 3L7IA 3WYGA 1SMKA 1P2SA 4J7CA 4B8YA 1HDRA 4Z9YA 2ERYA 3BT7A 1JJBA 1BVYF 4ZZ3A 2XADA 4ALKA 2G8NA 3NH6A 3D2AA 3U80A 1IONA 1CWUA 2QN2A 4OHBA 5CVUA 1M6NA 2C2WA 4RK6A 2DTXA 3MUEA 4I55F 1WCV1 1ZD3A 3O73A 4KVGA 3Q3GE 3CH5A 4Y9DA 4M1OA 2UZAA 4J16C 2R6AA 1TTHA 4WKOA 2ZCVA 1HYBA 4WVFA 5AI8A 1V9CA 4OFXA 4WBXC 5DTMA 3OIDA 2FDCA 4HDKA 4IDBA 3QE9Y 1XZKA 1MBZA 4XRRA 4QGBA 2CY0A 4IIYA 1WX1A 2WM2A 2HAEA 3HEAA 1JEQB 4BBJA 4HDNA 1DKQA 1JSLA 1NLYA 2ZFUA 4H3VA 4M1KA 3KR2A 3V7NA 3G0OA 3T5CA 4H0NA 1O6GA 2PRYA 2WTUA 2XITA 1GL6A 1FDSA 2JD2A 2LTAA 3SVTA 3M9XA 4O08A 4PCLA 4OJTA 5KC9A 1M8PA 3BORA 2DAPA 3VVLA 1QHEA 2RBKA 1II8B 1K06A 3ETGA 4OIFA 4C21A 5KIAA 1NN0A 3I05A 1ANKA 3I42A 5B55A 1YZFA 1KMCA 2GNPA 3DKRA 4YJDA 2W42A 2CLFB 3NOVA 1R6UA 2WU3A 3H8SA 1PKEA 4GQAA 4DBZA 2JFZA 1QF6A 4A6XA 1OB2A 5IKXA 3IH5A 3ZGXA 3EZ9A 4WK2B 3CLUC 1O87A 1JHQA 2ST1A 2Y76A 4RDHA 5DSXA 4MWOA 3IB3A 3EOZA 3IPCA 4DM4A 3NBZC 4D44A 1WSAA 4UFOA 3JY6A 4PG8A 3GJSA 3H2KA 1YMQA 2WQ7A 2D0DA 4K1XA 4HUTA 1ZVMA 3D7LA 2G04A 2UVPB 2X5NA 3B78A 5AW3A 5HSGA 3L8HA 1ZIDA 2WWVD 4KGDA 2GEKA 2X5OA 3HBJA 3MILA 3PR3A 4U8HA 2HV8A 3OOYA 5JG7A 1V95A 5L6MB 3DSRA 3EC1A 5JU6A 2OTCA 3KSDO 3CF6R 5LD2C 1E8DA 5TDHA 3K70B 3KD2A 2HMWA 4V1CI 2JJ2A 1Y1KE 2VDMB 3PNBA 5EUQB 3AERB 3TNYA 5IJ9A 4GDMA 4NR0A 1XNQB 2E85A 3B89A 2V3VA 4MUFA 4AMGA 1SQ5A 5LCXA 5CFQA 4JL8A 1W88B 2O7SA 2IYPA 3ORSA 3C5EA 5KQRA 3CX3A 1E3IA 1Q50A 3E7WA 4I14A 4OQNA 2JIQA 1UANA 4FJ0A 1OGJA 5DULA 2AR7A 4QATA 5HFNA 1NF8A 3JQFC 1BQEA 3UGKA 3H97A 2G9ZA 4OKSA 1K2WA 4MVJI 3DP9A 2AV6A 5KWIA 3TLEA 1FJGB 2PBRA 3O92A 4HQLA 2P8JA 2JCYA 3AF3A 2RFLA 3JQ9A 4IGFA 4JGGA 1C41A 5LL6P 4BVGA 3A1TA 3KPUA 1P1BA 4FGZA 3D1JA 4ZPXA 1DBQA 3KSZO 3C70A 4O3FA 4AMYA 4WHMA 4BO6A 1BROA 3QE4A 5TEWA 3UFXA 4QECA 3KUCA 1A9RA 3OLZA 5NULA 4JOQA 3N2KA 1EM8A 3NTLA 1N75A 2HHAA 1W25A 3FDJA 3R7DA 2JI9A 2GK4A 3FY4A 1T5OA 1R4NA 3TTWA 5DEIA 5GZ3A 3BRQA 1Y1LA 2HWYA 4JBIA 