4HBCL

Crystal structure of a conformation-dependent rabbit igg fab specific for amyloid prefibrillar oligomers
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
DVVMTQTPASVSEPVGGTVTIKCQASQSISSYLAWYQQKPGQRPRLLIYETSTLASGVPSRFKGSGSGTDFTLTISDLECADAATYYCQSTYENPTYVSFGGGTEVGVKGDPVAPTVLIFPPSADLVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTEYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen Binding Fragment, Immunoglobulin IgG - Heavy Chain
publication title Crystal structure of a conformation-dependent rabbit IgG Fab specific for amyloid prefibrillar oligomers.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hbcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hbcL01
2CIIB 5D1ZA 4I18C 5LCVL 5GGUA 2HJFA 5EUOF 4B41A 4GAGL 1X5LA 5MI0C 1G1YA 1D5XA 4YIQA 5ICZA 1C5CH 1KPRB 2G5RA 1S9XA 1YECH 5GS1B 4NKIH 5C6TH 2DOCA 4XPGL 2YD8A 2F54D 1RIVH 1NEZG 1C16A 3QDJB 5F7EL 3V4VL 2P8LA 2YZ8A 4MCYA 1IQDA 3I85A 2DLEA 4LSVH 4N0CD 1T22A 1ZA3B 4XBGA 3SQBA 4NBXB 2HT3D 3A67L 2V7HA 1X7QB 1WBZB 3UTOA 4EI5C 4ZOBA 1XIWD 4OCSH 4MD0A 4W68A 2F8OA 3ARFB 4M8VA 2VAJA 3L3JA 3OKLB 4OZHE 4NUJB 4YDVA 1FN4B 5AWNL 1H3VA 3T3PF 3HAEH 3Q6GH 3F7PC 5E8PB 2IQAA 2VXSL 4MX7B 5HDOA 5MP6L 2FL5B 1BVZA 3HUJF 4L3CA 5HGAB 4QF1A 3OB8A 2D7TL 6FABL 1VEPA 5TDOB 5KJRH 1RFDL 4PV9A 5LAXB 2CLRB 1RUQH 1QNZL 5GISH 1NMAL 1VGEH 3SDDD 3SDAC 1ZHKA 5CIPA 4P59L 4POUB 1FBIL 4PRNB 5EC2B 5F7UA 2VLLA 4JPWH 3C87A 4G6MH 4PG2C 3DO7A 5GS3A 2EIZA 2AJZA 1B6UA 4RZCA 4M5ZL 4OTXH 4Y4KC 3QDGE 1UXWB 4M43L 1JF1A 3EOYG 5HHQB 3S96A 3PGCB 4LCYA 2NX5D 1G0DA 2C26A 2VLJB 2W9DL 4ZXBC 3O6LH 5ESQA 1UG9A 4NZDA 3LVEA 1OAXL 1K5NB 1MCLA 2ITCA 3OKKA 4AG4H 1NJ9A 3RVVD 4QXWA 1KN2H 4JPKH 1LP9E 3BHBA 3T8XA 3ARRA 1F3DH 2P7TB 3FN0H 4MNQA 4AEHL 2YA0A 3VRIB 3QEGL 3X3GH 5E2VH 5EN2B 4JFED 2F5BL 4JFQA 4C57C 4HDIA 5IMLB 5KG9B 3KYNB 2GSGB 4IRJB 4FFWC 4MS8D 1J0IA 1CDBA 2PUQT 4PLJC 4XNMA 3WLBA 4GOSA 4ZUWA 5D1XA 3MV7A 3RWEB 5F7DB 2FJHB 4OIAA 1T89A 1L6XA 2I9TB 3V6ZA 5CSZA 2BJMH 1N5YH 3U7YH 1FSKC 4JRXB 3MBEC 1QBMH 5ERWB 1F42A 3L5HA 3OGCA 1YMMD 4HIJB 1XF4A 4IRZH 4LCWA 3CZJA 5A2FA 4Y16A 3UTPD 2HKFL 4YHNB 5DHYB 5HTSA 4I77L 3BH8B 4X9BA 3NIGE 5JUEL 3G6DH 3RU8L 2KPNA 4GW1A 3DRQB 4LVHC 1F6LL 5E8DH 1QSED 1V8HA 3TN0B 1MWAL 4FTVE 4BUHA 2IADA 4WHTA 3X17A 1WEJH 4ETQB 4PJGF 5GRZA 5I75C 1PEZA 2I26N 4PRHB 4ZUTB 3FB5B 4PREA 2EDFA 3HUJA 1KXQE 1K2DA 3DHJA 3C2AH 4RWYL 4G5ZH 5ENWB 5DC9B 1OM3H 1BREA 3KXFB 1PX4A 1INQA 5FAAA 4KUCD 2QR0A 2RB8A 1QG3A 1MFNA 1AHWC 3V4UH 1TETL 5E9DA 4XPHL 3B9AA 3DVNB 3SJVB 1RZIB 5C0FA 1YUHB 2JJTA 3ZTNL 3BGMB 3GSXA 4PG9A 4JFDE 5E00A 1MHHA 4PJFB 2V2WA 5EBLA 3C5JB 1DVFC 4FABH 1WTGT 3LPFA 4PRIB 4XNUL 1EHNA 3L3OA 1HILB 2HA1A 2R1XA 2WBJB 2XRAH 2OI9C 1MWAB 3CAFA 3G9AB 3QFJA 2X40A 4N9OB 1NAMA 4KVCL 5DS8B 3WD5H 3TT3L 1NUDA 4MAYA 4IMLA 3ROOA 1TMCB 1CDGA 5L2KB 3FFCE 5EO9B 1H3UA 1TJGL 3O3EA 4P23A 4AT6A 3PP3K 4YPGB 1QSFA 3JTSB 2DN7A 2P8MB 3MCLL 1PD6A 4QHNA 4R8WH 4RMUA 3QXAA 2VLMD 3HE7C 1MRCH 1DEEB 2GJJA 5TQ0L 3B8SA 2R8SH 4NZTH 4F2MA 3S88L 3VGDA 3NPSB 1MFCL 2COQA 1DBJH 1MF2H 1JPST 3DPBA 2AVGA 1MFAH 3ECBA 3D39E 3KHQA 3GSNA 4EQ3A 2IAMB 1ZLUK 2W92A 3HS0A 2HFTA 4IOFD 1A1MB 3HNSL 4AH2A 3JWDL 4NBYB 1IGYB 2HG5B 5C0BD 4BQ9A 4FZEH 1XH3A 4QNPF 2YC1B 1CT8A 1LDPH 3MLTA 3REVB 1PYWB 4P2RD 3H7BA 1PLGH 5GQBA 4I5BB 1A7PL 2BC4A 3UZVB 4OKDA 1JGEB 1NUFA 5L88L 4P4KD 2Z31B 5IT2L 5DK0A 1J05A 1I7RA 5BRZA 4YHKL 1YNKL 2GAZB 3E1F1 3I2CH 4FFYL 3O2DL 1AD9A 2GCYB 5IEKB 4JJHA 2GUOA 4M7JL 3IDIB 1BFTA 2KQNA 4KQ4H 2BMKB 1QLFB 4WU5A 2O93L 5ILTH 3DURA 4UOJA 1XGPA 3LQAC 4G43A 1IL1B 4CKVX 1MFEH 4YO0B 4GBXC 3DBXA 5FUCE 4M6OL 4G8IA 1S7QA 5GZND 3WJJA 4DAGH 4RGNB 4LFHD 4OCWH 4R4FH 3SQOH 1NCWH 2LTQB 3MV11 1GPOH 3OKDA 5L2JA 3U82B 2X70B 2DLGA 3T4YB 1I7ZB 4WIQA 1N3NB 3K2MC 3H9HB 2OM5A 5DVLA 2APTA 4OB5L 2FBJL 3OXSB 5B39G 4J3XA 1A6ZA 1IGMH 3WN5A 3C5ZD 5B8CC 1P4LB 3DGCR 2E27L 3NH7H 4HIIA 3UPCA 2IG2H 4RMVA 4JM4H 1NEZB 3FQNB 2ZOKB 5I9QB 3MGAA 2EKSB 4LLUA 1JNJA 4WFFE 1FGVH 4GMTL 3L3KB 1YEKL 3I75B 3QIBC 3RNKB 3WNKA 3HAEG 4H0GA 3ZDXE 4LEXH 1G9NH 1MFBH 4FG6D 2B2XL 4LPXA 5EWIH 1XGUB 5FKPA 4PJBE 1DVFD 1H5BB 1YEEL 1N4XH 1UB5A 1GGIL 4L4TB 1KXVC 3LEVH 3U7AA 2AKRA 3O4LB 3PWUB 1I8MA 1H9VA 1CCZA 1MCOH 4NFBA 4CN1A 1R3KA 2FIRT 2X9WA 3MREA 4RAHA 1B0GA 4HULB 4P9HC 2OS7A 3LKPA 5D2NE 1HQ4A 3C8HA 2DM4A 4TSCH 5DJ6B 5HY9A 1T80A 3P4LA 1OVZA 4YHZH 3IAPA 2FX7L 4R96B 3DVGB 4CDHA 4OBSA 3ARBC 3QHZL 4UT7H 5D5MB 1CXKA 5JHDE 2Y4SA 4R97B 1GGBH 5I18H 3LB6C 2OJEA 4OZIB 5FA3B 5FB8B 4M1DH 4Z95H 3HMWH 1VFOA 4Z78B 2YD5A 3ARQA 5T1DL 5INDB 1B88A 3RWHA 4XGZA 3T0AA 5J8OA 3RWGA 4PRDB 5GZOD 1ITCA 1I9EA 4K7FB 1FIEA 5D6CB 1VEMA 3CDCA 3GZKA 4MZ3A 2N7BA 1ZWIB 4ORGA 1BD2D 1A7NH 3D5OF 4C58B 2H2SD 2QHRH 4FMKA 3MV8D 3PL6A 5C08B 4JPVH 4N0UB 4Y5VA 3EBAA 5CMAA 2PYFA 4OSUH 1KNOA 3KYKH 5SWZA 4WGVB 3P73A 5MEND 2HWZH 1A6AA 5I6XB 4O00A 4GAYA 1BLNA 5FGSA 2HJKB 1VESA 1MQ8A 5EOCL 4AEIH 1CDJA 4GKZA 4ZSOE 1OHQA 2D2OA 1VERA 2BSTB 3DXAE 3T0EC 3EOBA 1F4WH 4B7LA 1CFTB 5KVEL 2DI7A 2WW8A 1UB6A 3P0YL 5JNYB 1J1OL 4GRWF 1ND0A 1CQYA 3WNOA 5C9JB 1F3JB 4Q9QL 4C4KT 4HPYL 4Y5YC 