4HB3A

Crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb3A00
2O5VA 3B7GA 4G5SA 1VIYA 2QTVB 3LFUA 5TDHA 3ZS9A 1VG1A 2ODWA 1VCIA 4II7A 4NBSA 3U5ZB 1KSJA 3FFBA 5KYKA 3FDIA 1NJFA 2QUZA 1JXMA 3REGA 1HTWA 4Z8XA 5DN6A 4V0KA 1GILA 4BLRA 3U44B 5E95A 2N1BA 3K9HA 4PPGA 3T1QA 3IBGA 1XZQA 1RJ9A 1AQYA 2FZLA 2ZAMA 4PAMA 4JVNA 3MGCA 4HUTA 3A8TA 3X1ZA 2QGZA 4DLYA 4TTPA 4B74A 1Q1QA 2VL7A 3AH8A 1WRBA 3IKJA 2JAQA 5AJYA 4D4KA 1EXMA 2XB4A 2GXSA 4H1UA 2V9PA 2ZEJA 1CJTC 3DO6A 2YWHA 3KTAB 4BLPA 3VKWA 2QAJA 4US1R 4M4SA 721PA 1A5TA 2WMOB 3CUEF 5EXXA 3U3KA 3ZH9B 3BGWA 1YZUA 4LCBA 1ZD1A 2O8BB 4BFUA 1DO0A 2IA5A 4MKIA 3EZFA 2A7QA 5BN5A 3F5FA 3QIAA 2AR7A 4FMCF 4MDEA 1CRPA 1AIPA 2EU8A 4A9AA 5JECA 3Q5EA 1OB5A 3SYKA 4D82A 1F2UB 2ZR9A 3SFZA 2F9LA 4PTLA 5JWOA 1KY3A 3GD7A 1E79A 4U7DA 2GZHA 3RC8A 4GBMA 4R98A 4BQSA 3BE4A 3GFTA 2J41A 4LRWA 1ZMXA 1XTRA 3GLFA 1M8PA 2W6JA 4KLZA 1XEWX 1ZW6A 1PZNA 4KHZA 4RZUA 3X1DA 1R0YA 5JS7A 1F6BA 4O2LA 3A1UA 2OG2A 2JJ1A 1E2MA 3N70A 4TT3D 1N2CE 3G5UA 1U90A 4QHTA 2NPFA 1GL9B 4PXAA 1OIXA 4TQUS 3KKMA 5EE0A 1FFHA 4Q4JA 4LYAA 2NGRA 4MGKR 4OHZA 2REXB 4B48A 1KK0A 2F1JA 3FHOA 3LD9A 1KNXA 2FGJA 1R7RA 2KSQA 1LTQA 3FKSA 2GESA 5DSZA 1R8QA 2XNDA 1C9KA 4O25A 5AUQA 2CVHA 1Q44A 2ORIA 3B1YA 2JLWA 3TNFA 4JL8A 5K8TA 3PEYA 2BHRA 4GDFA 2XOKD 1N6KA 2A5FA 4DWJA 2ZS8A 1YQTA 1QG4A 2GK6A 2BEJA 3MG9A 1U94A 3VU9A 3EPHA 2FEOA 1R10A 3QOFA 2ZUDA 3AVUA 4WBSA 1EWQA 4H9GA 4W5HA 4ASUA 2WWGA 4H1VA 1TU3A 4AWXA 3JVUA 4E09A 4Q7MB 4DJTA 3N2IA 4EDHA 3AKCA 3K9LA 1AA9A 1BKDR 4GP6A 4L16A 4B33A 3NVAA 1R0ZA 4EKDA 1KAOA 2CVFA 2W6ID 5FL3A 5CIQA 3U44A 1G16A 4Q00A 2OBLA 1N6IA 1R0XA 3LY5A 4LHZA 3BD9A 3ZDQA 4Q19A 1XXHB 4LJ9A 521PA 1LF0A 3R8CA 4CEJA 1E1RA 2JLRA 3SI7A 1A1VA 5L3SB 4TN1A 4DLXA 1M74A 3ASZA 2O8CB 2D7DA 1Q22A 3ICQB 1J8MF 3B5JA 3I4LA 1E0JA 2ODEA 2XNSA 3KTAA 4HB2A 2E87A 2GEVA 2GTPA 4CT4B 1L8QA 5CYPA 1WB9A 3U7GA 2O8BA 1DS6A 2FPLA 2FA9A 2J45A 2ZSDA 5SZHB 2BCJQ 2FSFA 4DCVA 5DI3A 3NDBB 1E0KA 4HB4A 5SZJA 3L2OB 4EUNA 3AKDA 3OEEA 4W7SA 2O52A 4HAXA 4HUQA 2FPMA 4UNPA 3R20A 4ABYA 1QHXA 2O8EB 2QSYA 5JJKA 3QG5A 1F2UA 3VX4A 3EXAA 3I72A 4Z1MD 3THYA 4QM6A 4MA4A 2HYIC 4N0EA 4F4CA 1E0SA 2H16A 4JKYA 3R7WB 1SULA 4URUR 4NCIA 1RRFA 5KDLA 4AKGA 2XZOA 5D3QA 2VH5R 1E96A 4UXJA 2A78A 3AP2A 1VCNA 4LV8B 3WRXC 4I81A 3ZIAD 2ZJ2A 2QE7D 2GZAA 4E07A 1WBDA 1TQ6A 1UBEA 2ERXA 1S9HA 5B30A 3QNUA 3F3YA 2X2FA 5G41A 3I3SR 1TX4B 4LPSA 2PZGA 1MABA 4B2IA 2H92A 4ACBA 3TIFA 5L3VA 2C9YA 1J7KA 3EC1A 1U9IC 4M53A 2CBZA 3T12A 1ESMA 1SZPA 1TAGA 1Z6YA 3V4FA 2ODBA 4MGYR 4NPHA 2P6RA 3CO5A 4CEIB 2P65A 1NLFA 1YZNA 4U5XA 2YOGA 1MO6A 1YVDA 4ARZA 2O8FA 4X8HA 1IJEA 4YMSA 1CU1A 2FFAA 2FF7A 4JLVA 4L9WA 2BJVA 5JZVA 2GZDA 3W34A 1N6OA 1ZM4A 4GSYA 1N5KA 1Q1BA 1KSHA 3W6OA 1EGAA 3GLHE 4B75A 3QSYA 2FFHA 1UEIA 2ZRFA 3VNUA 3AUYA 3FTQA 3LBNA 3FOZA 2A5GA 5JLJA 3KXLA 1G7SA 4DSUA 4TYWA 3GEIA 3QXSA 3SJCA 5KU1A 3RVBA 3TR5A 3SS8A 1NIJA 4A0HA 2YC4C 1AZTA 4XWKA 4FN5A 2C03A 2AWOA 3BXZA 3NWJA 1WP9A 2H17A 3I73A 1T9HA 2HDNB 5J5CA 3VR1A 3TAUA 3G0HA 5FPYA 4G5RA 4JBYA 3CPJB 1XZPA 5LB4A 1ODFA 4QKQA 2FZ4A 3H2YA 3KB1A 4PQRA 2ZI6A 1CJVC 2Q21A 5AK0A 5IK2A 3NBXX 4IXNA 3TKLA 2O8CA 3SDZA 1K8RA 2VF7A 4V0MA 1Z63A 1XEXA 1KNQA 2Q0HA 2A5YB 1NSFA 1E9AA 3QKSB 3GLGB 4GRAA 1NMXA 1R5OA 4ERNA 2OFOA 3CH4B 5E7IA 5GVRA 4A0RA 3UMSA 1OHHA 3UMRA 1XJCA 2HUPA 2CNWD 5C46F 1C4OA 1SVMA 5GADl 2GK7A 3GEHA 1X8KA 2JATA 2JASA 4CF7A 1YZTA 2GEUA 2VLIA 2WJJA 2J1LA 4DCSA 2YOFA 1DOAA 4BASA 4BFSA 5JJLA 2WZQA 4Q4LA 1XP8A 3I8XA 1KY2A 3R7WA 4OQMA 3PEWA 4PR0A 2BOVA 4I1VA 3VHLB 1XJ0A 2H57A 1W2HA 1JPJA 1P60A 1XNJA 4URXR 3HYRA 3NH6A 1TQ4A 4BWYA 3ZD7A 4JL6A 2DFNA 5J4YA 4JVLA 1Z6TA 3OIYA 2FOLA 1CLUA 2JIZA 5KPJA 4KCGA 5FBWB 3EA0A 4MQBA 2J7PA 1ZNYA 3JZMA 3ZS8A 3ADDA 2OCYC 3W8NA 4A6PA 2IYZA 4C0KA 3PITA 4F38A 3TMKA 4TLEA 3QF4B 1IY0A 4CEIA 2V6JA 2BBOA 4BLSA 3UANA 1YRAA 1YR7A 2A9KA 4Q9HA 2R2AA 1E9CA 2P5TB 2B8TA 5EE5B 3LAWA 5CM9C 4J0QA 2ZRLA 4JVSB 4CZ2A 3O47A 5H68A 1JR3A 2GAOA 3RNLA 1GWNA 4DT1A 2QP4A 4YC7A 1CR4A 4C0LA 2C2HA 1Z22A 3OAAA 4C2TA 3GLFE 4Q02A 2C78A 1G6OA 1T8UA 4NL4H 4Q48A 4PAQA 2RKOA 2ZYUX 5EXSA 3EA5A 5CDFA 3TUZC 4QJ3A 5KDOA 3CRVA 4BLQA 5AUNB 1ZM9A 1I4TD 4KLNA 1Y63A 3L0PA 4RY2A 1P9WA 2CL6X 1L4YA 2Z43A 2R6GA 4YMTA 3EG5A 1ZUHA 3EZ9A 4Q9LA 2FDCA 2PZFA 2W0SA 1E3MA 2ZTSA 1KOFA 3GFOA 1H8HA 1N3BA 4JL5A 4C0JA 5JBQA 4DEXA 2WICA 1J90A 4KFUA 4M1YA 4EFMA 3D3QA 2AN9A 1F2TA 3SJBA 1DAKA 4Q18A 4WAUA 5IT5A 2CK3A 3U3RA 3RANA 4JYCA 4WA7A 2GNOA 1NKSA 2R6CA 5JI2E 2PL3A 1ZM2A 1IN4A 3KQUA 2AD1A 1HT2E 1WXQA 5AUPB 1QG2A 3P20A 3T5DA 1X3SA 1AGRA 3C8UA 3F0TA 2HCBA 4HAYA 4TLBA 4ZKEA 3WNDA 4JLDA 2ZQ5A 4M22A 2YWEA 1TEXA 1IM2A 4IFEA 3AGQA 3QVVA 5GJWC 3ZZTA 1RE0A 1Z2CA 1QHHB 1NN0A 1HUQA 1VYVA 2WHXA 4RZXA 4B44A 2VEDA 1IN6A 2A30A 1ZIOA 3U4QA 1J2JA 3P4YA 4I1OA 3BH6A 4P3YA 1MKYA 2CL7X 4DLSA 1Q1EA 1X8JA 1HYQA 2H5EA 4BECA 3OZXA 3MJRA 2G0TA 4URVR 4A4DA 4LHYA 2IWRA 4IRUB 3CRRA 1M34E 3B1VA 2ZI5A 4DRZA 2ZYTX 4L9SA 2PMKA 4DIDA 4FMCB 1H8ED 2ZI9A 2GRJA 1N0WA 3B85A 2IXEA 2GCOB 2NPIA 4R71A 1W2GA 