4HB3A

Crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb3A00
4X8HA 3QE0A 4JVNA 1Y3AA 5JBQA 1IXRC 2D7CA 4M22A 6Q21A 3AGQA 1D2NA 1AK2A 4KBGA 2AXPA 3LWNA 1GM5A 3HYTA 1KJWA 2FF7A 4M21A 3AF0A 3KJIA 5H1YA 4KITB 3R9XA 4HEJA 5FBLB 2GBLA 4LUCA 5FOTA 2MSEB 2WWHA 2XZLA 3NEYA 2ZYWX 2A5GA 2PJRA 1RPZA 3W8NA 5KDOA 3CX7A 4NDZA 1KJYA 2NO1A 2ZR7A 2F9LA 4EPWA 2IWHA 2RGEA 1SVIA 1TF7A 1OXUA 1TX4B 4OK6A 4HB0A 3UK6A 1Z0IA 3HU2A 5D3MB 3IEUA 4MYTA 1CRQA 1TQ2A 1XD2B 1Z22A 1Z28A 2GWHA 3E5HA 3N2EA 4PPNA 1M7HA 1OIVA 2ZSAA 4LBZA 1EFTA 5TVKA 5AK0A 3I8XA 3BIFA 4QG7A 4TLAA 4YMTA 3ND9A 3PUXA 4C0LA 1JJ7A 1R5NA 3B13B 4DLUA 2E9SA 1RVDA 2ODEA 2WPDA 2YOHA 1UAAA 4C0JA 1E2NA 3DO6A 3IBGA 4MRNA 1N6OA 3CM0A 4ON9A 1U81A 1HE1C 3IPXA 1Z83A 3BERA 2PJZA 1IN4A 1L8QA 1NBME 1W5SA 1XU4A 2RGXA 5FUXA 5FR2A 2X77A 2QORA 5JWOA 3FTQA 4DDVA 2GJAA 2H7VA 4Q18A 3DOEA 1XF9A 2Z4RA 5EZ6B 2JJ2D 4RD1A 3U60B 1Z6XA 4OYHA 1G41A 3UMSA 4F4IA 3NC1C 4U5XA 1JAIA 4RZ2A 1EFUA 3OZXA 3KXKA 4FWTA 2SHKA 3QG5A 1OHHD 4PO1A 4YMSA 3VMFA 1U99A 4TLCA 4B74A 4YXWD 1GKYA 2J0VA 1U2RA 3O47A 3Q72A 1DAKA 3U7HB 1W46A 3IO5A 1ZRHA 4KO8A 1BMFA 4V02A 4Z8YA 4EPXA 1J90A 3TBKA 1E2JA 1S4QA 4HAUA 3LRPA 2EFCB 4PPFA 2O8FB 2V9PA 4LK2A 4V0MA 1QZXA 1BOFA 4PZLA 2OLJA 1XD8A 3NBZC 3CX6A 3F5FA 4PC2A 1KI9A 2QMUA 1ZIOA 1FPMA 3KXLA 4HAZA 4Q4JA 2ZSDA 3KQHA 5FL3A 4D4LA 4HYYA 4B2LA 1A4RA 2QSZA 4A15A 3DZ8A 5E7IA 4D6PA 1CR2A 2QTFA 2J7KA 3IIMA 2AR7A 4KBFA 5KOYA 1KDOA 3ADBA 1G9XA 1RJ9A 1ZCBA 4QGAA 4XH9B 3W6NA 3RS4A 4FXPA 4CIDA 4EFNA 1CR1A 1TL7C 1TADA 4LJ5A 3RRNA 4C3ZA 3B1ZA 5F3WB 2JLVA 1LF0A 4IVPA 1ESMA 2J0UA 1CTQA 1Q1BA 4WAUA 1NKSA 4NCHA 1JXMA 5ANRB 3W6OA 2W6ID 4NBSA 1N6KA 3AKYA 1UKZA 3V00A 3LXXA 1TPZA 2B8WA 3K70D 1E4VA 4QBGB 2CK3A 2AL7A 3JVUA 1XTQA 4JLOA 4Q00A 3A37A 2BMJA 3U3JA 8OHMA 3EPHA 1OFUX 3EZFA 4HDQB 2CBZA 5FUYA 1XTRA 1GITA 3OIYA 3U7GA 1WXQA 1L4YA 3EC1A 3VR4A 2IYLD 2QL6A 4WA7A 2FSHA 1R7RA 1H8HA 4PANA 4YDHB 4Z51A 1XTKA 2EFGA 3BD9A 2GK6A 1NF3A 2IL1A 1N5JA 1ZM3A 3TSZA 4KSCA 2OO7A 5FL7A 3NHAA 4BEBA 1W5TA 2NG1A 2X8AA 1UBEA 2J1LA 1SKYB 4O25A 1T3SA 3G82C 3KKPA 5TDHA 1Z08A 2IT1A 2YWGA 2FH5B 2YINC 5KHOC 1RE0A 3TUIC 4MKIA 3ZVMA 5FPYA 4JVMA 4C2UA 2BBOA 2JJ1A 5CK5A 1IOZA 2C98A 3KKMA 2XX3A 3I61A 4PAOA 2IA5A 4UXIA 3OHMA 4C0SA 3CF6R 4QJ4A 5J4LA 4GMDA 4M9XA 1CIPA 4K8OA 4LBYA 2J45A 1G3IA 4OQLA 4IVQA 3P4XA 1ZNZA 3IGFA 1EK0A 2X2EA 3Q5DA 4EFMA 1B0UA 2EFHB 3RSOA 4PQYA 1Z0AA 1PUJA 4XVQA 2CNWA 3FMOB 4D80A 5GVRA 5C4MA 2OEPA 1AM4D 3T35A 3H4MA 4Q7LA 1Z0FA 4OK5A 2Z0MA 4AK9A 2I1QA 2IS1A 3GCGA 4TMXA 4O2LA 2G88A 3E70C 4PHFA 4LJ9A 2RGDA 4Q1AA 1W48A 3C4JA 3QIAA 3LX5A 3MWYW 3QPUA 4QGHA 4BFSA 2YOFA 3MCAA 2CLDX 4CF7A 2OCPA 5C4GB 3DKPA 4LCBA 4HAVA 3CF2A 3ASYA 4AD8A 2QENA 4DLWA 1UBCA 4DSNA 1PUIA 2VP4A 3KQUA 1KOFA 1GSIA 1U0HC 2BVNA 1IAQA 3X2SA 3IIJA 3EIEA 5L3QA 2QQEA 4RZ3A 4NTZA 2QQ0A 3WBJA 3GLFA 1M74A 4B75A 3P20A 4B3XA 2CE7A 4G5QA 1YHNA 4KYIB 1UKYA 4FWIB 4C0BA 3KDSE 2ODBA 3AP1A 4TYWA 1KI2A 2KB0A 2Z6VA 5JWHA 1O3YA 3HU3A 3KQLA 4W5JA 3A1WA 4DKXA 4QGFA 3WRXC 2FA9A 2VP2A 3VR1A 1P73A 1GNQA 1E0JA 2FJUA 1Z3IX 2MMCA 4O0MA 2ASEA 2BBTA 1US8B 2CHVA 3AV0B 1RFLA 3C7KA 3K0AB 2WIBA 2KBFA 4OHXA 3K0FB 3WBKA 3CW2A 3I8SA 1Q21A 1ZM9A 2CJWB 2VF8A 5SZIA 2GA8A 3QVUA 1JEEA 4R9UC 3VX3A 4AYWA 4BZPA 1E9SA 4WBSA 1IN8A 3U3OA 4HB4A 4ZIRB 3ZH9B 5JS8A 1OH5A 1EG7A 1DAFA 1K5DA 2WOJA 3OF5A 2ZRNA 5DH9A 1ZD8A 1ODFA 3T1TA 1U98A 5JEEA 3RS7A 3RC8A 3SDZA 4R2HA 2QT0A 3RRMA 4LC1A 3WMFA 4XD7D 1R8SA 4PQRA 3AH8A 3GJ6A 3ONWA 5LBIA 2NPFA 3REGA 3TMKA 3ADCA 4GSYA 4TYNA 1QG4A 2PT5A 3AF3A 1HUQA 2GJ9A 2ZJ2A 3CRRA 4JYBA 3O8RA 2CEAA 2JLWA 4Q66C 1SVLA 4GT1A 3LQRA 4DDTA 1II8A 1KAGA 4IXNA 2ZJ5A 2VQSA 5C46F 2ZE6A 4U7DA 3GJ0A 5KNCA 2HXSA 4MITA 1VECA 4G5SA 2FSIA 4OI4A 3SHWA 1VHLA 2GF9A 2B8TA 5JECA 4CEIA 1Q57A 1YZGA 1UKEA 2F43A 4QOSA 4C4PA 2ZITA 3K70C 3U6KA 2H57A 1T91A 1FNNA 1UF9A 2AWNA 4DLYA 1FNMA 1AQYA 4PC3A 1G3QA 2NPIA 4JZKA 2RGBA 2V7QD 3P1JA 3WXMA 4GOJA 5EE9A 3MD0A 1J70A 4LJ7A 5UKDA 2ZYUX 4LHYA 2HJGA 5E7MA 2PBRA 2ZRLA 4ARZB 1E69A 1SVSA 3VHXA 1W47A 4BZXA 2BKEA 3FFBA 4PZYA 3AVVA 3CH4B 4PC7A 1KDPA 4NYIQ 2IX3A 3ZD6A 1T5IA 2WPDD 2XTZA 3GQBA 2B6HA 2IWRA 4Q4HB 1HQYE 3CPHA 1DG3A 2JLZA 5B57C 4PFSA 4PQFA 2F1RA 2RHDA 4JLJA 3CIOA 1DBSA 3SE0A 3B8HA 1JNYA 2CLSA 2FFBA 3RANA 2J0QA 1NVUQ 3KFXA 4D0LB 4W9MC 1IM2A 4CEJB 2UZ3A 1XMIA 4QNMA 3CX8A 2FFAA 2ZSEA 4JJZA 5AWFC 3WP0A 4L16A 2QMOA 5JCPA 3EARA 621PA 4JLDA 1KAOA 5JS7A 2ZU6A 4PSVA 2BJVA 2IS2A 4HLCA 5TY0A 3K70B 1BO6A 1D2EA 1NL3A 3R20A 2VBCA 4LJ6A 3OESA 2G1KA 3AUXA 1KI7A 3LXRA 1E2LA 1BMFD 2ZM5A 1L4UA 2R44A 4ZDKA 3VFDA 3T61A 1P2VA 2DBYA 3K0AA 4TMKA 1J8MF 1S2MA 5DSZA 5TXGA 1G3MA 3UKDA 4AYTA 1T5LA 4TL6A 1DS6A 3KTAA 4NYMQ 821PA 1W36D 4DLXA 3IBYA 3CPJB 1ETUA 2P6UA 1UEJA 1YRBA 1W4AA 3RS3A 1W2HA 3C41J 3SYLA 2WAYA 1W0KA 3QEJA 3BFXA 2YWFA 4D4KA 3OFND 1A2KC 1GKIA 1XBTA 4BEJA 3VKGA 4OI2A 2F1HA 1YZKA 5J4HA 2ZRDA 2Q9CA 3ZJYA 2QT1A 2JLRA 3TRFA 2JEOA 1KMHA 1FX0B 1P9WA 2YV5A 2ZI5A 4WXRA 5CLLA 3I72A 4FW9A 1ZM7A 4A6XA 1KIMA 2KBEA 3ZQJA 3LLUA 4MA4A 3T12A 1F5NA 