4KI5D 3U6RB 5FO9A 2P42B 1H8OA 3U30C 4PJCA 1MOEA 3IJSA 4QXTB 2ED7A 5HHME 1FYTD 3GB7A 3B2VH 2DJUA 3X12B 1P53A 1S9YB 2NY0B 4NCDA 2ZCLL 2HLFC 4KTEH 3E3QE 2DQEH 4N0FA 5DQDL 1ZLSL 4N90E 3QXTA 3FQTA 4MQXC 5TF1H 3G9VA 5FYKL 5C3TA 3LEYH 4NWTL 2P8PA 1K4CB 3UYRL 4AL8L 2FIKB 4YHML 3ARGD 5IQ7H 2EKJA 5CZXC 3IXAA 5IB3B 2F19L 2IBZX 1KYOJ 2H32B 3OL2A 3E8UH 1FCGA 5EOTB 5J4MA 5ICYB 3N85H 4HWUA 4Y1AB 4QHKJ 1LD9B 3U4EB 3VGAC 4M61A 3T1FA 3FRUB 4ZOAA 3S5LA 4KJWD 1RJCA 3HLAA 4YLQT 4ZFFB 4JRWA 4V2BA 5EZOL 4Z9KB 3PABB 4LU5L 3BE1H 3QYCA 1OP3K 5KVFL 4HMDA 3L6FB 1S3KL 2LVEA 3LRGA 4PJ8A 2EC9U 2NY2D 3RZCB 1E27B 2VO5A 4F33B 2VXQL 3EYFA 1RZJC 3QAZC 1I1AC 4X6FA 2EDJA 5I1IL 4N5UA 1JWUA 4U1HA 4HC1L 4UDTA 2CMRH 4ODVH 2LABA 3MRJB 3CMGA 4G3YH 4YC2C 2A9NL 3MLRL 1U41A 3B9KB 3DROB 3MRBB 3C09B 1FAKT 4P46C 3GKZA 1LEIA 3O2VH 1PQZA 1A7RL 3QULB 4HWZB 3ZMRA 5H35A 3P0VH 1YECL 5D7LE 2NNAB 4LEOA 4OF0A 4NKIL 1TVHA 1DQDH 2C3VB 4PJXB 5CFHA 5MEOB 5DFVC 3WHE1 2GJ6E 4UQ2B 5B38A 3CFBB 3EOAA 1ZV5A 3PXHA 3HZVA 4QT5B 1W0WA 2EDXA 4Z7VB 3T0ED 4L3AA 2HTLC 3QRGH 2EYRA 4BFIB 5CAYB 3ESUF 4JCLA 4G8GD 4XPBL 1DBMH 5F9JA 1QRKA 2A6KB 3FO9A 4FQIH 8FABB 3QEQA 3MRLB 1JPGA 2AI0H 3EFDL 3Q6GL 1B9ZA 4PTTA 4Q6IB 1WV7T 2IJ0C 3NN8B 2R2HA 3IS0X 4K3JH 4E5XB 4NYLB 2VZTA 1KJVB 1KT2B 2X4TB 4ODSH 1HEZA 4TSBH 5HI4C 3GHEL 2VXTH 4LLDB 4XBEL 5KJRL 2DQJL 2WWMD 3V7MA 1RUQL 1JJUA 3HR6A 3OV6A 1VGEL 5BXFA 2CH8A 4MLIA 1KCKA 1XF5B 4LGRB 2LFGA 1JBJA 3QSKB 5HD8C 4OTXL 3FKUS 1HWHB 1XCTA 5B39B 2P24B 4G6JL 2EXWC 1V5JA 4OCYH 3SDXE 1QA9B 3M45A 1MVUA 3WHE0 5MHSE 4O58L 5IB5A 3VA2C 2C1PA 4NSKA 1KN2L 3CJJA 4X4MA 3HAEB 3FT3A 4Z76A 2Y72A 1UM6H 2GITB 3K8MA 4MVBD 2EDOA 2WIIA 1TJHL 2BK8A 3MUJA 3O3BA 5A2JH 1C1EH 4YGVA 4JFHE 1G9MH 4HIHB 4LHUD 2H6PA 4N1EA 5KSAD 3BZ4B 3PIQB 2DLTA 4Q7DA 3RQ3A 4P2CG 5HHXH 3UTZB 3GHBL 3WS3A 4OZFA 4UINL 3VXUB 4OCXL 2A6DA 3GMPB 4YHIA 1R3JA 2BNQA 2R0LH 5IB1A 1QBML 5KN5B 2VSDA 2AXFA 4IRZL 3GNMH 2JIXB 5F21B 5IMOB 3UX9B 1QLEH 2E6PA 3BEWB 1MRFH 5DJ2B 3IRZA 5DZNA 4PJ5B 4HWBL 5CZKA 3AREC 3QG7L 3Q6FA 2G60H 5D1XD 4CN6A 3LDBB 4WUKH 5GIRB 1TIUA 4MXQC 2EECA 5T5FH 1DN2A 3F7VA 4XVUC 2ENYA 4PLKC 3PWVB 1YNTA 4G6FD 1P4IH 2A73A 4P9MH 4YR6B 1GIGH 4FZ8L 1ZHNA 1NBYB 2AJYH 4KI1A 4CW1B 1N64L 5EO1B 4AENB 3VXMA 4Y16D 4KQ3H 3H9SB 1W0YT 1RMFL 1DR9A 2XQBL 2OLDA 4I8DA 4KC3B 3NABL 1KEML 3RAJH 2NY4D 4HJGB 1DANU 4PYGA 4J6RH 5IMKA 1EEZA 3MC0A 1NBZB 5K9JH 1NFIB 5CGYD 5C0EB 4GG6F 3IDJA 2MTPA 1E0OB 3FL7A 3DARA 1T7XA 3V4UL 1ERNA 3DV4A 1KFAL 4GRWH 5FGBC 5J12B 5J3HC 4K9EC 4L8BB 4M7LH 5DDHA 5JW4Q 1X5XA 2V5SA 1EMTL 3P11H 4ERSH 5FDWA 1Z9LA 4R0LB 1XR8B 1AO7B 1FNGB 4JG1H 3TNNA 4HGWA 3WNPA 4OM1L 4YDKH 5I1KH 4UDUB 5IOPA 1YN6A 2DB8A 4F3FB 5TDNA 4BSVA 1KB9J 3CFCH 2EYSA 2OJZH 2CKBA 4WVRA 1TFHA 4O9HL 3SDAA 4XX1G 1WAAE 1DLFL 3HPJA 3DX6B 1JHLL 1I1RA 5HPMA 4PG2A 4JKKA 4X5XB 2WBWB 2MQ0A 4V1DB 1YYLL 5D7IE 3UJIH 2C3XA 3UROR 4JB9L 1MRCL 1J1PH 1U8NB 1UQSA 4NZTL 1DUYB 3UTTE 2R8SL 2HJFB 5M94B 1WICA 1QRNB 2GYSA 1DUZA 2X89A 3TA3A 1DBJL 1D5XB 4ZXBA 1MF2L 4S0TD 5DYOB 4OLYH 4RMTA 1UZ6E 1T5XB 2DDQH 3IJYA 1MFAL 1ZLVK 3TH2T 4E41B 3KPLB 1C7TA 5AAMA 1KIRA 4UNVA 4HUWA 4CVUA 1IQDB 3LKSA 3MNZB 1T22B 3NA4A 4Y2DA 2FCBA 4JHAL 2V9QA 1IGCL 4KVNL 3AS1A 1NBQA 5D96C 2BERA 5J6GA 1T21B 4ZUUB 3BX7C 1V3KA 4ZD3L 3UEZA 3L3IB 2ZKHL 3KVQA 2AEPL 4OUUA 4KKLD 4KHTL 4EBQH 3K0WA 2ZCKL 1OGAA 3RDTC 1NH6A 1GYAA 1A1NB 2XZZA 4X6BA 3I2CL 5D4QA 1DEDA 3LKNB 5A3ID 3BRGC 3V8CA 2ZJSH 3MBEA 2IQAB 4FQPA 1LNUB 4D0CA 4NN7B 1FAIH 4XCFH 4AIZA 4OZGE 4J1UB 4KQ4L 5HGGS 5T3XD 2D0FA 3FOMA 2VE6B 4PP2A 5DTFA 2KL6A 5C86A 1JHKL 2Y23A 1O0VA 3KLSA 1MAJA 5LGJB 5SWQB 4GG6A 1IZKA 3HZMB 1K8DA 5GSVA 4OZFH 4RZCB 3GSOA 3L7FB 1B3JA 3Q5TA 4JZOA 3QIUC 3SQOL 4TUOB 1B2WL 2E9BA 5GRJH 1RV6X 3NMEA 3B8YA 4U7SA 3DV6B 2L7UA 2OSLB 3CDGB 3MRCB 4GKNB 2R29L 5C0CE 3QQ4A 4UTAH 3QQ3B 4KY1H 3ZZ1A 3MACH 4Y89A 4C56A 1OAUL 4MNQB 5F89A 4M5YL 1FC2D 3NIDF 5ISZB 1T03H 2R56H 5DMYA 1AHWA 5L7XL 1MFDL 1NC2B 1G9NL 5IGXL 4H1LH 1NFDB 1G6VK 5EWIL 5HHOE 3IXTB 1NANH 3ARSA 2GSIA 1JN6B 4NT6B 4ZUWB 4GUPA 2EDNA 1ZHBB 4I0PA 5EUOB 3D0VA 4JCMA 5EBMA 3LEVL 4OKVA 3PWLB 1R3IH 2DQFA 3OF6A 2HFEB 4QRPA 3SGDI 1KCRL 1X3DA 1MCOL 5IUSA 4XNYH 3V0VA 4LCWB 4L5FL 1KJ3H 1AP2B 3IS1X 5DJDB 5EU3B 4YHZL 2ATKB 3PQYD 2BVPB 3HE7A 5JQHC 3IU4H 4KFZC 5C07E 1NCBL 1U58A 4X7SH 2V2TA 2VH5H 4NQDE 3EAKA 3LSOA 1EFXA 3LN4B 3BPCB 4NNXB 1RJZA 5E1AA 3SBWC 2CKBH 2ID5A 2IEPA 3BOVA 4WHTB 3UJTL 2XXMB 1AIFB 3ZYJA 2YS4A 2A6JA 4JFOA 4ZO6A 3JUZA 2GI7A 3HCVB 4JFDA 5F7YC 1T2XA 4EUPA 3O4OB 4XNXH 3GMMB 4ZFOA 5C0IB 3U9UB 4OLWL 1G6RH 1KLGA 3SKJH 4IMKA 5CWSA 3V6OE 4KROB 4V2CB 3MZGB 4AMKL 4XPAH 1A7NL 3W0WE 2VN7A 2VZSA 2QHRL 3D3VE 4IBLT 4NQEE 5E2WL 4I2XE 4OD2A 1V7ML 3MXVL 1S7RB 3MRIA 4OSUL 3UC0H 2P5EB 4JQIH 4PG9B 4DVBB 3GJFK 1MHHB 4Y4HB 2G9HA 2CQVA 5GJSH 3FTGB 3A0OA 4G7VH 2OK0H 3MLWH 3F5WA 4AEIL 1FV1B 5GRUL 1IQWH 3QFJB 5JXED 4Z77A 1OP9A 4F9PA 4PB9H 3ROOB 4NQUA 1M6OA 1E28B 1YYML 4P23B 1QHOA 1I1FA 3L3HA 4OAWA 3SOBL 1ORQB 1R5VB 4F7PB 2AQ3A 3VJ6B 5GSRA 5FM5O 4LP5A 4EOWH 3O2WH 3RY5A 5DLML 3GSVB 4QRRA 5GGTA 1A6TA 5B8CA 1U3HD 1AQDA 3HS0B 2OX5A 4YBQD 3TH4T 