4HB3B

Crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hb3B00
1GC7A 1FB8A 5JLJB 1U5EA 2LKOA 5C5BA 2CRFA 2DKPA 4KVGB 2JP2A 1X11A 1BAKA 1V89A 3FEHA 1U5DA 3DXEA 3N7CA 1V61A 3SNHA 5KCVA 1W1GA 2LG1A 4IAPA 2R09A 5DHFB 1X05A 4L6EA 1E5WA 1H4RA 2RGNB 4EKUA 3AJ4A 3T06A 5JHGA 4HAXB 5EFXA 2YT1A 2Z0OA 5KQ4A 3PG7A 2MDXA 1ISNA 2UZRA 2OQBA 2COFA 1WG7A 5D3XA 1QQGA 4F7GA 4PQ0A 4A5KA 2RNRB 4K2OA 4DXAB 2W2XD 2MWNB 4HAUB 1K5DB 3TCAA 5HE1A 4HAWB 2X18A 2E2XA 1J0WA 2DN6A 2D9ZA 2FJLA 2VSZA 2GCLA 3ULBA 1GC6A 2LULA 2DX1A 1BTNA 1P6SA 3HQCA 2VKIA 3OANA 4MY6A 1RJ2A 2Q13A 3SYXA 5C79A 5DI9B 4MK0A 2YS1A 1FOEA 1LB1A 1MK9B 2N0YA 1FAOA 3AU5A 2YRYA 1P5TA 2HTHB 3ML4A 5J3YA 2MFQA 2EMSA 2UZSA 3PSCA 3ZVRA 4H8SA 4XWXA 2DYNA 5LONB 2YS5A 2Y8FA 1I2HA 4KAXB 4HAVB 4DBBA 2V76A 1PFJA 2LYDA 1SHCA 1UNQA 2DA0A 2ADZA 2GS0A 3DXCA 1WJ1A 3LJUX 2KGXB 3KSYA 1MKEA 3WA0A 4C0AA 3A8PA 1UNRA 1SGHA 1DDWA 4HDQA 4HB3B 2W2XC 2RUKB 4DX8A 4CYEA 1BWNA 5C6RA 1U5FA 2RSGA 4BBKA 2KCJA 1WVHA 5DHAB 2DHJA 1DYNA 2UVMA 2L1CA 2XQNM 1MK7B 3D8DA 2Y7BA 4CHJA 1UEFA 2K00A 4IFSA 4GMVA 5HE0A 1ZC3B 2D2QA 2RVBB 3KY9A 3GYOA 3HK0A 3PEGA 2CY5A 5CLLB 3ZDTA 2NZ8B 4HDOA 4K17A 1BTKA 4MT7A 2P0FA 2DX5A 2YVCA 3P7ZA 2MKRA 2ROVA 4D0NB 5C5BB 4GPTB 3NSUA 1QC6A 1WI1A 2ELBA 3UZTA 3A8QA 3TW1A 4GMXB 2D9YA 1NI2A 1OY2A 1XKEA 2QKLA 5D3VA 5D27A 2I1KA 4WSFA 1FHXA 2W2WA 5DIFB 2YSZA 3FM8C 4K81A 2PZ1A 4IOYX 3X23A 3KRWA 5C16A 1Y5OA 2CODA 5JP4A 4Z2MB 1NTYA 4A6FA 3CXBB 3TFMA 3FSSA 1TXDA 1KZ7A 1AWEA 1M7EA 2NMBA 4A6KA 2KUPA 1U29A 1U27A 1UPQA 2QKMA 3HW2B 2L2IA 1XD4A 3QIJA 4GXBA 4GZUA 1W1HA 3F5RA 4TYZA 1W1DA 4HB4B 4EMOA 1ZVRA 1NU2A 3QWMA 2K2UA 2D11A 1OQNA 1DDVA 4GN1A 5DH9B 2D9VA 2M38A 2VRWB 5GOWB 2LOZA 1U2BA 1P3RA 1X86A 4WVFB 4Z2NA 1EF1A 1FGZA 4YONA 1NTVA 4PNKA 1TJ6A 1MPHA 4A6FB 3VIAA 4CHMA 2Y8GA 1XODA 2J0KA 2RLOA 1TQZA 2Z0QA 2P0DA 2J59M 2AEHA 1RRPB 4HAZB 1M7RA 1Q67A 1UPRA 1WJMA 2COCA 3IVFA 3TVVA 1ZSQA 2GCJA 1V5UA 3ODOA 5J3TA 2G35A 1EVHA 3MDBC 1DROA 3PZDA 3D8FA 3BJIA 5L81A 4ZRIA 1V88A 1X1GA 2J0JA 2H7EA 2HE7A 5HE3A 2DHKA 1H10A 2YS3A 2D9WA 2GJYA 1EAZA 4DX90 2AL6A 1ZC4B 3SO6A 1J19A 5J3QA 2K2JA 1IRSA 4HHVA 4F7HA 2M14A 2I5FA 3M1IB 4KHOA 4HAYB 1K5GB 1XCGA 4KHAA 5FI0A 2EJ8A 4ZRKA 3SUZA 5CLQB 4B6HA 1PLSA 5D3WA 3U8ZA 1PMSA 4K2PA 1DDMA 2H7DA 2OTXA 1OMWA 1Z87A 2DLWA 4HATB 4NY0A 1FGYA 1MIZB 1XX0A 2DKQA 3D8EA 1N3HA 5KQ1A 3GYPA 2DTCA 1UNPA 1B55A 2I5CA 1MIXA 2CAYA 4EJNA 3ODXA 4A6HA 4NSWA 1ZM0A 2COAA 2D10A 1WGQA 2D4QA 3V5WA 2I1JA 3CIKA 5FI1A 3TO1A 1Y19B 4HB0B 3P6AA 2J0MA 4KHBB 1EGXA 3PVLA 3WYFB 3ODWA 3ULCA 3PVWA 1KI1B 3AU4A 2P8VA 1FHOA 3O96A 4F7UP 3SV1A 4YL8A 2R0DA 2BCJA 2N23A 2YF0A 5D3YA 4TKNA 2DHIA 2DFKA 1U5GA 3KRXA 3DXDA 3PP2A 2ROZB 1XR0B 3QBVB 3PVUA 2Z0PA 1I7AA 2IFSA 3RCPA 1LW3A 1WGUA 2CY4A 4HB2B 2IYBA 1DBHA 1KZGA 2EC1A 4ZRJA 3MPXA 3G9WA 1X1FA 4Y94A 2ZPYA 1AQCA 1V5MA 3U7DA 2EMTA 1FHWA 2ELAA 1MAIA 5JHHA 1GG3A 3VOQA 3BINA 2DYQA 2LOXA 2D9XA 3KZ1A 1V5PA 4WJ7A 2YT0A 2P0HA 3F0WA 5LOPB 3A98B 5HE2A 4P7IA