1CKEA 4KLZA 4CYMA 1OYWA 4FMCB 1F2TA 4JMPA 4EIWA 2GXAA 3B60A 2B92A 1E2IA 4BFUA 121PA 1U0LA 2GRJA 4FCWA 4TYQA 4M9SA 2A30A 1WE2A 5K8IA 1OIWA 1ZCAA 5J4VA 4C2TA 3LD9A 4CRWB 3J81k 1VCOA 1NMYA 5HE9A 3AKDA 4PHGA 2IS6A 3PUVA 4JLBA 1GIAA 3T5DA 4BFXA 3WNBA 1OHHA 4CT4B 2OLKA 1HE8B 1KJZA 4ITRC 4UJ5A 5AJWA 5FL7D 3CRVA 4YXWA 4FMCF 3S1AB 2E1RA 2CHGA 2V4ZA 5IRCD 3HP1A 1KI3A 4P32A 1XTIA 2N42A 4OK3A 2F6RA 3GLHB 4F4JA 2MSCB 4F91B 2FSGA 2I3BA 2JDID 4Z54A 4IDHA 4PHHA 5KDDA 4DCVA 2FEMA 1CJVC 2WJIA 5B58C 4MQBA 2KE5A 3ETLA 5G3YA 1F3OA 1VIYA 1G5PA 1OB2A 2ZETA 1NJGA 4QBFA 1Z29A 1DAMA 1TMKA 3B1XA 1KK2A 1Z07A 2H1LA 4Q4HA 5EZ5A 3GLIB 2XTMA 4UKDA 2BMDA 3UG7A 2QM7A 4CT5A 2GJ8A 4JSTA 3DMDA 3KUDA 3B82A 3C15C 3LAWA 5JHGB 5J5CA 1E99A 1D9XA 4PX9A 4B32A 2IUUA 5FPTA 4JL8A 4CEJA 1I4DD 3AEZA 1YKSA 1JXOA 5HKKD 4Q7KA 5JI2E 2C2HA 3Q85A 1E0KA 5TV2A 1OH7A 4HLDA 1VDZA 1VG9B 4R2IA 1G1MA 4Q9JA 2W6IA 3K9GA 4PR0A 2ZJZA 4NMMA 4ERNA 2IYRA 4Q47A 4AG5A 4D82A 2G0NA 2GZHA 2VF7A 2QGNA 5AJVB 1X86B 1T3HA 4TYPA 3UWKA 1YZQA 3KX2A 2G6BA 3PENA 3NDPA 4JLNA 3LVRE 3WYGA 2HT6A 1QHSA 4OI0A 2XXAB 3EX7C 4PZZA 3RVBA 1A7JA 1D8TA 1YU9A 2GKSA 4Q02A 3FHOA 4W7SA 2P6RA 5JRZA 1U0JA 4YC7A 1R10A 4TWZA 1HTWA 4B34A 1E1QD 1OFTA 1SXJA 4M1OA 2P65A 1SVKA 5SZJA 5B30A 1W49A 3KZ1E 2ZAOA 4JT4A 3RWMB 4I1OA 5FBVB 3DMNA 1VG8A 2EVWX 2PCLA 3NKVA 4LI0A 2ZJYA 4NP6A 1TTTA 1D6JA 4Q1EA 3AKCA 2ZRBA 2DWPA 2I4IA 3BORA 2EWWA 1AKEA 5ELXA 1XPOA 4AI6A 1UKVY 1ZNYA 4IXMA 3SI7A 2ZJ8A 2R65A 3UIEA 1W2GA 3GJ4A 2D74A 2UKDA 2WJVA 4OQNA 4KVAA 1G3RA 2EWVA 1TF5A 4US2R 2V1XA 1KK1A 4MDEA 2YZ2A 3K09C 4QBIA 4RD0A 5FBQB 3VQTA 4GP6A 4Q48A 5FTNA 4PPQA 1MO3A 3RAPR 2IYQA 3U6BA 1MKYA 5KSZA 1YE8A 4LHXA 1W36C 2HF8A 1VCMA 1XPRA 3BFKA 2RH5A 4AURA 4D4MA 5F9FA 1AS0A 1NVWQ 4JLAA 1UADA 4MDFA 5DNYB 2ZRHA 5DHAA 1HH4A 1RYFA 1I2DA 4P4SB 3QKRB 4P33A 4M1TA 1DARA 2HLDD 1GNRA 1P9RA 4GMXA 4II7A 4MKFA 3ICQB 3T1VA 4OJQA 1JJVA 2BMFA 1AN0A 2BEKA 5FOWA 3U3KA 3RSLA 4DXAA 4R71A 1OW3B 2FOLA 2NO9A 3EA0A 4EPTA 1UJ2A 4NHOA 2VHUA 3A8TA 2ZROA 3PJRA 3X1ZA 5EP2A 1YRAA 1FMLA 1OF1A 2A5DA 4Q1DA 2R8RA 1JECA 1IHUA 3RLFA 4IJMA 5CB8A 2GTPA 3TSOA 2GCNA 5FTKA 4BFWA 2ZRMA 1YQTA 1G4UR 3O8CA 1X3SA 4LX0A 3AB3A 4DCTA 2H17A 1N0VC 4UNNA 3RDPA 2ANCA 2WTUA 1KKMA 4UNRA 1CU1A 3UPUA 3LBIA 2BOVA 5HPYB 1MT0A 3QJYA 4HAWA 1A82A 2CE2X 1YVDA 1CJTC 4DLZA 1I2MA 3IIKA 2ZRCA 3KFVA 4EFLA 4WXPA 2VEDA 3CWZA 2N1BA 3GFTA 3SYKA 2ZRIA 1U9IC 1FFHA 3GLGE 2XOKD 2FSFA 1M7GA 5B2ZA 4BE7B 2AD1A 1DADA 4HATA 1G8GA 1UDWA 2PT7A 1RJ9B 4DB4A 3IDQA 4BLTA 1WMSA 3QG1A 4XD7A 3A6PC 2VP6A 4PAMA 1OFIA 5K8UA 3AVWA 1CBUA 4TMWA 1GP2A 1M1YE 1SZPA 4V0KA 3TIFA 3CLVA 2IS4A 4FN5A 1DO0A 2OXCA 5EXSA 3THWA 1VTKA 2RAPA 4MRRA 1GZSA 2GXUA 4XTCS 4AKEA 3EPKA 1XDBA 2YWEA 2WKQA 5HTKA 4YLGA 5BN4A 2ECKA 3A4LA 3B2EA 4TTRA 1N6RA 3EWAA 1JPNA 4A36A 4DHEA 2FU5C 1VCIA 4LDJA 4DUGD 1FTNA 4YONB 4RSGA 1G8YA 2Y8EA 4DIDA 4L9SA 2NTYC 4LYFA 4A9AA 1R4AA 1W0KD 4GRAA 3PV0A 2V7QA 4F7WA 2OSBA 1LTQA 4B6EA 2JA1A 3CNNA 4B6FA 2FE4A 4KAXA 3K9LA 4G5OA 4DWJA 1P7CA 2AKAB 4D4JA 4XWAA 1UEIA 5BXQC 4M2LA 5DYIA 5L3SB 5JSZA 1K8RA 4B33A 2ATXA 4LJ4A 4UQOA 4P4SA 4BPBA 3QKRA 3BRWD 4MGKR 4UJ3A 4D26A 1TEVA 2ZJBA 4HLQB 4URVR 3FHTA 2A7QA 2IEZA 3UMRA 1IY1A 5JJKA 1HT1E 1AZSC 2V6JA 2AKYA 2QZ4A 4JKIA 1E2KA 3QKSA 3U44A 1AIPA 4Q1FA 2AHOA 3TKLA 4ZDIA 5A0FA 5JCZA 2FGJA 3GEHA 5H70A 1NRJB 3MWKA 2RGAA 2CCGA 1XMJA 1ZNWA 2OCAA 4EJSC 4OQXA 3RC3A 2OAQ1 1NIPA 2DFTA 1G7SA 2EFEB 4ZKEA 4AKIA 4IDPA 5B64A 1EWRA 5GVSA 4LPKA 4Z8XA 1ZJ6A 4L4UA 4DCNA 3QXXA 2CVFA 3DOFA 3L82B 2X2FA 1E2GA 5FOXA 5EP3A 2LCFA 3LBHA 3U2QA 4CW7A 1NBMA 3K09A 3DDCA 2ZS9A 4NCKA 4ZO4A 2JAQA 2VHJA 1O87A 4IEEA 4X8MA 5CM8B 4JJKA 3TUJC 5LD2C 2FPMA 1KZ7B 4R7ZA 3ZGXA 5L3QB 3WY9A 3PUYA 1YJ5A 4H9GA 4TTQA 1PVOA 3EASA 4NU0A 5TMPA 2ERXA 3GLFB 2H5EA 2QGZA 4YQFA 4OHYA 2YHSA 1KSFX 3OAAD 1JALA 2ORWA 3OFNA 5L3VA 1N0WA 4RFSA 1N6PA 3PR1A 1JB1A 3OE7D 2A78A 3PG5A 4HAYA 5IF9A 1AA9A 2WBLC 1S1MA 2GCOB 3DKVA 5F2EA 1K6MA 4IFEA 1XFAA 1N6NA 2WJYA 2ZI9A 4LY6A 4Q1BA 4L15A 2A2ZA 4GL2A 1KGDA 3FE2A 4DBLC 3I1FA 4XIGS 4HZIA 3R8FA 1Q0UA 4V03A 2PL3A 3X1WA 5CK4A 1RYHA 2VHTA 2GJKA 2CL0X 2P67A 3OEHA 3TJZA 1CS4C 4TLBA 2PZEA 1XCGB 2VIIA 1ANKA 1XXHB 4JBYA 4X8OA 2QTVB 2RCNA 2REBA 1NLZA 5DYGA 1EFRD 2OG2A 3FHCB 3JVVA 2NIPA 4HAXA 2OFOA 5FPKA 2IXEA 3AVPA 1ZC3A 1G8HA 2P3SA 4BUJA 4LRWA 1OE0A 5LD2B 4RKFA 3I73A 1YR6A 3LH5A 5L8VA 2XGJA 1SXJD 5KSOA 4A8JC 1EFCA 1P62B 2DFKB 2QE7D 1J2JA 4H1VA 2R6CA 5E95A 1Z6AA 1EGAA 3SYNA 3T15A 5JJIA 4JKYA 1T0HB 2D2FA 5FI0B 1II8B 5FH9A 5CB6A 1U9IA 1IXSB 3TNFA 2JDIA 2DWQA 5M04A 2CL6X 2WKRA 3WMGA 2VSOA 1WRBA 4KODA 1G17A 1NMXA 3O8DA 1GFIA 1KO1A 5L3SA 2F43B 2H18A 4CEIB 3PVSA 1QHIA 2BCGY 1FUKA 3HPRA 3T1QA 4DCUA 5FI1B 3PCRB 1E9RA 3EWSA 1W0JD 4J0QA 1UFQA 4TMTA 5KU1A 3KQNA 4FINA 1IN5A 3TR0A 1G18A 4IEIA 3EXAA 3L43A 3W6PA 2A3RA 2ODNA 4U00A 4EPYA 3TW8B 1RRFA 3FGNA 1WF3A 4P3YA 1AGPA 2BJWA 2DYKA 3MJRA 4QRHA 5HKKA 4C9BA 3CNOA 1JQLB 1R0XA 4PC6A 3AVTA 2A9KA 1Q20A 1G5RA 4N3NA 2ZQ5A 2ZSBA 4GZLA 1E79D 1QG2A 2PMKA 5AJYA 5DI9A 3MFYA 5E4FA 2J3EA 