4HB3A 2E1RA 2ODNA 3DL0A 3EW9A 2C8VA 1CXZA 2A3RA 1KKMA 3ND9A 4Q4HB 1W36D 4PPFA 4QGHA 5IHPA 1E4YA 1ZD8A 5M04A 3UPUA 2LKCA 4UNQA 2ZSAA 4IOMA 2OV2A 4ZKDA 1NVXQ 2IYLD 2EFHB 1ZNZA 2XAUA 2R44A 1JPNA 3C5CA 1KI1A 5C4GB 4QL3A 3NTUA 3RABA 2IUTA 5BN3A 2DBYA 2EW1A 2GJSA 4IVPA 2FGKA 1OYYA 3A4LA 1W47A 4XIGS 2WM9B 3RHFA 4OJKA 1IY2A 2B6HA 2IEYA 2ZRMA 4FXPA 4NKRA 3FGNA 4MYHA 4S2EA 3OE7D 3IILA 1AS3A 3QE0A 4QBIA 4ZCMA 1NIPA 2IYYA 3CX8A 2YVUA 2V8OA 1JXOA 1R2QA 2AXPA 2IBMA 1R6BX 4YXWD 4EPYA 1CIPA 4RD4A 4HEJA 1G3QA 2JLXA 5L8VA 1OIWA 1OJLA 3A1SA 1KI6B 4LOAA 5FR2A 2EWWA 1G17A 4XWAA 3R9XA 3HU2A 3GQBA 2V4ZA 1GRRA 4PAOA 4M8NE 3KJGA 4IDOA 4OHYA 4KBGA 3T06B 4BRUA 2HT1A 4W5WA 3NC0C 4KAXA 3LH5A 2F3RA 2QP3A 4LJ7A 2F6RA 1XFAA 2NOAA 1EK0A 3VR2A 2WWWA 4GZMA 2IS1A 2VQSA 3CWQA 1WQ1R 1R4AA 2QMOA 2Z4RA 1FW6A 4TMKA 1QHHA 4PC2A 3VR4A 1YR8A 2PZEA 1P4SA 2QSZA 1P9NA 2UKDA 2WMNB 3KL4A 1W4CA 3IEVA 1CEEA 5CITA 4DXAA 5EXPA 1DAMA 2QT0A 4ZPXA 1JI0A 1OXUA 5FPSA 3ZQJA 1XXHE 4CDGA 4QBGB 2BBSA 3NBYC 2OBNA 4IEEA 3TSZA 3EWAA 2GXUA 3S1AB 1SQ5A 3L0OA 4V0ME 1RFLA 1CJUC 4F4IA 3OHMA 5C4MA 2RGEA 3U7HB 3KJEA 1PV4A 1KI9A 4EPXA 1IXSB 1XBTA 4TSFA 2ANCA 3MRSA 4UNRA 3M4YA 4V0LA 3BB1A 2GCOA 2YHSA 1XMJA 4MRRA 1N5JA 4HDOB 3N2EA 1G8FA 1XTJA 1GKYA 4PHHA 2KB0A 4G5GA 3C14C 5CLQA 1QZXA 1FP6A 3U7EB 5JWRA 4Q4HA 2C95A 4DLVA 3BFKA 2C77A 2JDIA 3IBYA 1EFRA 4ZI3A 4JLKA 1U99A 4GOKA 2OCPA 2R6AA 3TQCA 1BMFD 2P2LA 2XB2A 4PHTA 2AK2A 1P2TA 1GM5A 2CJWB 2CLSA 2FV8A 3PENA 2ZU6A 4F91B 1CJMA 3TJZA 5KUTA 1ZUIA 1Z06A 2UZ3A 5JI3E 2GCPA 5DISB 4PANA 4JMPA 4XTCS 1Z6GA 3I8SA 1QVAA 4D6PA 3EC2A 1M6NA 1FX0B 1D9XA 3T61A 5SZKB 2CDNA 1RVDA 1SXJA 2JLSA 1P62B 2JLYA 4AI6A 1Q21A 4HSEA 5FI0B 4LV6A 5BYJA 2RMKA 3AP1A 4RFVA 4Q1BA 3OEHD 3Q3JB 1KI6A 4RJLA 1NBMD 4ZI2A 4Q7JB 1MRSA 3GJ0A 2IS2A 1UF9A 3P27A 5JRZA 3Q7QA 4KXFB 1Q0UA 4GI7A 5FPHA 2AFIE 2HLDA 2AXNA 3ASYA 4FWTA 3VR3A 1DG3A 4QRHA 3VHXA 2ZSFA 3LNCA 3LX8A 3FB4A 3D6TB 1JR3E 2REBA 3RAPR 2PCLA 3DKPA 1E2DA 3Q9LA 3ZQ6A 4DDWA 1LB1B 3HJNA 1TQ2A 4P31A 4WIAA 1HE8B 3DZ8A 2REOA 4QHSA 2WKRA 4O2RA 4FINA 1SKYB 4HB0A 3TW4A 3AUXA 1WA5A 1G6HA 1IN8A 1FL9A 2O0JA 2ZRBA 1V43A 3NDPA 5CDFE 3T1TA 3ZZUA 4QGAA 2RGBA 2YNMA 1MO5A 1UAAA 1A7JA 4TL7A 4MUBA 2WWYA 4OL0A 2WJGA 5FOVA 4KU4A 5L3QA 3PEVA 3WYGA 4RCYA 3OFNA 2AKYA 3LQRA 2Q9BA 1US8A 1X1RA 1R5NA 1OW3B 4Q1CA 3KKOA 4QG7A 3X2SA 4X8MA 1LS1A 4DDVA 4Z54A 1N6LA 2CE7A 3T5GA 2QI9C 4C0SA 4ESHA 4L8GA 4LPKA 4Z8YA 3O8CA 3RYTC 4WZAE 5UKDA 2QROA 1CBUA 5FFMA 2LWIA 2HT6A 5FOWA 2BBWA 1YE8A 4FMDB 2R65A 4E03A 4M1MA 3LX5A 4XD7A 1U81A 3GLGE 2F3TA 4AURA 4B34A 4IDPA 2ZE7A 1CJKC 5KNDA 4AKHA 5HTKA 5CJ2A 2F43A 4F93B 2DFKB 1G1MA 2CCKA 2ZVPX 2ZSBA 4WXPA 3TVTA 5EE3A 1GTVA 1G5PA 3VTKA 2IS4A 2IUSA 1YRBA 1E2HA 2IYSA 1OLOA 2YZ2A 5K8UA 2QPOA 3VKGA 4OHXA 421PA 4W5JA 3KFXA 2WJHA 1E9RA 5FTJA 2QENA 2J7PD 3BORA 1A2KC 1G3IA 2ZJBA 3CNLA 1X86B 3OESA 4Q1FA 2DYKA 3JVVA 2NQ2C 2VRWA 4LBVA 1G7CA 1DPFA 1H65A 2CJWA 1Q3TA 2AWNA 2EYQA 2CLCX 2GJKA 2D4HA 2HXSA 5KSPA 2Q3HA 3SJAA 4PPQA 2FSGA 1NG9A 4M1SA 3ZGXA 1PVOA 4TLDA 1S2MA 2OAQ1 1B23P 2ZROA 1YR6A 1FX0A 2DPXA 2N42A 2V54A 3FMPB 4OJQA 4EPTA 2PCJA 4EJSB 2IS6A 1ZCBA 4M2LA 1ZU5A 3GJXC 2F1RA 1TF7A 821PA 2FU5C 2QQ0A 1VPLA 4LJ5A 4AYWA 1COWA 1AJEA 4QNMA 2IC5A 4A8JB 5IRCD 1LY1A 1NP6A 2FE4A 4RSGA 1ZJ6A 3QXXA 1W44A 1E98A 2WPDD 5J40A 4DUGD 1CR2A 1RKBA 5KTYA 1N6HA 1G8PA 3FKQA 3HU1A 4BEBA 1GDDA 3CRW1 3U3MA 4A2QA 5C1BA 2JJ2A 2BMJA 1KDRA 4DDUA 2OXRA 1IHUA 2PBRA 4U02A 5EZ6B 3K70D 1NSTA 4B73A 1VG0B 1F48A 4QJ5A 1HA3A 1T3SA 4DCTA 1AGPA 2ZR0A 1B0UA 1NI3A 1FTSA 1LNZA 3PFIA 2O0KA 3J81k 1QHSA 3B1XA 2C5LA 2GETA 4Q66C 1KJYA 1QHIA 2E9SA 2YJTD 2QL6A 3GJ3A 2KBEA 2G1JA 1Z47A 5B57C 1JJVA 1MH1A 3LW7A 5J4VA 3GPLA 4JIMA 1FOEB 1K5DA 2ZRGA 5H8WA 2ZSEA 1Z28A 4B32A 4NCHA 2NZ8A 3KKNA 1E2GA 1UPTA 1NMZA 4P32A 3AGPA 4XOIA 3B1ZA 5AR1A 1Y3AA 3MWKA 2BV3A 3OIUA 3QXCA 1T0HB 3U6KA 2IEZA 2NO0A 5HKKA 4LZZA 2J7KA 4OI0A 3T35A 2VHCA 3QVUA 3QXHA 4A2WA 4CRWB 3N5CA 2V1XA 2ZRNA 1P72A 1TF2A 1S8FA 2ZETA 4TYNA 5CIWA 4C0HA 4KITB 4GP7A 3PG5A 1OV4A 5GJVC 1XPOA 1TQDA 1TEVA 1KO5A 3H86A 4EQ6B 3IPYA 1RW4A 3V4RA 4RD1A 3CH5A 2RHMA 2VBCA 1ZNWA 4DLZA 3CPHA 5FUYA 1BYIA 1E9SA 1D8TA 1CR1A 3AVPA 4DC9A 5GVSA 1IJFA 3EPKA 1E2NA 3H0KA 3KB2A 3BJIC 2FNAA 2F9MA 3MD0A 1NMYA 2ZUCA 2IUUA 4Z51A 3SOPA 1G7TA 3P26A 2W2VA 2XTZA 4Q5IA 5EXTA 4HYYA 5FBRB 2VP0A 4TL9A 1XX6A 1NY5A 4XH9B 3CWZA 1KAGA 2QPTA 5TARA 4JYBA 4UJ5A 3KKPA 1S4QA 3O8RA 3PQCA 4B3GA 3HR7A 3U6BA 4TZ0A 1IN5A 3U60B 3TAHA 5DHFA 1ZAKA 2NZJA 1Z0IA 3PR1A 1HEIA 2QM8A 1G8GA 2H8KA 1UKEA 3LW8A 1Z0FA 4DDTA 3AP3A 1DAFA 1G3UA 2HJGA 3KKQA 1M7GA 4ITRC 2NO6A 3A6PC 4IKEA 3VFDA 4P4TA 4GL2A 3HR8A 1KKLA 3RSLA 1SXJC 5EQTA 1OE0A 3EASA 5CLLA 2ZRIA 4HZUB 1VHLA 4BE7B 3UXMA 3LDAA 1I2DA 1CRQA 2OE2A 1JQJC 1MV5A 1PUJA 4BLTA 2LKDA 1W0KA 2VP9A 1RC8A 5D3MB 2R6FA 4LBZA 3AVOA 4QM7A 4A82A 3FYHA 3RS4A 2D2FA 3SYNA 4IDHA 4YQFA 3LBIA 5DE3A 4YDSA 2ERYA 4B3FX 1G4AE 2MMGA 4PC7A 5DHAA 5KNBA 4LV5B 3R9WA 1VYTA 5JEEA 1U8YA 2V7QD 3L82B 4OYHA 3RS5A 1EX7A 1S96A 3O8BA 1JECA 1XEWY 3TSWA 5IDVA 