chains in the Genus database with same CATH superfamily
1GC7A 1FB8A 5JLJB 1U5EA 2LKOA 5C5BA 2CRFA 2DKPA 4KVGB 2JP2A 1X11A 4QJ4B 1BAKA 1V89A 3FEHA 1U5DA 3DXEA 3N7CA 1V61A 3SNHA 5KCVA 1W1GA 2LG1A 4IAPA 2R09A 5DHFB 1X05A 2KIEA 4L6EA 1E5WA 2KR0A 1H4RA 2RGNB 4EKUA 3AJ4A 3T06A 5JHGA 3FVCA 4HAXB 5EFXA 2YT1A 2K49A 2Z0OA 5KQ4A 3PG7A 2MDXA 2KUQA 1ISNA 3NWDA 2UZRA 2OQBA 2COFA 1WG7A 5D3XA 2R2YA 1QQGA 4F7GA 4PQ0A 4A5KA 2RNRB 4K2OA 4DXAB 2W2XD 2MWNB 4HAUB 1K5DB 3TCAA 5HE1A 4HAWB 2X18A 2E2XA 1J0WA 2DN6A 2D9ZA 2FJLA 2VSZA 2GCLA 4L1RA 3ULBA 1GC6A 2LULA 2DX1A 1BTNA 1P6SA 3HQCA 2VKIA 2Z13A 3OANA 4MY6A 1RJ2A 2Q13A 3SYXA 5C79A 5DI9B 4MK0A 2YS1A 1FOEA 1LB1A 1MK9B 2N0YA 1FAOA 3AU5A 2YRYA 1P5TA 2HTHB 3NW8A 2NBVA 3ML4A 5J3YA 2MFQA 2FJUB 2EMSA 2UZSA 4QJ3B 3PSCA 3ZVRA 4H8SA 4XWXA 2DYNA 5LONB 2YS5A 2Y8FA 1I2HA 4KAXB 4HAVB 4DBBA 2V76A 1PFJA 2LYDA 1SHCA 1UNQA 2DA0A 2ADZA 2GS0A 3DXCA 1WJ1A 3LJUX 2KGXB 3KSYA 1MKEA 3WA0A 4C0AA 3A8PA 1UNRA 1SGHA 1DDWA 4HDQA 4HB3B 2W2XC 2RUKB 4DX8A 3NWAA 4CYEA 1BWNA 5C6RA 1U5FA 2RSGA 4BBKA 2KCJA 1WVHA 5DHAB 2DHJA 4CSQA 1DYNA 2UVMA 2L1CA 2XQNM 1MK7B 5I2SA 3D8DA 2Y7BA 4CHJA 1UEFA 2Z14A 2K00A 3DCXA 4IFSA 5LG4B 4GMVA 5HE0A 1ZC3B 2D2QA 2RVBB 3KY9A 3GYOA 1ZYIA 3HK0A 3PEGA 2CY5A 1T77A 5CLLB 3ZDTA 2NZ8B 4HDOA 4K17A 4HSIA 1BTKA 4MT7A 2P0FA 2DX5A 2YVCA 3P7ZA 2MKRA 2ROVA 5I2MA 4D0NB 5C5BB 4GPTB 3NSUA 1QC6A 1WI1A 2ELBA 3UZTA 3A8QA 3TW1A 4GMXB 2D9YA 1NI2A 1OY2A 1XKEA 2QKLA 5D3VA 4D6WA 5D27A 2I1KA 4WSFA 1FHXA 2W2WA 5DIFB 2YSZA 3FM8C 4K81A 2PZ1A 4IOYX 3X23A 3KRWA 5C16A 1Y5OA 2CODA 5JP4A 4Z2MB 1NTYA 4GOUA 4A6FA 5M4YB 3CXBB 3TFMA 3FSSA 1TXDA 1KZ7A 1AWEA 1M7EA 2NMBA 4A6KA 2KUPA 1U29A 1U27A 3B77A 1UPQA 2QKMA 3HW2B 2L2IA 1XD4A 3QIJA 4GXBA 4GZUA 1W1HA 3F5RA 4TYZA 1W1DA 4HB4B 4EMOA 4DIXA 1ZVRA 1NU2A 4QXAB 3QWMA 2K2UA 2D11A 3HSAA 1OQNA 1DDVA 4OSNA 4GN1A 5DH9B 2D9VA 2M38A 2VRWB 5GOWB 2LOZA 1U2BA 1P3RA 1X86A 4WVFB 4Z2NA 1EF1A 1FGZA 4YONA 1NTVA 4PNKA 1TJ6A 1MPHA 4A6FB 3VIAA 4CHMA 2Y8GA 2RRFA 1XODA 2J0KA 2RLOA 1TQZA 2Z0QA 2P0DA 2J59M 2AEHA 1RRPB 4HAZB 1M7RA 1Q67A 1UPRA 1WJMA 2COCA 3IVFA 3TVVA 1ZSQA 2GCJA 1V5UA 3ODOA 5J3TA 2G35A 4GNKB 1EVHA 3MDBC 1DROA 3PZDA 3D8FA 3BJIA 5L81A 4ZRIA 1V88A 1X1GA 2J0JA 2H7EA 2HE7A 5HE3A 2DHKA 1H10A 2YS3A 2D9WA 2GJYA 1EAZA 4DX90 2AL6A 1ZC4B 3SO6A 1J19A 5J3QA 2K2JA 1IRSA 4HHVA 4F7HA 4QJ5B 2M14A 2I5FA 3M1IB 4KHOA 4HAYB 1K5GB 1XCGA 4KHAA 5FI0A 2YT2A 2EJ8A 4ZRKA 3SUZA 4KHBA 5CLQB 5IRSA 3HIEA 2ZKMX 4B6HA 1PLSA 5D3WA 3U8ZA 1PMSA 4K2PA 1DDMA 2H7DA 2Z59A 2OTXA 1OMWA 1Z87A 2DLWA 4HATB 4NY0A 1FGYA 1MIZB 1XX0A 2DKQA 4OT1A 3D8EA 1N3HA 5KQ1A 3GYPA 2K8EA 3U12A 2DTCA 1UNPA 2Z4DA 1B55A 2I5CA 1MIXA 2CAYA 4EJNA 3ODXA 4A6HA 4NSWA 1ZM0A 2COAA 2D10A 1WGQA 2D4QA 3V5WA 2I1JA 3CIKA 5FI1A 3A58A 3TO1A 