4JT2A 1YZLA 1CR0A 5HCIA 4Z1MD 1Z6GA 1GL7A 3BK7A 1XJCA 2QUZA 4FI3C 1CEEA 2J0SA 2ZI7A 3SQWA 1E9EA 1E1QA 4LJYA 3PEVA 4TMVA 5EXXA 2JCSA 3BBPA 4BFYA 1P72A 4LZZA 1DE0A 1XZPA 1XEXA 4M1SA 1C9KA 4B43A 4RJLA 3ZYCA 4GI7A 3HYRA 3KJGA 1MRSA 1WCV1 1W7AA 1DVRA 2WMOB 1GILA 4KXFB 2QPOA 2GCOA 3NG1A 2O8CB 1WBDA 1KDRA 3CUEF 2R6FA 4WZAE 4BECA 3B6EA 1BYUA 1VG0B 1X1SA 3BWDD 3D31A 3KTAB 2KWIA 1VIAA 3O8BA 4I1SA 2ATVA 2W2XA 2DY1A 3AF1A 3PFIA 3GJ5A 4NL4H 4XWOA 5CM9C 5EJEA 4EJSA 4URZR 5KPDA 2ZVPX 2QPAA 3AF4A 1EFHA 1XXHA 1N25A 2C9OA 4B48A 5KNBA 2EQBA 1KSJA 1QDEA 2AXNA 4FMDB 4BLOA 2NO7A 1JPJA 2C8VA 2G83A 3CWQA 1BH2A 4JL5A 3QI2A 4PAQA 4QKQA 1KMHB 1VCNA 1Q44A 2J7PD 2BBWA 3P27A 2ZUDA 4UNPA 3FFAA 2W2VA 1G6OA 3G5UA 4LYHA 5G40A 1WBBA 1FP7A 2HLDA 3FPAA 1SHKA 3AVOA 2GXSA 1F2TB 1SKYE 1FMJA 4WOPA 5AUOB 1CJUC 1NKTA 3A1SA 2QP4A 3WRYC 1X8KA 3A1VA 2ZRPA 3MG9A 2ZU0C 1HYQA 1KDTA 5D3QA 4FIDA 4FMDF 5GJVC 3THYA 4ZDJA 3RS0A 3I3SR 4MH0R 2B21A 2OBMA 5LB2A 4LBVA 5JFGA 2C96A 4TTPA 3B78A 4RCZA 1WA5A 1ZC4A 4HUQA 4KSBA 1NVVQ 4AIIA 4A82A 1XNJA 2RGNC 3M1IA 2A5JA 3ZIAD 2OCBA 2W6JD 4WVFA 3T1OA 4OHVA 4TLDA 2O8EB 2ZEJA 2HT1A 3SEAA 1C1YA 5LPNA 5JMTA 2XNDA 1XP8A 1KI8A 1ZNXA 2VH5R 4ZCIA 2IYZA 3MMPA 1AGRA 1XTSA 3CRW1 4ESHA 3KQKA 1QBKC 1GRRA 4M9ZA 4E07A 1R6BX 1SXJC 3AGPA 4PPGA 4B71A 4BRWA 3Q5EA 4LHVA 3L8YA 1E0SA 4GPTA 4TQAA 2VSFA 3RS2A 2K5UA 4BFVA 2GZDA 3CRMA 4E22A 4DEYA 1LB1B 1IJEA 1KZGB 3L2OB 4KCGA 4A0RA 2XOKA 4BLPA 1ZP6A 5LB4A 1XJ0A 4M8NE 2ZS8A 3K9HA 3GFOA 2BWJA 3EZ2A 4A8JA 3NXSA 1IY0A 1NIJA 1G64A 2R9VA 2QNRA 2FX3A 1G3UA 4XWKA 2VA8A 4HLUC 2FPKA 5BN3A 1XTJA 3H86A 2Q9AA 3U61B 3KXIA 4A0HA 2ZJOA 4RZXA 1R5BA 3KKQA 1LS6A 4QHYA 1WDTA 1CRPA 1OT3A 4EPRA 1ONBA 2FMXA 5E3HA 1A1VA 1KMQA 2LWIA 4PSKA 4BLSA 3QPWA 2FZ4A 1HURA 3I32A 4C30A 3SJCA 1NBMD 3UWOA 2O8CA 2GHIA 3GMTA 3P4YA 221PA 1RRCA 3DM9B 1DELA 5JJLA 2HJVA 4DUGA 1N5IA 4JVLA 1U94A 4MGIR 2ORIA 5TB5A 4M4SA 3EZ7A 3LX8A 3QF4A 2HCBA 3CO5A 2JASA 5EUQB 1W4RA 1E2EA 1G16A 3FYHA 2ONKA 4M9QA 1SXJB 3ASZA 2GETA 5FBWB 4DEXA 2JLQA 2WWWA 1QHHB 4LJAA 4AC9A 5KPJA 2J46A 4DIEA 4E03A 1NN5A 1G21E 3AVYA 2ZI6A 2ZUCA 1T9HA 4X8LA 1N6LA 4PC1A 1X8JA 3QENA 3GJ8A 1C4OA 5E7JA 3SC3A 4B2PA 1KK3A 1E1RA 4XJXA 4CGZA 2OE2A 3DZDA 4XSHA 3VU9B 4JBXA 3THOA 3HDTA 4Q5IA 2IBMA 4ILEA 2QSYA 1ZD1A 4RD3A 3RYTC 2Q3HA 3ZQ6A 3KL4A 4NZYA 3LNCA 3OEHD 3GD7A 3WYAA 5J4KA 3REFA 1XCPA 2Z5FA 3BB1A 3CKLA 1JR6A 4JVSB 4ZKDA 2F3TA 3LV8A 1YR8A 3MUFA 4LSGA 4NCJA 2FV8A 3K0EA 3FMPB 3PQCA 4KI0A 3RRZA 2O52A 4LYJA 2QA5A 1U8AA 5GADl 2C9YA 4KFTA 4A2PA 2WMNB 1Z8FA 2REXB 2DB3A 5A4JA 1Q3TA 4EPVA 1CP2A 1GL6A 3WNDA 2OM2A 1DG1G 4JLKA 1E96A 2AD5A 2JGNA 3FWYA 4M53A 5CDFA 1T6NA 4IOJA 4DT1A 3FOZA 2O8EA 2J41A 4V0LA 2Q6TA 1P5ZB 1U8ZA 2VYFA 2QMHA 4QBHA 1OH6A 1QHGA 1VHTA 2ZRGA 3KUCA 1NN1A 5AJZA 5CYPA 1XRJA 1T8UA 4DSUA 3DEFA 1NP6A 2O0KA 4C7OA 3RHFA 1E98A 1KI6B 1U8YA 2ZUBA 3IO3A 5DN6A 4B3DA 3QKUA 3LW7A 3ND8A 4F38A 1OPXA 3OAAA 4JBWA 3E1SA 2WAXA 2WICA 4N0DA 4D0NA 5A5GA 2QAJA 2DWOA 1NN0A 5FTJA 3OE7A 1PLLA 4GOKA 2VP0A 2H8KA 1HQCA 2ORVA 3A4MA 4D81A 1NY6A 5DI3A 3M0EA 3SQXA 3EZ6A 1UPTA 1N3BA 3U7FB 4F92B 2V8OA 3QEOA 1BS1A 4BLQA 1BYIA 2HXYA 2OT3B 5EE0A 1VYTA 3Q3JB 1IJFA 4KYUA 1J7KA 1ELOA 1S8FA 1RRGA 4EKDA 1NJFA 3TW4A 1ZVQA 1E9CA 1GKUB 2RGNA 1VYVA 3SU8A 1E0AA 1QVRA 2G1JA 1KSHA 3VNVA 3CNLA 1NN3A 2QU8A 3C14C 4LBWA 1A2BA 1EFRA 4F4CA 1II9A 3KKNA 3EAQA 3ZS8A 2YKGA 1E94E 2QY9A 3HR8A 1ZU5A 3BGWA 1JR3E 1G7RA 2OFXA 1Q22A 4IKEA 4DZZA 3DVLA 1YR9A 2JJ8A 3G0HA 2HEIA 3CRQA 1QHHA 1CULC 5CITA 2QE7A 1E2HA 3THWB 3BFVA 3VHLB 5HCNA 2PEZA 4Q01A 2IUSA 4RFVA 1KNXA 3UXMA 4WZBE 2UZIR 2PX0A 2XAUA 4LHWA 4DRZA 4DSOA 2XEXA 1WP9A 2NQ2C 4UNQA 2YC2C 4F93B 3NBXX 1JI0A 3GJ3A 2OILA 1YZNA 1ZYUA 4QHTA 4LJ8A 2C04A 3IQXA 1W0JA 1SKQA 2BKUA 3UATA 2CDNA 3IILA 3VU9A 2P5SA 1Q1QA 2QG6A 4QC2A 1H8EA 1QVAA 4HLUA 5JRJA 1TU3A 1KY3A 1XEFA 4L8GA 3SJZA 3W9YA 1COWA 1Z2AA 1II0A 4Q4AA 1B23P 3M6AA 1ZD9A 3K1JA 4I4LA 5JZVA 3ZZ0A 2QM8A 1DPFA 5EXPA 4AWXA 2IHYA 2RGGA 3NWJA 5AR1A 4EQ6B 1E32A 1MH1A 1IN7A 4RD6A 5JSZB 3ZVLA 1V43A 1PZNA 2OBNA 3C8UA 3H1TA 4D0GA 4ASUD 1G20E 1E79A 1YR7A 5AUNB 3B1YA 3SOPA 4B44A 4TL9A 2WWYA 2Z43A 1OH8A 4MUBA 1FUUA 2OCYC 4Z1MA 1Z6TA 2F55A 4BRUA 3GLHE 2WWIA 3QKSB 3U44B 3RWOA 3SZRA 2Q21A 4ZPXA 4HZUA 1ZAKA 4TL8A 1KI6A 1Z0DA 2HCJB 1A5TA 2H16A 1GVNB 2BC9A 2BIFA 5SZKB 2ZI4A 4R98A 5EUMA 4C0HA 2FG5A 4QFMA 3GLIE 3RS5A 4POAA 3OEED 1RZ3A 2GAOA 2OV2A 3T5GA 4TSFD 4NPHA 2QAGC 4KVGA 4QJ5A 3ZZTA 2I1VB 2XNDD 1FQKA 2GEUA 2CCKA 4KFUA 4Q7MB 5BWMA 3EIHA 1N6IA 2O8DB 4LGMA 2VLIA 4G5RA 1EESA 1DTSA 1W36B 2QN6A 4LOAA 3FKSD 3BH7A 3N5CA 2WZQA 4IOLA 3GEEA 2ZXUA 1SGWA 4PHTA 4TZ0A 5DO9A 1Z6YA 3AVQA 1HT2E 2IYXA 4KV9A 2G3YA 4C0QC 2QP9X 1Q1ZA 3CR8A 2D3WA 1JAHA 1KK0A 1MABB 2Q3FA 2VP5A 4LV6A 1M34E 4RFSB 4Q03A 2GEVA 2P0EA 1OYYA 3AKEA 1OXXK 5KUTA 3ECCA 5EE1A 4CDGA 1YZTA 4NCIA 2WWGA 2J7PA 1R5OA 1KTVA 2R2AA 4IFBA 4ZDWA 3OIWA 4IRUB 4OBEA 4YMUA 4TLEA 3TSWA 2ZTSA 5FBRB 3SHFA 3IHWA 3U3MA 1GL9B 2H92A 3OIVA 4P0TA 1FTSA 4DLRA 1VG1A 3BC1A 3GLGA 3K8YA 2V6IA 2PH1A 2LKDA 1ZBDA 