2BM1A 3L0CA 4RHFA 1T2UA 1A2BA 1GAWA 5GV7A 5LP6C 3V8VA 5I7WA 4DSZA 1MOSA 4PGMA 1Y3CE 3QV1A 5A6SB 4QUAA 3VZQA 2NTYC 4L07A 1BIFA 3P9PA 2C00A 2AMVA 3SICE 1SUCA 1YGYA 1UFRA 3ZY6A 5BNWA 3LQRA 1RLTA 4ZVOA 2IDKA 4M3NA 2HO5A 1OJ7A 5JUWA 5EOVA 5TXGA 2QX4A 2B35A 1USIA 2BKLA 4XX1A 4Z7OB 2VSXA 1XCPA 1KR5A 1MV8A 3BMNB 4YJFB 1R8XA 4BQRA 3HDYA 3TPCA 1EVJA 2HSZA 2P2SA 1Z8NA 4OU5A 3SYLA 4HNVA 1YZHA 2GZ3A 3B2EA 4YI5A 1KDZA 3CU5A 1DO2A 4UMVA 5AXDA 5CA0B 4KQCA 2HGSA 4AP9A 2QPAA 3KS9A 3PE3A 3WFJA 1NLZA 1D7AA 4R8RA 1L5YA 1KRHA 5KTNA 2BSQA 2XCSB 4BE4A 4XTCS 1PX0A 1AUPA 1K3TA 2R00C 1XCJA 5A9TA 5G41A 4UBJA 5AVJA 4GOKA 4M1TA 1W44A 4J3FA 5CTJA 4AECA 4ANFA 2AJCA 4KRXA 3CPHA 1ADBA 4HLDA 4FFOA 2V6GA 4IIJB 3GJ4A 1G5IA 4MWSA 3LPCA 5IN5A 2X1HA 4LXQA 5F2NA 4L8VA 3JQ7A 4MCHA 1RI3A 2CCJA 1IBRA 4IIEA 5KC8A 2ICAA 3AB8A 3HCOA 1JHRA 1PJRA 4CF5A 1S5PA 4YONB 1Q0PA 3QBTA 4O4IF 3TIVA 1PFWA 4A73A 5CIWA 5LMCA 3ZWOA 1AC5A 4KBYA 1BCSA 5JTUA 2F4VB 1IJKA 5HGJA 1SGWA 1FS4A 2Q2QA 4LSGA 3W1WA 1C3EA 1NZJA 3I2HA 4O4IA 4YN3A 1MC4A 2MR6A 1KO8A 2C83A 4TSRA 1TM7E 3VHXB 2G5GX 3WAJA 1HEYA 2V8OA 2SKEA 3K8ZA 3NVMB 3OQ6A 1JJVA 4IJUA 1COZA 3FIUA 3BDIA 1H6AA 3OEYA 1UZNA 1SHZA 1F38A 2V45A 1QPGA 2VLIA 4IRXA 2QJTA 4EKIA 4B6FA 4ER5A 3U81A 1MB0A 2VSQA 1CUYA 1D9ZA 3MRSA 4H3SA 1M54A 1OFTA 2ZIEA 1FDVA 1H6CA 2I4LA 1W5FA 4XWKA 4RQUA 4GX1A 5DBIA 5GTDA 2NZVG 1LTQA 1YSCA 2QJRA 2QQGA 3KAQA 2O8VA 4H6VA 1EGQA 2B2XA 1KDPA 3GDFA 1X7XA 4GOXA 4R54A 1VDMA 1J8FA 4H16A 3EPHA 3PC8A 1XEXB 5ENVA 1MFPA 3SU8A 4AMVA 2QTRA 3M4YA 4HAIA 5BQFA 2BBTA 2OUKA 1SCAA 4WOPA 1RLJA 4NONA 2QMYA 1O6BA 3GIWA 1GAJA 3IQGX 4KDFA 4PPGA 3L18A 1A4UA 1IJFA 3M6FA 3L6OO 4DCMA 3O8BA 4MV7A 3H18A 4H27A 3HR7A 1XALA 4Q3DA 4DCOA 4BS9A 4JZKA 4EATA 1B42A 3ULKA 3AR6A 4GGMX 2KSQA 2ZJ1A 5FT9A 4I50F 1YMVA 3EVBA 3L79A 2IDJA 5SY4A 4O29A 3OOEA 4ZOBA 1CY8A 5EMMA 3A06A 2HJ9A 5JXIA 3O7WA 2HRDA 3LLVA 2OO3A 3HJAA 2P0EA 5JBNA 1PGOA 2O2CA 