1Y19B 4HB0B 3P6AA 2J0MA 4KHBB 1EGXA 3PVLA 3WYFB 3ODWA 3NWFA 3ULCA 3PVWA 1KI1B 3AU4A 2KIGA 2P8VA 1FHOA 1MI1A 3O96A 4F7UP 3SV1A 4YL8A 2R0DA 2BCJA 2N23A 2YF0A 5D3YA 4TKNA 2DHIA 2DFKA 1U5GA 3KRXA 3DXDA 3PP2A 2ROZB 1XR0B 3QBVB 3PVUA 2GUMA 2Z0PA 1I7AA 2IFSA 3RCPA 1LW3A 1WGUA 2CY4A 4HB2B 2IYBA 1DBHA 1KZGA 2EC1A 4ZRJA 3MPXA 3G9WA 1X1FA 4Y94A 2ZPYA 1AQCA 1V5MA 3U7DA 2EMTA 1FHWA 2ELAA 1MAIA 3OHMB 5JHHA 1GG3A 3VOQA 3BINA 2DYQA 2LOXA 2D9XA 3KZ1A 1V5PA 4WJ7A 2YT0A 2P0HA 3F0WA 5LOPB 3A98B 5HE2A 4P7IA
chains in the Genus database with same CATH topology
1GC7A 1FB8A 5JLJB 1U5EA 2LKOA 5C5BA 2CRFA 2DKPA 4KVGB 2JP2A 1X11A 1BAKA 1V89A 3FEHA 1U5DA 3DXEA 3N7CA 1V61A 3SNHA 5KCVA 1W1GA 2LG1A 4IAPA 2R09A 5DHFB 1X05A 4L6EA 1E5WA 1H4RA 2RGNB 4EKUA 3AJ4A 3T06A 5JHGA 4HAXB 5EFXA 2YT1A 2Z0OA 5KQ4A 3PG7A 2MDXA 1ISNA 2UZRA 2OQBA 2COFA 1WG7A 5D3XA 1QQGA 4F7GA 4PQ0A 4A5KA 2RNRB 4K2OA 4DXAB 2W2XD 2MWNB 4HAUB 1K5DB 3TCAA 5HE1A 4HAWB 2X18A 2E2XA 1J0WA 2DN6A 2D9ZA 2FJLA 2VSZA 2GCLA 3ULBA 1GC6A 2LULA 2DX1A 1BTNA 1P6SA 3HQCA 2VKIA 3OANA 4MY6A 1RJ2A 2Q13A 3SYXA 5C79A 5DI9B 4MK0A 2YS1A 1FOEA 1LB1A 1MK9B 2N0YA 1FAOA 3AU5A 2YRYA 1P5TA 2HTHB 3ML4A 5J3YA 2MFQA 2EMSA 2UZSA 3PSCA 3ZVRA 4H8SA 4XWXA 2DYNA 5LONB 2YS5A 2Y8FA 1I2HA 4KAXB 4HAVB 4DBBA 2V76A 1PFJA 2LYDA 1SHCA 1UNQA 2DA0A 2ADZA 2GS0A 3DXCA 1WJ1A 3LJUX 2KGXB 3KSYA 1MKEA 3WA0A 4C0AA 3A8PA 1UNRA 1SGHA 1DDWA 4HDQA 4HB3B 2W2XC 2RUKB 4DX8A 4CYEA 1BWNA 5C6RA 1U5FA 2RSGA 4BBKA 2KCJA 1WVHA 5DHAB 2DHJA 1DYNA 2UVMA 2L1CA 2XQNM 1MK7B 3D8DA 2Y7BA 4CHJA 1UEFA 2K00A 4IFSA 4GMVA 5HE0A 1ZC3B 2D2QA 2RVBB 3KY9A 3GYOA 3HK0A 3PEGA 2CY5A 5CLLB 3ZDTA 2NZ8B 4HDOA 4K17A 1BTKA 4MT7A 2P0FA 2DX5A 2YVCA 3P7ZA 2MKRA 2ROVA 4D0NB 5C5BB 4GPTB 3NSUA 1QC6A 1WI1A 2ELBA 3UZTA 3A8QA 3TW1A 4GMXB 2D9YA 1NI2A 1OY2A 1XKEA 2QKLA 5D3VA 5D27A 2I1KA 4WSFA 1FHXA 2W2WA 5DIFB 2YSZA 3FM8C 4K81A 2PZ1A 4IOYX 3X23A 3KRWA 5C16A 1Y5OA 2CODA 5JP4A 4Z2MB 1NTYA 4A6FA 3CXBB 3TFMA 3FSSA 1TXDA 1KZ7A 1AWEA 1M7EA 2NMBA 4A6KA 2KUPA 1U29A 1U27A 1UPQA 2QKMA 3HW2B 2L2IA 1XD4A 3QIJA 4GXBA 4GZUA 1W1HA 3F5RA 4TYZA 1W1DA 4HB4B 4EMOA 1ZVRA 1NU2A 3QWMA 2K2UA 2D11A 1OQNA 1DDVA 4GN1A 5DH9B 2D9VA 2M38A 2VRWB 5GOWB 2LOZA 1U2BA 1P3RA 1X86A 4WVFB 4Z2NA 1EF1A 1FGZA 4YONA 1NTVA 4PNKA 1TJ6A 1MPHA 4A6FB 3VIAA 4CHMA 2Y8GA 1XODA 2J0KA 2RLOA 1TQZA 2Z0QA 2P0DA 2J59M 2AEHA 1RRPB 4HAZB 1M7RA 1Q67A 1UPRA 1WJMA 2COCA 3IVFA 3TVVA 1ZSQA 2GCJA 1V5UA 3ODOA 5J3TA 2G35A 1EVHA 3MDBC 1DROA 3PZDA 3D8FA 3BJIA 5L81A 4ZRIA 1V88A 1X1GA 2J0JA 2H7EA 2HE7A 5HE3A 2DHKA 1H10A 2YS3A 2D9WA 2GJYA 1EAZA 4DX90 2AL6A 1ZC4B 3SO6A 1J19A 5J3QA 2K2JA 1IRSA 4HHVA 4F7HA 2M14A 2I5FA 3M1IB 4KHOA 4HAYB 1K5GB 1XCGA 4KHAA 5FI0A 2EJ8A 4ZRKA 3SUZA 5CLQB 4B6HA 1PLSA 5D3WA 3U8ZA 1PMSA 4K2PA 1DDMA 2H7DA 2OTXA 1OMWA 1Z87A 2DLWA 4HATB 4NY0A 1FGYA 1MIZB 1XX0A 2DKQA 3D8EA 1N3HA 5KQ1A 3GYPA 2DTCA 