4FD2A 4CEHB 1W1WA 4A1FA 3CB4A 1KSGA 3I5YA 3IKJA 2EYUA 2IYYA 3VKHA 5DISB 4URUR 1MV5A 1JEDA 1MR3F 3LDAA 4B76A 1W4BA 3CONA 3ZIAA 1Z63A 2W6JA 4PSAA 4QNRA 4RVCA 2GVDC 3MAAC 3PITA 1IONA 3GP8A 1AJEA 3L0IB 4LC0A 3BAFA 2J5XA 2ZRKA 3X1YA 3HJNA 2JLXA 2QBYA 2IF0A 4JL6A 4FMBB 3I5XA 3QVVA 4NYJR 4OKSA 2Q3MA 2HDNB 3MWLA 3B1WA 4L5BA 2W00A 2QTHA 1D9ZA 4DB2A 1G6HA 5DE3A 2BDTA 2GILA 4FCVA 2WSSA 4YMVA 5CJPA 5FPHA 2D06A 4MGYR 4EQ6A 1NSFA 4C0AC 3ZLJA 2XJ9A 4IVRA 1H65A 1P2SA 1SQ5A 4URYR 3NBYC 2A5YB 1TUIA 4G5GA 1LW7A 1E1RD 4Q9IA 5AJXA 1TQ4A 2VRWA 4Y0AA 1S1CA 2GXQA 4B3FX 3SJBA 3SBDA 5IK2D 1NVXQ 4YDSA 1N5KA 3TVTA 4BZQA 4Q4LA 2XSZA 4DC9A 2ZRJA 1E2FA 4ZCMA 1ZUHA 2GCPA 2IYTA 5IDVA 4LWZA 5CJ2A 4XOIA 2O0JA 3QQ5A 4JSYA 2AN9A 2HYIC 4E5UA 5IT5A 3AP2A 3U7EB 1P60A 3KJHA 3Q8XB 1R0WA 2VHCA 2D7DA 1SVOA 3IHLA 4KHZA 4MRSA 4URWR 3F0TA 2HUPA 3U5ZB 2ZVQX 2HV8A 4JS0A 4TL7A 3K0SA 4AY2A 2FGKA 2ZREA 2IHBA 3UANA 1Z0KA 3VR3A 4DCSA 2NZ8A 3U4QB 5EP4A 1M7BA 4WW0A 3HU1A 4DLVA 4A2WA 1F2UA 1E3MA 1L2TA 1Z5ZA 2O8DA 2AWOA 4V0ME 2PEYA 5BN5A 4KLNA 3CR7A 3IQWA 4LYAA 1E9FA 4URXR 1BKDR 1NLYA 4QL3A 4FCTA 5DN6D 3EA5A 3AQ4A 4GZMA 2ZR0A 1SVWA 1Z0JA 3DM5A 4IOMA 1G291 1LF5A 1W4CA 1XEXB 4QGGA 5AUQA 1MABA 3GJ7A 3CZQA 2C99A 2OAP1 3EIQA 3IEVA 3QXJA 1Y63A 2GJSA 1TQ6A 2QI9C 2CCJA 2AK3A 3C5HA 5TARA 2EU8A 3BE4A 1GNPA 2NO0A 2BV3A 2FWRA 3CZPA 2YOGA 1RC8A 1XMSA 1XX6A 2IK8A 3MRSA 2GK7A 1Q12A 4BLRA 2C03A 2GEDA 1DOAA 4UXJA 3VR5A 3PEYA 3RABA 3BXZA 3PUZA 3LLMA 4EJSB 1G4AE 3OIUA 4ACBA 2IYUA 5FTMA 5JI3E 4TQUS 2RKOA 1UM8A 3QOFA 3UG6A 5AUPB 4CEHA 1Q1EA 3QSYA 2BM0A 1E2DA 5BW8A 3HPQA 1AZTA 3NEJA 5DHFA 2QAGA 4GNKA 3AP3A 2GNOA 3L0PA 4QHSA 2ZR9A 2IEYA 2J59A 4Q9KA 1E2MA 3CPEA 3MJHA 3TH5A 1D2MA 1T4GA 2JLUA 3PIRA 2OUKA 1CJMA 2REOA 4WIAA 4A6PA 1IQPA 4IDNA 5JHHB 3GEIA 3L8ZA 3Q7PA 1TAGA 5EXTA 2EFDB 4M1MA 4A92A 1KO4A 1OSNA 5FTLA 4W5HA 3THYB 1E2PA 1FOEB 2KSQA 4XTRA 5C1BA 2IYVA 3A58B 3KB1A 3ZVNA 1VYUA 1GUAA 1E9BA 4HUQB 4OQMA 4ZI2A 2PZFA 4MKHA 4B35A 1JR3D 1YZUA 3AUYA 2J9RA 1OKKA 2DCUA 3A4NA 1FP6A 1KKLA 2IXGA 3B1VA 5D3MA 3SR0A 3TGPA 1LVGA 1XD2A 3H84A 1H8ED 4TYYA 1P4SA 2GZAA 2IC5A 5BQ5A 4NE2A 4S35A 1COWD 5JEDA 1HEIA 2ZYVX 4DDUA 3P32A 1FL9A 1N5LA 2W0SA 3W90A 1MOZA 1XJQA 3FVQA 3FB4A 1DAIA 2ERYA 4A0FA 4PO8A 1ZIPA 4IDQA 3DL0A 3BB4A 5GJBA 2GAAA 5KDLA 4ZCLA 2JATA 4RCYA 2YWHA 5DIFA 2C77A 2XB2A 2ZE7A 5FPSA 3LO5A 5CIWA 1Z2CA 3SN6A 4AKGA 4D25A 3QNUA 1J99A 2WSMA 3U4QA 4NONA 3TQCA 3T06B 1AS3A 2WJGA 4I1VA 4I99A 1SHZA 2NGRA 4A8JB 4AKHA 3QKTA 3IPYA 5KSPA 2V54A 2RMKA 3F3YA 3GLFE 4C0KA 3PUWA 5H68A 3BJIC 2OBLA 2WIAA 3CF0A 2VO1A 3LW8A 1NG9A 3BOSA 2IYWA 4XVRA 1LFDB 2OFWA 2NO6A 1MO6A 2C9CA 2XNSA 2ZI3A 3EPJA 3QF7A 2PLFA 3GJXC 4IHQA 1FZQA 3WNCA 4I1UA 1RKBA 1LNZA 5GJCA 5L3RA 2DR3A 1KHTA 1GTVA 2VTKA 2BBSA 5SZHB 1IY2A 5FR1A 1P6XA 4DJTA 2R6AA 4CVNA 3TLXA 2V1UA 4ACAA 4B73A 2O8FA 2HF9A 1DEKA 2RHMA 4BFZA 4JIMA 2W2TA 3ZDQA 3EG5A 3ICEA 2TMKA 2ONJA 3QF4B 2OHFA 3D6TB 3H0KA 4GOXA 2JIZD 4EDHA 2FFQA 1E9DA 1D5CA 2X19A 3NTUA 1P3JA 3WYFA 1S9DA 4W5WA 5FUWA 2JLSA 1XXHE 3SBEA 4TN1A 4XSGA 1TNDA 1N0UA 3THXB 3BH6A 2B7CA 4LV8B 2WWXA 1N2CE 3A1TA 3MWJA 2O0HA 3BH0A 2PLRA 3W8RA 3D7MA 3TE6A 4DLSA 5FOUA 5J47A 5J40A 2O8BB 2Q9BA 4TQ9A 4US0R 1KI4A 1ZUNB 4ASUA 1PV4A 3VNUA 3QXSA 1JQJC 1KI1A 2YNMA 4B3GA 2R6DA 3LFUA 4CZ2A 2B7BA 1X6VA 3N2IA 3QPVA 4NCNA 2QEQA 4ZI3A 4MKGA 3KJEA 4Q21A 3VKWA 2F9MA 4IW3B 4N0EA 1OXSC 3QY0A 4K46A 1P9NA 2RGCA 2WJJA 4US1R 3QBVA 2MMGA 3SNHA 2FDCA 3ZZUA 2XZOA 4TT3D 1EX6A 3NH9A 4P4TA 2C78A 1T0JB 3OEEA 5BYJA 4B3BA 1RW4A 4DT1B 4TSFA 1XZQA 1JBKA 1VKJA 5FOVA 4JLMA 4Q9LA 1RIFA 2VPPA 4HUTA 3C5CA 2BCJQ 4ZV4A 4ESVA 5F9HA 2VL7A 4C7OB 3FKSA 2Z83A 1LS1A 2WSSD 4OJKA 3TK1A 3W3ZB 4AG6A 1P75A 2C5LA 4AYXA 1P2TA 4WZ6A 2QROA 4L9WA 4BQSA 3K0CC 5K8TA 1CF4A 3NIBA 1TU4A 4QM7A 1NSTA 2XB4A 2YC4C 2AX4A 2BEJA 2G9NA 1SULA 4RKEA 2WM9B 2IF2A 2KJQA 4OHWA 2XSZD 1OXVA 1OIXA 5DI3B 2NOAA 2G77B 4JYCA 4OI1A 1GDDA 3MSXA 1LV7A 1XPUA 3U3RA 4NKRA 2OESA 2PZGA 4Q19A 3DPUA 2XITA 1G8FA 2YYZA 5LDDC 5KO2A 3A1UA 5KYKA 2A5FA 1ZUIA 521PA 2LKCA 2WOOA 3B5JA 1AKYA 1W44A 1EWQA 2D2EA 1OLOA 3X1XA 4PO9A 1GAJA 5BYKA 4HSEA 2EW1A 2VSXA 2V3CC 2KI5A 1TEXA 1E4YA 5DGXA 3CH5A 4MYUA 1BIFA 4DDWA 1KYIA 2RB4A 1S96A 1Z47A 3X1DA 2AFHE 1GOTA 5JWRA 3P26A 1RRPA 4B2IA 4P4UA 4D2IA 3R7WB 1S3SA 3QUSA 4DVGA 3TUZC 1OB5A 2D62A 1MO5A 3THXA 2IXFA 3KKOA 1HV8A 3EC2A 1IBRA 3D8BA 2ZRFA 2CL7X 1K5GA 2F3RA 1US8A 3AVUA 3R9WA 1ESNA 2GF0A 3K0FA 4LPSA 4RD2A 2CJWA 2WHXA 4U02A 3SFVA 1R0YA 1CLUA 2ZYTX 3FKQA 3IUYA 3K53A 4HI0E 2O8BA 2VHQA 4UXHA 1IN6A 4ZIRA 3WP1B 1SVMA 4EAQA 1R8QA 2QRNA 5IK2A 2WJHA 2XTNA 1J8YF 1HA3A 4S2EA 4E09A 2P5TB 2AFIE 4M1WA 1QHNA 4Q4AB 4BWYA 3ZD7A 2ZRAA 1PLKA 3JZAA 3LBNA 1U90A 2R62A 2CLCX 4PXAA 2V55B 4KFRA 2R6GA 1WB9A 2DFNA 5KNDA 3DHWC 4QJ3A 1HY3A 1DAHA 3H2YA 1G7CA 1E6CA 4BFTA 5CDFE 5KTYA 2N46A 3TQFA 4MYHA 4OQFA 3BS4A 3ZS9A 3ADDA 1TQDA 5FFMA 3VX4A 1ZU4A 2HYDA 1S3GA 2CK3D 2ANBA 3GFPA 3TAHA 3WHLA 2G0TA 1X8LA 5EQTA 3PEWA 2ZIAA 3RRYA 2JJ2A 3ADKA 3N70A 4MYCA 1KNQA 4HZUB 2O5VA 1KO8A 3CBQA 4TMZA 