3VNVA 2I4IA 1OH8A 1KMHB 1RZ3A 1U0HC 3LQQA 1QVRA 1S3GA 1VYUA 3QKRB 3SNHA 1ZYUA 4B43A 2WSSD 2VPPA 1SXJE 2YKGA 1Z6XA 3FE2A 2FFQA 3ZYCA 2DWPA 2GXQA 4IXMA 4TTRA 4JLBA 5KO2A 2PEZA 4U00A 2QAGB 5DYIA 4ZDIA 1DELA 3UG6A 4R9UC 4JJKA 5JCZA 3SR0A 1WMSA 2J87A 1Q20A 5AJZA 2HYDA 4K8OA 1TNDA 1E2FA 3H1TA 1W7AA 2FJUA 1GAJA 1E1QA 2C9CA 4HLUA 3THOA 4EQ6A 5JJIA 1NVUQ 1VG9B 2AX4A 2VP4A 2MSEB 4Q7KA 1P75A 1XXHA 4I99A 1JEDA 2IYXA 1VTKA 5FOXA 1QHGA 2QEQA 5JCPA 4JSYA 1OKKD 2J9RA 5BXQC 5FTMA 2WWHA 2QMUA 2J5XA 5L3SA 2RGXA 3TR0A 3A4MA 2X1VA 4C0BA 2GF9A 3K1JA 2XX3A 4TSFD 4DEYA 2DR3A 3BH7A 2EFDB 1D9ZA 4NDZA 5FL7A 1EFCA 1HY3A 1XMSA 2MSCB 1CF4A 2QP9X 4PZZA 4R7ZA 5FPTA 4FMDF 1W5TA 2FG5A 3W5JA 1JBKA 2ZR7A 5A4JA 2VP6A 4B2PA 1W0JD 3TH5A 3GP8A 2VP2A 3ETLA 5ANRB 2UZIR 1GNPA 3EWSA 3FMOB 3KQHA 3ECCA 2O8EA 4JVMA 4Y0AA 4M0LA 4PPNA 2C04A 4B3DA 3B60A 3CR8A 1VECA 4XWOA 5BW8A 1RRPA 2YYZA 3TRFA 1KO7A 2KE5A 4TWZA 2WOOA 4RD2A 2GCNA 1SVKA 2N46A 3IUYA 4UNNA 4B35A 1XPUA 3W8RA 2ZE8A 3LV8A 2PJZA 4LJ8A 1NLZA 3E2IA 2XSZD 3AEZA 3LBHA 3MWYW 3QEOA 5L3RA 5D3MA 5KSOA 1KHTA 3TBKA 2ZM5A 1P73A 3QPWA 3V00A 3ZZ0A 5FTNA 3KXIA 5A5GA 4V0OA 4WVFA 4BFWA 2PLFA 3QPUA 2HJVA 1II0A 3C7KA 4LWZA 2OHFA 1XTIA 3PV0A 4QHYA 3QF7A 2J3EA 1T5LA 3HP1A 1VIAA 3ADCA 1P3JA 2KJQA 4HLQB 3DPUA 3E5HA 1HE1C 3L43A 2PLRA 5TXGA 3W6NA 1DARA 2ZJZA 1QF9A 2K5UA 1T6NA 4CEHB 1GUAA 1KMHA 1JQLB 2H7VA 2W83A 2ASEA 3KUCA 3LLMA 2ZYVX 1QBKC 2XTNA 4BZXA 2DCUA 2HF8A 1N25A 3IQXA 2QAGA 3KZ1E 3QBVA 3LO5A 4Q9JA 3ADBA 2GWHA 1G8HA 3AVWA 5GJCA 3GFPA 4C7OB 1J70A 4ACAA 1UJ2A 5G53C 1NVVQ 4TZ6A 4TYQA 2QPAA 4M9QA 1LV7A 1UKYA 4B47A 3X1WA 4TQAA 4DKXA 1XD2B 2RGDA 5AUOB 3BOSA 3KJIA 4ZO4A 1V5WA 4DZZA 1ZU4A 1G4UR 4WW0A 1G5RA 5DN6D 1SKYE 2CLDX 2P6UA 4GMDA 2PT7A 4AG6A 1FQJA 4LJ4A 4BFTA 3ICEA 4Q9IA 1PUIA 1CP2A 3QKSA 4TT3A 3ZLJA 1E9EA 3GLGA 4RZ2A 1HURA 3WYFA 4PHGA 4A0GA 3IEUA 2ZJ8A 2XJ4A 4XJXA 1WCV1 3RWOA 1OB2A 3HPRA 3AVVA 1SVOA 2HXYA 4K46A 4XVUA 4HAVA 4R2HA 3WRYC 4IVRA 2A5JA 3CZQA 2QN6A 3RDPA 1XCGB 2F1HA 2O8DB 4G0NA 3G82C 2ZITA 4TMZA 3FMFA 4X8OA 1F5NA 1G20E 2ZJAA 3CLVA 5CYOA 3WHKA 3EPJA 3NBZC 2CHQA 5EZ5A 1OXXK 3TK1A 4Q1EA 5DLQC 2BIFA 5J4LA 3P32A 3B82A 2GKSA 4B2LA 2IYTA 6Q21A 3DHWC 2YWGA 5FH9A 2QORA 1SVSA 4XVRA 5FBLB 1FUKA 1TUEA 4Q1DA 4HAWA 4A8JC 3B2EA 3BB3A 4QJ4A 3PXGA 1XRJA 3R8FA 1E79D 4PFSA 1NF3A 4OQXA 1C1YA 1J8YF 2DWQA 2W6JD 3DEFA 2Q6TA 4RD0A 3KQLA 5AJWA 2HV8A 2L0XA 2IHYA 4LJAA 2W6IA 3PUXA 2ATXA 1VHTA 2RH5A 1RYFA 2FFBA 2JJ1D 3QF4A 1E2QA 1ZM3A 2HF9A 1ZINA 3THWB 1GSIA 2XXAB 4GOJA 5SZIA 1G64A 1ANKA 1Z83A 1NNEA 3WY9A 2OCBA 2VHUA 3BFXA 3A4NA 4TYYA 5F9FA 4CEHA 2VHQA 1CULC 2OUKA 1A82A 3HU3A 4CT5A 4TTQA 4C0QC 3U3JA 2ZRCA 3B8HA 3FKSD 4P4SB 4UJ3A 3SEAA 4URZR 2XNDD 4M1TA 4NYIQ 2JEOA 2R8RA 1G3RA 4JJZA 1W4AA 2OLKA 3D8BA 1L4UA 1IQPA 1KK1A 3QG1A 2WJVA 1Q12A 2DHRA 2Z6VA 4US2R 2CHVA 5HE9A 1ZP6A 2QA5A 3I92A 3ONWA 4BFZA 4Z1MA 3W9YA 4KSBA 5EE1A 4ASUD 4HLUC 1BH2A 4IJMA 1TMKA 3LRPA 2QMEA 3A37A 3TLXA 4AK9A 2W58A 1XD2A 2ZVQX 3SQXA 1PLLA 5F2EA 2G88A 1Z08A 1JEEA 5LDDC 3GEEA 1D2NA 4NYMQ 1R0WA 2DFLA 4IDNA 4OQLA 3CNOA 2C96A 2EWVA 4UQOA 3ZIAA 1PJRA 1Z6AA 3LXXA 4A2PA 1QHYA 2QE7A 1G19A 3CKLA 1K6MA 4LYHA 4TMXA 2ZREA 1E1RD 2G77B 3TUIC 2UVQA 4G3XA 2ZE5A 2NO1A 4Q7LA 4TLCA 2GDJA 4FD2A 2WIAA 3SJZA 5FPKA 1N5IA 3AVTA 5J47A 3WHLA 2XJ9A 4ESVA 3A1WA 2ZU0C 4JLNA 5JEDA 2BMFA 4Q47A 2QU8A 3UMFA 4JBWA 4GT1A 4YMUA 4UXHA 2QY9A 1KJWA 3PUVA 3RS2A 2YV5A 3K0FB 4A6XA 5TVKA 4D26A 1GVNB 5GJBA 1FZQA 1OIVA 1G18A 3OEED 1FMJA 3UWOA 2C9OA 2ZRKA 2BCGY 4QNRA 2VHTA 1ZD9A 2QZ4A 3QUSA 1FNMA 3KDSE 1GOTA 3GLIB 1E94E 1TUIA 3SN6A 3CPEA 1AKYA 4NP6A 5E4FA 3I32A 4D0NA 2BBTA 1XCMA 3Q8XB 3T34A 1OFIA 2XITA 2QGNA 2GBLA 3EIQA 3UIEA 5H70A 2JJ8A 2NMVA 3NHBA 2IYUA 4AYXA 1KDPA 3MJHA 4G01B 4AKEA 3A1VA 4M1OA 4PSAA 3A1TA 5P21A 1FQKA 4YMVA 2GHIA 5EP2A 3SQWA 4FIDA 5JHGB 4JLAA 4LHWA 1TTTA 1D6JA 3RS3A 3K9GA 1NVWQ 4NONA 4LJ6A 3Q5DA 1T4GA 4MYTA 2WOJA 1U0LA 2Z5FA 4E22A 4ZCIA 5C2JB 4ZDWA 1EG7A 1OXSC 1RJ9B 3NEYA 4UXIA 3FHCB 1E9DA 1Q57A 5K8LA 4KO8A 2JLUA 2ZRHA 1KK2A 2BDTA 4JBXA 4RVCA 4URWR 4D0LB 2QAGC 2CNWA 4PQYA 2Y8EA 4PSVA 1SVIA 4GNKA 4QC2A 1G7RA 3UG7A 2SHKA 3V9PA 2OCAA 4DLRA 5CB6A 5EE9A 1ZUNB 5KSYA 1LVGA 4PHFA 4AIIA 1Z0JA 4OQNA 2KBFA 2OEPA 1R5BA 2WV9A 1ONBA 5G3ZA 1LFDB 3QQ5A 1KDTA 1NJGA 5JRJA 4PX9A 1FMLA 2JCSA 3UK6A 3H4MA 2B21A 3CONA 2GILA 2IYRA 4GPTA 4OK3A 2G6BA 1NG1A 3QY0A 1NKTA 2ONJA 1A4RA 1ZIPA 4KFSA 4V03A 1IXZA 2NO7A 2WAYA 2MMCA 2ZAOA 1UKZA 3OIVA 4MKFA 2A2ZA 4LBWA 5BN4A 1IONA 1GKUB 4XTRA 4UKDA 1Z8FA 3TW8B 3WMFA 5KDDA 2IF0A 1E9FA 4NMMA 3WP0A 5CK5A 3OF5A 3GLFB 3BH0A 2IX3A 1ZC4A 3SU8A 5IK2D 4BRWA 4PO8A 1E2LA 2BKUA 1OF1A 2G1KA 3KQKA 1IOZA 4B6FA 4NYJQ 1W48A 5CJPA 1UEJA 4RFSB 4WZBE 2X77A 4P33A 3W3ZB 2H18A 3KQNA 5FL7D 3A36A 5F98A 3C4JA 1KI4A 1W36B 1XU4A 1GFIA 2OZEA 2QM7A 3DMDA 4BFXA 1G8YA 4M1WA 1OHHD 2J46A 3K0FA 1F3OA 4HZIA 3TE6A 3BBPA 3RC3A 4ILEA 2OSBA 4KSCA 3TQFA 3I5XA 4L15A 3DKVA 4JLOA 4LDJA 4BZPA 3GLIA 3S1AA 3WBJA 4KFRA 2WBLC 4DSOA 1E2KA 4I4LA 2AFHE 1JR6A 5KNCA 4RD6A 5FI1B 3VU9B 2VF8A 4Q9KA 