3QP3A 4MMXC 5FKAA 1RZKL 4F15C 3QIBA 1EGJL 3MLTB 2CDEB 1PG7L 5C0AB 1PX3A 5IQ7L 4U05A 5C3LD 3R8BB 2CGRH 5FUZL 5BRZB 3L9RA 5E4IA 3VFGL 1I7UB 3GUTB 1HHIB 1BVKA 3OXRA 2B1HH 2HKHH 1AD9B 4FXGA 4BQ8A 1GZPA 1IARB 5GRYA 1A21A 4XVJH 4MSWA 2YPVL 4PJGB 4TVPL 4P3DB 1FVDA 2A74B 1W72A 2NY7H 3CC5B 3V0WH 5TH2B 4WU5B 1HHJB 4CADB 4ELMF 3DI3B 4G43B 1IC7L 2HTKD 5DFTA 3ARBA 4PJHE 1D6VL 5HGHB 5BO1H 1U8KA 1J87A 3UTSA 2BSRB 3I6LD 1TTFA 2FHFA 3GGWB 2P5WA 4JQXC 2X4UB 4X9HA 2XNAA 4ZMAT 1OPGH 5E03A 1INEL 1JWSA 4N9GB 5ESVA 4Z7OF 2NXZC 2X42A 1TJIH 5DC4B 3TCLA 1Z0MA 4G3YL 1A6ZB 3WN5B 1Z6JT 2X1XR 4PJ8D 5IW6A 4WW2C 1CE1H 4O51A 1FZOA 2N4IA 2PO6C 1KB5L 1MIEH 1WSST 1F11A 1FIGL 4OD1H 4NO0D 1RZGB 3VDCA 2RAMA 4P5MB 3S36L 1OWWA 3BP5A 3LV3A 2R4SH 4NKMA 5CSBA 5FIEA 2K7PA 2ZOLA 3KPSE 1DQDL 5FECA 4H25A 1LO5A 1DL7H 3SHSA 3ZKNC 15C8H 3QT2A 1WJ3A 1XR9A 2SEBA 3QUMA 1JK8A 3EKCA 1JMXA 2FO4A 3QNXB 3M8OH 4WHYH 4LLWA 4U1IB 4MQ7A 4P2QA 1ED3A 4Z8FL 2IFFH 3ROLB 2G5BA 4M6NH 5BMFH 1G7MB 5IW1A 1R3KB 5F3BB 5DRZA 4PRPA 4QWWC 2HRPH 3FT4B 1IRAY 1DBML 2G2RB 1S9KC 3M17B 1BOYA 1ZK9A 2AI0L 4N0YL 4Y5YA 5IB2A 5FK9A 4KJQC 4YHPA 4XC3H 5JZ7D 5J1AB 1K85A 1C08B 5TE7H 1BZ7A 4GRLD 5GGRY 1PKQE 3VFWA 2DMCA 3EYQC 3GM8A 1XGQB 4JM2B 1HYRC 4UOW1 3PGDA 5AYUH 3CVHA 3AB0B 4M7ZB 4N8VA 1KIQB 1IGJB 4H1LG 1I3RA 1UA6H 3S3JA 1PBYA 1UENA 3S35X 4XCCH 3VFOB 1UWXH 1BJMA 4UB0H 3BD4A 3QIWD 2IF7A 1S9WB 2VUOA 3PL6B 2H9GB 3U0PA 5CMAB 3NA9H 1OSZA 4QEGA 1OT2A 3OKNA 3VE0B 5CJXA 2F58H 5GGSY 3SKOA 4KJPD 5AZEL 3WNNA 2R0KH 4WFGD 1QACA 1UXSA 2FYYB 2BHYA 4XCEB 1WCBA 3IETB 5ICXB 3S6CA 5A2IH 5L9DL 5T3ZE 2VLKE 4PJAB 1C1EL 4JFFB 5DZLA 5HGBA 4LKCA 3TVMC 5C2BL 3T0VA 1GHFH 4G9FE 5HDQL 3NAAH 2Y36L 1KELL 1UB6B 1C7SA 2FWOA 3CNKA 1KLUA 5HHXL 5EU6B 3OJMB 3UPRA 4QRQB 4XXDB 1FL6A 3RWIA 3U79A 1I1AA 1D6EA 1HDMA 3VXRB 3NTCL 3ZDZE 3TJEL 3O0RH 3VFRA 2YHGA 3WXWH 5JPNB 4WWKD 4P9HH 2CXKA 1ZGLM 1LVEA 1MAKA 4Q2ZA 4WO4C 1JPSL 4R7DB 3A6OA 1FLRL 4UOW0 3OKOA 2DM7A 3MCKB 4AM0A 4P46A 3OAZK 3P40A 2A9ML 3WFEL 5CJOL 2RHEA 3TO2B 1P4IL 4WI9A 4N0FB 3X13A 2VB5A 2H3NA 3WV0A 1BBJA 1GIGL 2GHWB 4LDEB 4UT6H 5D1QC 3HZKA 3K8KA 3ZHLA 5JHLH 4HKXB 1N7MH 3IXAB 3P9LA 4U6HB 2VLRD 4U1GC 3BO8A 3TJHD 2VDRH 3VXTB 3WO4B 3DYMA 2XA8L 2DMBA 1I85C 4UTBL 1OLZA 1IAOA 5MEPB 1SEBA 2C4FU 1FL3A 2QADD 4M61B 3T1FB 3G5YA 3HLAB 3QDAA 3TIDB 3O45B 4QWWD 3Q48A 1ZA6B 2AK4B 1JZ8A 4RNRA 4X6DF 4IRSC 4H20H 1TZIB 4ERSL 3RWCA 1M7DA 4IHOA 3TBTB 4KGJA 3QUKB 5EH1A 1NGPL 5CJ8A 3KNBA 5KTEH 1A4JA 1TPXC 2ZUXA 2XTJB 4PY7A 3EYFB 4HUUA 4DW2L 4B53A 4BZ2L 4DN3L 1CDCA 3O8XC 4Y7MA 3CFCL 3GSWA 2A77L 3MJ9L 3TZVD 4KGLA 4J3VA 3SKMA 4XHJD 1MPAL 5KOVC 2APXA 4HCRH 4B0MM 4F58H 1T66D 4UDTB 1P5UA 4TVPE 5C0RH 3JV4B 1CLYL 4QOKD 1HYSC 4YDJA 3QG6B 2VDNH 1LEKB 2BNRB 1UH3A 4LFHG 4BFEA 3UJIL 1OTSC 3IFPA 5CJQL 1OB1B 5IVXA 1YDPB 1ZHLB 4U1SA 1CU4H 2Z35A 5BS0E 3W39A 1PG7W 1U8LB 4GRWB 2UUDH 5DGRA 2YRLA 3SE8H 2F54B 3MUY1 3BD3A 1Y18B 4YHOL 1SMOA 5FHAH 4NGHH 4LPWA 1U0QA 2P4AB 5HYEA 4ZS7H 4O2CB 4QGTA 3BPLC 2VISB 3K4ZA 5JR1H 4LCIH 3HZVB 4FXKA 4LHJB 2Y9RT 1U8PA 1XIWB 3GMQB 3TA3D 4WU7A 5E2TH 5E1HB 1QPXA 3S37H 5B3JE 1CG9A 3QJHB 1S7XA 4GXVH 4NQCE 3FMGL 3QEQB 4K23H 3TYFA 4HBQA 4ZDHA 3RA7H 4PTTB 5FO7A 5ETUB 2R2HB 1BECA 1RIHL 1YQVL 4Y2DD 3UBXG 1BFOB 4PUBH 1WUNT 1J0KA 1PDKA 3VXQA 3JTTB 3N50A 1F8TL 3LN9A 4HJJL 7FABL 3CXDH 3HR5A 3IKCB 1IEBA 3AREA 5BXFB 1HXMA 3SDDB 4ZAKC 5KS9F 5EZLB 2WUBL 4TQEH 1A7BA 1CGVA 3OX8A 4ETYA 5GS1C 1RZJH 1G7IB 4X6DA 4WY7L 5I71B 4P2OC 4BSJA 5GRJL 3MNWB 3QXDA 1OAYH 5EG6C 5IQ9B 3OMZA 2H8PB 2O5ZH 3OJDA 2UWEB 1VEOA 3HE6C 1HCVA 4EDXB 2C1PB 3H42L 2LU3A 3N06B 3VI4F 4UTAL 4KY1L 1T20A 1QSZA 1YEIH 3MACL 2VLJE 3AC0A 3I6GB 2VDMH 2OR8A 5GGRA 1UCTA 2DQTH 1T1ZB 1AXTH 3TWCL 2VDOH 1DDHA 5FYJE 2QKIB 1EA9C 1NLBL 1ORSA 2HLAA 1ZVSB 3UZEA 5FGCE 1TXKA 4MJIE 3TBVB 4YGVB 5E5UB 4PJ7F 1JNHA 4X83A 2ARJB 1LO3H 4KRNA 3OG6B 3O3DA 5IFHL 3O6KH 4GG8A 1L0XA 3HC3H 4MJ5B 2QQLH 3WS3B 4OI8A 3N9GL 4OZFB 1OTUD 1HH9A 5IG7A 2NTSP 1PW3A 4C56D 5EU7E 2WQ8A 1XF3B 4YHIB 1DLHA 2K1MA 3LKQA 2W59A 1G7JA 1N59B 5F1IA 4YDLB 1QP1A 1C5BL 1JNNH 3MRQA 4UBDC 5IK3B 2OL3A 3GRWH 5KSUA 5GGSA 4CMMB 1FZKB 3MLVH 5SX4I 3KLDA 1JZ3A 5DK2B 3BKYH 4I18B 35C8L 3IU4L 4HV8B 4DQOH 1T7WA 4RX4A 4X7SL 5HI3C 5T5NF 3NIFE 4PS4H 3KLAB 5EUKA 4M1CD 1E4XI 2ZSVB 1F4XH 4I0KA 1QSEB 3VI3E 1ZHNB 4XAWH 5DRWB 4H1LB 4FTVD 4KJYA 1M1SA 1ES0A 2AV1A 4XNXL 3KG5A 3LRSB 2ITDB 3MA7B 3MQIA 1NMCB 5IMKB 1JZ2A 4IRJC 5I2IA 4EI5B 3ARWA 1CFNA 3GMLB 3DMMC 1XF2A 2DM3A 5KS9A 3HNTL 3T08A 3RDTA 3KXFE 4RFNC 4RQQB 4NRYB 4Y19A 1WCQA 2DI9A 5I8KH 3V6BR 4AY0A 5I1AB 4DGYL 1CL7H 4LLAA 5GJSL 4JFDD 4GSDH 1H15B 4HIXH 1VHPA 2VWEC 5D7IA 3RTQC 3TC9A 5IOPB 3RIFK 1OF2B 2R69H 3UTTA 5IWLC 3CSBA 4BSVB 3MLWL 4PJFE 1TZGL 2XWBA 2CKBB 4U0RC 3ULUL 3KYMB 4PRIE 5HHVL 1GOHA 4PB9L 5FYLE 1FJ1B 3CFKA 1AGCA 1CICD 5D2NC 3AU1B 3FFCD 1G6RB 2FGWL 1Z9MA 4Y4KB 3QIUA 5IFAL 1MUJA 4PJ7A 3VH8A 4TUJB 4QYOA 5L2KE 4IDJL 4HLZH 4JGJA 5J7CC 1E4XL 3RJQB 5IBTL 1BIIA 4JPIB 2BSED 3O3AB 5T3XH 3RVXD 3FN3A 2DI8A 1T4KA 2XFXB 3B6SB 4P5KB 2WUCH 5HGDB 4TNVK 1H8NA 1KIRB 1XZ0A 2O5YH 4HUWB 2G75B 4FQ1H 1NGWB 4Q9RH 2J88H 2ESVE 1W0VB 