1Q3HA 4P31A 1R2QA 3WMEA 4IDOA 3R8CA 1S0UA 3L0OA 5K8LA 1H8HD 4OL0A 1UBGA 2BHRA 4MRPA 4I81A 4K81B 4MUAA 1OKKD 1T8TA 3K9NA 4PTLA 3ZVRA 1P2UA 2UVQA 4NYJQ 4MGZR 1CJKC 3A36A 2IYSA 5G41A 2ZPTX 1NNEA 3SS8A 1OJLA 1DAGA 1GRQA 4ARZA 4EUNA 3VTKA 2X1VA 2D4HA 2F7SA 4V0NA 3M4YA 1XEWX 1ZM2A 2JJ1D 5CLQA 5J4YA 3T34A 3TVDA 4G0NA 3NDBB 1G7TA 2ZE8A 1MRNA 1XD9A 4ABYA 1QHXA 4GDFA 2QRZA 2NMVA 2GBLC 2DFLA 4H1UA 1NG1A 3W34A 1XB2A 4A0GA 2Q0HA 2GESA 4B47A 5HZKA 1XMVA 4IOKA 4HB3A 1F6BA 3VR2A 2FFHA 5GJWC 1M2OB 4DLTA 3EW9A 5CYOA 421PA 2QMEA 3V4RA 1WQ1R 4KJZA 2CNWD 2XZPA 1I4TD 3NHBA 1PLJA 1VMAA 1T3LA 2FNAA 2NZJA 3B9PA 2WV9A 4B3CA 1SXJE 1QHYA 3MLEA 3AF2A 5G3ZA 4JLVA 5EE5B 3R7WA 1F60A 3V9PA 1OXTA 3GLGB 4LHZA 4O2RA 1F48A 2CHQA 5HZHA 3K0CA 5CIQA 2JLYA 1KO5A 2QP3A 3HWSA 3MGCA 1ZW6A 4M0LA 5DLQC 3E2IA 5H8WA 1JR3A 1TF2A 2MSDB 1NVVR 2F1IA 2ODWA 2BM1A 4TZ6A 1GG2A 3B7GA 3AM1A 1AQUA 1NI3A 4LV5B 5G53C 4G01B 5C18A 2QBYB 2XJ4A 4NH0A 5JLJA 3W3AA 3FDIA 1S9HA 3BB3A 2P2LA 2C95A 2FN4A 2CVHA 2ZE5A 1FX0A 3VAAA 5P21A 3SJAA 1MO4A 1Z06A 1FQJA 4O3MA 1GRNA 3W5JA 2W58A 4GBMA 1R0ZA 4NYIR 1M8PA 1L7VC 2FZLA 1CR4A 1V5WA 2F1JA 3UMFA 1PJRA 1EXMA 4YMWA 2CXXA 2PMDA 4V0OA 2WKPA 1N6HA 2YJTD 2ZANA 4N1AA 3PXGA 2GDJA 3R9IA 2FEOA 3AVXA 1QRAA 3V4FA 2GVZC 4QM6A 2OXRA 2P6NA 4KFSA 2IUTA 3I4LA 1XCMA 5IHPA 2YVUA 4RY2A 3S1AA 4M1KA 3RNLA 1LY1A 2L0XA 2QPTA 2WVJA 4A4DA 3Q7QA 1AS2A 4RD4A 2Z4SA 5HE8A 721PA 1OV4A 3NBFA 3B85A 3FMFA 3GLHA 3QXHA 5KSYA 1FW6A 1KY2A 1DAEA 1E9AA 1F2UB 3GPLA 3C16C 1XWIA 4HDOB 5C2JB 1G19A 3I92A 4DSTA 2FPLA 2ZAMA 1E2QA 1IXZA 1OFHA 2ZJAA 4Q1CA 4XVUA 1ZMXA 4NYMR 3HR7A 2JIZA 3Q9LA 3TR5A 4HB2A 3W5IA 1ZINA 4Q7JB 1KO7A 4BASA 3GLIA 2IW3A 2PCJA 3F8TA 4GFDA 3B9QA 5FOSA 1M6NA 4BGDA 2EYQA 3TAUA 2ZS7A 4Y0VA 4G3XA 1UBFA 3QBTA 3EZ9A 4JLPA 3LQQA 1NMZA 5EE3A 5FUVA 1GWNA 1X1RA 5F98A 3VR6A 1ZM4A 3PEUA 3WHKA 1G8PA 2OZEA 4QXAA 2DPXA 1VPLA 3LY5A 3FMIA 4HDCA 2AK2A 3SFZA 4RZUA 4A2QA 2WWFA 2ZSFA 3EPLA 2VP9A 4Q4JB 3LVQE 4KU4A 1NY5A 1UDXA 1NLFA 4GP7A 2PX3A 3LA6A 1CXZA 1G5TA 2BMEA 4MRVA 2DHRA 3I62A 2W83A 1EX7A 4OHZA 1XEWY 4Q9HA 2XXAA 5HR5A 2CMKA 3JZMA 1I4LD 1QF9A 3L0SA 4M1YA 2QAGB 2J87A 3NH6A 4TT3A 5EP1A 2J0UB 1DO2A 3D3QA 3NVAA 3QXCA 1TUEA 3KB2A 1P61B 4G1UC 2E87A 2W0MA 3NC0C 4UNSA
chains in the Genus database with same CATH superfamily
3F46A 4X8HA 4JVNA 4L08A 2X3UA 4ZQBA 1Y3AA 3MTDA 5JNUA 3OJFA 3KOUA 4I4NA 4OFZA 6Q21A 2OK7A 2PSJA 3AGQA 1D2NA 2ATIA 3EFHA 3FH0A 1IRIA 2AA3A 4KBGA 4R9NA 4ARCA 1GM5A 2HREA 3HYTA 5H1YA 4QT4A 3AF0A 3PI6A 3WWCA 2GBLA 5FOTA 3ONDA 5DBGA 1J8QA 3KXPA 1WY7A 2A5GA 1RPZA 2I6QA 3AZPA 4NDZA 5AKKA 1KJYA 1U0GA 2B1JA 2ZR7A 3IIEA 4C7JA 2PX4A 1A3CA 4EPWA 1RCTE 3R3SA 1KYZA 3HDQA 1ZSVA 3EGXA 3AQIA 2O2GA 2XYGA 4CIYA 3A27A 1Z0IA 3TGLA 1SBNE 3TB6A 2WQZA 4YJGA 1Y48E 1KQOA 2GWHA 4C7MA 3PQ8A 5HQTA 3N2EA 1M7HA 3LHKA 1GYQA 1BHO1 7YASA 4O4LB 1YRLA 2ZSAA 4LBZA 1EFTA 1MAHA 1SCBA 2OCKA 5EWJA 4FGWA 5DHRA 1L7PA 4C0LA 3W2GA 2XW6A 2ZKLA 5HKAA 1R5NA 3B13B 4BNTA 4HFJA 1KDVA 4BE4A 1GRCA 3B9BA 1AVTA 2BD0A 4INAA 3P9QA 2NVUB 1XWWA 2UUBB 4RHYA 3NTRA 4LMRA 4PSDA 4EW6A 5KU7A 2IEBA 1XK7A 2QJOA 4ON9A 3ZK8A 5JDCA 1O0BA 1CFJA 2FPSA 1HG0A 3LKVA 2YV1A 4KR2A 5K3BA 2PJZA 1PWHA 5FUXA 5BSGA 4TWJA 2ZTHA 5CT5A 3SQOA 3OQMA 1IU9A 3IV7A 2XNCA 4X71A 4DDVA 3CHYA 2VHWA 4G9GA 4WINA 3I6YA 5J23A 4HNRA 1P1CA 3MS2A 4H7EA 5EZ6B 3JVEA 4RD1A 3SZGA 3U60B 4FD3A 1Z6XA 4OGKA 1G41A 4IZIA 4OYHA 2AJDA 2HQSA 4F4IA 1DXYA 1RJEA 4U5XA 1WXGA 4ZAZA 4RZ2A 3BCSA 3HK2A 2YH2A 3U49A 4Z3DA 4MUXA 4FWTA 3STYA 5CNKA 1CJCA 5T8KC 3D1LA 2HRRA 1O6ZA 3W2IA 1SCUA 4F6CA 4G4SO 1IZ7A 1U2RA 3O47A 3FGPA 1ECFA 4ND1A 5E4JA 4WK2B 4KO8A 3NHWA 3JD3A 4ZWNA 2X4DA 4EGFA 4V02A 4Z8YA 5JH7A 4LF9B 3D2BA 4I9UA 4XQCA 3KR2A 1JQDA 4HAUA 4EGAA 1JZSA 2EFCB 2O8FB 4UAJA 2YZKA 3WK9A 1DDOA 4V0MA 3PDWA 3ESCA 4AJ9A 2OLJA 3C6QA 1ULZA 5A3QA 4IDCA 2H9AA 1E4EB 1MHPA 2CFTA 4JJ6A 4BY9E 3F5FA 4RLHA 4DIBA 4Q4JA 1FPMA 2L69A 3KXLA 3RTCA 4I36A 1NJ6A 4UHKA 3VDMA 2CLMB 3IQIX 5FL3A 1DWUA 3WB1A 3H9QA 7REQA 5JD5A 5THKA 5E7IA 4RQAA 1VJ1A 3VZCA 4HH1A 2DUNA 2YDYA 3IIMA 3IQZA 1UWKA 4KBFA 3GWZA 1XKQA 3IQHX 4XH9B 1GT6A 5SY4A 1FSFA 3NWEA 2HZBA 1PZMA 1JDJA 4FXPA 4W6QA 3BL5A 3BBLA 2BY4A 3EFEA 5K20A 4UHJA 1TOAA 3GXBA 3G13A 3MUEA 3PQ2A 1LF0A 3T3HA 2XYPA 5F3WB 3LC2O 3CLHA 4L9AA 5LBUA 1ABEA 2Q4DA 1VE1A 1G5IA 1Q1BA 3RU3A 1VP3A 4NCHA 1JXMA 4G0MA 4EF6A 4NV0A 4EB6B 1ADCA 1ISRA 5INTA 4NBSA 1N6KA 3LXXA 1TPZA 5K3SA 3TBHA 4X7PA 2MTBA 1RABA 1VLJA 5CEJA 3JVUA 3U3JA 2CDRA 1MC4A 4JJ4A 3VDNB 1OFUX 4HDQB 3C5WP 4E2YA 3OFJA 3OIYA 4HO1X 4DCMA 4IINA 4QSMA 3U7GA 1E3IA 5L7YA 4LVOA 3EC1A 2LRHA 2QL6A 1TVMA 1V11A 1CWUA 1XZNA 4M8LA 5EHNA 3JYNA 1A8IA 2G1UA 4H7IA 2VKTA 4PANA 1R9GA 2YRWA 1IVYA 1QQTA 2XH8A 5TVGA 4Z51A 2IL1A 2G40A 2ZXFA 1N5JA 2VI5A 4F4UA 4H3KB 2YIJA 2YDXA 3NHAA 3N8NA 2NG1A 2OK8A 2X8AA 1B93A 3QM1A 2HQRA 1PGNA 2X8WA 1SKYB 4O25A 4ZJYA 2GB4A 3P0FA 3S28A 1PJQA 4M89A 4WNCA 2IT1A 2RK3A 2YINC 1SCQA 5DHSA 4C4XA 5JZMA 3QLUA 2WU4A 1DGQA 1ZK4A 1EIWA 3BMOB 2R00A 4MR7B 4OSOA 5FJIA 1QRUA 3QGMA 3QE9Y 2P3OA 5JNWA 5F51A 