2B7CA 3WNCA 1U8ZA 4BPBA 3M0EA 3QBTA 5FOSA 1EX6A 4LSGA 3K09A 4P0TA 3WP1B 2ATVA 3QPVA 4EPVA 1N0UA 3CF0A 4OHVA 3CW2A 2JIZD 5FOTA 4HDQB 1OT3A 3PUYA 1NVVR 3DM5A 4DLUA 4MYCA 3X1XA 2RGGA 4KBFA 5EUMA 3SBEA 1JB1A 4KI0A 2G9NA 4YLGA 1PLJA 2ZRPA 1T3LA 2W2TA 4IFBA 2IT1A 3IO5A 3PVSA 1U0JA 4ZDJA 2RGAA 3ZVMA 4FW9A 1J99A 4EFLA 1GG2A 3QEJA 2AKAB 2GJ9A 4CEJB 1SKQA 1MO4A 5FBQB 2BC9A 2D06A 2ORVA 1GP2A 3LLUA 4LUCA 1VKJA 1W4RA 3BC1A 1D2EA 4D25A 3EIEA 5TMPA 3IHLA 3B9PA 2OLJA 3CB4A 4LYFA 1U98A 1WBBA 1JR3D 5J4KA 2BMDA 1TADA 4KJZA 1XCPA 3OAAD 4FMBB 1EESA 4BGDA 3IIJA 4D4LA 1II8B 3EX7C 4LBYA 2ANBA 1Z29A 2ZIAA 3AF1A 4MRVA 2Z83A 4G5QA 1FUUA 5DI3B 1RYHA 2MSDB 1JNYA 3T1VA 1HV8A 4JLMA 1NY6A 2Q3FA 1P5ZB 2QRZA 3GCGA 4HUQB 4JZKA 4RZ3A 5K8IA 5E7JA 3SFVA 2WKPA 3KX2A 4I1SA 3U7FB 3THYB 4F4JA 5AJVB 3HDTA 2CMKA 4OQFA 4HI0E 2D62A 2VP5A 1R8SA 1Z0DA 3JZAA 4RKFA 2ZJYA 3TSOA 1H8HD 2OESA 3T1OA 1RIFA 5AJXA 1H8EA 4B3CA 4QOSA 4NCKA 2CE2X 2CK3D 8OHMA 1ZVQA 4RFSA 2OILA 1D5CA 3BWDD 3WMGA 1M7HA 1UDWA 4X8LA 4ON9A 1O87A 1MABB 4LC0A 4DCNA 3LWNA 1CTQA 4DB2A 2OO7A 1F60A 2CL0X 2H1LA 1FNNA 2NO9A 2C98A 2J0VA 4M9ZA 5CK4A 2PX0A 1X8LA 5LBIA 1VG8A 4AKIA 4CIDA 3CNNA 2WJIA 2C99A 1UFQA 2XZLA 4ARZB 2O8FB 3L8ZA 1ZCAA 4M9XA 1KK3A 4CYMA 4F7WA 3LVRE 2YC2C 5HR5A 3OE7A 1SHKA 4NU0A 4Q01A 1UBFA 4NYIR 2FWRA 2OFWA 1E2EA 2GBLC 3QXJA 3EZ6A 4YXWA 4LY6A 3I5YA 3REFA 1DAEA 3IO3A 2GXAA 4JKIA 1E99A 4O3MA 1XD9A 4P4UA 2ZJOA 2W0MA 3GJ7A 2Q9CA 4CVNA 3B78A 1S9DA 1W1WA 2ZXUA 2VSOA 3HPQA 3L0IB 4E5UA 3O8DA 2F1IA 2ZANA 3PCRB 1VDZA 4NH0A 2J0UB 4XVQA 1DVRA 5FUXA 5AWFC 3I62A 1E69A 4TLAA 5EP3A 5FBVB 3IGFA 1XTQA 3T15A 1EFTA 1AS2A 2EFCB 4NYMR 3NG1A 1YU9A 3NC1C 5HE8A 4IW3B 1NN1A 5A0FA 3VMFA 2W00A 3SZRA 2IL1A 1UBGA 3MWJA 4NE2A 1EWRA 1XEXB 2NTYC 3QJYA 5LD2B 4G5OA 4C4PA 2RGNA 1P2VA 4EJSA 5DIFA 2JLVA 4KYIB 2WSMA 3NH9A 4LHVA 2PX3A 3QI2A 1II8A 4FI3C 3L8YA 3PIRA 1KO4A 1KO1A 4TMTA 1N6PA 3DZDA 2BWJA 1AZSC 3QKUA 5TY0A 4YDHB 4A8JA 4A92A 5FR1A 1LS6A 2QG6A 1E0AA 2WKQA 1KSFX 3U2QA 3RS0A 1UDXA 5FTLA 3VAAA 5KPDA 2BKEA 1QDEA 3W3AA 1E32A 1E4VA 1E2PA 4PC6A 1GNQA 3NIBA 3RS7A 4OI1A 1O3YA 3K9NA 1NN3A 4RD3A 3FFAA 3CIOA 2ZS7A 4PZLA 4ZIRB 2IYWA 1Q1ZA 2KWIA 3OIWA 3IDQA 3BK7A 4AC9A 1N0VC 4PZYA 1I4LD 2BM1A 1LF5A 3FVQA 1RRCA 1IBRA 2XTMA 2ZI3A 2VSFA 2D74A 3K8YA 2PT5A 1N6RA 4DHEA 4IOLA 3AV0B 5EJEA 2JLZA 2EFGA 1CS4C 1Z5ZA 2OXCA 1ZC3A 2VYFA 1BMFA 1KDOA 2F55A 3MMPA 4A1FA 5LPNA 4OHWA 4MKGA 1AQUA 1XWIA 5HZKA 3Q85A 1WF3A 3D7MA 3M6AA 1XB2A 2PH1A 3C16C 3K53A 1XEFA 4GOXA 4C3ZA 5JWHA 1YZGA 5EP4A 1CKEA 4IHQA 3NBFA 4TMVA 4DBLC 2WTUA 1Z2AA 3TVDA 1PLKA 1OFTA 1MR3F 3WMEA 1GITA 4I1UA 1Z0KA 5HCNA 2IF2A 4NHOA 2CEAA 4DT1B 5HPYB 3K0CA 4C30A 5CB8A 1FTNA 1ZRHA 2VHJA 4B71A 1ELOA 3UWKA 3AKEA 4FCTA 5DYGA 4F92B 2ZUBA 3OEHA 4TMWA 1NBMA 2EFEB 3K09C 4WXRA 3U3OA 4B76A 4ZCLA 1NL3A 2IK8A 3CF2A 4KVAA 3WNBA 1YJ5A 3IIKA 4IEIA 2J0UA 5DI9A 2GF0A 1ZNXA 4EFNA 2ORWA 3K70B 1BS1A 1QHNA 2OFXA 3E70C 1SGWA 4WZ6A 2JDID 1EFRD 4FCWA 4MH0R 2GJ8A 4QBFA 3GLIE 1F2TB 4PC1A 4N3NA 3ZVRA 1P2UA 4HLCA 2X19A 3AM1A 1IAQA 1SHZA 4FCVA 1AN0A 1EFUA 4Q4AB 4UNSA 3EZ7A 3H84A 2P3SA 2TMKA 3AKYA 2V6IA 3ADKA 4HZUA 1CR0A 4C0AC 4WOPA 4HATA 1BOFA 5G3YA 4NYJR 4DB4A 1YZQA 2AHOA 1E9BA 4QXAA 3W5IA 2HCJB 3BERA 1G9XA 1SXJD 1VCOA 3CM0A 3FPAA 3RRZA 3PEUA 5G40A 3FWYA 3U61B 4N0DA 3U4QB 2Q9AA 1WE2A 4MRNA 3BB4A 4OBEA 4HLDA 4KV9A 1IXRC 4QFMA 4ZIRA 4CW7A 3DM9B 2CCJA 1XD8A 4KODA 4YMWA 2HLDD 5LB2A 3B13B 4JLPA 4D4MA 2BM0A 1Z3IX 2G3YA 1KIMA 4D2IA 1K5GA 3QKRA 221PA 2R9VA 3AVXA 3PUZA 4DVGA 1T5IA 3IPXA 1TF5A 4BFVA 1NN5A 1W36C 3SBDA 1UBCA 2G83A 1ETUA 1QRAA 2AK3A 4EIWA 4L5BA 4PSKA 1EFHA 1TU4A 1ZM7A 2WIBA 2ZRJA 1T91A 3DOEA 4K81B 1TL7C 1YR9A 3W90A 4XSGA 2IXGA 1AS0A 3DMNA 1M1YE 2NG1A 1XTSA 3E1SA 3RWMB 1S0UA 4AD8A 5ELXA 1G291 5B58C 3OFND 4KVGA 3KJHA 5TV2A 4AG5A 1U2RA 3ZJYA 1Z07A 3GJ4A 3EARA 2V3CC 3SHFA 2PMDA 3CR7A 2GA8A 4TL6A 1G21E 1OPXA 2WAXA 3HWSA 1GL7A 2V1UA 1T8TA 2A5DA 5BYKA 1SVLA 4POAA 3BAFA 5CM8B 4YONB 2RB4A 1XMIA 4PQFA 4XD7D 1OH5A 2EYUA 1E2JA 3BRWD 2WPDA 5JFGA 1DAGA 4DUGA 4Q1AA 2PEYA 3Q7PA 3THXB 3WBKA 4C9BA 1JALA 4MKHA 4PO9A 1KMQA 2F7SA 1AM4D 4A15A 3AF3A 1HT1E 1P7CA 1UKVY 1M7BA 5FUVA 2AL7A 4OI2A 4B6EA 4HDCA 3GJ5A 4LX0A 2B8WA 2DWOA 4EPWA 5FUWA 1GZSA 2PJRA 2Z4SA 5E7MA 1DTSA 2IYQA 1KI2A 1S1MA 2RGNC 2XOKA 4M21A 4MGIR 4Q4AA 2FH5B 1KI8A 3KFVA 3MCAA 4EJSC 4V0NA 3AVYA 2ZJ5A 2EQBA 2ZS9A 1MT0A 1P2SA 2D7CA 2QTHA 4V02A 3QKTA 4LGMA 3NHAA 5HZHA 3DOFA 1HH4A 3IQWA 1UADA 4D81A 4L4UA 1A2BA 4JLJA 4ZDKA 2XGJA 2WVJA 2RGCA 3SYLA 2VO1A 1DBSA 1COWD 1MOZA 2ZRAA 2P5SA 4JS0A 2QMHA 2B7BA 4LI0A 3SC3A 3BIFA 2J0QA 1ESNA 1SVWA 2QBYB 5IF9A 121PA 3L0SA 4JSTA 3GJ6A 3ZVLA 1XPRA 1HQYE 3GMTA 1KI7A 1KI3A 2I3BA 1AK2A 1JJ7A 2JJ2D 2W2XA 2G0NA 5DNYB 2RCNA 4PO1A 1DADA 4G1UC 2JLQA 4LYJA 3K0SA 2QNRA 3GJ8A 4BEJA 4M9SA 3I61A 4OK5A 3CZPA 4CGZA 1YHNA 1LW7A 1DEKA 4RCZA 3HYTA 1OXVA 3QENA 3VR6A 1P61B 3C15C 2BJWA 1GRQA 4M1KA 2WWXA 2VA8A 3EIHA 2BMEA 1W5SA 3CX6A 4S35A 3RSOA 4AYTA 1KO8A 4DLWA 3WYAA 1GIAA 4C7OA 1G41A 3TGPA 3AF0A 1KJZA 2B92A 1E6CA 3IIMA 