4FQ2H 4MDJA 4WHCA 3FO0H 4LAQH 3E6FB 1HZHL 2YWYA 4NP4H 4P2RB 5AD0A 4POZC 1KEGH 2Q76A 4IDLA 4S1SH 3RVUD 1YMHA 1NLDH 5F3HB 5E2UH 4FQXC 2CGRL 4P4KB 3MR9B 4QRRD 3AY4C 3WLWD 2WBJC 1LQSR 4X6BB 2YD4A 1G7HA 3ZE2F 4OGXL 2K7QA 3QWRA 4D0CB 2AW2A 4S11A 3BT2L 2RR3A 1KCLA 5I16A 2E8YA 2NY7L 5I0ZA 4A6YA 2DMKA 2Y6SC 3MRMA 4QHUA 3UDWC 1AE6H 5EBGA 1FNEB 4J2XA 4RBPH 3NPSC 5BO1L 1N6UA 5GSVB 4LVHB 5LJYH 5I15H 2FBOJ 3GSOB 4M00A 3WHXB 2CJUL 2R4RL 4OIBA 1Q9WA 1MHCB 3NCYS 2IAMC 3P4OB 5I75B 2ZCHH 3VFMA 5A2KH 1TJIL 4EI6A 4JFEE 4PLNC 2W38A 4NHUB 1CBVH 2ZG3A 2D03H 1GOGA 1F6AA 3F7YA 3C6SA 4PBXA 1A9EA 1CZ8H 1CE1L 3L95B 1INDH 3DMMD 5F89B 4OD1L 3T77A 4OV5B 5DJAB 4JANA 1AHWB 3GI8L 4JKPL 4UNUA 1U8HB 3GI9H 4OIIH 4JZNB 5IHLB 4LAJH 3OB0H 1DVFB 1YMME 2DLHA 4S10A 1P84K 4GUPB 5JA8B 2XZQL 3DUSB 4JY4A 3TBSA 2VIRA 3M8OL 4OKVB 4U3XA 5EZJA 2XPGA 3H3BC 4LHUG 2OI9B 2IFFL 2AXJA 4WW2F 5E6ID 5BMFL 4X7TB 5T1KA 4PR5A 5CEZH 2VNCA 4L4TE 1YY9D 2VDQL 3JWDC 3UBXB 3GJFA 4JRYE 3QNZA 4ZUVA 5D2LE 1F3RB 4PB0H 4LSRH 4QHKI 4RGNC 4L3EA 1VACB 4HD9A 4Z5RA 2CXGA 4GMSH 3U2SB 5JHDD 3LH2H 1DSFH 4K7PY 3V6OA 1RJZB 3ARVA 5E1AB 3ZTJH 3KWWB 2RFXA 3V5HA 1IBGH 4OZ4A 1EJOL 3SE9H 1RUMH 1ITBB 1HHHB 2J6EA 1LO2H 2A6JB 3WIFA 5I9QC 3ZLQC 3JBG7 5BQ7A 3BRFA 5HVGB 4BH8A 3IU3A 2Q7NA 3I02A 2FATH 4XCCL 1YA5A 1JRHI 2XI9A 3GMOA 1BD2B 3BEVA 4K3DH 5EU5B 4EN3D 4PGCB 3IVKA 3L3GA 5D70H 2EIDA 5CJBA 3MGTA 3V5KB 4OD2B 5FOBA 4CL7A 1RI8A 1CD0A 4U1MB 5ACZA 3D6GA 1IAMA 2VSCA 1MJJA 1GGCL 2DIJA 4CDGC 5MENB 3DECA 3H3KA 3NFNA 1JV5B 2X44D 3RL1A 5DJXA 4N0UE 4KXZH 1FG2A 1CK0L 4Z7QE 1A7OL 2EEDA 1AGDA 5HSFA 1RHHA 4Z77B 3DXAD 3NAAL 1WIOA 1E6OH 4Z7NF 2VZOA 4R97C 3VMNA 2D7NA 1JPFA 4PJDE 4GBXB 5DK3A 43CAA 4LSTH 1DQJB 3OZ9H 1I1FB 3L3HB 4JQXA 1T2QH 4OAWB 2OMBA 3O0RL 1MREH 2VERN 1U8MA 3WXWL 1HSAB 4PGDA 1QVOA 5GSRB 1XGTA 1RIUL 5C0BE 2DQCH 5HHMD 1ADQH 1MNUH 3ULUE 4QKXB 5CJ5A 1QEWA 1R3LA 2QQNH 1ETZB 4ZS6D 5FKAB 4IOIA 2ZUQC 3D18A 2AJ3A 3QIBB 3VXNA 1HOCB 5KW9H 3EO9H 4UT6L 3CLEH 5L0QB 1Q0YH 4OLVH 1XMWA 3ARGB 2CIKB 3FT2A 1IGIH 4WRLA 2WV3A 3U9PH 1GZQB 2FX8H 1JUFB 3RVTC 1DQQB 4APQD 5K9KA 2BOCA 4NZRL 7CGTA 2D7OA 1YNLH 1YC8A 3FQRA 1HIMH 1FVDB 4O4YH 2XQYK 4ALAH 5KVGL 2CDGB 3O6MH 2H41A 1N2RB 25C8H 5IVNA 4HLZG 5I1EH 2AV7A 2J4WL 2JJSC 1P4BH 2DBLH 2NY2B 4P5TD 4CJ0A 5ALCL 3UTSB 1TVBB 1UKTA 4KPHH 5DUPL 4KK9D 3DRTB 1U3ZA 2P5WB 3U0WL 3ULVE 1OGTA 2ZWLT 2LVCA 4F58L 3B83A 2NY0C 2MFNA 3DGGB 3T2PA 5CHNA 2XY1A 1EAPB 2BDNL 2OP4L 1H3GA 1KTRL 4N8CL 5IFJA 4LF3A 4RISH 2QBWA 4X5WB 5E99H 2DTMH 3WE6A 4L4VB 3QWOA 1RVFH 4ODXA 2ZG1A 3BP5B 1KJ2H 3LHPL 5FECB 2HFFB 1LO5B 1QFUH 4U6YA 3QI9A 4WUUA 5E95B 4X9GA 3PWNA 1QQDB 1MLCB 1XR9B 1EIBA 2QLVB 2YKLH 4NUGL 4XCYA 5D6DC 4PJXE 2FO4B 2GJ6D 2FEEI 3I3DA 1NEUA 4LCIL 4MQ7B 4NNYA 5HYSA 5JR1L 5I8CB 3WKML 2G5BB 2ILLA 3Q3GB 2CLZA 2DIAA 2X4QA 3DUUA 3O6FD 3T0EB 4OLZH 3TVMA 3OSKA 5IW1B 2R1YB 3S7GA 1Q1JL 3GO1L 2GTZA 5TPWH 3RZCC 4X7DC 3S37L 3OPZL 4KK8D 1HHKB 3WYRA 2MHAB 3SDCA 4HGKC 3F8UB 4YHPB 5F7FA 1F4HA 3BQUD 4PUBL 4P2YA 3UTQB 5CP3H 3AROA 1G7LB 2KUTA 2PTTA 1QKZL 3CXDL 3RI5K 1V7NL 3VFWB 1A4KA 2PYEA 5IF0B 1YZZA 4Q0XL 4JREB 4KAQH 3JV6A 3BKMH 5M95B 1MLBB 4KKAC 5D1QA 3KPQA 4ELMB 1FLTX 5C0DB 3IDNA 3T1WA 4PJEB 5J0BA 1JGVL 2A38A 4LIQH 2O5ZL 3BISA 3HB3D 4X4XB 1ZLWH 3H8NA 3U0PB 3CX5K 1I85A 4HK0B 4U3CA 5MHSD 3OKNB 1YEIL 2VDML 4NO2B 3TFKC 3L1OH 3VGAB 1MJ8H 1W8NA 1D9KD 5F7MC 5FA4A 4RCAA 1AXTL 4QRUB 3ISWA 3ALXA 1IEAA 4NDMA 4MNHB 4KI5E 4JFHD 4LHUB 4Q6IC 5KSAB 4LCCB 3MRHA 3O6KL 3WIIH 3UZQA 2XACC 3RHWK 3MLYL 1WC7B 4G80A 1A6WH 2FRGP 4F80A 3ZTJG 1FYTE 2Q87A 1A14L 3QAZB 1I1AB 2HP4A 5DUBA 1HDMB 1IC5L 3NZHH 3V7AG 3S8WA 4XTRC 5J56B 5JW5A 3BDYH 2Z91B 5ELIA 3VXUE 4LLVA 4F7CA 1DTUA 3HG1E 4NQXA 4YC2B 1EHAA 3VH8G 1SYSA 3QDMA 4OFYA 4KK6D 1YJDL 1MJ7H 3BKYL 4AM0B 3SPVA 2PTVA 4KTDL 4PS4L 3MO1B 4YK4C 1SVCP 3K74B 2UYLA 3FRPA 3O11A 2OTWA 3C5SB 5CSGA 4JVWA 3C8DA 5L6YH 5TE6H 4GT7A 4J3WA 5GHWH 2DWEA 1I8IA 1SBSL 4RIRB 2NY4B 3LPGA 3MRPA 4Y5XC 2OQJA 2DM2A 5E94B 4LARH 3EJJX 1IAOB 2YD1A 5SWSB 4URTB 4I3SH 3FFDA 2DKSA 3JVGA 3D87B 12E8L 5D9SA 1A9BA 3AM8C 2E7LC 2C1OB 3VW3L 1R0AL 3QUXC 5GGQL 1NAML 3MV9B 1CL7L 3GEWB 4GSDL 3KNBB 4HIXL 4JKMA 1KACB 1KPUB 3VFPA 1PJ9A 2R69L 5HI5C 1KENL 3B2UD 5DQJB 5JORB 3H0TA 1FFPA 1WF5A 4OD3H 1BQLH 2CIIA 2Q8BL 3LDBC 4ZAKA 4G7YH 1B4JH 3HC0B 2I5YL 3HFMH 3BDXA 3GSNL 3KPRE 1KPRA 5GS1A 3IFPB 4U49A 4P2OA 4DGIL 2EDRA 3C60C 4U1SB 3QDJA 1SY6H 3UTTD 3KPOA 4NNPH 3N1PC 1SEQH 1ZA3A 4X9FA 4E0RB 3HE6A 3OAUL 1X7QA 1WBZA 2WUCL 2DJSA 5TE4H 4WFHE 2O5YL 3WIHA 1AY1H 3OR6B 3ARFA 2J88L 2YPKB 3OKLA 2CK0L 5DO2C 4NUJA 4LAQL 5K9QI 3T09A 4BH7B 4NP4L 1KEGL 1U8PB 4R0LC 4S1SL 1J1XH 2ZG2A 5E8PA 4TTGA 3DSFL 4MX7A 3K8LA 1MY7A 5HYJB 5HGAA 2ZUWA 4XP5H 4L8DA 2A83B 2OR7A 3CCHB 5GRVL 4AQ1B 1BMGA 5FO7B 1IM9A 1TLKA 2DQIL 1M7XA 4J8RB 5EC2A 4PRNA 3OJVC 4LASH 3ZYOA 4NCC1 2GY5A 5I66A 4TOYL 2IPUG 1UXWA 3D0LA 3MLZL 3ILQD 1MAML 3MJ8A 2BX5A 1AE6L 5HHQA 3PGCA 2VLJA 5F6HI 4TNVF 2X4SB 5I15L 1BX2B 4X6DB 4D0BB 1V3JA 3TGXA 1EEUA 4FQLL 1B90A 3RGVC 4UQ3B 3F12A 1E4KC 2ZCHL 4JO4L 2P7TA 2PXYD 1KG0B 5EN2A 3WFZA 4ZPVB 1HK6A 5IMLA 5KG9A 2EXYD 1BFVL 