1UNPA 1B55A 2I5CA 1MIXA 2CAYA 4EJNA 3ODXA 4A6HA 4NSWA 1ZM0A 2COAA 2D10A 1WGQA 2D4QA 3V5WA 2I1JA 3CIKA 5FI1A 3TO1A 1Y19B 4HB0B 3P6AA 2J0MA 4KHBB 1EGXA 3PVLA 3WYFB 3ODWA 3ULCA 3PVWA 1KI1B 3AU4A 2P8VA 1FHOA 3O96A 4F7UP 3SV1A 4YL8A 2R0DA 2BCJA 2N23A 2YF0A 5D3YA 4TKNA 2DHIA 2DFKA 1U5GA 3KRXA 3DXDA 3PP2A 2ROZB 1XR0B 3QBVB 3PVUA 2Z0PA 1I7AA 2IFSA 3RCPA 1LW3A 1WGUA 2CY4A 4HB2B 2IYBA 1DBHA 1KZGA 2EC1A 4ZRJA 3MPXA 3G9WA 1X1FA 4Y94A 2ZPYA 1AQCA 1V5MA 3U7DA 2EMTA 1FHWA 2ELAA 1MAIA 5JHHA 1GG3A 3VOQA 3BINA 2DYQA 2LOXA 2D9XA 3KZ1A 1V5PA 4WJ7A 2YT0A 2P0HA 3F0WA 5LOPB 3A98B 5HE2A 4P7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  1FB8 A;  5JLJ B;  1U5E A;  2LKO A;  5C5B A;  2CRF A;  2DKP A;  4KVG B;  2JP2 A;  1X11 A;  1BAK A;  1V89 A;  3FEH A;  1U5D A;  3DXE A;  3N7C A;  1V61 A;  3SNH A;  5KCV A;  1W1G A;  2LG1 A;  4IAP A;  2R09 A;  5DHF B;  1X05 A;  4L6E A;  1E5W A;  1H4R A;  2RGN B;  4EKU A;  3AJ4 A;  3T06 A;  5JHG A;  4HAX B;  5EFX A;  2YT1 A;  2Z0O A;  5KQ4 A;  3PG7 A;  2MDX A;  1ISN A;  2UZR A;  2OQB A;  2COF A;  1WG7 A;  5D3X A;  1QQG A;  4F7G A;  4PQ0 A;  4A5K A;  2RNR B;  4K2O A;  4DXA B;  2W2X D;  2MWN B;  4HAU B;  1K5D B;  3TCA A;  5HE1 A;  4HAW B;  2X18 A;  2E2X A;  1J0W A;  2DN6 A;  2D9Z A;  2FJL A;  2VSZ A;  2GCL A;  3ULB A;  1GC6 A;  2LUL A;  2DX1 A;  1BTN A;  1P6S A;  3HQC A;  2VKI A;  3OAN A;  4MY6 A;  1RJ2 A;  2Q13 A;  3SYX A;  5C79 A;  5DI9 B;  4MK0 A;  2YS1 A;  1FOE A;  1LB1 A;  1MK9 B;  2N0Y A;  1FAO A;  3AU5 A;  2YRY A;  1P5T A;  2HTH B;  3ML4 A;  5J3Y A;  2MFQ A;  2EMS A;  2UZS A;  3PSC A;  3ZVR A;  4H8S A;  4XWX A;  2DYN A;  5LON B;  2YS5 A;  2Y8F A;  1I2H A;  4KAX B;  4HAV B;  4DBB A;  2V76 A;  1PFJ A;  2LYD A;  1SHC A;  1UNQ A;  2DA0 A;  2ADZ A;  2GS0 A;  3DXC A;  1WJ1 A;  3LJU X;  2KGX B;  3KSY A;  1MKE A;  3WA0 A;  4C0A A;  3A8P A;  1UNR A;  1SGH A;  1DDW A;  4HDQ A;  4HB3 B;  2W2X C;  2RUK B;  4DX8 A;  4CYE A;  1BWN A;  5C6R A;  1U5F A;  2RSG A;  4BBK A;  2KCJ A;  1WVH A;  5DHA B;  2DHJ A;  1DYN A;  2UVM A;  2L1C A;  2XQN M;  1MK7 B;  3D8D A;  2Y7B A;  4CHJ A;  1UEF A;  2K00 A;  4IFS A;  4GMV A;  5HE0 A;  1ZC3 B;  2D2Q A;  2RVB B;  3KY9 A;  3GYO A;  3HK0 A;  3PEG A;  2CY5 A;  5CLL B;  3ZDT A;  2NZ8 B;  4HDO A;  4K17 A;  1BTK A;  4MT7 A;  2P0F A;  2DX5 A;  2YVC A;  3P7Z A;  2MKR A;  2ROV A;  4D0N B;  5C5B B;  4GPT B;  3NSU A;  1QC6 A;  1WI1 A;  2ELB A;  3UZT A;  3A8Q A;  3TW1 A;  4GMX B;  2D9Y A;  1NI2 A;  1OY2 A;  1XKE A;  2QKL A;  5D3V A;  5D27 A;  2I1K A;  4WSF A;  1FHX A;  2W2W A;  5DIF B;  2YSZ A;  3FM8 C;  4K81 A;  2PZ1 A;  4IOY X;  3X23 A;  3KRW A;  5C16 A;  1Y5O A;  2COD A;  5JP4 A;  4Z2M B;  1NTY A;  4A6F A;  3CXB B;  3TFM A;  3FSS A;  1TXD A;  1KZ7 A;  1AWE A;  1M7E A;  2NMB A;  4A6K A;  2KUP A;  1U29 A;  1U27 A;  1UPQ A;  2QKM A;  3HW2 B;  2L2I A;  