5MN5A 4Q9IA 3RSCA 4AN0A 1BW9B 1PJTA 2GSWA 3JYLA 3OEHA 2OEPA 3DOEA 1D3AA 3PSAA 4R7ZA 4NU0A 1QHHB 1UF9A 2CVQA 1H2RS 1J97A 3C2QA 3PNQA 1F2UB 1G9XA 4NCJA 3SIWA 2QNIA 5EJ8A 3JR7A 3TUIC 1WHSB 2OK8A 3ZDYB 1PW5A 2CJPA 3W9BA 5CITA 4PQGA 3NHFA 1BCSB 5F1OA 2LIPA 1N3LA 5A4FS 3HXMA 1Z6YA 5JAUA 5LC1A 3FVVA 1TZBA 1SCNE 3Q6IA 2A9PA 3T9EA 4I6JA 1SKAA 2EAUA 5HZKA 4DADA 3W8RA 3T06B 2NVWA 2J3EA 2BV3A 3PA6A 4G1MB 3GNTA 4W6QA 1Z0DA 4JOCA 1E18A 4UVHA 2EJWA 5CDUA 621PA 1CR2A 4NFYA 4IINA 4RZ3A 5KSYA 3V8EA 4UM9B 1I4EB 1LBSA 3UNXA 2IC5A 3I1JA 1CJUC 3F8WA 3KL2A 3QX7A 1QF9A 1ZKMA 3BWBA 4HB4A 3HBNA 4YYEA 3MMPA 4DNXA 4POAA 4MKZA 3A9SA 3WRVA 2JAXA 3ILVA 1IM8A 1L5OA 4C07A 3ZU5A 1WULS 2ZRBA 1VJ5A 3QOWA 5FWDA 4U2FA 1E63A 4OXYA 4B32A 2QZJA 2BN4A 4BHTA 4QC2A 1Z9BA 2W6MA 2I1WA 4PBTA 1D8AA 4BQIA 2FWIA 3ND6A 1SQFA 2JAPA 1O6ZA 4MV5A 1O2DA 2CDBA 1QZ3A 1TMOA 1MPXA 1V26A 2O2HA 3V6LA 5E2AA 1JA0A 3IPLA 4C1NA 1XD2B 3OBBA 1P3Y1 3C6KA 2FCAA 2XMSA 3EK2A 1N2HA 2FEWB 3ZWBA 4B7AA 5I7HA 4TTSA 3FM9A 3MNFA 1W6UA 4C20A 3GUYA 5EUCA 2WICA 4MA5A 3TNDA 1U63A 4C0LA 2QMUA 2XB8A 3O4FA 2W4IA 4ZAWA 1CF4A 1I32A 1UAGA 3PQ3A 1A8QA 4N49A 2YBEA 2NUTA 5K0SA 3NMUF 4FQ5A 1FNBA 3WGJA 3CF0A 4R2WA 1TFRA 4N12A 4PLHA 1OXSC 4RV4A 5DNUA 1OF1A 2IJGX 3FAZA 3HKDA 1N1DA 4CDMA 4IHJF 4EBBA 3C3MA 3WDKA 2GN8A 1XN1A 4G37A 1G7CA 4S1PA 3VJMA 1EHYA 3FDZA 3FNHA 3V4RA 4ZO8A 2QUIA 1Z0FA 3JZAA 4P83A 5FPSA 2MU1A 3KB2A 1U8FO 3F6PA 5E7IA 3C6XA 4L27A 3RVBA 2YCLA 1B14A 2VHQA 2Y99A 3F6YA 2FA9A 4H7DA 1LB1B 3JYNA 3FKQA 2P5YA 4KAXA 3VH4A 2XT6A 3RFVA 1CEQA 3JASA 2YOHA 1EDDA 4MVJD 1K75A 3AI3A 1KZ4A 3G59A 1JYEA 1KP2A 4FZVA 4HTAA 1IIRA 1VLVA 1B43A 2WI8A 3I83A 4KN9S 5LBUA 5EE3A 3REFA 3RUIA 3U9LA 5CURA 2YOFA 5HQTA 1M10A 2CMGA 4BKUA 4DV0B 4CYMA 3SAJA 4YX9A 2O3UA 4EG3A 4WOCA 5BSVA 3CURA 5A4AA 2WP8J 4QULA 5DW3A 3EZNA 3H3XA 5JJIA 2W6OA 2WF5A 4DA7A 3H1FA 5TLSA 2XZLA 1Q3HA 1IM5A 3IEUA 4MUNA 3BC1A 1G8HA 4D79A 1LLDA 3NLLA 