3KYNA 1CZ8L 2GSGA 2PW1A 5C0CD 4RGOH 4IRJA 1INDL 1FPTH 1FNFA 1ZS8B 3RWEA 5F7DA 2FJHA 3CLFH 3G6JF 4OIIL 1GCFA 2I9TA 3NCMA 4MNQE 3RPKA 3CU7A 1I9IH 3L7EB 5HHOD 2HJLB 4JRXA 5IBLC 1HXYB 3GBNH 4NN7C 4PP1C 4HIJA 1A3LL 1MHEB 5IWLA 3RBSA 2ADFH 4YHNA 2ZZUT 5DHYA 2N56A 3BH8A 3GMRB 2OTPA 3MV7E 3LKQB 5EUOE 2EO1A 2WNGA 3FB8A 3B3IB 5H2BA 1UYWH 4HPOH 3GIZH 1Q9OA 3DRQA 1Z9SA 2QEJA 3MODL 1MI5B 3ARDD 2FEDC 4HH8A 4LSRL 3TN0A 2R0ZL 4BZ1L 5GRXG 3PP3H 4LCWE 4U6VL 3V52H 4UIKL 4PRHA 5C07D 4PD4K 2JCCB 4NQDD 5T1KD 3S34L 4NJAH 2B4CL 5ENWA 4IM8A 1A3RL 3KXFA 2D0GA 1S78C 2YUWA 4HG4K 1ZLUH 4P49A 2ED9A 3C6LC 4PRBA 1WBXB 5GGVH 1OSPL 5C0GB 3Q5YA 3T3PE 3WFDH 3DVNA 4ENEC 3SJVA 1H3TA 1RZIA 5D96B 3PDOB 4NRXB 5I2IB 3ORJA 3BGMA 1Q72L 3F6LA 4ZTOL 4NZUH 4XAKE 4DK3A 3HUJE 3C5JA 1EZVY 4ZFZB 2Y06H 4ONFH 1A1OB 3W0WD 4FQXA 4FQCH 3D3VD 3QUZD 3QCUL 3SCMD 4NQED 1A02N 4Y19B 2WBJA 4GQ9L 3KJ6H 3BGFB 2J8UB 1MWAA 3BWAA 1AI1L 4LOUD 1IILE 2PNDA 2NTFB 5E9DE 1MHPH 5DS8A 8CGTA 5I30H 3MLXL 2NY6C 2P5EE 5L2KA 3GM0A 2EH8H 4IOSD 5I1DB 2YRZA 1M7IA 1BHGA 4YPGA 3JTSA 1A7QH 4KUZH 2JELL 2WQRA 1DEEA 4ZODA 5LCVH 3UDWA 4ZUSB 3VXPB 4GAGH 5K59F 4LRNH 3QFJE 2HVJB 3CPLB 4LSTL 5DGQA 1PEWA 4ZO8A 4O2EA 3QIUB 1G9NC 4XPGH 1N8ZB 4PJ7B 3VH8B 4QYOB 2IAMA 1CFQB 5F7EH 3RGVD 3V4VH 1A1MA 1CVSC 1EO8L 1QSFE 2EE6A 1Q9LB 1ZT4B 4KKBD 3VXSA 5E0QA 1IGYA 2HG5A 5EO0A 1NQBA 5KAQG 3A67H 2YC1A 3VDBA 1AGEA 3REVA 4QXGL 1PYWA 1U3HB 3PHOA 4KROC 1XZ0B 5D5MF 4I5BA 2EH7L 1JGEA 4QRSA 2QQNL 2Z31A 4OZIF 3NCEB 5ANMA 3EO9L 2Q7YB 4Z0XB 3VGFA 2GAZA 5AWNH 1BQSA 3V8OA 4Y4HC 1Q0YL 2HT2D 2GCYA 5IEKA 2EDDA 1YMHB 2P48B 3DYOA 4AIXA 2VXSH 3IDIA 5MP6H 4EVNB 2FX8L 2BMKA 2O61A 2D7TH 6FABH 3V6FB 1QLFA 1QNZH 4JFXB 4WI2A 1IL1A 1YNLL 4KRPD 5BRZE 4JQVC 4P59H 1FBIH 4U3HA 3X14A 5F70A 4LK4A 5JXAL 4LQ1A 3U0TB 1JCKA 4M43H 1I1YA 2DBLL 3BZEB 4PRAA 3FQWA 2FGZA 1N3NA 3H9HA 4PGEB 3EJYD 4NKOB 1EZVX 3GMNB 3OXSA 2VXVL 3O2DA 4XZUB 1U91B 1NEZA 4M9PA 3FQNA 5IROC 2ZOKA 4JVPA 4AEHH 4EI6B 2EKSA 2NY3D 2VQ1B 2AABL 3QEGH 3HRZA 3I75A 1ZAGA 2W9LA 4OUOA 3RNKA 4Y4FC 1S7WB 1HNGA 2P44B 2DTSA 4XP9H 3F7QA 1RURH 3T77B 4Q58C 3W9EB 4NO0B 1DZBA 3CFJB 2IALB 4LVOC 4HX1B 3UYOD 2GIYA 1WFOA 3KPSD 1EK3A 1HKFA 4HXBL 3O4LA 3PWUA 4G9DB 4JO3L 4U4BA 3LCYA 3NFPB 4JY4B 3OKYA 2VIRB 4HZLA 1UVQB 2HKFH 2XPGB 4NQSB 4K8RD 1SQ2N 2KKQA 4I77H 3RWDA 5JUEH 3DVGA 2GFBB 4LSPH 3RU8H 5D5MA 1ACYH 4PY8I 4X80H 4TVSa 2NXYD 1XEDA 2BXYA 3V79C 4OZIA 5FA3A 1RZKC 5FB8A 3RGHA 4Z78A 3GSRA 5C09A 4XP6H 3RNQA 1HINH 3UJJL 5INDA 1IVLA 4K94L 1HWGB 4QNPE 4PRDA 3SE4A 3RUGF 4GRLB 1KJ2B 3QR2A 4K7FA 1ZOXA 5D6CA 3V4PH 4MQSB 4C55A 1U36A 2RFXB 3BGAA 1EPFA 2F53A 3HMXA 5EU4A 3B5TA 4FFZH 3WIFB 3MA9L 4XBPB 4KAQL 2JB5L 3BZFB 1MCBA 5C08A 3IU3B 1VA9A 4XPHH 4N0UA 3I02B 1CYGA 1JI1A 2KDGA 4HUVB 2Y5TB 1TQCC 4XNUH 5FOBB 5CGTA 2HJKA 4U33A 1WTLA 4ODWA 4PJIF 2XZAL 3ZKQD 5DJXB 2BY0A 4RFOL 1MJ8L 4KVCH 2R2EB 1DBAL 5JNYA 1AGDB 4XH2B 5SWZE 5C9JA 1F3JA 5T3ZD 1KUMA 3KPPB 3T0XA 2VLKD 1P1ZA 3U6RA 3OWEA 4G9FD 2O26U 2JJSA 4LNRB 3RI5F 3S88H 4BQCA 1MFCH 1S5IH 3PXJA 1AR1C 4QXTA 2PTUA 4ZO7A 2APWA 3NZHL 4Z7VF 1VFUA 1UCBH 3QHTC 5EU6E 4JM2C 2NXZB 4PGDB 4WWKB 2ICWJ 3HNSH 5CILH 3V5DB 2OR9L 3JWDH 4LVNB 3T65B 2VRAA 4JO2L 5KANG 4M9OA 4WW2B 4NN6C 4MLSA 1K4CA 2PO6B 2XN9A 2FIKA 1A7PH 1QEWB 5FYKU 4X98B 5IB3A 1H3XA 2H32A 5HVFB 5L88H 5IT2H 5EOTA 1RK0B 4YHKH 5ICYA 3QXWA 1YNKH 4Q9CA 4Y1AA 4FFYH 3O2DH 3RP1A 5TE6L 1LD9A 3U4EA 5HBBA 2VLRB 3GBML 2YZ1A 4M7JH 3FRUA 2BY2A 4OZGF 3MJGX 5DRXB 2MJWA 3WBDA 3RUGA 1PSKL 4ZFFA 1X9QA 1ULVA 2APVA 3PABA 2V2XB 1J0HA 2QADB 5B21A 3BKJH 1UACL 5TQ2L 3RZCA 1E27A 4F33A 4NQVB 3TBYB 3IT8D 4M6OH 4ZQKB 2D9QB 1MY5A 2ICCA 2YPLB 2HT4C 5DEFB 4H5SB 4C83B 2VZUA 1U8JB 4OF8A 4LSDA 3MOAH 2EO9A 4OB5H 3FB6B 3T2QA 1ZT7A 3SDYH 3VRLF 3MRJA 3R0MA 4O02L 1BQLL 4Q9BA 1P7QB 3DROA 3MRBA 2E27H 2XTJE 3ALWA 4Z7UF 1BFSA 4PJIA 4G7YL 1SJHA 1B6DA 3QULA 4HWZA 3QJFA 5IFJB 1OW0C 2NNAA 2C3VA 1T1XA 1SY6L 5MEOA 1JZ7A 2V17H 2XWJA 1G7QB 3VWJC 5BS0D 1YEEH 2AEQL 4UQ2A 4QTIH 1GGIH 3CFBA 1PZ5B 4KDTA 2A0LD 4WI5A 4IJ3B 3SGJC 2CD0A 4QT5A 5IHUL 1P2CA 4Z7VA 2MPAL 1HQRB 3VFSB 5KVMC 3F62A 1OP5K 2EIEA 4BFIA 5CD5C 2GTWB 1CS6A 3DLQR 2A6KA 4NO5B 8FABA 1RZ7H 3MRLA 1F13A 2FX7H 1J86A 4Q6IA 1NMBH 3NN8A 4O5LL 3QHZH 1DE4A 4E5XA 1CFVL 1RY7B 1IC1A 1KJVA 3IDUA 3U46B 4OZHB 2E6JA 4X7FC 1JYWA 4LLDA 4NQCD 5DSCA 4P99A 3ARFD 5J89A 5T1DH 3F7RA 4LPTA 3IDXL 1XF5A 2MWCA 3QEQE 2AXHA 2DRUA 4F37F 1DBBL 4WO4B 1UJ3C 2P24A 1S7SA 4S1QL 3BIAX 4P3WA 1QA9A 2Q3ZA 4OI9A 4F57L 3B5GA 2YD7A 2ED8A 5D1QB 3FHQA 3QDGB 4JVUA 4HEME 3FCTA 1ZXQA 2B0SL 3HAEA 5AYQA 1EDQA 4U1GB 2GITA 4N0CC 2NZIA 2BVOB 3IB4A 4Y5XA 5EOCH 1T2JA 1Y6NR 4QHLB 1LP9B 1XIWC 2FSEB 2VLJD 3GKWH 4HIHA 3VG0H 5KVEH 4G6AD 5E56A 3BZ4A 2UV3A 3PIQA 4J4PA 3P0YH 1J1OH 3CLFL 4X4ME 3UTZA 3CXHJ 2E7LA 5FYJD 4IRSB 5DEGB 3VXUA 4Q9QH 3BIKA 2EDHA 1HHGB 1I7TA 4MJID 5DR5L 1I9IL 3IDMB 4XPFL 3MRHB 3G5VB 1NDMA 1V3LA 5KN5A 3K46A 1L9NA 3IFOB 2JIXA 3FQUA 5C6WH 2HAZA 2R9HD 4FN0A 5F72S 5DJ2A 5GJTH 3O8XB 2IPTL 2KZ1B 4PJ5A 3CH1A 3SDDC 1YQ2A 5I76B 5GIRA 4HPOL 5GS0D 4NFCA 3W11D 2GJZB 3ARUA 3O9WD 2V5TA 5DQDH 2BNQE 1ZLSH 4G8EB 3TPKA 3LN5B 