1XD4 A;  3QIJ A;  4GXB A;  4GZU A;  1W1H A;  3F5R A;  4TYZ A;  1W1D A;  4HB4 B;  4EMO A;  1ZVR A;  1NU2 A;  3QWM A;  2K2U A;  2D11 A;  1OQN A;  1DDV A;  4GN1 A;  5DH9 B;  2D9V A;  2M38 A;  2VRW B;  5GOW B;  2LOZ A;  1U2B A;  1P3R A;  1X86 A;  4WVF B;  4Z2N A;  1EF1 A;  1FGZ A;  4YON A;  1NTV A;  4PNK A;  1TJ6 A;  1MPH A;  4A6F B;  3VIA A;  4CHM A;  2Y8G A;  1XOD A;  2J0K A;  2RLO A;  1TQZ A;  2Z0Q A;  2P0D A;  2J59 M;  2AEH A;  1RRP B;  4HAZ B;  1M7R A;  1Q67 A;  1UPR A;  1WJM A;  2COC A;  3IVF A;  3TVV A;  1ZSQ A;  2GCJ A;  1V5U A;  3ODO A;  5J3T A;  2G35 A;  1EVH A;  3MDB C;  1DRO A;  3PZD A;  3D8F A;  3BJI A;  5L81 A;  4ZRI A;  1V88 A;  1X1G A;  2J0J A;  2H7E A;  2HE7 A;  5HE3 A;  2DHK A;  1H10 A;  2YS3 A;  2D9W A;  2GJY A;  1EAZ A;  4DX9 0;  2AL6 A;  1ZC4 B;  3SO6 A;  1J19 A;  5J3Q A;  2K2J A;  1IRS A;  4HHV A;  4F7H A;  2M14 A;  2I5F A;  3M1I B;  4KHO A;  4HAY B;  1K5G B;  1XCG A;  4KHA A;  5FI0 A;  2EJ8 A;  4ZRK A;  3SUZ A;  5CLQ B;  4B6H A;  1PLS A;  5D3W A;  3U8Z A;  1PMS A;  4K2P A;  1DDM A;  2H7D A;  2OTX A;  1OMW A;  1Z87 A;  2DLW A;  4HAT B;  4NY0 A;  1FGY A;  1MIZ B;  1XX0 A;  2DKQ A;  3D8E A;  1N3H A;  5KQ1 A;  3GYP A;  2DTC A;  1UNP A;  1B55 A;  2I5C A;  1MIX A;  2CAY A;  4EJN A;  3ODX A;  4A6H A;  4NSW A;  1ZM0 A;  2COA A;  2D10 A;  1WGQ A;  2D4Q A;  3V5W A;  2I1J A;  3CIK A;  5FI1 A;  3TO1 A;  1Y19 B;  4HB0 B;  3P6A A;  2J0M A;  4KHB B;  1EGX A;  3PVL A;  3WYF B;  3ODW A;  3ULC A;  3PVW A;  1KI1 B;  3AU4 A;  2P8V A;  1FHO A;  3O96 A;  4F7U P;  3SV1 A;  4YL8 A;  2R0D A;  2BCJ A;  2N23 A;  2YF0 A;  5D3Y A;  4TKN A;  2DHI A;  2DFK A;  1U5G A;  3KRX A;  3DXD A;  3PP2 A;  2ROZ B;  1XR0 B;  3QBV B;  3PVU A;  2Z0P A;  1I7A A;  2IFS A;  3RCP A;  1LW3 A;  1WGU A;  2CY4 A;  4HB2 B;  2IYB A;  1DBH A;  1KZG A;  2EC1 A;  4ZRJ A;  3MPX A;  3G9W A;  1X1F A;  4Y94 A;  2ZPY A;  1AQC A;  1V5M A;  3U7D A;  2EMT A;  1FHW A;  2ELA A;  1MAI A;  5JHH A;  1GG3 A;  3VOQ A;  3BIN A;  2DYQ A;  2LOX A;  2D9X A;  3KZ1 A;  1V5P A;  4WJ7 A;  2YT0 A;  2P0H A;  3F0W A;  5LOP B;  3A98 B;  5HE2 A;  4P7I A; 
#chains in the Genus database with same CATH topology
 1GC7 A;  1FB8 A;  5JLJ B;  1U5E A;  2LKO A;  5C5B A;  2CRF A;  2DKP A;  4KVG B;  2JP2 A;  1X11 A;  4QJ4 B;  1BAK A;  1V89 A;  3FEH A;  1U5D A;  3DXE A;  3N7C A;  1V61 A;  3SNH A;  5KCV A;  1W1G A;  2LG1 A;  4IAP A;  2R09 A;  5DHF B;  1X05 A;  2KIE A;  4L6E A;  1E5W A;  2KR0 A;  1H4R A;  2RGN B;  4EKU A;  3AJ4 A;  3T06 A;  5JHG A;  3FVC A;  4HAX B;  5EFX A;  2YT1 A;  2K49 A;  2Z0O A;  5KQ4 A;  3PG7 A;  2MDX A;  2KUQ A;  1ISN A;  3NWD A;  2UZR A;  2OQB A;  2COF A;  1WG7 A;  5D3X A;  2R2Y A;  1QQG A;  4F7G A;  4PQ0 A;  4A5K A;  2RNR B;  4K2O A;  4DXA B;  2W2X D;  2MWN B;  4HAU B;  1K5D B;  3TCA A;  5HE1 A;  4HAW B;  2X18 A;  2E2X A;  1J0W