3OOSA 2HU5A 2NAPA 3PQ5A 4IZHA 4LWQA 4OQXA 4Q9HA 4PSUA 4KN5A 2DU8A 1ZOSA 2P4QA 3WWYA 5ECYA 1GPKA 3IR6A 2XX3A 5ENDA 3VU3A 4J1SA 1K3FA 5F9MA 2JLXA 2W8ZA 4CLEA 1ENPA 3H6KA 2X4LA 3IO3A 3O7MA 4YCMA 2WB2A 1L7RA 3H5LA 4UBLA 4OL0A 4PYMA 1TT7A 3U49A 1IH8A 2XV1A 2ZT6A 3P5SA 3MTGA 4C87A 5BMVB 1E3LA 2FZCA 2PR2A 4DIDA 3OZGA 4EO7A 4HVLA 3KKLA 3BGWA 2IU4A 1T36B 3QE3A 3WGGA 3LDGA 4KXWA 1RAHA 4OXNA 2NV0A 1I01A 4GE3A 1KQNA 3RSGA 1XX6A 2J5RA 4C4XA 1Y4DE 1JV2B 2W90A 2GAJA 1L8QA 4IQFA 4JBWA 4MB0A 4DGSA 4DNPA 1QO7A 1ZM3A 4M53A 4C0WA 2PGXA 4DHEA 1HEUA 3AR5A 5EEHA 1J9ZA 1Q3KA 1T10A 4X5OA 3K0CA 5IBCA 1GPUA 1N6KA 1UOQA 3F4LA 3R3WA 4MAFA 4TYQA 2VDQB 1EWRA 3VSBA 4EGCB 1BOOA 1T8PA 1VZ2A 4KQFA 2V54A 2Z43A 1GQSA 2QTHA 4Q3NA 3TS1A 4FHCA 3TTXA 2VNIA 3FSJX 4BY9E 2BCEA 5FTNA 2R87A 1RWMA 3EXIA 4M0LA 4EHJA 5JXGA 2UUPA 2PUFA 1RBMA 3RUFA 3QF4B 1Z47A 4MB2A 2H1CA 4LDNA 4OFZA 4JI1B 2YNMD 5AJHA 3AESB 4D45A 5HIAA 2RK4A 2O8CA 1TE2A 2DZDA 3U1TA 1LBIA 1T5BA 4K6MA 1N2CB 1SG6A 4HYTA 2ETXA 2QOEA 3D6HA 2MSWA 3I8OA 3INYA 3N6VA 3OEWA 4NMMA 4TLMB 5JNSA 2I3AA 1C4XA 5G1PA 3AFIA 5A03A 4UJ3A 3GEDA 4P2BA 1XRPA 4TTJA 1PJQA 2PZLA 4JWTA 4LXXA 3K31A 5LB2A 1CIPA 2I6TA 2O7RA 4ZAXA 4U7WA 4TYMA 3I0MA 2D13A 3DQZA 5FYQA 1W19A 4B47A 3H2JA 1SN7A 2QIPA 4A2QA 3MJCA 3VOAA 1IQPA 5JD5A 2CLEB 1E1RA 5GVSA 2C96A 1HGXA 2OCPA 2C84A 2Y0BA 3Q7QA 5IAOA 1KJIA 4IJKA 4HDKB 1IOZA 3B7PA 1AKVA 5CB6A 2VDVE 1PSZA 4B44A 2QLLA 5EKSA 4ZHSA 1QNFA 4XDGA 5BSMA 2WSIA 5HYVA 2FMHA 2Z2IA 4F4FA 3AFOA 1JHPA 1MVOA 2GYUA 3D6NB 1HL3A 4RMIA 3T1TA 1UIMA 1NVWQ 5CFNA 2FPWA 4RTNA 1IOWA 4G86A 2K5UA 2W71A 4G1FA 1QK3A 1EFDN 1PN3A 1U2SA 3EBOA 5KREA 3F6RA 3P8ZA 4LHZA 2H07A 2WUDA 1PWZA 5K3FB 3TCKA 4J1TA 3NKVA 4LX8A 1O4VA 1XZCA 2P0YA 3CUTA 4MRRA 4CLHA 2CEKA 2DT8A 1TIPA 2QAGB 2QD3A 4CLOB 2KYRA 4CEJB 2V7UA 3GGGA 4JJAA 3PC6A 2DLCX 4EKYA 3SKXA 4WLFA 2FZVA 2TECE 1SY7A 3H5NA 2QA5A 4OHMA 5SYNA 5AVQA 2PMKA 4F06A 2Y8EA 3F1KA 