3MUFA 1W46A 2OAP1 4A0FA 3LVQE 5HKKD 5EUQB 1XF9A 4EAQA 1AKEA 1OH6A 4W9MC 3BS4A 1TPZA 3K0CC 3TUJC 3UATA 1KSGA 1JAHA 1YKSA 3M1IA 3RLFA 4XSHA 5KOYA 2FN4A 3LXRA 3K0AB 2J0SA 2XEXA 2QQEA 4Q03A 2X2EA 4MUAA 3K0EA 1OFHA 4JT2A 3RRYA 5JSZB 1I4DD 3ZVNA 5F9HA 3AB3A 2X8AA 4D0GA 1Z0AA 1KZ7B 4DIEA 2R6DA 2IWHA 1SXJB 5FTKA 1L2TA 1U8AA 1KTVA 4GFDA 1G5TA 3PJRA 4OI4A 3THXA 3B9QA 2VIIA 3GLHB 2CXXA 2OBMA 4HAZA 2DFTA 3D31A 1IY1A 4US0R 3RRMA 5F3WB 2JA1A 3VKHA 3X1YA 3DDCA 1W49A 3DVLA 1T3HA 2ZPTX 5HCIA 1II9A 2RHDA 4PC3A 5BWMA 1BYUA 2V55B 1FP7A 5FOUA 4B3BA 4GZLA 1N5LA 2DY1A 2FMXA 2O8DA 4MITA 3LA6A 2V7QA 4MGZR 1RRGA 2GEDA 3EZ2A 2GJAA 4IVQA 2D3WA 3B6EA 1I2MA 3CRMA 4URYR 5DGXA 5E3HA 4D80A 5LD2C 2LCFA 2R62A 1S1CA 2WSSA 1NRJB 3MSXA 3P1JA 4NCJA 2FEMA 5JMTA 1RPZA 4OKSA 4QGFA 3C5HA 4OK6A 4DSNA 3ZD6A 3AF2A 4TL8A 3AF4A 4DLTA 3UKDA 5B64A 1NBME 4DSTA 2WWFA 2D2EA 4R2IA 1XMVA 4GMXA 1N6NA 3Q72A 1GNRA 1M2OB 5BQ5A 2P0EA 4TYPA 3B1WA 5L3QB 4QGGA 1OXTA 1W0KD 1US8B 2QBYA 4LJYA 4IOJA 2KI5A 3THWA 5DH9A 4EPRA 1FPMA 1OSNA 2IYVA 1KGDA 1KYIA 1NLYA 3NXSA 2XXAA 2EVWX 4MRPA 4LK2A 3FHTA 4D4JA 1OKKA 3MWLA 2ZI4A 4C2UA 4ZV4A 4NTZA 5KHOC 2QT1A 4NCNA 4LC1A 4TQ9A 4P4SA 3MAAC 4BZQA 2I1VB 2F43B 1G3MA 1ZBDA 2CCGA 1P6XA 3I1FA 1JAIA 1UM8A 1YZLA 3P4XA 1W4BA 3PUWA 3MFYA 4Y0VA 5C18A 5DO9A 1OYWA 3C41J 3CBQA 2P67A 2FSIA 1YZKA 2Z0MA 1OFUX 3F8TA 4KYUA 1GKIA 1W0JA 1L7VC 3CF6R 3EPLA 2GAAA 5H1YA 5KSZA 3AQ4A 2YOHA 3VQTA 1DAHA 2YWFA 4LHXA 2IXFA 2FSHA 2BEKA 2ZE6A 4AY2A 4RKEA 3MLEA 4B3XA 4DCUA 3EAQA 3FMIA 3K0AA 2JGNA 2OT3B 1XDBA 4IDQA 1OH7A 5EP1A 4MYUA 1E1QD 1X6VA 1KZGB 4JT4A 5JSZA 1XTKA 1X1SA 2XSZA 5TB5A 2VSXA 2ZRDA 1GRNA 3A58B 1VCMA 1BO6A 4QBHA 3SE0A 2IW3A 5JS8A 2QTFA 1DG1G 1GL6A 3GLHA 1MRNA 1VMAA 2GVDC 3IHWA 1S3SA 4MDFA 5JHHB 3K70C 4Q21A 1WDTA 3AVQA 1BIFA 1MO3A 2WWIA 2ZYWX 2VTKA 4FWIB 3SHWA 2ZI7A 3WXMA 3RRNA 2XZPA 3NKVA 1DAIA 4Q4JB 3R9IA 4A36A 1D2MA 2YINC 2CHGA 2FPKA 3CRQA 2NIPA 1U9IA 3KXKA 1IN7A 1E2IA 2P6NA 3KUDA 2J59A 2OM2A 4O0MA 3VR5A 4BLOA 4HAUA 1T0JB 2WJYA 1XJQA 1Q3HA 2RAPA 2QRNA 3ND8A 4BFYA 2I1QA 1DO2A 5J4HA 2ONKA 2IHBA 3BFVA 2BVNA 2ECKA 3CX7A 4KFTA 4MRSA 3W6PA 4IOKA 2FX3A 3VX3A 2AD5A 4NZYA 1DE0A 1P9RA 2HEIA 3NEJA 5B2ZA 4BUJA 1HQCA 4N1AA 2DB3A 2O0HA 2GVZC 2Q3MA 621PA
chains in the Genus database with same CATH superfamily
1E1CB 1RWKA 1OREA 3I9LA 3LUPA 1D07A 4JOSA 1IZYA 1UAYA 3AQIA 3B7GA 4MVJF 2O8NA 3LFUA 2QTVB 3ZS9A 2IRWA 4RTOA 1KZ4A 2ODWA 5EXDA 1ZWKA 4DR6B 4NBSA 3FFBA 3HB4X 1J42A 2J9FA 1NJFA 1MO2A 1WMEA 1A97A 5CW2A 5FJIA 1MW9X 4C4YA 4X20A 3CVUA 3U7RA 1Q1NA 2UVPB 5FBKA 1Z5VA 2NTJA 4LW8A 1STOA 3QUAA 1GUZA 2ZAMA 2Z2JA 3N74A 4WLUA 5HNKA 2AI3A 1UP4A 2VDUE 3X1ZA 3RHZA 4GKKB 2VPXA 4TRJA 1SD5A 3AJ8A 3TBHA 3DXXA 2C9ZA 4DRXB 1L4BA 3UJ3X 5A1TA 5F52A 1EXMA 2WF6A 2BEUA 3WDKA 2V9PA 1YMQA 1CJTC 4M8SA 4RKRA 2CFRA 4L4ZA 1JEAA 4KX3A 3R3WA 1QAQA 3CRNA 5EXXA 4WFQA 5ALJA 1ZD1A 4OQZA 1DG9A 3L8MA 1DO0A 2RHBA 3E9RA 3QIAA 2PGLA 4AXBA 1LLCA 3EH2A 1XLTC 2AR7A 2Y1LA 3TGLA 2EU8A 4HX9A 1ZIYA 4MUJA 4F0JA 1CG6A 1I2AA 3Q5EA 3G2PA 4HWTA 4DZZA 1OB5A 1J56A 2JRLA 3Q3HA 5TSDA 2AI1A 4GQIA 1F2UB 3SYKA 4D82A 4LJRA 3S81A 1R18A 4XFKA 1WTCA 4JHXA 5CNMA 5JWOA 3QLUC 4WGFA 3HK2A 2TSYB 5IZCC 3J7TA 2VJMB 5AW4A 1JIVA 4R98A 5FQOA 3LL7A 3TW8A 2TMGA 2CBXA 3IAHA 2J41A 1H2RS 1UK8A 3DZJA 2CKMA 1B6RA 1M1UA 2NYUA 4QDZA 2FEPA 4AS2A 2H7YA 2BTEA 1R0YA 1I1QB 1CUCA 1U0EA 2AEEA 4LA4A 4O2LA 2OG2A 2WFLB 3N70A 4QYMA 5K3FB 3B5EA 4YROA 3DGEC 3O91A 4RK1A 4DJ5X 4YRLA 2B1JA 5EE0A 1UMBB 4Y18A 5CTAA 4B4UA 1F2DA 2XWBF 2CFSA 1PZGA 2OD7A 5AW0A 2F1JA 2QN8A 3GZNA 3USCS 3BA6A 3I04A 1VRCA 3ORFA 1SUPA 3RK0A 4BC0A 4B6RA 1DO8A 4N9WA 1C9KA 4OQDA 3ZHUA 4EF6A 4TTVA 2ORIA 1TZKA 3QU7A 1MPXA 4HXFB 3A1DA 4JL8A 3TNFA 3ZGOA 3ZX5A 5JS6A 1BE0A 3CE6A 4ZO9A 3RODA 2KHZA 4IWXA 4U7JA 5K51A 3BWEA 5KOHA 2GZSA 5LZ8A 3NVDA 2IELA 1N6KA 5KNBH 4DGSA 1YQTA 1CR6A 1QG4A 2O06A 2CB0A 3MG9A 4HYQA 4WCFC 1MX1A 4CM8A 2Q5LA 2VCHA 2Q6IA 5TQ2B 1UOEA 4D9FA 2DAPA 1TZBA 3AVUA 4H2DA 1P6QA 3PP8A 3W4JA 4JEUA 2WIFA 3MGAA 1Z5WA 2MSKA 1X3LA 2VFAA 3MUOA 4W5HA 4ASUA 2GZ1A 4MYDA 4AWXA 2XW6A 1QRDA 1T25A 1X92A 2Q49A 3JVUA 5SY9A 4E09A 3L0DA 4XDYA 4N48A 3VH1A 3V33A 4XAQA 1W5FA 3E6AA 5LMZA 5TPWA 1AA9A 4IIUA 2XA2A 3L77A 4L16A 1QG6A 4B6JA 4B33A 5I4KA 3MJFA 5K3SA 3QX3A 1KAOA 4RPKA 4EYGA 1G16A 1WO8A 2B20A 1LX7A 4Q00A 1R0XA 2RK3A 3W5VA 2XVAA 3BD9A 3C6MA 4EG5A 1XL0A 4LJ9A 521PA 1E1RA 1ISMA 4ZRDA 2JD0A 1XWFA 2JLRA 2V97A 1YDWA 2O2HA 2CGEA 4FDLA 3E7PA 2B9EA 2F48A 3IR7A 3NALA 4TN1A 4DLXA 3F7NA 2D7DA 3ICQB 2AN5A 2B1RA 4INPA 3ILVA 2C1XA 3R09A 3NPAA 3E15A 1E0JA 3E48A 3I53A 1QU3A 5ICSA 3OZVA 4P2GA 2GTPA 4CT4B 5GJBA 2HAEA 1L8QA 3HDQA 2DETA 2AMVA 2X7JA 2GAIA 5DRYA 1MP0A 2VJOA 5SZHB 4J3NA 2BCJQ 2XQFA 4RK7A 2L42A 5F4BA 5PNTA 4EA9A 4HB4A 5SZJA 3AWIA 4ZOLB 1KFKB 4FYYA 4EUNA 4HAXA 2I91A 2FPMA 2CVZA 4P2BA 1P5HA 1RAAA 4DR1B 3L06A 3VX4A 5INTA 2PYDA 3DBIA 2W6QA 1PGPA 4MA4A 1R8XA 1LBQA 2FJ0A 2YFHA 4Q3EA 4MB2A 2HYIC 4QDOA 4FNGA 4MIEA 4URUR 5EIEA 5K0NA 3OVMA 2ZDGA 3TI9A 4AKGA 4PQEA 1FXWF 1YFLA 2FYTA 4YP9A 8ADHA 