5I71C 4W70A 5FYKH 1NBYA 4W6YB 4NWTH 4CW1A 4AENA 4ZFOL 5F88B 4LLQB 1ZTXL 1Q0XH 3H9SA 2UYLB 3O11B 2DYPB 2NYYD 4HJGA 3WXVL 4R4BB 4NJAL 4KWUA 3RVVC 5C7XH 1ZLVH 5E6ZA 1NCCL 1NBZA 1JVKA 1Y6KR 4ZYKA 3BJLA 5C0EA 3EO0B 3STBA 3VRJB 5GGVL 3TN0D 4LKXB 3A6CL 3VXME 4L8BA 4LU5H 2EDYA 5BV7L 5I1CL 1C12B 4NZUL 4PRHD 4R0LA 1XR8A 1AO7A 1FNGA 1S3KH 2V7NB 2W1NA 4YUEH 1LE9B 4UDUA 4F3FA 3KXFD 4YNYB 1MEXH 3BVNB 5I1IH 1DP0A 2XY2A 3MV01 3ZE1F 4HC1H 2GK0B 3SJVD 3DX6A 1T04B 4X5XA 2Y25A 3MLRH 4V1DA 1NGXA 1NFDF 4CVWA 4EDWL 3BP6B 2WINA 3U1SL 1U8NA 4PRID 4ZAKB 1DUYA 2L0DA 4HHAB 4PTUB 1QRNA 1FVCB 2MSPA 3LKOB 5FYLD 1NBVL 4LRNL 4LPCA 1A7RH 1CICB 5DYOA 1J7VR 4JJ5B 1T5XA 5TFSL 1T0PB 4E41A 3L5WB 4P2OB 4JY5H 3KPLA 1AGFB 3R8QA 2E3VA 5L2KD 3KPOB 5BJTB 2KH2B 2UZXB 3MNZA 4L29B 3HE6B 4X6EA 1X4YA 3TO4D 1EHLL 4YPJA 1NMCC 4R7NB 5EIQA 3D39B 3E0GA 5EIVA 1T21A 3DTXB 4ZUUA 3T2OA 3MRFB 1TNMA 2JK5A 3TM6A 3L3IA 1CGWA 3P9MB 1GRWA 2ESVD 3T0WA 4XPBH 3TYGL 4CU8A 1A1NA 4DZBB 3ZYIA 3LKNA 5FFLA 3KPNB 3EFDH 4DKFH 5H37H 3MYJB 1LNUA 1L4IA 4OCRL 5D93C 4J1UA 3GHEH 2VE6A 4XBEH 4L8DB 2DQJH 4L8SC 3MPCA 4X6CF 3D69A 2DD8L 1IM9B 2FR4A 2AQ1A 1OGAE 4WI3A 5J13B 5AUMB 5LGJA 4GLRI 5SWQA 3HZMA 2WM0A 5I66B 1JIBA 3D0LB 3L7FA 3T0DA 4TUOA 3MJ8B 4G6JH 1DJSA 3ILPB 1TTGA 5BVJB 4PJ9D 1E4JA 4XB8A 3VXOA 4YFLI 3QUYD 5DJYB 5CEXB 4I0CC 3DV6A 3JWOL 2OSLA 2R23A 3CDGA 4O58H 2NMSA 3MRCA 4GKNA 3S97C 5ITFB 4GG6E 3EHBD 1CLOL 3QQ3A 2CO7B 5KSBF 3F12B 2W0KA 2BOBA 3F58L 4IOFC 4ZNEE 4DZ8B 3C6LA 5ISZA 3S4SG 4EEEA 1TJHH 1D5ZA 1FZJA 2YA2A 5JTWA 1NC2A 1HSBA 5TGBB 2PW1B 4AQOA 3ULUC 1RULL 3QUML 1NFDA 4XP9L 1RURL 3IXTA 3DMMB 1MIML 3PDDA 4NC2B 1JN6A 4MD5A 3TV3L 4CU7A 4NT6A 2EE3A 4P4KC 3QCTH 3WDJA 1KXTB 1ZHBA 5EUOA 1NGZB 1BM3L 1Q94B 3GHBH 4C56E 4RFNB 4UINH 4OCXH 3PWLA 4M3JA 2HFEA 4KRLB 4PJBB 4N0RA 5FV1L 1OT1A 3RTQB 4DVRL 4M62L 5E5RB 2QSCL 3OG4B 2DLFL 1XGRA 3GIVB 1AP2A 1EUUA 5DJDA 5EU3A 4HWBH 1AKJD 1NUGA 1WITA 2ATKA 2VC2H 3QG7H 4HEPG 4U0RB 5E6IB 5IKCB 2BVPA 4LSPL 4NC0B 5JW4M 3FB8B 5T1MA 1ACYL 4L4TD 5CBAB 2IQ9L 4X80L 5H2BB 1Q9OB 4U1JB 1T5WB 2EICA 5D2NB 4JRYD 3Q2CA 4FQHA 3LN4A 4QRPE 4XMLL 3BPCA 4NNXA 5DD1H 5GZNC 2MCG1 4FZ8H 5EULV 4XP6L 2ATPB 4OF3A 5IR1B 1HINL 1N64H 3D2UD 3CVHL 4MNGB 4L9LB 1AIFA 1KBGL 5C0ND 2UVFA 1RMFH 3HCVA 4U6XB 2XQBH 1J8HB 2RBLA 2FJFB 3DX9B 3GMMA 3NABH 1KEMH 3U9UA 3V4PL 5C0IA 1L7IL 3C5ZC 3WFCH 1T0MB 1ZVYA 4FFZL 2ENSA 4PRBB 5C70A 1XF1A 5DJ8B 5EPMB 1EXUB 2Z8SA 1KFAH 1S7RA 2P5EA 3GDBA 1EMTH 4FG6C 4MJ2A 4DVBA 5HVHC 4WV1C 4Y4HA 4EN3B 3FTGA 1LE5B 1YY8A 1OOAA 4FQXB 4OM1H 2FLRT 4MD4B 2VITB 1NSNH 3BDBA 3STZB 1UM5L 3BWAB 1FV1A 5FO8B 1BIHA 3H3PH 4O9HH 5KSBA 4JQVA 5C08D 1DLFH 1FNHA 1F97A 4HBCL 3QFDB 1E28A 1JHLH 2MOVA 3QWQB 4DGVL 5LKNA 1M7IB 3BWUC 4LNVA 1YYLH 4ZSOB 4JB9H 3DXAB 5K9OB 5L8KB 1ORQA 1R5VA 4EKXA 4F7PA 3G04B 3BJ91 1IAII 3VJ6A 1S5IL 1NAKL 3C08L 1NC4D 1EV2E 4I13B 3GSVA 3G6JB 4KKCD 4O2EB 3FO2A 4ZTPH 4PFEA 1UCBL 3NIDE 5SV3A 4OGYL 3HI5L 4OCNC 4OM0H 5CILL 1C8PA 3VXSB 5GZOC 5EO0B 3R1GH 4LBEB 4K55A 4JHAH 5HHMB 5ALBL 1IGCH 4KVNH 1FGNL 1AGEB 1R5WA 1CIDA 2CDEA 3PHOB 3QO0A 4XB7A 5FM4A 3VA6A 3ULUD 2X41A 3ZHKA 2EEBA 5C0AA 3KGRA 4ZD3H 2ZKHH 2AEPH 1MCCA 1ZANL 3DHMA 2H2SC 4KHTH 4QRSB 4QRRE 2ZCKH 5B3JF 5ANMB 1VADB 1UWEH 1I7UA 4OJFL 1HHIA 5JQ6L 3GUTA 2FO1A 3L3DA 4JM2F 3UXFA 2XA3A 3H2WA 4PJGA 3ZKMD 4BKLB 4P3DA 3PHQB 2A74A 2O61B 2DQGL 3CC5A 3WKNA 5TH2A 1HHJA 4APQB 4CADA 1JHKH 4CJ1A 1U8IB 3BKJL 4PIRF 4GQPH 4K3EL 3X14B 5HGHA 4ACPA 4Z7WF 2GK2A 2Y7QB 2NY5H 4YEEA 2BSRA 3KR3H 3GGWA 2X4UA 4KI5C 1B2WH 1I1YB 5ECJE 3QZWG 4PRAB 4N9GA 1IAIL 3MOAL 3FQWB 5HYQA 1LO4H 1KYOK 3PWPA 3SDYL 4PJAF 1A2YB 3VWKD 4Q97A 4K8RH 1K6QH 2R29H 2X4PB 3S35L 3QEHB 3ULVD 2PETA 3UTSE 3ARXA 1NGQH 1OAUH 3MRKB 5A2LH 2Q8AH 2P5WE 4LCUB 4M5YH 1RZGA 3DX8B 4P5MA 3HRZB 4MXWL 2VZ1A 4R4ND 5L7XH 1MFDH 5H37G 5IGXH 3RY6C 3K7UA 5L0QC 3ARGC 2V17L 2AK1L 4MA7L 4FA8A 4QTIL 3T3MF 3QNXA 5D7LB 3B9KD 4U1IA 3QH3B 4LDLB 1E4WL 5CCKL 3ROLA 2AAVA 1G7MA 1KCRH 5C2UB 2R0WL 5F3BA 2X9XA 3P9WB 4KJWC 2GJ6B 4HZLB 4L5FH 3FT4A 3EGSB 2A6IB 1JMZA 2G2RA 2OZ4H 5DD6B 5IVZA 3RWDB 5DJCB 3M17A 3QISA 1RZ7L 3RY4A 1R5IB 1NMBL 5LWYL 4JDVA 4MA1B 5F71A 4GJTB 2NY2C 3A6BL 2IMMA 2IANA 5J1AA 1NCBH 4P2QE 1C08A 4HGMA 1T1WB 3GSRB 5D72L 2JTDA 5C09B 1BQUA 3WFHB 3RNQB 4UUJB 4PRPE 3RWFB 2UZYB 3UJTH 2R1WB 1XGQA 4XWGH 4JM2A 4ONOA 3QNYA 1P5VA 2DJ4A 3EYSH 3WFBL 1SJVA 1KIQA 1IGJA 4OLWH 5T3ZH 3B4NA 2X10A 2F53B 2VOTA 5EU4B 4OLUL 4HXAL 2Z9TA 5FYJU 3VFOA 1A0QL 2WANA 4AMKH 1SBBA 4WNQA 1S9WA 3ALPA 4L8CB 2X1WL 2LU4A 4Z7WA 5E2WH 2H9GA 2ZUQB 1TCRB 3VFTB 3MXVH 1V7MH 3SKUD 3IYLW 1UEYA 1KTLA 4NM8L 3NCBB 3VE0A 5JW4N 1P7KB 3SDXB 2F9BT 4Y8AA 2FYYA 1CXFA 2QQKL 4XCEA 1WZLA 3IETA 5ICXA 4ELME 1JP5A 4HH9B 4PJAA 4ODWB 4JFFA 5GRUH 3SGDH 3GKWL 1MCPL 2CO6B 3VG0L 2UUDK 1BVLB 1D9KB 5EU6A 1YYMH 4QRQA 4XXDA 1F58L 4WDIB 4YGAB 1RJYB 1P1ZB 4Z7OE 3SY0A 3VXRA 3WDIA 3U4AA 4KZDL 3P2TA 3SOBH 3H7LA 3I84A 3MGOB 4W4OC 5JPNA 3WO3B 4HWEH 3CUPB 5GJTL 5DLMH 1EHXA 1MCFA 2C5DC 2WWMC 3HI6L 5DURD 2QL1A 4R7DA 4JN2B 3MCKA 3QB7C 4PPTA 4JREC 5D7JD 3QDHA 3TO2A 1X5KA 3VXUD 1RZKH 3HG1D 1TZHB 1QLRB 1T6VN 1EGJH 4DJMA 1OAZL 