1P4AA 3CF2A 3SE7A 3M5PA 5GONA 3KO8A 4R0VA 3A6PC 3DL2A 3GJ6A 2ZETA 1PFYA 4GF5A 3LY5A 5AVWA 1AS3A 4R01A 2MCFA 1TMYA 3KQYA 5LSAA 2AQ8A 1MRZA 1K3UB 2PEYA 2RGAA 2VA9A 3DE2X 3HY4A 4AURA 1SJ9A 5A4JA 2OGUA 1Y0BA 5HQJA 4F3NA 3B3JA 2WIJA 5KNDA 2BFEA 4Q6BA 1UAYA 4V3BA 3RADC 4EUKA 4B85A 2PAFA 1PR2A 3BE6A 5B6PA 1UJCA 2RHWA 4DEVA 4MWBA 5HJ5A 2HA4A 5DN6D 4IVNA 2COKA 4NG4A 1J6UA 2ZWAA 3E53A 2O5VA 2DRIA 3NH9A 2JAHA 3PCXA 2NUPA 3ZLBA 3O0TA 3WL5A 5JADA 1VB3A 3P71T 2I54A 1OH6A 3D2CA 4F9GA 2ZPAA 1T0BA 5DEOA 1CKEA 3W2IA 1T5SA 5DISB 1TQ8A 2AFVA 4Z4EA 5JCOA 4DARA 2EZTA 4M1SA 1KFKB 4M9CA 3IEXA 5B3AA 1KFEB 4NRDA 1QKKA 3ZCQA 3OX1A 2YICA 3TOSA 4CE6A 4TV8B 2RDMA 1S8FA 2GDZA 1R0LA 3VPAA 4BEBA 4D97A 5CG2A 5HRAA 1HLDA 2IBTA 4HX5A 4OGLA 4DLUA 5JAIA 2Z5GA 3UM9A 2CMHA 3I6QA 4E5DA 5IS2A 4BFYA 4PWYA 4JJZA 4II2A 3K09C 4XX0B 4OYLA 3S2ZA 4TL7A 3W3ZB 1VQ1A 2A94A 2Q0SA 5HKKA 3EGDB 3QVXA 4EYEA 4FOLA 3EHDA 4PVDA 2WF9A 2XAAA 4F84A 1U0BB 2IIPA 4OX9Y 3NASA 1HNWB 4HNTA 4FC6A 3E7FA 2C9YA 2VHCA 8MHTA 1K7CA 1N8NA 4S1OA 1ISGA 2JAOA 3N8KA 4HDRB 2XDQA 4KI7A 3TX6A 3RIHA 3D59A 4KE7A 2P2LA 2R7MA 3M6UA 1RLMA 2VDKB 3I37X 4CBVA 4JROA 5AKYA 1XMOB 1KKMA 4JX8A 5GAJA 5A3JA 5LZ2A 5IP5A 2JFWA 4WK6A 3AFHA 4TWBA 3TJZA 5C7LO 1M8FA 1EFUA 1CJVC 1N57A 2HLNA 2X8JB 3Q98A 4KYUA 4MTLA 3F9IA 2HUNA 2YYYA 3GMIA 3H5RA 4G07A 5F23A 4F5WA 1SEPA 1UM8A 1Z5UA 2Q5FA 4YAOA 2XMDA 5JBIA 2F55A 2Q5HA 2JL1A 4ZYYA 4QXRA 2IHJA 1QP4A 1C8KA 3FVQA 4QBGB 3EH1A 4CI9A 1EGMB 1U3UA 3MUNA 4IY1A 1WR8A 2GN2A 5DYNA 4X85A 2V7QD 3CONA 4F85A 2IEDA 2XA2A 1POXA 3BA6A 3IA2A 3P9ZA 4RELA 4X1KB 4Y98A 2FSGA 4GVXA 5DCWA 4DRXA 5HKOA 2RCYA 4TZTA 1BFDA 4NCHA 1PZXA 1VL5A 5B30A 3KE9A 1T4GA 3OZ7A 4TL9A 1B76A 3C3JA 1QTQA 1BGWA 1ELOA 3MAJA 1U9JA 3U4GA 3VFDA 2QJFA 3Q7TA 5JNVA 1KI6A 2REQA 2WFLA 1DLIA 1X8XA 3HV2A 3B1ZA 3OT5A 4F1JA 3E0QA 3HKCB 4MUJA 3EUAA 1MOZA 4NYMQ 3RVNA 1V2HE 2C0CA 2OCGA 1KEZA 1ADCA 2R7LA 3PUHA 1J9GA 3WIVA 