A;  2DN6 A;  2D9Z A;  2FJL A;  2VSZ A;  2GCL A;  4L1R A;  3ULB A;  1GC6 A;  2LUL A;  2DX1 A;  1BTN A;  1P6S A;  3HQC A;  2VKI A;  2Z13 A;  3OAN A;  4MY6 A;  1RJ2 A;  2Q13 A;  3SYX A;  5C79 A;  5DI9 B;  4MK0 A;  2YS1 A;  1FOE A;  1LB1 A;  1MK9 B;  2N0Y A;  1FAO A;  3AU5 A;  2YRY A;  1P5T A;  2HTH B;  3NW8 A;  2NBV A;  3ML4 A;  5J3Y A;  2MFQ A;  2FJU B;  2EMS A;  2UZS A;  4QJ3 B;  3PSC A;  3ZVR A;  4H8S A;  4XWX A;  2DYN A;  5LON B;  2YS5 A;  2Y8F A;  1I2H A;  4KAX B;  4HAV B;  4DBB A;  2V76 A;  1PFJ A;  2LYD A;  1SHC A;  1UNQ A;  2DA0 A;  2ADZ A;  2GS0 A;  3DXC A;  1WJ1 A;  3LJU X;  2KGX B;  3KSY A;  1MKE A;  3WA0 A;  4C0A A;  3A8P A;  1UNR A;  1SGH A;  1DDW A;  4HDQ A;  4HB3 B;  2W2X C;  2RUK B;  4DX8 A;  3NWA A;  4CYE A;  1BWN A;  5C6R A;  1U5F A;  2RSG A;  4BBK A;  2KCJ A;  1WVH A;  5DHA B;  2DHJ A;  4CSQ A;  1DYN A;  2UVM A;  2L1C A;  2XQN M;  1MK7 B;  5I2S A;  3D8D A;  2Y7B A;  4CHJ A;  1UEF A;  2Z14 A;  2K00 A;  3DCX A;  4IFS A;  5LG4 B;  4GMV A;  5HE0 A;  1ZC3 B;  2D2Q A;  2RVB B;  3KY9 A;  3GYO A;  1ZYI A;  3HK0 A;  3PEG A;  2CY5 A;  1T77 A;  5CLL B;  3ZDT A;  2NZ8 B;  4HDO A;  4K17 A;  4HSI A;  1BTK A;  4MT7 A;  2P0F A;  2DX5 A;  2YVC A;  3P7Z A;  2MKR A;  2ROV A;  5I2M A;  4D0N B;  5C5B B;  4GPT B;  3NSU A;  1QC6 A;  1WI1 A;  2ELB A;  3UZT A;  3A8Q A;  3TW1 A;  4GMX B;  2D9Y A;  1NI2 A;  1OY2 A;  1XKE A;  2QKL A;  5D3V A;  4D6W A;  5D27 A;  2I1K A;  4WSF A;  1FHX A;  2W2W A;  5DIF B;  2YSZ A;  3FM8 C;  4K81 A;  2PZ1 A;  4IOY X;  3X23 A;  3KRW A;  5C16 A;  1Y5O A;  2COD A;  5JP4 A;  4Z2M B;  1NTY A;  4GOU A;  4A6F A;  5M4Y B;  3CXB B;  3TFM A;  3FSS A;  1TXD A;  1KZ7 A;  1AWE A;  1M7E A;  2NMB A;  4A6K A;  2KUP A;  1U29 A;  1U27 A;  3B77 A;  1UPQ A;  2QKM A;  3HW2 B;  2L2I A;  1XD4 A;  3QIJ A;  4GXB A;  4GZU A;  1W1H A;  3F5R A;  4TYZ A;  1W1D A;  4HB4 B;  4EMO A;  4DIX A;  1ZVR A;  1NU2 A;  4QXA B;  3QWM A;  2K2U A;  2D11 A;  3HSA A;  1OQN A;  1DDV A;  4OSN A;  4GN1 A;  5DH9 B;  2D9V A;  2M38 A;  2VRW B;  5GOW B;  2LOZ A;  1U2B A;  1P3R A;  1X86 A;  4WVF B;  4Z2N A;  1EF1 A;  1FGZ A;  4YON A;  1NTV A;  4PNK A;  1TJ6 A;  1MPH A;  4A6F B;  3VIA A;  4CHM A;  2Y8G A;  2RRF A;  1XOD A;  2J0K A;  2RLO A;  1TQZ A;  2Z0Q A;  2P0D A;  2J59 M;  2AEH A;  1RRP B;  4HAZ B;  1M7R A;  1Q67 A;  1UPR A;  1WJM A;  2COC A;  3IVF A;  3TVV A;  1ZSQ A;  2GCJ A;  1V5U A;  3ODO A;  5J3T A;  2G35 A;  4GNK B;  1EVH A;  3MDB C;  1DRO A;  3PZD A;  3D8F A;  3BJI A;  5L81 A;  4ZRI A;  1V88 A;  1X1G A;  2J0J A;  2H7E A;  2HE7 A;  5HE3 A;  2DHK A;  1H10 A;  2YS3 A;  2D9W A;  2GJY A;  1EAZ A;  4DX9 0;  2AL6 A;  1ZC4 B;  3SO6 A;  1J19 A;  5J3Q A;  2K2J A;  1IRS A;  4HHV A;  4F7H A;  4QJ5 B;  2M14 A;  2I5F A;  3M1I B;  4KHO A;  4HAY B;  1K5G B;  1XCG A;  4KHA A;  5FI0 A;  2YT2 A;  2EJ8 A;  4ZRK A;  