3REWB 1PG7H 2XN9B 5EORL 4HKXA 4KK5D 2DS4A 4NC1E 4U6HA 1Q0XL 4FMFA 5FUZH 3VXTA 4I3RL 1BJ8A 4LLMB 1JTTA 3QHFH 3VFGH 3T4AA 5ADPL 3N1FC 3SGJA 5C7XL 2ZPKL 5MEPA 4MVBC 5A40E 2YPVH 4TVPH 3K1DA 2YWZA 2FJGA 3RUGB 3TIDA 3O45A 3W81A 1ZA6A 2AK4A 1TZIA 5IJKC 3TBTA 1IC7H 3QUKA 5KSAC 4LCCC 3PG2A 4YUEL 1AFVH 4X99B 1D6VH 3PJSB 5EFIB 3DETC 2UWEF 3QEUB 4Z6AT 3INUL 5GRWA 5J9PB 1MEXL 4LPVA 5B22A 3SGKC 5KZCD 1AJ7H 1INEH 2DWDA 3JV4A 4HF5H 2HMID 3MV9E 2P47B 5E8EA 1ZT7B 3QG6A 1LEKA 2BNRA 2UVEA 4HKJB 1AO7D 1LHZA 1UJ3A 2EZ0D 1OB1A 2MQ3A 5D1XC 5DFWH 2QV2A 1YDPA 4PJIB 1ZHLA 1KB5H 4HFUL 4R90H 1SJHB 1T89C 4ODUB 1FIGH 2YRPA 1BZ9B 3S36H 1U8LA 3QJFB 1D5IL 3KPRD 5DJZB 4JFPB 3MBXL 3PDGA 1ONQB 1T1XB 2F54A 3RKDD 4JY5L 4WENB 4XP4H 1Y18A 3X11A 2XWJB 4Y16C 1KIPB 1GAFH 4O2CA 5I1HH 3MRGB 5IVXE 2VISA 2NY4C 4R26H 5D1ZD 2YD2A 4Z8FH 5CP7B 5LG1A 1P2CB 5I17B 5KSVA 1S7TB 5CGYC 1XIWA 3GMQA 2IPKB 4WFHD 2LU7A 4MWFB 1BZQK 1E6JL 1WQVT 1XCQB 3QJHA 5LXGL 3D1MC 3LRHA 1FO0H 4N0YH 4DKFL 3AMKA 5ETUA 1DE4B 2PN5A 1G1CA 4GW5B 1MCQA 4A6YL 4CVZB 1BFOA 3T0BA 1UADC 2YOCA 1Z2KA 43C9B 3JTTA 3W9DB 2VUYA 3M1BB 3CDYA 5DSCB 2E6QA 3LMJL 3IKCA 5JIPA 4KUCF 5HYJE 3SDDA 3S9DB 3AGVA 3NGBC 4Z18A 5EZLA 3MLSL 3QZWB 4OZGB 2ARJQ 5FYJH 4KHXH 5D71L 1WWBX 1G7IA 1S7SB 1NCAL 5EOQL 4QCIB 3MNWA 1F2XK 3UPAA 2NX5A 4WEUD 4NBZB 4YK4B 5IQ9A 2H8PA 2CLVB 2UWEA 1KC5L 1T83A 4EDXA 1KF9B 3FCTB 2FX9L 3BH9B 3I6GA 4HUNB 4I4WB 5AZEH 5EC1A 5DVMA 4X6DE 2AJSL 3DVIA 1T1ZA 5L9DH 2QKIA 1FFRA 4Y5XB 3JWNC 1ZVSA 5C0CB 3TBVA 4GS7B 3E2HB 5C2BH 2ARJA 2X1OA 4Z7UB 5LGHL 5HDQH 4D94A 2Y36H 1KELH 4ISVA 4KKLC 4D9RE 3QCTL 5JA9A 5DI8B 3DETD 4MJ5A 2J1KA 3TCXA 3QUXB 4MA8L 3BIKB 1I7TB 1F6FB 4CGTA 5A3IC 3BAEL 4MNQD 1XF3A 3MSPA 4D9LL 3NTCH 2VABB 3TJEH 1NDMB 1CDUA 5CBEA 3FQUB 1N59A 1IAIM 1J11A 5IK3A 1KPVB 3VU2A 3IRPX 4N1HB 4OBRA 4CMMA 4DFIA 1FZKA 2VC2L 1JPSH 3CH1B 1FLRH 3MV7D 5DK2A 3L5JA 4I18A 4HV8A 2A9MH 4JN1L 3WFEH 1JNLL 3KLAA 5CJOH 5GRVK 2ZSVA 4DCQA 2VJXA 3ARZA 5DD1L 1CD8A 1QSEA 3MCG1 5DRWA 4H1LA 3C60B 4OGAD 4LCWD 4MGXA 2X4NB 5C07B 1JF6A 3RJDA 3LRSA 4NQDB 2XA8H 1D5BB 2ITDA 4UTBH 3MA7A 2NR6D 4RBPK 3FZUD 5SX5K 3WFCL 4ZYKB 4EI5A 3GMLA 5EA0L 4DTGL 2ADGB 3ULSB 4CNIA 2B5IB 4DN4L 3U48A 3LEXB 5TF0A 4RQQA 4NRYA 3KPMB 2KZWA 2Y07L 5J6HB 4XMPL 3W82A 5I1AA 1NGPH 2W0LA 4XAKD 5DVOA 1H15A 4R2GD 1OF2A 4NQEB 4DW2H 4DN3H 4BZ2H 4I2XB 4HZAA 5IV2B 1NSNL 1BGXL 2A77H 3MJ9H 4ODHL 4JY6A 5KS9E 4RGMC 5JDSA 4OI7A 3H3PL 4MMZC 1MPAH 3KYMA 5E9DD 1LDSA 2AERT 5DUML 1WT5C 4R6UA 4Y19E 1CLYH 3NFSL 1NCNA 5JW3L 1FJ1A 2P5ED 3OB0K 3AU1A 1QBBA 1G6RA 1NGXB 4Y4KA 5CJQH 3TP4A 2WINB 1KGCE 4OLXL 4WWID 1ZT1B 2XXCB 1VCAA 4TUJA 2Q3AA 4JPIA 2J3SA 4OGZA 3O3AA 3VI4E 1ZGLP 3QXVA 3J8F7 3QFJD 4HIEA 4YXHL 4ZTPL 2XFXA 2LAGB 3B6SA 4P5KA 4MAYD 4YHOH 3EOTH 1U95B 5HGDA 1U3YA 4NFDA 2DBJA 3RGVB 3WUZA 3B9DA 4OM0L 4P23D 4XWOD 1GGYA 2G75A 3RVWD 1NGWA 1QSFD 4YQXL 2YK1L 3R1GL 2H1PL 1W0VA 4PJ7E 4X6EB 4HS3B 3E6FA 4P2RA 2JK5B 1IM3A 4S1DD 4BQ6A 4RAUB 5F8RC 5F3HA 4P4KA 1T0NB 3C8KB 3MR9A 5DT1H 1NCDL 3BSZL 4P4RB 4F8TA 1UWEL 1JZ6A 3FMGH 1CXEA 3MNVB 3BGFC 1LO0H 4MXVF 1Z5LB 5IM7B 1YEGL 2JKXA 1RIHH 1YQVH 4UU9B 2NW2B 3B5HA 5CUSL 2C3HA 3U36B 2RIKA 1QR4A 1F8TH 4Y2OA 2F5AL 2IMNA 4HJJH 1CR9H 7FABH 3D69B 5JXEC 5DMGD 5LQBL 3FONB 2FR4B 2B4CC 4MCZB 4NOBA 2I07B 2BVUA 2VDLL 1FNEA 5BRZD 4WTZG 2MKLC 2WUBH 3VD7A 3MOBH 5CINH 2NY5L 4ZNEA 3WHXA 3KR3L 1VB9A 2NZ9D 1RQ5A 3GK8L 2B7DT 3P0GB 4WY7H 4IS6B 4ZPTB 1Q38A 1MHCA 3BN9D 3CDFA 2J8OA 3P4OA 1F45A 2I60H 1GOFA 3VXOB 4Y8DC 4PJHB 1LO4L 1AD0A 2ADIA 5KBNC 5D8JH 2W9EL 1IKFL 2R23B 3DX7B 4NHUA 4K8RL 1K6QL 3C5ZA 3H42H 1Y6MR 4J3OC 1U3HC 3L95A 1I8KB 1UFUA 2WIMA 1NGQL 2BOBB 4YBQC 4OV5A 1EX0A 2Q8AL 5DD0H 5DJAA 4TRPL 3C6LB 3LD8C 1MJUL 3TWCH 1D5ZB 1FZJB 1NLBH 3BKCH 1U8HA 3CFIC 1HSBB 4KI5F 3RX7A 2DQUL 4JZNA 2NW3A 1VFBB 1YPZF 3G08B 2ICWI 4MD5B 5D7SL 5IFHH 1DVFA 3O41B 3DUSA 2ADJB 3NBNA 3KAAA 5T33H 4BELD 3N9GH 5JMRA 4NPYB 4X7TA 1A64A 3RIAF 1T7ZA 2NY6B 1XGRB 1ZGLB 3UBXA 1C5BH 5BZWB 2OZ4L 4HKBB 1FC1A 4H8WH 1GC1L 1LGVA 2HTKC 4FP8L 4DKAA 4YZFF 1VACA 3D85B 1GL4B 5T1MB 35C8H 3U2SA 3SGEI 4HT1H 2D7PA 2VR9A 4FQHB 4H0IA 3F65A 2W0FB 3KWWA 1T7VA 2XKSA 5IESH 5CD3A 5GS2D 4XWGL 1HHHA 1MCSA 1EEYB 3EYSL 1VGKB 4L3EE 1PKQB 5T3ZL 2BVQB 3ES6B 1A5FH 4PJ8C 4X6CB 1I75A 4JFZH 1X5YA 5DD3L 3EDJA 4JE4B 1BD2A 5EU5A 4PGCA 1I4FB 2ERJC 3MV8A 3ET9F 3HNTH 5T1LB 4OCMC 3ZT6A 3V5KA 3IF1B 3ZE2E 4U1MA 3G5ZB 1RZFL 2VL4A 5MENA 3I6KB 4DGYH 2Y1VA 1YEFL 1JV5A 4M1GL 4GFTB 1YY8B 32C2A 3IGAB 3BRDA 3WEXB 2X4RB 4GKSB 2NLJA 5F6HJ 2YD9A 1TZGH 2AJUL 3ULUH 4F7TA 4NCC2 4YDIL 4TSAL 5IW3A 3PL6D 5KSBB 5HHVH 4K2UL 1U42A 2ICEB 5CEYB 4GBXA 5SWZD 2X1PA 1JGLH 4JAMA 5SX4H 2VLKB 3NOIA 1DQJA 2FGWH 2AP2A 3HI1B 5IFAH 1YPZA 5JZ7C 4G9FB 4IDJH 2Z92A 1JTOA 4GAJL 1HSAA 1E4XH 4HWEL 2XIDA 5IBTH 4GRLC 2CDFB 3QRFM 1I8LC 4WW1B 3FO2B 3GSUB 3UAJD 1TITA 5TDPB 1WBYB 5EU6D 2GT9B 3WJLC 3C9NA 3MRNB 1ETZA 4XC1H 3VXRD 1HOCA 4LHQB 1R5WB 4Y4FB 4OFIA 1HZHH 3QO0B 2XKNB 5DA0B 2PW2B 4LIQE 4B5EA 3RY6A 3K4AA 3ARGA 3QIWC 2CIKA 3MUHL 4HS6B 3X3FL 3QA3B 4LVOB 4KTYA 4HSQA 1GZQA 1BWWA 3QHFL 3W2DH 1JUFA 3FB7B 5KOMC 1DQQA 1H3PL 3ULVH 