2VH5R 4YWJA 4DGQA 4AJ2A 4TSRA 3QU4A 4N0MA 5JMPA 3Q2IA 4IYRA 3UGTA 3LFTA 4HQRA 1VIVA 4AWAA 2GBPA 1EG2A 1SB9A 4TVSA 1P2FA 4QATA 4BDSA 2ERXA 1S9HA 2MJLA 3CZ4A 4MCIA 1HM5A 3QNUA 4UCQA 3RSZA 2P3LA 3F3YA 5G41A 1C30A 2VH2A 4CLRB 4U0KA 5JTTA 1DB3A 5ADUS 1PEKE 1C4KA 2BHLA 2ZYSA 4BNIA 1XQVA 1GPMA 3R24A 1T8PA 5BUSA 1J7KA 2EGHA 2I6GA 4MV1A 4LNAA 1SOMA 4E5KA 5DTQA 2C94A 4CR6A 3KB8A 1ESMA 5I51A 3AKZA 2PIDA 4IJVA 2P6RA 1Y7LA 1YB1A 1IWBB 1F14A 2H5LA 2P65A 1T10A 3IAXA 3OF3A 4QUDA 1UBKS 1ZVVA 1UC5B 2R48A 4GQBA 2YHAA 1V2GA 3TCKA 2H1VA 4ARZA 3VMMA 4H7IA 2C4TA 1IJEA 3A3OA 3FPGA 3O92A 4TVKA 3JR3A 3ZX4A 1QMGA 4NS1A 4JLVA 2JARA 4KAAA 4L9WA 2BJVA 4N6OA 3W34A 1N6OA 1ZM4A 1AK1A 3FUWA 3GBPA 3IBTA 3M82A 4GSYA 3B38A 5TF4A 3G5TA 7MHTA 2ZAGA 2QTBA 2VJAA 3G2KA 2DHDA 4HGNA 4B75A 4BNUA 4BVHA 4X61A 2OQ2A 3QYPA 1SUEA 2A8YA 3LUAA 3VOTA 4BNKA 1YHYA 2A5GA 2PV7A 5JLJA 4KREA 2MINB 3EEYA 4EYOA 4FHCA 3QXSA 2CNBA 2FAXA 1GAWA 2WSBA 3RUPA 4NPAA 3SJCA 2W2LA 1LSOA 3TR5A 2DH5A 1NIJA 2QYOA 4OMUA 2E3JA 3A11A 4LG1A 4OOEA 4A0HA 2W6CX 4FN5A 3UQZA 2AWOA 3ZE0B 5T6BA 4N0QA 4BYMA 1WP9A 2AJTA 3ZWNA 1B1AA 4XDGA 4BXOA 4MVJP 5DP1A 1OZAA 4R2KA 1QYWA 2HDNB 1UIMA 3SS9X 4AO7A 4KH0A 1Q17A 1A04A 4PM4A 3T9DA 5E4TA 4E1VA 1A9XA 5TS2A 3MTJA 2J9GA 3ORYA 3KG2A 1GUYA 4LDQA 5FNVA 3E8SA 4J4TA 3SDZA 2GH1A 1ODTC 2DMRA 4AS1A 1XEXA 1Z0SA 4UVEA 4OJMX 4YPVA 2G28A 2R85A 3GLGB 4ND5A 2O2CA 1R5OA 1M2VA 2AJ8A 3IAM1 3FDZB 4ERNA 2R1VA 1JLSA 3G0BA 5E7IA 3ZNOA 4HKTA 5T7BA 2FR0A 2C4UA 3UMRA 1SKBA 5IAOA 2CNWD 2CVOA 4HAIA 3PZRA 2OLEA 4C2BA 3UHAA 4OIFA 4IVNA 3CGGA 2C7QA 4DIOA 1D0VA 3A6DA 1DKNA 3NHUA 2QRJA 4Z5XA 1S89A 5A4DA 3DUFB 1FUYB 2K87A 4COOA 2WJJA 1EWTA 3C1TA 5IKPA 4LMAA 5ALNA 3DKKA 1FP4B 3D3JA 5FIUA 4BFSA 1GZ7A 3U4CA 1XP8A 3C6QA 1KH1A 1TCCA 3U81A 1SOUA 2DT8A 2AR0A 1HDYA 3ZGVA 1KP2A 1XJ0A 1R4NB 4LECA 3RI3A 3AESB 4DJFC 1CUVA 1P60A 2ZAYA 1AX9A 3EGVA 4CQMB 3CSDA 4KO1S 4Y98A 3RVNA 1IXYA 3QVXA 1EH5A 1KZ6A 4QOGA 1JRLA 3F3SA 4G0YA 4B3HA 4FFWA 4JVLA 1DV2A 4JNKA 2OCDA 4HRXA 4LSMA 3V1NA 4X7BA 2EWMA 1KZHA 3ZI0A 1L6IA 1YU6A 4C14A 3GA7A 3G5MA 3VU1A 5K3OA 5FBWB 4YJ3F 1ZSYA 1MXHA 3QSGA 4NEQA 3ZS8A 3ADDA 3CTMA 3N53A 3W8NA 4A6PA 2XUFA 3TRJA 2HBZA 1T29A 1TZMA 3FRJA 3QX8A 2INGX 2W43A 4GYWA 4EKNB 3CV3A 2C2GA 4BLSA 2JGLA 4RENA 1E3QA 1IDN1 2R2AA 5KCMA 1L5MA 4DG5A 2W4MA 5EE5B 3LAWA 1V8DA 4YQEA 2HHJA 5K8JB 3HXLA 4CZ2A 3HZHA 3AONB 1ZONA 1ENPA 2GAOA 3K31A 3RNLA 1A76A 1GWNA 2AJLI 2DKFA 3OQHA 4B2YA 4UFPA 3EDMA 3PLRA 1DIGA 4MI6A 5FF9A 4BO8A 5DYYA 1WG8A 1RSZA 3ESYA 4Q02A 2PMFA 3BTSA 3IOCA 1T2NA 1Z45A 2D2IA 2RKOA 3CHYA 3D7SA 4FDUA 4IQ0A 1KQPA 5EJIA 5K0LA 1J06A 5FFFA 4G0QA 3IUBA 1GPBA 4WD3A 3H9BA 1LEHA 1L7NA 4BLQA 3I9V6 4MVJM 2WDZA 5ITWA 1I4TD 1TO2E 4C08A 1Y63A 4RY2A 3TZLA 4O4JF 4BL5A 2CL6X 5JH7F 2R6GA 3ZHVA 3FJOA 4YMTA 4B0PA 1ZGBA 1ZSVA 4Q9LA 2FK7A 2PZFA 3JVDA 3WSTA 4EW1A 1XZAA 1U6IA 2W0SA 1KOFA 2YS7A 1EHIA 3GFOA 4GPEA 4KN8A 3PXUA 3U80A 4C0JA 4MJ3A 5KYWB 1D8AA 3UYLA 3GQBB 1J90A 4K8RB 4WZAA 2B30A 1Y7PA 3U7QA 2AN9A 2CNNA 2XNCA 1DAKA 4FZVA 2CK3A 3U3RA 1L8OA 1QH9A 4EO9A 4CL8A 2GNOA 4BKQA 1NKSA 1FE8A 2R6CA 4DJDC 1ZM2A 2BEVA 3KQUA 4J49A 3NM6B 1YJCA 4FFLA 1WXQA 3STYA 1V71A 2GO7A 2C4HA 2P6OA 4B3TB 4HAYA 4ZKEA 3UUGA 2OV6A 1VSQA 4IMIB 2J6HA 2YZKA 2PMWB 4I7EA 4JLDA 3ZGYA 1SU4A 4B4OA 3N2GA 4IFEA 2VYQA 1TGYA 1YR3A 3GEDA 5EKUA 2HMWA 1F0YA 2WHXA 4RZXA 3F73A 3HA5A 4RF4A 4INJA 4TPKA 4CTOA 3O8LA 4GC5A 3QVGA 5ALHA 5LBUA 3LKBA 3PRYA 3QVOA 1DTWB 3MD9A 3BH6A 1IUPA 5HS6A 1ITZA 3DMYA 5KJ1A 1V6AA 4TLLB 2XOXA 4G09A 4UPDA 2FZCA 3KTOA 3PVCA 2VPQA 4QYIB 3IHKA 2QMQA 1GKLA 4NG4A 4M88A 3WWZA 3OZXA 4J0HA 1QV7A 4LRQA 4BECA 3HLTA 4MUMA 2BH2A 3DE6X 4HK4A 2WC1A 4LHYA 1X0XA 2X9VA 4CG3A 4DRZA 4L9SA 2HGSA 4L8FA 4W6ZA 1FW8A 1SJ9A 4DIDA 1SURA 1H8ED 1TMGE 1UMDB 2GRJA 2ZI9A 1WUJS 1SUSA 4K3VA 4MJLA 3SM9A 3ETCA 3PCTA 3MF4A 4AIRA 3ELBA 3HFSA 2P30A 3UH1A 4F96A 4MWBA 1W2GA 2C7BA 3L1VA 2OHGA 2ODNA 4JHLA 4IIVA 4XJVA 1EUYA 3T38A 1JSCA 1J2EA 3DL0A 2V65A 3OWXA 4MVCA 4R0NA 1KKMA 5HEKA 3T7DA 1Z26A 4Q4HB 5AQ1A 4PPFA 1P39A 3BWMA 1E4YA 3LC0A 3H5WA 1QC5A 1M2KA 3FLAA 1WF6A 4KWIA 5IHPA 1IL0A 1DQRA 5J2TA 5TGDA 4RA9B 1X9IA 2M6LA 2EFHB 3BXOA 1JJBA 1C41A 4J1SA 4XRRA 5IT4A 5EQDA 4FLEA 3DWFA 1GU7A 5C4GB 1S8OA 4XGIA 4EHFA 1QUFA 1OFUA 5MHTA 2I3AA 4OYLA 3V7YA 3WLSA 4MO2A 5HUJA 4H1TA 4CM1A 2AQHA 1W47A 4XIGS 2RHHA 3D4NA 3K16A 1T5BA 5IUJC 3LS2A 1IY2A 1TZCA 4X60A 3V48A 3IILA 3GFFA 1ULZA 2WA2A 3CX8A 5ARDA 2VNSA 1YJXA 3RYFA 4X95A 3H5TA 3TL3A 2V8OA 1JXOA 1R2QA 2AXPA 3VSCA 1Z5NA 1R6BX 2IBMA 1IEXA 4G1EB 4EPYA 1JEQB 3GUVA 3L7OA 4HEJA 2RIRA 2JLXA 4RTNA 2QDKA 1Q0QA 2CXHA 1Y8RA 1OIWA 2FSUA 2KLBA 3A1SA 4R83A 4S1NA 3NYRA 2B8JA 3FSRA 4H3SA 4HGPA 4M1EA 4LVUA 3V8VA 1TI7A 1G17A 3GRAA 3DE5X 3N76A 2HNKA 3R9XA 1GFZA 2V4ZA 1VB3A 1RLIA 2JLCA 4IDOA 1GZDA 1ZL2A 1W76A 3NM5A 4DS3A 3E2PA 4LQCA 1Z37A 3JARA 3LBYA 1MFZA 1DTEA 1N78A 2QP3A 1BQ3A 4LJ7A 2F6RA 2QRVA 3PQEA 1USVA 3VR2A 4X65B 3CVOA 3D0QA 2DQZA 1RAFA 4DQXA 1EZZA 2VQSA 1GRVA 3RVLA 2WAOA 4P3PA 2WYVA 2Z4RA 1HT3A 1ULHA 1QHHA 2C2BA 3SXUB 