2RIPA 4BHTA 1IOZA 2JD1A 4HC4A 3A9WA 4KV7A 4BLVA 2CFCA 4EK9A 4UXIA 5H0IA 4W82A 3W2HA 2CWDA 5IXSA 3RC1A 1UC4B 4DEVA 3F71A 1W1UA 2MJLA 1I6LA 4E7OA 1WMAA 2O8NA 2IHJA 3G0OA 3GGOA 2DFDA 3IV9A 3MGGA 1WCWA 1TM7E 2J45A 2P9CA 5CPBA 4ZVLA 4MR8A 1N5MA 5F78A 1ZN7A 3PL5A 4D74A 5L3QB 1VZ3A 1AKTA 4KAAA 4PQYA 4J1QA 2XADA 4QSHA 3DNFA 4E08A 4ER3A 1W5BA 2P90A 5H9WA 2ORED 3STVA 3C6BA 1L9KA 1YS6A 2QDKA 4HX2A 3RAJA 1U02A 4OV6B 3OUUA 1C3EA 3NT4A 4JKOA 4GZ6A 1W48A 4Q1AA 3UEOA 5B2EA 2B36A 5BQXA 4NXNB 3D5TA 1J8FA 3MWYW 1BWSA 2HRBA 2BSXA 4A16A 1K5HA 4BFSA 2MYNA 1QVWA 2CLDX 1P1HA 1I7PA 2JLCA 3H5OA 5C4GB 3HA3A 4B80A 4EA7A 3CF2A 3ZQUA 4AL4A 5CFQA 1F3LA 1WLYA 3KQUA 2DECA 3S5UA 1E62A 4N5MA 2AC4A 2BVNA 3FGZA 1IAQA 1CZRA 5L3QA 3G9QA 3HXPA 4YT8A 3WAJA 3VJMA 1FJ2A 2A9PA 2NAFA 1BMQA 4NTZA 4REQB 5JD3A 4FP9A 1GNSA 1M74A 3WBJA 4DDHA 4CQLB 3ZPXA 1I7NA 2IVFA 1EBBA 5L40A 2JGRA 2H2HA 4U2GA 4BQEA 1UKYA 5AVTA 1LRLA 1OWMA 3KCQA 1O5OA 3EMKA 4FWIB 4O5AA 2HMTA 1I13A 2FZVA 3EHDA 4FGKA 1CZOA 2H63A 2KB0A 2PUBA 4TYWA 3Q10A 4BN0A 3IVAA 4W5JA 2EJCA 4QU9A 3Q6MA 2PYIA 3QUQA 3VR1A 4DV5B 1VRCA 1C0PA 1WNFA 2YVAA 3BK1A 3MJDA 1GNQA 3H1EA 3KFLA 4O0MA 2ASEA 2BBTA 2GERA 5BQ3A 5AW2A 3K0AB 3MELA 4I55B 3BK2A 1B8OA 2AZTA 4F3KA 1CZNA 2CHEA 1CEQA 3CW2A 3M81A 4C0WA 3CSDA 1BDJA 5SZIA 3QVUA 3HZOA 1JEEA 4IKOA 4PSCA 4R9UC 3VX3A 2XV1A 4ROSA 3AR5A 2GN8A 2X8LA 1UFVA 2WOJA 1K5DA 4HS9A 4Z9XA 1O6CA 2ZRNA 1YWGO 4W8HA 3RS7A 4Z7NB 2FPRA 1XYYA 4GVPA 3SDZA 1SMKA 1B0ZA 4U7FA 3P2JA 1R8SA 2FEXA 3ONWA 1VPEA 2JW5A 3E9ZA 4G1VA 3REGA 1GFZA 1HUQA 2GJ9A 2JEYA 4Z1OA 4BNVA 2G9RA 3KZVA 5C37A 4L50A 4JYBA 1CUZA 3PBKA 4FPXA 4W8OA 5DOZA 1GFWA 2L82A 2DHCA 2GEBA 3NUQA 1ODLA 2F64A 3EVCA 3DPSA 5KJ1A 5B3AA 1A77A 4MROA 3PDJA 2XVZA 1SVLA 3GCDA 2IPXA 1ZA2A 1B7GO 5BN1A 4XJVA 4DTCA 1KAGA 4IXNA 2QNBA 2VQSA 2ZJ5A 5I9LA 2HSGA 1WSBA 5KNCA 1HL7A 3C1OA 1WPRA 3SHWA 1N77A 1CRWG 1NW7A 3SHOA 3UAVA 5JECA 1Q57A 4MPDA 4Y1FA 1TE2A 5KTOA 5KC9A 4RTJA 1T91A 4J2HA 3AWDA 1FNMA 4PYMA 5DX1A 3WK6A 1G3QA 1WMBA 3L4KA 1QK4A 2IHUA 2NPIA 1L5KA 2B1GA 3CNHA 1KZ9A 3FI0A 2V7QD 5EC8A 2ZSHA 3MD0A 3I6BA 2FRDC 3DUFA 1NJ2A 1PJ4A 1TT5A 1J5XA 1WQ3A 3IALA 5E7MA 4C5CA 1P19A 2VRCD 2PBRA 1E69A 1DB3A 1EUQA 4Z7JA 1E8MA 1A97A 2BKEA 1U3TA 5BQOA 4A3SA 4TKZA 2B30A 3H04A 1AQNA 1R50A 5AJTA 3K96A 4NPAA 4NYIQ 4AUMA 2IVZA 3TEJA 2WPDD 1TTPB 3GQBA 3KLBA 3RIYA 3WX0A 2FMIA 1MX1A 4Z9AA 3TL6A 3K9FC 1Y6RA 3CPHA 2VT2A 1DG3A 2EHJA 3OZ7A 2Z1MA 1HYHA 2NSYA 4PQFA 5FAKA 4MW4A 1YIDA 3ABOB 3HFRA 4BFCA 4UD2A 3IOCA 5ERYA 4NMWA 3CQ9A 4DV2B 1UANA 2FFBA 2J0QA 1JMKC 3VNBA 1C3XA 4D8UA 1R0SA 1IM2A 2JFYA 2JFPA 4NWIA 3WLEA 1ETHA 1XMIA 2BGRA 3BSYA 4RSRA 5AI9A 4D0SA 1EP1B 1TZCA 3WP0A 2QMOA 4HQLA 5MFZA 4G5YA 1K08A 1FF9A 3D2LA 3R77A 4H16A 5D3ZA 2XBLA 3DEIA 5EWMA 5J58A 2BJVA 2ZIEA 4ZV7A 4PN3A 3JQ7A 3N0VA 4HLCA 2V7PA 1NDUA 5TY0A 1GQ2A 1NL3A 3GY0A 3NM4A 5LWQA 2BEWB 1JHPA 1BMFD 1L4UA 2EQ5A 1V5FA 3VFDA 3RF6A 1P2VA 3GAZA 4BN5A 1P2BA 5HRCA 1OWPA 3OM8A 1T5LA 1YDHA 2JFXA 2NAPA 3KTAA 1K66A 1R0BA 3HRKA 1UINA 4NYMQ 4N7BA 3TLKA 1U9CA 1OMOA 5BSRA 1UM9A 4DLXA 4J3NA 1QCCA 4IG9A 3DULA 1UEJA 4MJLA 4MVJH 3RTDA 2IYEA 1YQEA 3C41J 3RADC 2XUIA 5F1YA 3QEJA 3OQOA 3ZY6A 4INPA 1PKEA 3BFXA 1KZ1A 1XQVA 1P7PA 4D4KA 1XBTA 4BYMA 4CKZA 3VKGA 4ENRA 2CMDA 4QLBA 5AKZA 3V8EA 3BZUA 2WJZB 3ZJYA 1UXGA 1AB5A 2QT1A 5DT9A 3RVNA 3FW1A 1KMHA 1P9WA 3QRWA 2V6FA 4UU1A 3UB3A 1NASA 1ZM7A 4A6XA 1E1YA 1BQEA 2J30A 1HETA 3EXHB 3JYHA 3LLUA 3U4IA 3P94A 2JI6A 3KTDA 4IGEA 2JC3A 4KLZA 1TXGA 4OHFA 2O7RA 2Z8XA 2V7XA 2ALJA 2P9HA 2PV7A 4EIWA 2Z2ZA 3P0JA 5EEHA 4BFUA 4LVNA 2WD7A 3VOAA 6REQA 4C4TA 4FCWA 4QQKA 1WE2A 2P0YA 1XI2A 1DBPA 4Q9DA 2HFKA 1RE1A 4DR6B 3HKDA 4RVDA 4P92A 4MPTA 4CRWB 2QVCA 3J81k 2A88A 4BVHA 4C2TA 2HKIA 3SZOA 1Q0SA 1VCOA 3LO8A 2CFOA 1S7CA 5DWVA 2DE0X 3AFHA 1EFAA 2SKEA 2V3VA 3WYDA 1KWKA 2HF2A 4JLBA 4AZ3B 1NNUA 3D3WB 4BFXA 1LTHR 3S2YA 1EUYA 4CT4B 4K0KB 1HE8B 3VZBA 1G98A 1ULSA 2VNIA 3F47A 4MWOA 2JFGA 1MJFA 3EGOA 5K2OA 4Y2SA 3RSFA 3DLCA 2CHGA 5H4GA 2FWIA 1KVRA 1R37A 1MQAA 4RU1A 3LT0A 1Y8QB 1S5PA 3A9RA 2AJ8A 2XYRA 4P32A 1XTIA 4WNIA 2FSVA 4UTVA 2PKCA 1UBNA 2RHCA 3Q7TA 2F6RA 3GLHB 3OZGA 3V5NA 4XZ3A 1UP4A 4LDRA 1O89A 4F91B 1WSDA 2P2ZA 3EN0A 4NJMA 3E5NA 1ISPA 4NG5A 2E85A 4PHHA 4DCVA 3TQHA 1H05A 1CJVC 2RGUA 4D9JA 3DAPA 2VNHA 5KYGA 1EXNA 1BEEA 1OI3A 2KE5A 3ETLA 4PLZA 1F3OA 4HNUA 3FPHA 1K27A 3NYWA 4CU5A 2ZETA 5L6MB 1G4HA 1NJGA 3IKMB 5F2OA 5HBGA 2QRQA 3RLIA 1HDIA 4HBZA 2XTMA 4EY6A 1WU8A 4UKDA 2BMDA 1QPBA 3LC7O 4R2LA 4CKEA 3RVQA 2ET6A 4ER0A 5HF6A 2ATEA 5F33A 4RX1A 3ODGA 3B82A 5DNVA 5FRDA 3LAWA 4F21A 1D9XA 1JLSA 4R1MA 1WHTB 1TIBA 4HRXA 2VEOA 4EI7A 2XLCA 3BQ9A 5G4KA 4YCLA 2K4MA 4FZ5A 4Q7KA 5I01A 1A88A 2BGGA 1RKXA 3ZWVA 1RYNA 1QH8A 1WABA 1Z13A 1WCYA 3H83A 3O1JC 5TV2A 3SF0A 2HCFA 3UHJA 1PX0A 4PR0A 3LCVB 4NMMA 2O2ZA 4KC0A 3DB1A 2VT3A 3IELA 4B83A 2GZHA 1SKBA 5AQEA 4AJHA 2QGNA 3Q88A 1G42A 1M34B 4ZYZA 1BCRB 2Y1OA 4JLNA 1PQWA 2IIVA 2VXCA 3LHDA 3CF4A 3O9ZA 2BFEB 3UOWA 1QHSA 2CN1A 1FXWF 3EEBA 4HWOA 4OI0A 2DBZA 2R25B 3AEYA 2PUHA 1OLUA 