3L3DB 1YEDA 4OGXH 4KJPC 4XNQB 4K94C 4I9WD 5IIEB 2Q20A 1WZMA 2R2CA 3BT2H 3TNMA 2CDGA 1UWGL 3K81A 1HCFX 1N2RA 1QYGH 4KU1A 4PJEF 1CGSL 3JUYA 4JDZA 1AFVL 1D7FA 4HAGA 3CSYA 1TVBA 5BVPH 3DRTA 2CJUH 2R4RH 4ZO9A 4U0QB 3NACL 2E7MA 1AJ7L 4RFEB 1J5OL 3NCYP 1CIUA 3DGGA 4NJ9H 3BUTA 4WWKC 5HYQB 4HF5L 4P3CL 1EAPA 4QHMB 4LVNC 3PWPB 2YPLE 1FNSL 1KCUH 2YBRB 1MCIA 3U4BH 5DEZA 4X5WA 4M48H 4MAUL 1MRDL 1XGYL 1M71A 5HHPB 2JJVA 2RCSH 4TTDD 4L4VA 1CGTA 2XTJD 2ARWA 4R90L 2HFGH 1EBAA 3GI8H 4JKPH 1CDIA 5BOZG 2HFFA 3WIHL 3AAZB 4XP4L 3MFFB 4P57A 1RAMA 1GAFL 1QQDA 1MLCA 5IB4B 3TJHC 5BS0B 2XZQH 5I1HL 1TQCB 4R26L 3PP4L 4HFWB 5I8CA 2H45A 4J7RA 4Z7NE 5DQ9B 3Q3GA 3T0EA 4HCRA 3T04D 2QADC 3DI2B 2R1YA 3ME0A 5BW7C 4NO3B 4DUVA 5I74C 4WUUE 2VDQH 1GH7A 1IFHL 1HHKA 4HAFA 4POYA 4G8GA 5IVZB 5INCB 2MHAA 1FO0L 1QPPA 4YXLL 4JDVB 4A2LA 3EJZD 5F6IC 3VDAA 1D5MB 1KB5B 2IANB 2B20A 1GGTA 4W4OA 3UO1H 3UTQA 3NPZB 2IWGA 2BCKA 1G7LA 2NY1D 4RA0C 1UM4H 1N6QL 4NQCB 2VTFA 3TZVC 4XHJC 1QBLL 1EJOH 5IF0A 1T66C 4R3SA 4JLRB 5CGMA 1VKXB 3QNYB 2EDEA 2BNUB 4FQQB 3QEQD 3HHRB 5FYJL 4KHXL 1MLBA 3AXLB 3G5XB 4ELMA 4NN6B 5C0DA 4WNQB 4PJEA 1IKNC 3ELAT 4Z7WB 4PYHA 4X4XA 2PYEE 4HW6A 2CR6A 1KTLB 4HK0A 4IJ3C 1GGCH 1FO0B 2YSSB 6CGTA 4NO2A 1FFNA 3STLB 5GS0L 1CFSB 1VFMA 3TBWB 1CK0H 1A7OH 4QRUA 4ELKB 1RJLB 2EDWA 3HNVH 3P4MB 4MDIA 3OAYH 4MNHA 3D9AH 5IJKA 3TA3C 4OF7A 2CRIA 4LHUA 5KSAA 4GXUN 2EDBA 4LCCA 2W91A 3GSQB 5HHNB 1WC7A 1TQBC 1CVRA 1QO3A 5FHBL 5FGCB 2YMXL 4XRCB 4BFGA 5FUOL 1FFOB 4JG0L 4MJIB 4YXKL 3SY0B 3SGKA 4Y2DC 4LGSB 4MQTB 2VYRE 2XYCA 3LQZB 2Z91A 1RIUH 1RU9L 4U6TA 3VFUB 4IIQB 3CK0H 4MJ6B 4YWGH 2F74B 4JHZA 4OCLC 3MO1A 4M4RA 2XT1B 3O9WB 1KCVH 3C5SA 3GFUA 2BNQD 2VDKL 1N5AB 3EO1B 3PWJA 3KDMB 1JRHH 3FO1B 1RUKL 5BZDA 1KCSH 1L7TH 3VWJB 3QDME 4XNZC 1RUAH 4PY8J 1UJTA 4RIRA 2P45B 3T4AB 5E94A 4YHYC 3NCCB 5SWSA 5EBWB 3BP4B 4NZRH 3BFOA 4M8QA 5FYLL 3EYOB 2FJGB 4JFYB 2XQYG 5KVGH 4HUXB 2R15A 3OHXB 3GRWA 2C1OA 5MERB 2Q6WB 3VXMD 4GKOA 3MV9A 2J4WH 3MROB 2D0HA 1KPUA 2UY6A 4CVXB 5ALCH 1OTUC 2CSPA 5DUPH 4YBHA 5DQJA 3BUYB 4TNWF 4EI5D 5JORA 4QGYA 3U0WH 2JF1A 3AUVA 2V6HA 2DWDB 4RAVB 4X0KA 4WJ5B 3HC0A 2BDNH 2FDBP 1NL0H 5E8EB 2OP4H 2DQHL 3S98A 3RPIB 2W60B 2ZSWB 4N8CH 5DD5H 3ESVF 3ZL4H 4YJZL 1UJ3B 3EDDA 4I0PC 1S9VB 2CR3A 2PR4L 2AXGA 4M1CC 3CX2A 5JMOC 4H26B 5E8OB 4ESKA 2C7UB 3LHPH 2BY3A 4E0RA 5I8OH 3SDAD 3EOTL 3X11B 2BRRH 5IEHB 4HJ0C 2DIBA 4NUGH 3OR6A 2XG4A 2YPKA 4Y4KD 3TO4B 3QDJE 4BH7A 2YUXA 3WKMH 3EUUA 5KSVB 2X89D 4ZXBD 5H94A 4RDQG 2EIBA 1Z3GL 4YX2H 1Q1JH 3GO1H 5DT1L 2JCCF 5HYJA 3OPZH 5DHXB 2ESVB 1H3WM 3Q5OA 1MCKA 2BVTA 5CIPH 1LO0L 2A83A 3CCHA 3BXNA 5C92A 1GGUA 1J8KA 4U1LA 3RL2A 1OQXA 4J8RA 1F4YL 2GKIA 1JGDA 4IMKC 1IEHA 4X9IA 4FFWD 3CSPA 1CR9L 1QKZH 1C5DB 4PLJD 1V7NH 4WI7A 5F1NA 1OGAD 4Q0XH 1FORL 5I0DA 2AEWA 1S7UB 1CTNA 3MOBL 5CINL 2MQCA 1CICC 2X4SA 5I8EA 2DF3A 1BX2A 1FZMB 3I50H 3PGFH 1RZ8B 3H9YA 2J8UF 3MBED 4D0BA 4MHHG 5BV7C 1S7VB 4M7LT 2I60L 4PJ9B 3NVQA 2NX5B 3QUYB 1JGVH 4UQ3A 2Z8WC 2EC9T 2ICES 5D8JL 5IP4A 3RVXC 1KG0A 4PV8B 4PGBA 2VDPL 4ZPVA 4OLEA 1KJMB 3KPTA 4F9PC 1CF8L 5EC1B 1ZS8A 5DD0L 4NZJA 1BQHG 4JFEB 1MCJA 1I9RL 2CPCA 3BKCL 3RFZC 5FGBA 1MQKL 2BFVL 1WISA 4U1NB 3L7EA 3RVUC 2HJLA 1HXYA 4ISVB 1AXSA 3QPXL 1VFAB 3MLYH 1MHEA 3LIZH 5T33L 3WLWC 3SEPA 1A14H 4X4YB 3IFLL 1X6LA 1U8QB 1IC5H 3GMRA 5J13C 2WAHA 3GJEB 3JV0A 1A6UL 1YMMB 2M26A 5CBEB 5EZIL 1WT5A 3B3IA 4HQQL 5BOPA 1EO5A 4JRXE 1MI5A 4PJCF 3CMOH 1AKJB 2VWEE 3PQYA 4H8WL 1YJDH 1O7VA 4I0PD 1PFCA 4WEBL 2X6MA 4LLYB 4S2SB 2Z4QA 4KTDH 4ZG1A 4JZJC 4DCQB 4HT1L 5FUCC 3HMXL 4JRYB 2JCCA 3AS2A 3OF6D 2RQ8A 5D2LB 3SE3C 4QRPD 3LS4L 3LZFL 4RA3A 5IESL 3D2UB 4GAFB 4HJ0D 1FH5H 4QY8B 5CZVH 1R24B 2P1YA 1WBXA 2IBZY 4G8FB 1SBSH 4WFEE 4BK5A 5C0GA 1X4ZA 4MNGE 3HE7D 1A5FL 4FQJL 2E9JA 3PDOA 4NRXA 4PRHE 4JFZL 4CNIB 4M02A 1J8HE 4ZFZA 1EFXD 3N0PB 12E8H 1CE6B 1A1OA 4I48B 3TIEB 5E08L 3J7HA 3VW3H 1R0AH 5GGQH 1IJ9A 1NAMH 4Z0BH 2GY7B 2J8UA 2NTFA 5HDBE 4HUMB 3SJVE 4KZEH 5D93B 4NQTA 5I1DA 3JWOC 5IJVB 1KENH 1JI2A 5JLZB 4L8SB 4JY6B 5JDSB 5E6IC 1KTDB 1SYVA 5JXEA 1SVZA 3KS0J 5DJ0A 5EIIA 2Q8BH 1DQTA 1JZ5A 2ORBL 1YY9C 4ZUSA 3VXPA 1CLCA 2I5YH 2AEIT 3GSNH 4OT1L 1JGLL 2HVJA 3CPLA 2D31A 3ARTA 5ADOH 1F90L 4DGIH 1N8ZA 5DRNB 4L9LC 2YR3A 5JOFB 1CFQA 3V9FA 1WIUA 1OAQL 3ZO0A 1Q9LA 1ZT4A 2VKXA 1NC4B 2ZUSA 4PJDB 4OQTL 4HIEB 4I3GA 3CFEA 3OAUH 4ZNCD 3R06B 3ZE0F 2OYPA 1HKLL 3HPLB 3OKEB 1U3HA 1FRGL 3BP7B 4QXUH 4GBXD 2GW5A 3U83A 2QSTA 3G6JE 2J2ZA 2HN7B 1NDGB 4K3GA 5C0BB 3MJ7B 4YE4H 2CK0H 4XC1L 5JO5B 3EYVB 1K8IB 2Q7YA 4Z0XA 3I3EA 4UMGA 5HJ3B 1IM3B 3VXSE 4EN3C 3DSFH 4MHHI 1AGBB 1MH5B 4EVNA 1CDYA 4ODTL 3W2DL 2VR4A 3ULVL 3V6FA 3WL9B 1P9MC 4JFXA 5ANME 2DQIH 5FCUL 3CVIL 3QIBD 4NIKB 2WLZA 4ONGH 1ADQA 1DANT 1QYGL 5C1MB 3U0TA 4TOYH 1JPTL 3MLZH 1UKQA 3O3UN 1MAMH 2EYTB 3BZEA 5I19L 4WEMB 2X7LA 4HKZB 5ESAB 3VFNB 4PGEA 5CJXC 5BVPL 4NKOA 1I3GL 3GMNA 3SBWA 2CKNA 1H8SA 3HC4L 1LEGB 5SV4A 4NJ9L 2FNBA 4NWUH 1U91A 4FQLH 4XZUA 5C0JB 3M07A 4F7MA 4JO4H 5F7NC 1AD0B 2ADIB 3OTTA 4XCNA 3BD5A 1KCUL 3PV6B 1T1YB 2VQ1A 4RGNE 3VWKB 3U4BL 3SKNA 1OAKH 3VGBA 5L8JB 4M48L 3C5ZB 1EH9A 1BFVH 3ARBD