1VSQA 1EUCB 2CXUA 2NU7A 3OIWA 3CTMA 4WDRA 5I8PA 3WK5A 1H5NA 1I2CA 5BNFA 3AUJB 4D5GA 1NNEA 4IGKA 3GJ8A 1MZPA 4U39A 3PF9A 3A6DA 1L1EA 1NKTA 5FBZA 4BO7A 5HCNA 5KHOC 1GPWB 1OILA 1PL7A 5HP4A 5BW4A 3IBCA 1U5CA 3ZZMA 1KYTA 1QX3A 1K5HA 3DF9A 3KFXA 3NT2A 3EZYA 3OEHD 4K26A 5CPFA 1E5XA 1XL0A 4QUIA 4C3VA 2ID4A 4P7BA 1QH1A 1FTNA 2NMVA 2NG1A 1FRFS 1XZGA 3K15A 3E61A 2QYHA 1QB8A 3LGXA 2BT4A 3D3JA 3PNYA 1VG0B 1Z4PX 4YJ3B 1XWWA 1GZ4A 1L8OA 4MV8A 3C1OA 1C30B 5CIYA 4K03A 4LPSA 1QWOA 1CB7A 2XT9A 3T0IA 4GMXA 2IY7A 3RC7A 3S70A 1K0FA 2CF6A 1KR2A 3EIXA 3VX3A 4A91A 4EITA 2P3LA 3VU1A 1SXJC 1I10A 1I2ZA 4MWDA 2WIAA 2IPOA 4W5TA 3UJPA 2F90A 3NJ4A 3SBXA 2KPOA 3F5QA 3F9RA 3WGNA 1JDBB 3DKPA 3OWHA 1GIAA 4LC0A 4PZYA 3QFRA 4IQ4A 3DUFA 1XFAA 1YBAA 4UQPA 3ESCA 1TQ4A 4AJJA 4B9AA 2OXRA 2AFHB 1I36A 3DKKA 2ZYUX 1JIXA 3TL2A 4OQQA 4GL2A 4F8JA 2OXIA 2Z2ZA 3PC4A 1H2WA 1E7YA 3BCHA 3OQPA 4YMGA 3MTJA 5C9ZA 5EWMA 1R00A 1UZUA 2VK4A 5KPJA 3RSQA 4D3XA 3AHJA 1HDGO 3I30X 1BMDA 3BL6A 3DHEA 4HDQB 2PMEA 5SZKB 2C4UA 3ZKAA 4YR9A 2J4DA 4KQKA 5EGNA 1YC2A 1FLNA 2XPCA 4H6XA 2DWQA 3MCAA 5J40A 5SZJA 5IF3A 2VF7A 5FI5A 1PYDA 3PEUA 3PDWA 2ET6A 3R0IA 4IW3B 1WMDA 5IMBA 5ULLA 5MN6A 2D1QA 1YACA 2YZ2A 1QIEA 3NCHA 1V45E 2KWIA 4K9PA 2YIJA 1BN6A 2VHTA 3KUDA 5EZYB 1R50A 4QHTA 1AURA 1A9QA 3K35A 3ZV4A 1PE0A 3GDGA 5FB3A 3TOVA 1B6GA 1XTQA 1JPVA 2DBYA 2NACA 3LXXA 3NRBA 2M9MA 1G8SA 4RTQA 3IAS1 1D6NA 2JANA 1IN7A 3OJ0A 1TZKA 3PHCA 4JVOA 4WUTA 4UOQA 2NSLA 1NPTO 4G8BA 3BDAA 2Z3ZA 1G9TA 1GKYA 1EK5A 3AEUA 1CZLA 1ZGBA 3PXGA 1M1YA 2R4UA 2IX3A 1DFGA 4UD2A 3P97A 4GGPA 4G89A 1TEHA 2OM2A 4YJHB 4Q03A 5LR6A 2CDAA 5IG2A 3TF5A 3NT5A 1JKIA 4XSVA 1SOVA 3QHAA 3IIEA 3KWMA 4KB5A 1E32A 3LI2A 1VJDA 4TZKA 2PKEA 1L0BA 4QOEA 4ARBA 2UU9B 5I7AA 1ZK0A 1TI7A 1XVLA 2CJWA 3WBBA 2EZUA 4IHQA 4ME6A 4ZA2A 3TEMA 5JSZA 1CT9A 3I34X 1PSDA 1JN0A 1U3TA 3IAUA 1Y6ZA 4FCCA 2Q5QA 1WJGA 1X2BA 2A9RA 4I4TB 4OAPA 5K2OA 4RTRA 2H2FA 