3SUZ A;  4KHB A;  5CLQ B;  5IRS A;  3HIE A;  2ZKM X;  4B6H A;  1PLS A;  5D3W A;  3U8Z A;  1PMS A;  4K2P A;  1DDM A;  2H7D A;  2Z59 A;  2OTX A;  1OMW A;  1Z87 A;  2DLW A;  4HAT B;  4NY0 A;  1FGY A;  1MIZ B;  1XX0 A;  2DKQ A;  4OT1 A;  3D8E A;  1N3H A;  5KQ1 A;  3GYP A;  2K8E A;  3U12 A;  2DTC A;  1UNP A;  2Z4D A;  1B55 A;  2I5C A;  1MIX A;  2CAY A;  4EJN A;  3ODX A;  4A6H A;  4NSW A;  1ZM0 A;  2COA A;  2D10 A;  1WGQ A;  2D4Q A;  3V5W A;  2I1J A;  3CIK A;  5FI1 A;  3A58 A;  3TO1 A;  1Y19 B;  4HB0 B;  3P6A A;  2J0M A;  4KHB B;  1EGX A;  3PVL A;  3WYF B;  3ODW A;  3NWF A;  3ULC A;  3PVW A;  1KI1 B;  3AU4 A;  2KIG A;  2P8V A;  1FHO A;  1MI1 A;  3O96 A;  4F7U P;  3SV1 A;  4YL8 A;  2R0D A;  2BCJ A;  2N23 A;  2YF0 A;  5D3Y A;  4TKN A;  2DHI A;  2DFK A;  1U5G A;  3KRX A;  3DXD A;  3PP2 A;  2ROZ B;  1XR0 B;  3QBV B;  3PVU A;  2GUM A;  2Z0P A;  1I7A A;  2IFS A;  3RCP A;  1LW3 A;  1WGU A;  2CY4 A;  4HB2 B;  2IYB A;  1DBH A;  1KZG A;  2EC1 A;  4ZRJ A;  3MPX A;  3G9W A;  1X1F A;  4Y94 A;  2ZPY A;  1AQC A;  1V5M A;  3U7D A;  2EMT A;  1FHW A;  2ELA A;  1MAI A;  3OHM B;  5JHH A;  1GG3 A;  3VOQ A;  3BIN A;  2DYQ A;  2LOX A;  2D9X A;  3KZ1 A;  1V5P A;  4WJ7 A;  2YT0 A;  2P0H A;  3F0W A;  5LOP B;  3A98 B;  5HE2 A;  4P7I A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  1FB8 A;  5JLJ B;  1U5E A;  2LKO A;  5C5B A;  2CRF A;  2DKP A;  4KVG B;  2JP2 A;  1X11 A;  1BAK A;  1V89 A;  3FEH A;  1U5D A;  3DXE A;  3N7C A;  1V61 A;  3SNH A;  5KCV A;  1W1G A;  2LG1 A;  4IAP A;  2R09 A;  5DHF B;  1X05 A;  4L6E A;  1E5W A;  1H4R A;  2RGN B;  4EKU A;  3AJ4 A;  3T06 A;  5JHG A;  4HAX B;  5EFX A;  2YT1 A;  2Z0O A;  5KQ4 A;  3PG7 A;  2MDX A;  1ISN A;  2UZR A;  2OQB A;  2COF A;  1WG7 A;  5D3X A;  1QQG A;  4F7G A;  4PQ0 A;  4A5K A;  2RNR B;  4K2O A;  4DXA B;  2W2X D;  2MWN B;  4HAU B;  1K5D B;  3TCA A;  5HE1 A;  4HAW B;  2X18 A;  2E2X A;  1J0W A;  2DN6 A;  2D9Z A;  2FJL A;  2VSZ A;  2GCL A;  3ULB A;  1GC6 A;  2LUL A;  2DX1 A;  1BTN A;  1P6S A;  3HQC A;  2VKI A;  3OAN A;  4MY6 A;  1RJ2 A;  2Q13 A;  3SYX A;  5C79 A;  5DI9 B;  4MK0 A;  2YS1 A;  1FOE A;  1LB1 A;  1MK9 B;  2N0Y A;  1FAO A;  3AU5 A;  2YRY A;  1P5T A;  2HTH B;  3ML4 A;  5J3Y A;  2MFQ A;  2EMS A;  2UZS A;  3PSC A;  3ZVR A;  4H8S A;  4XWX A;  2DYN A;  5LON B;  2YS5 A;  2Y8F A;  1I2H A;  4KAX B;  4HAV B;  4DBB A;  2V76 A;  1PFJ A;  2LYD A;  1SHC A;  1UNQ A;  2DA0 A;  2ADZ A;  2GS0 A;  3DXC A;  1WJ1 A;  3LJU X;  2KGX B;  3KSY A;  1MKE A;  3WA0 A;  4C0A A;  3A8P A;  1UNR A;  1SGH A;  1DDW A;  4HDQ A;  4HB3 B;  2W2X C;  2RUK B;  4DX8 A;  4CYE A;  1BWN A;  5C6R A;  1U5F A;  2RSG A;  4BBK A;  2KCJ A;  1WVH A;  5DHA B;  2DHJ A;  1DYN A;  2UVM A;  2L1C A;  2XQN M;  1MK7 B;  3D8D A;  2Y7B A;  4CHJ A;  1UEF A;  2K00 A;  4IFS A;  4GMV A;  5HE0 A;  1ZC3 B;  2D2Q A;  