2FQ1A 1W75A 4PNEA 5LYJF 3A9RA 3F6SA 2OHJA 2QL5A 4FFBA 3SYMA 4W4TA 2NU7A 1YASA 4Y0NA 1BMDA 3QFTA 1R6XA 1OJ7A 5GZ3A 1FTYA 1XAGA 4DA7A 1CEEA 2WIDA 3ZV5A 2W6NA 5EXPA 4DXAA 1PT7A 1PT9A 2GSWA 4KE9A 1Z7GA 4CDGA 2XRMA 3G89A 1IZ0A 3W3AD 4ECEA 4UPEA 4YS6A 2ZYHA 1Z6PA 1PTJA 4Y1FA 2WMYA 5JE8A 4L3VA 2FW0A 1JIQA 3NUZA 3T4PA 3I4CA 1BVRA 3L0ZA 2VTBA 4V0ME 1CJUC 1IEQA 4F4IA 4L07A 2RGEA 2Q2OA 3RTCA 1U8TA 3OWOA 3KJEA 3TXAA 3ZGNA 1KI9A 2DUUA 3F7TA 3IMEA 4H27A 1GSAA 1IXSB 3PC8A 4FYMA 3VU3A 4GH5A 2WR8A 2WU8A 3KYBA 2QY6A 2JI6A 3EIUA 3BB1A 1XQWA 2GCOA 5CPFA 3GDFA 3WLEA 4PZ0A 4HQNA 5HUQA 3B6ZA 3CG4A 2QZJA 4NDNE 1LRLA 3C6KA 3EQ9A 4PHHA 4RVGA 2KB0A 3B6KA 2HF7A 5B53A 4WADA 2J9ZB 5G0SA 4M98A 3UT0A 5DM1A 2PMCA 4FE3A 2C77A 3EEQA 3IBYA 1KBOA 4N3AA 3ZDZB 1GDTA 3QFRA 1DI0A 3HJTA 2R6AA 6YASA 3ABOB 5L9AA 3NGLA 2ZYIA 3GAFA 1O6BA 1EFDN 1P2TA 1IQUA 1V8OA 4HX2A 2CXQA 1RABA 1XZLA 4F9TA 1U3UA 3VYWA 1V26A 5DISB 1Y8ZA 3O84A 4KRFA 4XTCS 1ZGGA 3PDUA 2B1QA 4QAQA 2EKZA 1BJRE 5F3WB 3I8OA 1W19A 4E51A 2X42A 3N2YA 5CA0F 5LQNA 2NU9A 4Y2HA 5LU9A 1V8BA 4P53A 3NGXA 1RVDA 5TR9A 2JLSA 1P62B 1UJNA 2JLYA 4AAYA 1IZ7A 1RHRA 3G2HA 4OH7A 1Q21A 4RK0A 1AF7A 3K9BA 1NP7A 5FI0B 3QHAA 2VJNA 1XIVA 1HOXA 3OCCA 5AI8A 3K15A 5EHQA 4C76A 3QX9A 4CMEA 1PR0A 2H1CA 3FDFA 1ODLA 1RJDA 5L45A 1XZGA 1LPBB 3O38A 2IS2A 1B8PA 3P27A 5JRZA 3JW8A 5FPHA 3JAKB 3PF8A 2O3QA 2HLDA 4QTUB 2XUPA 2YXDA 3E9YA 3ASYA 3RVRA 4HG2A 1FYFA 1DG3A 1TLTA 4G8JA 5G1NA 5CLFA 3EHEA 1DFGA 3NOOA 1V4BA 4O8CA 4C07A 1T2UA 4PN7A 4J75A 3D6TB 2REBA 2W90A 4LGCA 1XCBA 5FAXA 2YYAA 4CIWA 3KPYA 1C3EA 4ZEMA 3GCDA 1E2BA 1XZEA 4BCBA 1E2DA 3TXYA 2RSLA 1G21B 1VHQA 2W4IA 3G0OA 3Q9LA 4P31A 1TQ2A 3CE9A 3TRHA 1R6DA 4ZGWA 2REOA 4QHSA 4Y9DA 2Q5OA 3REOA 1JILA 3I6MA 1ULUA 2MYTA 3O9VA 4A8PA 4DZTA 1LPSA 4ZQFA 3EEOA 4REQB 1CERA 4ZU3A 3TW4A 3DB2A 4JC8A 3FWHA 1G6HA 1IN8A 2O0JA 2ZRBA 3NDPA 1OBVA 4OB6A 3T1YB 1C1DB 3ZZUA 2LDXA 4RLQA 3D0OA 4J0EA 4JUDX 1PFGA 1MO5A 1VB5A 2RI6A 3HBAA 3QOWA 4MUBA 4G67A 4ND3A 1SRQA 1QZUA 3W05A 5L3QA 5EPUA 1ETHA 2AKYA 3KSUA 3MWGA 3OFNA 2WT4A 4ZQIA 5IFLA 5JASA 1US8A 1X1RA 5JNLA 2QVYX 1MW8X 1GGKA 4R1NA 2HK9A 4FILA 4AO8A 4Z54A 3T5GA 3AZQA 3ZZMA 2Z4TA 2BHNA 1ZAYA 1VMEA 5G02A 3OJEA 5ALFA 1QCDA 5UKDA 3ULKA 2XUHA 2DJIA 4Y2PA 3VPDA 2X3FA 4PYNA 3SLRA 2IBTA 3LCMA 3GGGA 5EXEA 3SQLA 3DKIA 4NARA 3LX5A 4E03A 5I01A 5DWDA 1U5BB 1U81A 3F4BA 1ST2A 1G8KA 1ACJA 2BFAA 3BRWA 3EZLA 2HIHA 3VDRA 3WZLA 4AURA 1T5DX 3GR6A 3I0MA 5HTKA 5TGTA 3TSCA 4UHCA 1G1MA 4F93B 2F62A 2GERA 1R9JA 2PSEA 2ZSBA 3OEWA 4WK6A 5AVKA 1A9SA 5EE3A 1GTVA 1G5PA 2EL7A 3SXJA 3VTKA 3ZCRA 1E2HA 2IYSA 2PGNA 3JQGB 1MORA 3H2SA 4D98A 1GUBA 2BAGA 4IM7A 2R96A 5K4AA 1QK5A 4U39A 3DBLB 3IQEA 3C45A 2ZTUA 1KS2A 1Y80A 4Z4QA 2Z6UA 1NF2A 3H4TA 2QENA 2J7PD 3UYKA 4DJAA 4UOEA 3SF8B 2FMKA 1JU4A 4XUEA 4YX9A 2LW7A 3EDOA 2DYKA 4G23A 1IVSA 3LQKA 3NBQA 3GJTA 3CGWA 4G0MA 4LBVA 4CMIB 2VSFA 5TJHA 2CJWA 3D2AA 4N3BA 5KSPA 4HMOA 2HK8A 5CNKA 1PAUA 3Q41A 1T5TA 4G25A 4PPQA 1TIKA 2FSGA 4MTCA 5DGHA 1UR5A 3F47A 3WX0A 4DIBA 3TL2A 5AW6A 2VJPA 5AKLA 3ENQA 4ND2A 4CMGA 3N5KA 5KX5A 2ZVDA 3K20A 3KELA 3NAMA 3DOIA 3CUUA 1VBKA 5F5LA 3ZHCA 2FZKA 1AD2A 4EPTA 1EP2B 4EJSB 2W7TA 4H7JA 1ZU5A 4J2OA 4EO4A 1L6RA 4OP3A 1TF7A 821PA 1NRIA 4LJ5A 1COWA 4WNYA 2PA0A 1AJEA 2HSZA 4A8JB 3D7LA 3I4FA 5LOVF 1V48A 2IHZA 1MPTA 2FE4A 2J8ZA 3KWLA 1EYZA 1ZJ6A 3HA2A 3O1HB 1W44A 4MRMA 3V2GA 3MHTA 1BQEA 1R0SA 1IHDA 1RKBA 4OSEA 3UA3A 1N6HA 4KNYA 1G8PA 3FKQA 5JLAA 4XOUA 4KI7A 3D54D 1KDRA 1YCDA 1MB3A 1IHUA 1NVDA 1QQTA 2B78A 4ROSA 3K70D 3IIEA 4BKMA 3NYIA 4X92A 1F48A 3QX7A 4LX8A 4MI3A 2M6RA 1A2QA 1Q15A 2OUIA 1N7HA 1NI3A 4KGXA 4BQFA 3PFIA 3ZJ4A 2HA6A 5H9WA 4FI3F 2C58A 3NBUA 2E55A 4ZT3A 1QHIA 4AMZA 2E9SA 2QUIA 2ZKIA 2YJTD 1DRUA 3N2NA 4PR3A 5ECYA 5HG0A 5E0OA 3ICOA 4CTMA 4LXIA 2G5TA 5J4VA 4FNAA 1FOEB 3HDYA 3R3VA 3FCOA 2ZSEA 5H8WA 1DPGA 1SIOA 1NJ5A 2NO4A 3KKNA 1UPTA 1NMZA 4UDYX 3AGPA 3IE2A 4YLEA 5AR1A 1VBMA 1KQ3A 5MN5A 1GQ2A 5CM2Z 4HGRA 1OLUB 5HKKA 5DNAA 4PAWA 1P0QA 2VHCA 4RWZA 1BEUB 1V35A 4L73A 3T35A 4EHKA 5IWCA 2V1XA 4JXZA 2QTVA 1GEEA 3EB9A 3EIWA 4IILA 4IRMA 3I6BA 4C01A 3HVJA 1NOJA 2ZETA 4GSKA 4N01A 1L5WA 4HDMA 5AT1A 1UZLA 4RV5A 1K4KA 1PTJC 4G8CA 4D9NA 2WYHA 4KO4S 2SBTA 1OV4A 2B7LA 2AZ4A 2IEDA 3PG5A 1TQDA 4FN4A 4KG7A 5ALMA 3H86A 3QWAA 3U17A 3WB9A 2XA9A 4QO8A 2ARKA 2CSXA 1Q3KA 1E7YA 3CH5A 4LYDA 5JVDB 1WV0A 2VF5X 4TZKA 3ICCA 3CPHA 3PC8C 2HA5A 1V3VA 2ENUA 3BHJA 3CN9A 4QICA 4HBZA 1E9SA 5AKIA 4Y2RA 1ORWA 4JBNA 3JD3A 1D8TA 1CR1A 2PQ0A 3USES 3H0KA 3KB2A 1WR8A 4RVSA 1CQIA 4EYSA 1H1LB 2WFAA 2ZBEA 1NSYA 5E6RB 4CI9A 2XTZA 3AM4A 3I6IA 3E9CA 1QIGA 3H65A 4Q5IA 2BKXA 2VP0A 2YHIA 1ATZA 1MH9A 5IM4A 4FKBA 2A9RA 3D9QX 3N8NA 1ORTA 2IP1A 4YV7A 1KAGA 5TARA 3VR6D 4JYBA 4UJ5A 4AJ9A 4UZSA 3O8RA 1NVGA 2YXEA 2FDXA 1I36A 1N5RA 3DHEA 1AUOA 2R86A 5NLLA 4TZ0A 2ZBFA 3U60B 3OLWA 1KRXA 1EVJA 1HGXA 1AB6A 1I7PA 2QM8A 4D41A 4JROA 4P58A 3BEOA 4RJ2A 4CJXA 3PJDA 7ADHA 3OCWA 1MIHA 1ZBQA 1PG2A 3AP3A 1DAFA 2R84A 3BPSA 3ZHSA 3DO8A 4EY6A 3CSUA 5GWXA 4YMGA 5G0TA 3A6PC 1O77A 