3RVBA 1YU9A 4AF6A 4UOZA 4W7SA 2P6RA 4WCVA 3ILHA 1U6IA 4QPNA 4FKMA 1QYWA 4LF4B 3KZOA 1HTWA 4C04A 1T8WA 3BSWA 2CHUA 3VV2A 1ECLA 1I80A 1FBTA 3EXIA 1PT9A 4RH3A 3K5PA 1X1EA 4W5WA 1TJPB 3EODA 1CIJA 5BR8B 4QUBA 1X1AA 4HDSB 4I1OA 4Y2JA 2PCLA 3DGEC 1NW3A 5DLEA 3AEUB 1A9XB 3DZHA 2ZRBA 3GRAA 2VF2A 1F5SA 3L41A 2DWPA 5I7VA 4FNGA 2EWWA 3EVBA 4RO0A 1XPOA 4MVJG 3A6ZA 2AI3A 4XI9A 2I8CA 1TA0A 2ZJ8A 1VLMA 3FUWA 2VDRB 3DCNA 3DAYA 3F49S 4FBGA 4KVZA 4QO8A 1MC1A 1CQXA 2HNBA 1U5BA 5CLGA 1V3VA 3JYLA 2ZTVA 1IBCA 2WAOA 2WJVA 5K0BA 1G3RA 1V16A 1TF5A 1MW8X 4DLAA 5DEIA 5NLLA 4CN9A 1MQSA 4F1JA 2UXBB 4PPQA 3RCBA 3U4CA 1H4QA 4MX8A 4X84A 2C0PA 5KSZA 1E20A 4FYMA 4RY9A 1ZD3A 3DYIA 5CXSA 2QX7A 1ZIXA 2ZWMA 3KKKA 5F3RA 2G36A 3A28A 4YP7A 5AM3A 1XPRA 3NNDA 4HPXB 5FLEX 4NLLA 4KZPA 1RCFA 2X58A 4XCVA 3H05A 4P6VF 3V1UA 1AS0A 4P53A 5A7HA 4UUQA 2X41A 4Y1RB 1J4AA 4EELA 2VYND 5DNYB 4WPGA 5DHAA 4H7KA 1PSZA 1S2IA 3MS4A 3M3DA 1LCIA 3QKRB 3URMA 3HVJA 5IN4A 2JH9A 1RRVA 4II7A 5FWYB 5JV5A 4RHEA 1UT5A 4OJQA 3VYUB 3G0DA 2BEKA 3DOCA 2DX7A 5TQ2B 5KNDH 4DIUA 1KE2A 1ZXLA 2ZUVA 4YNBA 3ZEIA 1WR8A 3DMHA 4AJOA 1AX9A 1CF2O 2FOLA 4R4JA 3KZXA 1MF7A 4CLDA 5BNIA 4FB4A 5BWLA 1R8YA 1YI8A 4QZVA 5CPFA 3D3NA 1SUIA 3N3BC 4CPDA 3PJRA 3RR2A 4HVLA 4CHTA 3T3PB 1RHUA 1FMLA 1L6IA 3JWJA 4CUZA 1OF1A 4Q1DA 3QLTA 3KIPA 5AKXA 2CJPA 3L06A 5K0SA 4I50A 1QH9A 3RLFA 1HZZA 4ZAWA 1Z4JA 3QVSA 2G9QA 2UZAA 3O8QB 3V48A 5F23A 4WDRA 1D09A 1LI7A 3F78A 4PAWA 1GQOA 2P75A 1WUJS 1C3VA 4D56A 2H17A 4KQHA 1KY5A 2GGSA 3OCJA 4BBPA 2WA1A 2ANCA 2WTUA 1KKMA 2COEA 1CYDA 3PPYA 1U3DA 1PFWA 1V96A 1UEXC 3R41A 4P81A 2PZMA 4LNAA 1JQ3A 2AOUB 1A82A 5FORA 2J5QA 1GZHB 4LOIA 3A4TA 1I2MA 1KEEA 3V32A 4AJ2A 2ZRCA 3SXPA 2P40A 4XASA 5LNK1 3CWZA 3G7NA 4TS9A 3SYKA 1P18A 4R7GA 4TRMA 4RZHA 3BA6A 3G68A 2VDOB 1NQWA 1DADA 3I05A 5A2GA 4D79A 4UVEA 5GM2A 4X6LA 5IFKA 3ZJTA 2IYNA 2FPUA 4ENPA 4DB4A 4QOEA 1CEYA 3DJYA 3QW4B 1WMSA 3SP1A 4PAMA 1OFIA 4CMBA 5K8UA 2Q5LA 3V80A 4TMWA 4EABA 1HGXA 3MUNA 5JXIA 1C7FA 1PP4A 4EX6A 2OZLB 2G1AA 4V0KA 2VZ0A 3MWEA 4ZO7A 4I8XA 2Z95A 5JXHA 1NV9A 4C5AA 3D4LA 4JU8A 1LBSA 3TKYA 3IAEA 5TMDA 5BSVA 2WFLB 4QECA 1EP9A 1AQIA 1DO0A 2OXCA 2R7AA 3C24A 3BD7A 3HE3A 3JWPA 2VJBA 5F64A 5G0TA 3HQ4O 4MRRA 4EO9A 4AKEA 3IDOA 1XZEA 1Z18A 2IU3A 1QCDA 3EPKA 1PZHA 4YLGA 2WF5A 4BXOA 3EWAA 1JPNA 1Z6QA 4GP9A 3HXTA 1HR0B 5JROA 1X42A 1NA5A 4DUGD 1FTNA 2V8BA 4P4LA 3Q8MA 3G3EA 2OYRA 3B1FA 4RSGA 2H9YA 2I3DA 2O0LA 4LXUA 4DIDA 3A14A 2NTYC 4MQ6A 4QU8A 4D9KA 3LCCA 4HH4A 1DX9A 2NT3A 4UDYX 1W0KD 3I5AA 1KEUA 1XAIA 2IYOA 2V7QA 1KPIA 2NNLD 3EY4A 2OSBA 1LTQA 3LT5A 4LXYA 1V9SA 3JSXA 4OTZA 5IHXA 3NMUF 2C1EA 2UDPA 4XX0A 1RKVA 1T4DA 2Q45A 4ZI7B 3ZKAA 2VRCA 4GWKA 4V24A 3RI3A 3K9LA 5IT4A 3P96A 1P7CA 1CPYA 1ONNA 2AKAB 4OUDB 4D4JA 4YRFA 4Q9AA 1OFUA 3CZRA 1SELA 3EQ9A 3HRHA 4NI5A 7ABPA 2G7ZA 1HT3A 5JARA 2UUOA 1ZD4A 1K8RA 4UBNA 1RWVA 2UV8A 4N4AA 4ARAA 5CG2A 1Y7IA 4P4SA 4G81A 2G06A 3UOAB 2R60A 1TEVA 4D26A 2ZB3A 1QWSA 3SC6A 1LPMA 1V26A 1JFVA 3FHTA 2IU6A 3V8MA 3UMRA 4F2PA 4JKIA 1KMMA 3S99A 2R1ZA 4B7CA 4RWZA 4OJNA 4P3NA 3VC1A 4E31A 2UYHA 2CLLB 3IPRA 2DKNA 3GFVA 4K6HA 4WLFA 3B6MA 4EMSA 4B09A 3E7PA 2B94A 3FRIA 2OGZA 3LOQA 2BDEA 1XMJA 1ZNWA 2OCAA 5C1DA 1T25A 4GECA 2HAEA 3UJNA 5CW1A 2DFTA 1THMA 1ZQ1A 2EFEB 3BFPA 3PKZA 1FS4A 4ZKEA 4U2BA 5JQGB 3D02A 2D0OB 4PRYA 3RYIA 2MSWA 1V4VA 1P44A 4NEQA 2P9JA 4LZLA 4RXMA 5B55A 3FHLA 2CVFA 3TQTA 2O2DA 2X2FA 2WTEA 2OYSA 1BRTA 3DDCA 3FPLA 4WD3A 4UM9B 4IEEA 4R68A 4X8MA 3BUSA 5CM8B 5LD2C 1OLSB 3H1GA 5IKOA 4OX9B 2HMYB 4TKUA 2HK6A 1ZS9A 1QYCA 4H9GA 1U7WA 4NAVA 5TMPA 3GLFB 1NPTO 3FDZA 1CERA 3MXOA 4YQFA 4AJPA 1P1RA 4CTKA 1NBEA 2X8BA 3QV1A 5HTOA 1AB6A 1WZEA 3WLIA 2ORWA 4PN7A 1N0WA 1WQ4A 2BZ0A 4NZMA 4RFSA 4BVKA 1N6PA 1Z7YA 3PR1A 4EKEA 2DFPA 4YRBA 1JB1A 2C29D 2W2MA 3OE7D 2LUOA 1AA6A 3L7KA 3R4CA 1MG0A 2WBLC 1NI4A 3HVHA 1S1MA 1RHKA 4DUPA 1V0JA 3FCCA 4HHEA 2YMMA 1K6JA 4AXBA 1N6NA 1X92A 2ZI9A 3KYDB 3PQDA 4LY6A 1GR1A 4LMAA 3MWFA 4Q1BA 3ZY5A 5C5CA 1T6XA 2PQMA 3FE2A 3FCSB 4NATA 3NV9A 3RT1A 4RLQA 4F5YA 3X1WA 3VHQA 5F2KA 4ZHSA 2VHTA 3CLTC 2CL0X 3Q11A 3TJZA 1CS4C 1M5RA 2DT5A 1EK1A 3UKOA 2VIIA 3SR4A 5EJ6A 1JLKA 3ZWMA 4A5OA 2RCNA 4TKLA 2G09A 2GDZA 1LC0A 2OCDA 4DCPA 1EFRD 1Y6QA 2OG2A 1FU8A 1OT5A 2OP1A 3AESB 4H4CA 3FM9A 3KC2A 2HQBA 2XB9A 3MN1A 5KSWB 2BFFB 4L4YA 5FPKA 4GW3A 3P9XA 4KACA 4MUNA 4RPKA 2Y99A 5JAHA 2P3SA 3BCHA 5LP6A 5K6RA 1OE0A 3L1KA 4HP8A 4OAOA 1LJUA 2BFDA 3EWIA 4M0CA 3LH5A 5L8VA 4LXIA 2CKMA 4LZNA 4J94A 4YT5A 5JYDA 2CUTA 4G84A 2DFKB 4BCCA 2DR0A 3PGJA 3A2KA 5FIUA 3SYNA 3GXOA 4JKYA 3ZJUA 3GVPA 5BQPA 2CNLA 2YJGA 4PCVA 2H1FA 5CB6A 1U9IA 1XDZA 1IXSB 3C3XA 3DF9A 3PF8A 2DWQA 3TNFA 5M04A 2CL6X 1JU4A 2Q5QA 2X40A 4JOBA 3PDIB 3TLGB 2JFVA 2FAXA 3X2EA 1IIRA 5BSMA 2H9IA 2VSOA 3EVZA 1OCEA 2R66A 4XDGA 1GFIA 5AW6A 2IY8A 2F43B 5K5EA 1FUKA 4KDEA 3ZI4A 1Z74A 4DCUA 1THZA 1WDMA 3PCRB 1QHEA 1UJBA 4FDTA 1DMRA 3L4SO 1NYTA 4OA5A 4BV3A 3KQNA 1J56A 1SBTA 4X94A 3BMCB 4LF7B 3QUCA 1KR5A 1UAGA 4IEIA 1E1MA 3PJGA 4NNOA 3R0ZA 2WIKA 5HG0A 4M49A 3EBPA 3THSA 