2RVB B;  3KY9 A;  3GYO A;  3HK0 A;  3PEG A;  2CY5 A;  5CLL B;  3ZDT A;  2NZ8 B;  4HDO A;  4K17 A;  1BTK A;  4MT7 A;  2P0F A;  2DX5 A;  2YVC A;  3P7Z A;  2MKR A;  2ROV A;  4D0N B;  5C5B B;  4GPT B;  3NSU A;  1QC6 A;  1WI1 A;  2ELB A;  3UZT A;  3A8Q A;  3TW1 A;  4GMX B;  2D9Y A;  1NI2 A;  1OY2 A;  1XKE A;  2QKL A;  5D3V A;  5D27 A;  2I1K A;  4WSF A;  1FHX A;  2W2W A;  5DIF B;  2YSZ A;  3FM8 C;  4K81 A;  2PZ1 A;  4IOY X;  3X23 A;  3KRW A;  5C16 A;  1Y5O A;  2COD A;  5JP4 A;  4Z2M B;  1NTY A;  4A6F A;  3CXB B;  3TFM A;  3FSS A;  1TXD A;  1KZ7 A;  1AWE A;  1M7E A;  2NMB A;  4A6K A;  2KUP A;  1U29 A;  1U27 A;  1UPQ A;  2QKM A;  3HW2 B;  2L2I A;  1XD4 A;  3QIJ A;  4GXB A;  4GZU A;  1W1H A;  3F5R A;  4TYZ A;  1W1D A;  4HB4 B;  4EMO A;  1ZVR A;  1NU2 A;  3QWM A;  2K2U A;  2D11 A;  1OQN A;  1DDV A;  4GN1 A;  5DH9 B;  2D9V A;  2M38 A;  2VRW B;  5GOW B;  2LOZ A;  1U2B A;  1P3R A;  1X86 A;  4WVF B;  4Z2N A;  1EF1 A;  1FGZ A;  4YON A;  1NTV A;  4PNK A;  1TJ6 A;  1MPH A;  4A6F B;  3VIA A;  4CHM A;  2Y8G A;  1XOD A;  2J0K A;  2RLO A;  1TQZ A;  2Z0Q A;  2P0D A;  2J59 M;  2AEH A;  1RRP B;  4HAZ B;  1M7R A;  1Q67 A;  1UPR A;  1WJM A;  2COC A;  3IVF A;  3TVV A;  1ZSQ A;  2GCJ A;  1V5U A;  3ODO A;  5J3T A;  2G35 A;  1EVH A;  3MDB C;  1DRO A;  3PZD A;  3D8F A;  3BJI A;  5L81 A;  4ZRI A;  1V88 A;  1X1G A;  2J0J A;  2H7E A;  2HE7 A;  5HE3 A;  2DHK A;  1H10 A;  2YS3 A;  2D9W A;  2GJY A;  1EAZ A;  4DX9 0;  2AL6 A;  1ZC4 B;  3SO6 A;  1J19 A;  5J3Q A;  2K2J A;  1IRS A;  4HHV A;  4F7H A;  2M14 A;  2I5F A;  3M1I B;  4KHO A;  4HAY B;  1K5G B;  1XCG A;  4KHA A;  5FI0 A;  2EJ8 A;  4ZRK A;  3SUZ A;  5CLQ B;  4B6H A;  1PLS A;  5D3W A;  3U8Z A;  1PMS A;  4K2P A;  1DDM A;  2H7D A;  2OTX A;  1OMW A;  1Z87 A;  2DLW A;  4HAT B;  4NY0 A;  1FGY A;  1MIZ B;  1XX0 A;  2DKQ A;  3D8E A;  1N3H A;  5KQ1 A;  3GYP A;  2DTC A;  1UNP A;  1B55 A;  2I5C A;  1MIX A;  2CAY A;  4EJN A;  3ODX A;  4A6H A;  4NSW A;  1ZM0 A;  2COA A;  2D10 A;  1WGQ A;  2D4Q A;  3V5W A;  2I1J A;  3CIK A;  5FI1 A;  3TO1 A;  1Y19 B;  4HB0 B;  3P6A A;  2J0M A;  4KHB B;  1EGX A;  3PVL A;  3WYF B;  3ODW A;  3ULC A;  3PVW A;  1KI1 B;  3AU4 A;  2P8V A;  1FHO A;  3O96 A;  4F7U P;  3SV1 A;  4YL8 A;  2R0D A;  2BCJ A;  2N23 A;  2YF0 A;  5D3Y A;  4TKN A;  2DHI A;  2DFK A;  1U5G A;  3KRX A;  3DXD A;  3PP2 A;  2ROZ B;  1XR0 B;  3QBV B;  3PVU A;  2Z0P A;  1I7A A;  2IFS A;  3RCP A;  1LW3 A;  1WGU A;  2CY4 A;  4HB2 B;  2IYB A;  1DBH A;  1KZG A;  2EC1 A;  4ZRJ A;  3MPX A;  3G9W A;  1X1F A;  4Y94 A;  2ZPY A;  1AQC A;  1V5M A;  3U7D A;  2EMT A;  1FHW A;  2ELA A;  1MAI A;  5JHH A;  1GG3 A;  3VOQ A;  3BIN A;  2DYQ A;  2LOX A;  2D9X A;  3KZ1 A;  1V5P A;  4WJ7 A;  2YT0 A;  2P0H A;  3F0W A;  5LOP B;  3A98 B;  5HE2 A;  4P7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...