3VFDA 1CNEA 2XIQA 3C6BA 3HR8A 1KKLA 3MTAA 4KLRA 4D9BA 3EY9A 1OE0A 3MJCA 4BMOB 4LJSA 4QU5A 4BE7B 3UXMA 2CLEB 2HADA 4BU1A 2OE2A 2VZLA 2C07A 2V4MA 4CMEC 2PH7A 2VK1A 3VVLA 3G2JA 2VP9A 2WFLA 3EZYA 4WWHA 3EMKA 3T0FA 1YB5A 3I01A 3TECE 1XCJA 3LXUX 4BTLA 2IH4A 2XTAA 1RADA 2XY4A 4A82A 3FYHA 3LY9A 1YL7A 2D2FA 2GN1A 3MRXA 2WFMA 4IDHA 4QASA 3UB3A 1UMBA 1QPBA 2VDWA 2Z1DA 4MV0A 1V95A 2WP0A 4KQ2A 2ERYA 1KC3A 3O4JA 1ZJZA 2BM9A 4QLBA 1L7OA 4U9HS 2JHFA 2CLFB 3B5IA 1JG4A 2WW8A 4OYHA 3L82B 4S1TA 4AULA 3DC7A 1VE5A 2E49A 3TSWA 2EHDA 2D2VA 1PDOA 3K9FC 5IDVA 1I3CA 1DIAA 1T24A 1Y6JA 2I4IA 1RZ3A 2B25A 4KQJA 1U0HC 3LQQA 3QKRB 2EG5A 3IBSA 3SNHA 4B43A 3FNFA 2HWYA 2VPPA 2XOEA 1SXJE 3GDHA 3F7MA 3OUZA 5BR1A 1BMTA 2BMVA 3OJLA 3OMWA 4MV4A 2YRFA 2F1KA 4FEYA 1IQRA 3KOXA 2QAGB 4QOEA 5KNLA 3ZWYA 4DIMA 2AG0A 4JP3A 4ZCRA 5JCZA 1HLGA 2HYDA 4H0NA 4MA0A 4PFKA 3RFVA 2ZIUB 3HS3A 1IM5A 2FOXA 2XMBA 2O14A 3BJMA 1QGAA 3IVCA 4L2IB 3DTVD 4O2BF 2NVUB 1E61A 2FJUA 3OH8A 4HLUA 4X54A 2IYEA 3THOA 4EQ6A 4HNHA 1T8RA 1P44A 5EIAA 4E4TA 1VG9B 2AX4A 3IAFA 4YRKA 3CB2A 1UEXC 4DA8A 4Y67A 3HJRA 1SWVA 4YJHA 5JYDA 4YO7A 3OC0A 1PG0A 2IYXA 3K05A 4C4ZA 1M76A 2PZAA 5I7OA 2AEJA 2LUOA 5JCPA 4JUAA 2YDYA 1EU1A 2WK1A 5BXQC 5JJBA 3HXQA 2BD0A 3A14A 4B6SA 2RGXA 2J6BA 4XQCA 3TR0A 1LLDA 1V6SA 2BFWA 3A4MA 3FX2A 1U4NA 2QYTA 3HADA 2AFHB 2WA1A 2XX3A 5DGTA 2XMQA 3IEIA 2DR3A 2W2NA 3T8YA 4DEYA 2UXDB 1AO0A 4G97A 5GV7A 3ZXSA 4NDZA 1TIBA 2YXLA 3QPDA 1ZUWA 1NULA 1XUOA 1ULSA 4Q82A 5FPTA 4R7ZA 3G8YA 4YRDA 2ZUFA 2BUCA 2YFQA 4HNRA 4QPJC 4BNJA 3ORQA 1JBKA 2WF8A 4EJFA 1TUBB 5A4JA 6REQA 1W0JD 2QD2A 2VZEA 3BDAA 4DNXA 3TZ6A 1DJOA 3LJKA 4INAA 1XQ1A 4FHZA 4WN3A 4GL4A 4WOKA 1T34A 3NFRA 2DR2A 1DAPA 3BXEA 2VK8A 4KUHA 3Q1KA 1ISJA 1KFBB 2C04A 1KMCA 3LYLA 4GF5A 4LNUB 2B3DA 5BW8A 4TM8A 2KPOA 3WMWA 2YYZA 3TXXA 4M6WB 2QTAA 3IVAA 3LQFA 3V2HA 5JZSA 4HTFB 4KN6A 1RPAA 5A4FS 5ALGA 3LDGA 4Y9RA 1P9LA 4GMHA 3STXA 1BDJA 3OTWA 3W8RA 3LV8A 4LJ8A 1P2DA 2G07A 4GBED 1PHRA 5EIHA 5L3RA 1B0PA 3QEOA 5D3MA 4E0BA 3TBKA 2NVBA 4XGQA 1W581 3QPWA 1WUYA 3NBMA 3JQAB 1O08A 2X5OA 1JA0A 3B7PA 3DDHA 4GI3A 2ZYGA 4ZO7A 3VAYA 3WO1A 4CLRA 4V0OA 1RMQA 1C8VB 2I8CA 3AZOA 3M7IA 3U3ZA 2HJVA 1SG6A 2FSPA 2AX3A 4LWZA 4ZYWA 1FVOA 2A57A 4DLLA 4QHYA 3QF7A 1L7EA 1ONSA 2EP5A 1P3JA 4NMLA 3G6KA 5T4EA 1XE3A 1WOYA 1HNNA 2FN9A 3KR1A 3SG0A 1O6GA 3E5HA 1HE1C 1AQJA 3BIXA 3L3BA 3R5JA 1G6Q1 3L1UA 4AUEA 1U2SA 1ZEMA 1T6NA 2WWRA 1GUAA 4NV3A 1KMHA 3IBCA 3NJ4A 4CCYA 3WFJA 1FFYA 3H2IA 2W83A 1RWMA 2ASEA 4U7PB 5DLEA 4QZVA 2G8LA 3EXG2 3ZY6A 4D1YA 1ILWA 3D8HA 5DOVA 4CETA 4I2VA 1QBKC 3GB9A 1ZCJA 2QE6A 4YAKA 2SCUB 2A14A 2OPHA 3IQXA 2XT6A 1VE3A 2XNHA 4GYYA 4Q9JA 2AC7A 3S2UA 1XAJA 1JNXX 2MINA 3R76A 3TPZA 1J25A 1QE0A 1UL1X 1YRYE 1G8HA 5KVVA 3AXSA 1BZYA 1E8DA 3GFPA 5C1PA 1J70A 3K6JA 3C5WP 1UJ2A 5T64A 1XYVA 1NVVQ 1Q7EA 2ZBQA 3EQZA 1BA3A 2AXQA 1RRVA 3ZDFA 2AYYA 2W2PA 3AW8A 5GV8A 4M9QA 2I54A 3WFIA 1QYIA 1LV7A 1UKYA 2B4QA 2ZWMA 3ONVA 1ACLA 3GGJA 2RGDA 3L8FA 4I5IA 1JHMA 2JEYA 2WDPA 3CA8A 1V5WA 5TT1A 4ZHSA 1V11B 2FWIA 1NVFA 3FAKA 4XA8A 3MINB 3T9EA 3L7DA 2P6UA 3BF7A 4MWEA 3IV9A 1XRMA 4AG6A 1FQJA 2FHPA 3SEFA 4BFTA 4Q9IA 1E59A 2PJDA 1CP2A 2XMPA 5AK6A 3HVRA 3GLGA 3G9XA 3WYFA 1FYWA 1B74A 2R6HA 3FDZA 2ZJ8A 3IEUA 3OLQA 5KYVA 2XJ4A 3F3KA 1AF4A 2LIVA 3JQ8A 3LK6A 3LCJA 1Y8QB 4J0GA 4KWHA 4YGXB 3RWOA 5FV4A 4E12A 3MT9A 3S70A 2HSWA 1EWYA 4K46A 3ROXA 3QY9A 3LHKA 4IVRA 2A5JA 2XB6A 3EVBA 5HMMA 2X0EA 3RDPA 1XCGB 2O8DB 3ZDCA 3DUFA 1ZD3A 4X8OA 4F8EA 2F67A 2YCBA 1W8IA 4R9NA 3S1LA 2ZJAA 3TEMA 4BLWA 1CVRA 1FP4A 3CLVA 4K5QA 5HQJA 1TKAA 2RHTA 1GGMA 2AQIA 2CWDA 1G5HA 4WKBA 3TK1A 4Q1EA 1DRVA 5ELMA 1G38A 4E32A 2VAWA 3P32A 4B2LA 4ZOQI 2IYTA 1R4NA 1VL0A 4CKBA 3F90A 2GI4A 4XVRA 4UC0A 1VJRA 1FUKA 1TUEA 1F5SA 2QJRA 3B2EA 4QJ4A 4GOOD 3IUJA 3CH7A 1XRJA 1O5OA 2EEZA 1NF3A 3VC7A 4AZ3B 1C1YA 1E63A 5EKXA 1NXSA 3KKKA 2DWQA 3M6VA 4I8XA 5DBGA 1HYEA 2CJFA 3KQLA 4K26A 3ZI7A 2SKCA 2HV8A 4L22A 2PU5A 2ZYRA 3A3KA 2W6IA 3G6WA 1VHTA 1WW8A 3AR4A 1RYFA 2FFBA 2Z98A 2C5AA 3D1VA 1ZINA 5A9SB 1BVUA 2VRCA 3H1PA 4V0QA 2ZRQA 5ALWA 3R7SA 1Z83A 3WY9A 3BFXA 1HNWB 5COBA 5EERA 1L8LA 4JEHA 2EDAA 1P7PA 1A82A 3BMNB 4J4BA 1W2WB 1WXXA 2O7RA 5JS2A 2QJOA 1UC8A 4M1TA 4Q9AA 4RGQA 4LS3A 4JGGA 4JOBA 5LZ4A 2FRXA 1P5RA 2MYPA 1UP6A 1K8YB 2FG7C 2R8RA 3OPVA 1XDGA 4YUXA 3FPFA 1YVPA 2MCFA 5E6SB 3NC4A 3IUMA 2WG0A 3L8DA 4QFBA 3D8BA 4W1QA 2H9AA 4OBXA 3A1NA 1IQPA 2ILTA 3GP3A 1QGED 2H59A 1M6WA 4US2R 1YQ9A 2Z6VA 4KPUB 4Q7QA 3BHMA 1HK7A 1HFEL 2CHVA 4OHBA 2WHQA 2QA5A 4OCZA 1U2GA 2HHAA 2PGDA 3D5EA 3I92A 2IDMA 3R0XA 4KR7A 4Z1MA 3MS7A 5JSYA 4WT7A 4ASUD 4HEQA 4FOLA 4HLUC 4IJMA 1RMYA 2C1EA 3KAPA 1W0CA 3MNFA 4F9EA 1WXHA 3A37A 4P98A 3TLXA 4RMNA 2ZVQX 4QBTA 2JH9A 5KYWA 1PN3A 2OYSA 4LFCB 4UM8B 1MAHA 3GEEA 3M2TA 4R6WA 3RVJA 4YRMA 5LDDC 1ND5A 4MVXA 3C98A 2HMAA 5KTRA 1GXSB 1WKVA 4J29A 3JAMA 4UQOA 2C96A 2EWVA 4O4IA 1ZOOA 1Z6AA 3LXXA 1OWNA 3MK31 3CKLA 4J0DA 3KJFA 3IEKA 5JAPA 1I0ZA 4EEKA 1S7GA 2ZREA 1E1RD 4KR9A 2FW7A 3VSBA 3DAGA 3RGWS 2DFVA 2YUIA 1KRWA 1LK7A 2PKCA 1UH5A