3DM5A 4YUYA 1TTQB 3FTDA 3SR4A 5B7PA 5FPHA 3KEFA 3TZQA 1N0IA 1L5NA 3P4YA 2HIMA 4MYDA 3EYWA 1X9HA 1XRNA 2H0QA 3DEZA 2Y4OA 3NOXA 3V48A 2SKCA 4BNIA 4YQZA 3BSFA 1Q0HA 1GGHA 4KSYA 4OB7A 5FI3A 1MD9A 3TE7A 5G3YA 3X1ZA 4M0CA 5DK6A 1XPUA 1E2BA 1ZCZA 1EFVB 4XGRA 3GLHE 2B8NA 1L5VA 1O77A 1W0KA 1TLFA 1R5NA 2PKCA 2WMOB 3O1JC 4WSOA 4XIGS 5CEFA 4UQLA 3FFWA 2GASA 2FFHA 4L9SA 2IUTA 4FFBA 4IPTA 3WL8A 1QIGA 4CMEC 3CCFA 3CLRC 1JVBA 2QN9A 1H1LB 4GLBA 1F8XA 4I6GA 4ZOAA 4OQYA 3AI1A 3NC1C 4QYIA 2OCKA 1NW9B 2HEGA 2Z3VA 4FHZA 3CVOA 2OXEA 2J3MA 3KYDB 4FYWA 4GAEA 1DDGA 1S2MA 3IUNA 4EG0A 1E1CB 2V8BA 2HHJA 1D04A 2NM0A 3BJIC 4TUYB 3VBEA 2VT3A 2QUBA 1M1YB 2B5WA 2IIVA 4HQOA 2GAAA 3E22B 3R5HA 4KYTA 2DC1A 2I1LA 2HJHA 3O4VA 1M2FA 3CX6A 3LT1A 4TYWA 2XYPA 2Z5VA 1EVIA 4XM0A 3WNBA 2BLNA 4PIPA 1OLOA 3BXZA 2D2FA 3HB1A 4X92A 2HMUA 4RSMA 1C29B 2V1XA 2PXAA 1EP2B 3ECCA 4GNRA 4RPLA 5SY9A 3I9KA 4F46A 3O3OB 4RPKA 4EVSA 4AXBA 5A6VA 2A1UA 1JFTA 4WINA 3PVSA 1QGAA 4FFDA 4B6OA 4QTYA 4J0FA 3VTFA 4HNGA 4D8UA 2L42A 3QJ5A 1DT5A 3HVRA 3FDZB 3LT0A 4DSOA 1JYSA 1VHLA 2B37A 4PC6A 3ANSA 1U0HC 3GMSA 3OTIA 7MDHA 1SRQA 2PLFA 4DLVA 3KXPA 1SXJA 1ZR2A 1JQKA 1QHXA 3F5MA 3I04A 5BQ5A 3ICWA 3M6XA 3V9PA 1YV9A 3G17A 4B82A 2O06A 4ZT4A 3Q0TA 3TLJA 2YYZA 1TRKA 3U7EB 3SX2A 3I64A 3LS2A 2WD8A 4GU5A 4BMCA 3T7IA 4BMNA 2VUIB 4H1VA 2JGFA 3TW8A 4A0FA 2Q3JA 2CVHA 2VJCA 2IZZA 1DAPA 1GU1A 4AO6A 1XTIA 4RM3A 9GPBA 3NORA 1NXQA 4LC1A 1LV8A 3VNQA 3BB3A 4CG1A 2Z6QA 4H0FA 1ODCA 3DO6A 5B1YA 3KJQA 4FSXA 1PR5A 3AETB 4F21A 1T8RA 3WHPA 3LYLA 4KR6A 1GA6A 2C1EA 3GW8A 1UOOA 2QT9A 1POWA 1ZN9A 3AP3A 3FCUB 3B52X 1GG2A 5A0FA 3HM2A 4CCAA 2GERA 1R6DA 1IXRC 2K2WA 1HT1E 3LUHA 4KQ6A 1I1QB 1NTRA 5HJ7A 5KUTA 3HUDA 5JI3E 4IVQA 4LJKA 2XKBA 1RLIA 4P80A 3UXHA 1RTKA 2UYGA 5BUZA 3I5MA 4YC7A 3A1VA 2IUSA 1TKRA 2R7AA 2EWMA 1EP3B 3B1XA 1QVWA 3KDAA 3T9AA 3ROTA 5K6RA 4MI1A 3BWYA 3BRSA 2BFOA 3ONFA 4YMSA 2PSHA 5I9TA 1JXQA 2BD0A 1M67A 