2ODNA 1RWOA 4EYKA 3U19A 4P3YA 1YOVA 3HA7A 1MFZA 1QH1B 1NVEA 3MJRA 4E15A 1K7CA 3OTGA 2QRUA 4H60A 1GT91 1X87A 1YR1A 1RC0A 3D4PA 1A8PA 3LT1A 3PC4A 4YCBA 4GKJB 3LBYA 1L5WA 1C4WA 4BNDB 3TI7A 3ZCPA 2BFMA 1R66A 5AVOA 3GRCA 4A91A 5F77A 2ZSBA 4G41A 4GKKB 3OQJA 1D2GA 4GZLA 2Q1XA 1E79D 4E1VA 1GZ5A 2PMKA 5DI9A 3O8OA 5E4FA 3DLAA 5DCUA 1YZLA 1CR0A 1YR3A 1Z5WA 5HCIA 2ODQA 3YASA 4D0RA 2QTWB 1JKJA 2OMEA 4Z1MD 1O9HA 4ID3A 2XDAA 4MUGA 2NU7A 1IH8A 2LDBA 2ZUTA 4PYKA 3S2GA 4MVJE 2BHNA 4EY4A 4FI3C 4E2XA 4UUMA 5LQNA 1IFXA 1T6ZA 1TCCA 2VBFA 3D6NB 2EERA 2N1MA 4GBGA 5D7NA 3PEVA 4TMVA 4BFYA 4KTVE 2P9QA 4QVKA 1SIOA 1S7GA 4LZZA 4N5NA 4MI3A 2QLFA 1Y33E 4B4WA 1C9KA 1M5TA 1G38A 4UBJA 3PXXA 3AHFA 4LS3A 3JPWA 3HYRA 4GI7A 4NMLA 3ZWOA 4AN4A 4B17A 2WP8J 1LFAA 5JJCA 2WMOB 4R2WA 4CHGA 1O97D 5SYAA 5F5XA 3SX2A 1JH9A 2QPOA 4TYMA 1U0FA 4KQWA 2YVLA 3NG1A 5DHTA 1JG6A 4FFWA 4G67A 1WBDA 3CUEF 4P9NA 4AM8A 1KBQA 1TVCA 1Q3KA 4QNNA 2QMQA 3PCXA 4F3NA 2EL9A 3D31A 3L1JA 3QFSA 3SJ7A 3EMDA 1J7JA 3DGFC 2C7PA 4I1SA 5FBHA 1DINA 4NS1A 3AJ9A 1PSDA 1ZMTA 5KJFA 1T0BA 1A8QA 1GCIA 3GJ5A 4NL4H 1XROA 2BFWA 5J1TB 4CM4A 2FSVC 2ZJ4A 4DMUB 4EJSA 2PMFA 4URZR 5FWAA 5BMVA 5CCDA 1PEDA 1N36B 1PWZA 4BWVA 3F6EX 1N25A 2C9OA 2V7GA 3JYOA 3M9WA 4B48A 1TQ8A 2EQBA 4FMDB 1XZDA 2ENWA 4OHBA 4ZVQA 2QYHA 2BF7A 3BD6A 3H6KA 1YFJA 1BH2A 1EEXB 3HCWA 4PAQA 1J9EA 1PJ8A 2RAFA 4U9IS 4IP0A 2BBWA 1PWYE 2VYNA 1GRVA 4JVOA 2W2VA 1TA4A 1T8SA 4LYHA 5G0UA 3LLSA 3K9BA 2R11A 2YV3A 2NACA 1SHKA 1BVYF 1KYTA 3AVOA 1KA9H 3NOOA 3TVYA 1O4WA 5AUOB 3CX3A 3KBBA 3A1SA 2QP4A 4HGOA 3OLXA 4YLEA 1X8KA 3A1VA 2OV6A 3UB4A 4YACA 3MG9A 2ZU0C 1HYQA 1KDTA 2RSLA 5GZ1A 5D3QA 1CZLA 1FNDA 1HPLA 1NFFA 2FG7C 3CGGA 3QFCA 4WRRA 3KETA 1JA1A 2AEMA 2B21A 3JASA 5LB2A 4LBVA 3EIOA 3GH1A 4G97A 5JFGA 3B78A 1H2ZA 3F7NA 3EDQA 4EMBA 1JEQA 1C8BA 3KEGA 4F9GA 1E3EA 2XE7A 4UZEA 2QTZA 4LQLA 1EK5A 4ZU6X 2IELA 3Q0EA 3AB7A 5A9SB 4QU0A 1SM4A 1B41A 4U7TB 3LYUA 4FI3F 1Q0HA 2O6HA 4OHVA 4PAGA 5K0LA 5TT0A 5EJ2A 1EB8A 1XP8A 1NP7A 1ZNXA 2HIMA 2VH5R 1IOLA 3ACDA 2YRFA 3F98A 3SHQA 2IYZA 4F6RA 4PZAA 1EUCA 4IAOA 4ESHA 3L6RA 2HIHA 4NX2A 3NHJA 1TW3A 4E07A 1R6BX 1M76A 2LNDA 3KLOA 4G6ZA 5EPOA 1YAHA 3KQQA 1A4XA 3W1WA 5E38A 3BWMA 4LHVA 4Q34A 2YJ4A 1EVLA 1PDOA 2GZDA 3CRMA 3HY4A 1Z0ZA 4E21A 1LB1B 5LQJA 4O2BA 4KCGA 4DJEC 1I6MA 1LJLA 4R1TA 4BBJA 4ZMBA 1J09A 4Y9UA 1SN7A 4J0KA 5LB4A 3WGVA 4FFDA 3U4HA 1ZJJA 5IAKA 1T2VA 5DM60 3VPXA 4QXQA 4C4RA 3ZJ5A 3EZ2A 3TPFA 1PL0A 2NZWA 3E81A 3LT2A 4ENQA 3GPIA 2F9FA 2QRHA 1G3UA 3AHIA 3QE4A 2Q4RA 1JB9A 3A31A 3KSAC 3R76A 2EP7A 1PYOA 3H86A 3B20A 3U61B 1BX3A 3KXIA 3ZDCA 2ZJOA 3EFBA 4KFCA 5E6RA 3VPFA 2PLAA 5KYUB 4H7HA 4EHNA 3VYWA 1EP2B 2Z9BA 4UM7A 1LC3A 4WDQA 5E3HA 2CD7A 5JSKA 1M0EA 2J3KA 1Q2XA 1J24A 4NE7A 3I32A 2MINB 4JWTA 4MXDA 3TLEA 3A11A 4UHBA 3PE4A 1I3OA 2JGKA 3P4YA 1RRCA 1YS7A 1MPTA 1DELA 1C2TA 1OI7A 1TCVA 3NIDB 3R6TA 4KN8A 5AKEA 4ZVUA 1Z4KA 3N8IA 4OG2A 3K5IA 1ZO8A 5E9AA 3RHSA 4JVLA 1REQB 4J0DA 1KAQA 1T3ZA 3DC2A 4MGIR 3BE8A 4Z4CA 4M4SA 4PYJA 1K2VN 3N0WA 3PT9A 3KPJA 3TCXB 1EHYA 2HCBA 2WT4A 5EUQB 4Z0HO 5BVHB 3MHTA 1VJ0A 3OX2A 5B3JC 5EOVA 5FBWB 4DEXA 3AG5A 1QONA 4J0EA 4P93A 1QHHB 4RACA 4AC9A 3GDFA 1A76A 1SU8A 4G24A 3TR6A 1VPDA 3AETB 1OH7A 1P0CA 4H1TA 4HMOA 4E03A 5A3JA 3J81A 2ZI6A 2E7ZA 4PGMA 1T9HA 3SSAA 3OUTA 4PFKA 5ER9A 1R4MB 2FE1A 2R96A 4X8LA 3WL8A 4A73A 1N6LA 5EIOA 5AIBA 3I9KA 1GN8A 3FNRA 4JUDX 1XRSB 1BD3A 5E7JA 7GPBA 3EQ7A 4IQ0A 2Y2VA 3T0IA 4ECEA 1DJMA 3IJ5A 3DBRA 3Q41A 4MMYB 3DZDA 1V39A 2JFFA 3LY7A 4JBXA 4WOCA 3VU9B 5A1TA 2CKDA 5CFPA 2O1WA 1DQSA 4ADSG 5KWVA 1RADA 1ZD1A 2V5VA 4WLOA 1XGKA 1K7EB 1KBZA 4RM2A 5JSUA 3CLUD 4H17A 4V2UA 3LNCA 3OEHD 4ZRNA 3KD3A 2Z5FA 4X24A 1YGYA 3CKLA 1JR6A 3DVAB 4MCHA 4LSGA 3DBVO 1G63A 3ZU5A 1NP3A 2FV8A 1ZMBA 3FMPB 3FPBA 3PQCA 4PNPA 3VVBA 3UWMA 3VYVA 2WJ6A 5ALQA 5HIJA 4CF3A 2QA5A 4P3PA 3MA0A 1U8AA 4RNCA 4KFTA 3Q0IA 4LXQA 4MYRA 1UJMA 4A2PA 4LJRA 1CE8B 3JD2A 1BFDA 3GRVA 1OV6A 1Q3TA 4UAUA 4C89A 1GGFA 3DKIA 4ZD6A 1M1ZA 2OD2A 3F5MA 4ETMA 1ZR2A 1MX3A 4XIYA 3LRXA 2YWJA 4EJ2A 5CDFA 3FOZA 1RD4A 3JQFA 1P5FA 2PO5A 4HJRA 5K7SA 2Q6TA 1U8ZA 1A72A 2QMHA 4JZYA 2UUPA 4QBHA 1LPSA 4BMOB 3K4QA 4XFJA 1SXQA 3HMQA 1KZ4A 4FYXA 3ANMA 2WM2A 2QNIA 1EQUA 4NFYA 5ITZA 4KZKA 3DEFA 3LIIA 1NF8A 3SYTA 1OILA 3VBEA 1E98A 1GLGA 3QKUA 5A7GA 3WYEA 3LW7A 4OQZA 1T4CA 3AERB 4Q39A 1N7GA 4AY3A 4JBWA 4KXXA 2WAXA 1NBAA 2VOEA 5A5GA 2G72A 3FBWA 2QAJA 2DWOA 3D7KA 1EI9A 4IGFA 2I03A 3OE7A 1FS5A 3AM4A 3JQAB 2H8KA 1X39A 1HQCA 2MSKA 2GASA 4QXRA 3A4MA 4NOKA 5DK6A 4CMEA 5U4XA 1ESDA 1WU7A 3WKDA 1GL3A 3W5SA 5BR7A 2LPMA 1Y7LA 2CXHA 2QTBA 1UOPA 4UCQA 1GCUA 3BGDA 2V8OA 4RMIA 3BQMB 2Q0SA 4BLQA 3HVUA 1C30B 2OT3B 4W9NC 5EE0A 3P5SA 5DOVA 2HC9A 3OKAA 5DBIA 1ELOA 1S8FA 1RRGA 2JHAA 3A04A 4M7PA 3S8MA 1KC3A 4NBLA 1VYVA 2DULA 2VPWA 3IT0A 1J0BA 4I9GA 4MP3A 1KSHA 5F4ZA 4PLPA 3SU8A 4Z4GA 3VNVA 3LUFA 2K7ZA 2QU8A 3DFIA 5E6UB 1EFRA 1MH9A 1J25A 4KDFA 3KKNA 2P6PA 5D5HA 4N5IX 2XXJA 2GPTA 3H7IA 3GJYA 3HR8A 1IZ0A 4IO1A 4ZOEA 1XNHA 3HACA 3CRNA 1CUGA 1DZ3A 4IKEA 2QL9A 3FMGA