3CF4A 3REQA 1M34A 2GXAA 3JATB 3B3GA 3AG5A 1A69A 2YWDA 4Y1RA 5K6AA 3A2KA 4CLDA 3ZN2A 5JSKA 1Y3AA 1Z36A 2WRZA 1Q1ZA 1I0ZA 1DARA 3GT0A 1K89A 2NU9A 1XCBA 4ALLA 3KX2A 3VNBA 2QXTA 3OTQA 2NZYA 3U3KA 4Z9BA 4KHPB 2GBLA 2J9FA 1N78A 1GXSA 3H8JA 1G5HA 4FEAA 1J8YF 2A4MA 1ZK3A 3T38A 4I6EA 1WCXA 2OBNA 5HM6A 5CDTA 4S1VA 1Y1PA 4FX2A 1NN3A 1YR6A 2F3PA 3WSVA 3HCRA 4KJZA 2P9QA 3MXOA 3NXKA 1E3WB 2ZWPA 4XW2A 5J2UF 3T61A 2C59A 1AIPA 4M6WA 4CMGA 2WNHA 4RH1A 5D3ZA 1ZEJA 2FVXA 2I6UA 2NSDA 3EXIB 5DKFA 1W7AA 4C88A 2OE2A 2P40A 1TUIA 1OI4A 1X1CA 2YN4A 4EW1A 1XAHA 3L6CA 4J16A 3C98A 1F5SA 4AKIA 4XSGA 2NUAB 4OUKX 2A33A 4KREA 1O58A 4NE7A 2X15A 1CQPA 1HEIA 1Q6YA 1CE8A 1DC7A 1OU4A 2WJPA 1A1VA 1CF9A 1AKUA 2QTWB 2TRSB 1H3NA 3PGXA 4LYFA 5JR3A 1H2ZA 2C58A 4JJ6A 3CEMA 1E2NA 1OX4B 5KINB 4XB6B 1Y4ZA 4RETA 3UT5B 1GU7A 1WV0A 2GJAA 2YY6A 3C41J 3BEDA 1V11B 2PGLA 3SF8A 3L7LA 4J94A 3DZGA 1O8BA 3ZS9A 3K6SA 2ID9A 1WHTB 1KMMA 2WMDA 4IKEA 4ZTZB 1B6TA 1QK5A 1Z2CA 2Z1NA 1U3WA 3IP3A 2YIVX 4IP0A 4OHCA 4EM6A 2F43B 1I3KA 3TSWA 4XARA 2ZIFA 4DMGA 2EX1A 1R4MA 3C87A 2G5TA 2I4NA 3H1TA 3CVUA 4FMCB 3S2EA 1Z6PA 2X3FA 1S9DA 4JITA 4LWOA 2PUAA 1WIWA 3GFPA 4PG5A 1VYUA 4M8SA 1YFLA 1LPSA 2OLEA 3EFHA 2I8AA 2KMLA 5KNBD 2CT8A 2Z83A 5CT8A 1MX5A 3AVVA 4JGBA 1HSZA 3NDBB 5I3ZA 1LK0A 1OYOA 4J7UA 2WTXA 4BYGA 5TQ2B 1BMQA 3OOJA 4OOEA 5TE9A 5IJAA 4EY5A 4P7JA 3EVCA 5D5HA 1N8TA 2VPZA 2VBCA 4B09A 2BE9A 2OV6A 2NU9B 2YVAA 3CS3A 3GT7A 2BWJA 4DMMA 4EFNA 1E5TA 3PWZA 5A71A 1YJBA 3E23A 1TPZA 3AF1A 4GRAA 3RO7A 1RC8A 2VUHB 1TIKA 5DWDA 1GSAA 1T0UA 1T6XA 3D6MA 4D4HA 4MXDA 4W5WA 5AJWA 2JCSA 2B21A 2FF7A 1A7UA 1IG3A 1HKHA 1EJ6A 2IUFA 1PS0A 3HV0A 1I7PA 2QT1A 3K1ZA 4M9XA 5FTWA 1I1HA 1QPBA 1UMDB 4LWPA 4AQYB 5IARA 3NTQA 1RXUA 2VPPA 2AK2A 3RODA 4BQSA 2GTIA 3NDIA 4WN3A 3TJRA 1MW9X 4TQ9A 4HLNA 5FL7A 1G7RA 2YVLA 4QDUA 1L4YA 4EFDA 2FZGA 1BWQA 5AKIA 1UK6A 4D81A 4F4IA 3U19A 1GT6A 4EAQA 2Z4RA 1T2FA 3VR3A 3V32A