4HBEA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
b'TEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
total genus 14
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hbeA00
4HARA 4HBOA 4HBEA
chains in the Genus database with same CATH superfamily
1GPFA 1JNDA 1Q6IA 2KO7A 1JNEA 4DH0A 4Z2HA 2PPNA 3CHFA 1BKFA 1X6NA 4DWSB 2MLYA 3O5EA 3AS2A 2K8IA 4ODNA 5HW6A 4NNRA 3UF8A 4ODOA 1WB0A 2LGOA 1NWUA 3FAPA 4IPXA 2IF4A 2OLHA 5GPGA 2XP8A 4DRPA 2O9OA 3IKDA 2L2SA 3AROA 3B9DA 4GIVA 3RGCA 3WQVA 2D9FA 1NH6A 2F2DA 2A3CA 1W9UA 4R5EA 4Z2GA 2FAPA 1SR0A 2KR7A 2F23A 3I6CA 2XP6A 4L3NA 1HJXA 4NSBA 3WIJA 2DSWA 3O5RA 3KAIA 1D2KA 2ITKA 4W9PA 3RFWA 1D7HA 3WH0A 1QPFA 1E44A 3AS1A 4HBEA 3O5PA 3LUOA 2P4VA 1ZBVA 2RQSA 1JCHB 1ZBWA 1ZU8A 4HARA 1NMWA 3FY1A 1A7XA 4DWSA 1IX5A 1LL6A 4MSPA 2DPEA 1ZBKA 2XP7A 4JYSA 3KAFA 5DIUA 1HJWA 1LJYA 2WLYA 5I98A 1LQ0A 2RUDA 3EY6A 5HBFA 4DRIA 2UZ5A 4P8UA 2XPBA 2XP9A 4JFIA 1NWSA 3OOBA 5JH8A 4AY1A 2VCDA 2A3EA 4Q22A 2M2AA 1UR8A 1FKFA 4JFLA 1FD9A 2B5UB 1LG1A 4ODKA 2DG3A 3PRBA 3UQIA 1HJVA 2ZR4A 1C9HA 3ARVA 4DZ2A 1TCOC 1Y0OA 3AQUA 2EULA 1YW5A 4WJXA 1Q1CA 1ROUA 1FFRA 1W9PA 4L72B 4UDMA 4MGVA 3ALFA 3TC5A 2PV3A 3ARSA 2WK2A 1KT1A 1KFWA 3KCEA 1FKBA 4DZ3A 5HW8A 1XHGA 3G6LA 2FDMA 2G41A 3AS0A 4C02B 1K9TA 1HXVA 1H0GA 4W9QA 1ZCNA 2QF8A 2XP4A 4Z2JA 1GRJA 1BL4A 1FKSA 2N87A 4MNLA 1VF8A 2ZQVA 2ZQUA 1JNSA 1FKJA 4WKFA 4DRHA 3PRDA 3WD4A 1EHNA 3O5IA 2ZR6A 3H9RB 4R0XA 1X6LA 3O5QA 4JFMA 1WAWA 1OWQA 4TW8A 2PI6A 4Q7NA 2FKEA 2F4EA 3UI6A 1OGBA 5DO2A 2ESCA 2M1IA 3G6MA 1J4RA 4U84A 4ITZA 4MPKA 1ZK6A 4WK9A 2AOSA 1B6CA 5HW7A 5HUAA 1NWRA 3PRAA 4P8XA 4W5UA 2DSVA 3KAHA 4FN2A 4LGXA 3O5KA 1H0IA 4Z2LA 2DG9A 3O5GA 4IQCA 2ZQSA 1D6OA 3O5FA 5HWCA 4DIPA 4QIBA 5HWBA 5BXJA 4U85A 4ZPWR 2Q5AA 2O92A 1JVWA 3BMBA 5DITA 4W9OA 1EDQA 2YBUA 3KADA 1Q6UA 4IT4A 2RSEA 2PBCA 2ZQTA 1ITXA 5DIVA 2DT3A 3W4RA 3GPKA 1HKMA 4ODRA 3RM8A 4DWSD 3B8SA 3AS3A 1FKRA 1FKIA 4MNJA 4ZS6A 4P8VA 4IT6A 3O5JA 1W1YA 4U86A 1E6RA 2ETNA 3ARWA 5DEZA 3CHCA 1J4IA 1D7JA 4O2TA 2XPAA 5HKGA 4LAVA 3UI5A 4S3KA 4ZPTR 3ALGA 3OA5A 2DSZA 2KGJA 1W9VA 1Q6HA 1T11A 4KQZA 3IK8A 2OFNA 4ZPVR 4DROA 1W1PA 2RURA 5DF0A 3CHEA 3O5DA 1J4HA 3IHZA 4PTMA 1JNTA 5HT1A 1OGGA 4KR0B 4GGQA 3CGNA 2XP3A 3UQAA 1GUVA 3GU0A 3JXVA 4Z2KA 2M08A 4Z2IA 3FXYA 4JFJA 1RD6A 2JZVA 4WIWA 3O5OA 1FKLA 2MLXA 2PV2A 3O5MA 3PR9A 3ARRA 4ODQA 1NSGA 2VN1A 5HTGA 1WNOA 4MNKA 1KT0A 3CH9A 1E6ZA 3IKGA 3B9EA 4BF8A 4DRKA 1EIBA 4DWSC 3O5LA 4LAYA 1LG2A 3UI4A 3WQWA 1QZ2A 5D75A 2MF9A 1PBKA 2PPPA 2A3AA 3TCZA 1E15A 2MPHA 2XP5A 3ARTA 2Y78A 3B7XA 4ODMA 1FKGA 3WL0A 4NZCA 3NI6A 2KI3A 2F21A 2RUCA 4TW7A 1ROTA 1SYTA 3BXWA 4WKHA 2KFWA 1TFVA 1L1PA 3NRKA 3ARYA 3ARQA 3WL1A 1FKKA 3CHDA 3UQBA 4DT4A 1FKTA 4QT3A 3KZ7A 2LPVA 1W1TA 4HBOA 1XRVA 4DRQA 3RMEA 1CTNA 3WKZA 1FAPA 2DT0A 4J4NA 4N19A 3EIPA 2DSUA 4FAPA 1EQ3A 1E9LA 3ARXA 3VAWA 4DRNA 1NMVA 1O6IA 4TNSA 3KABA 4ODLA 1E6NA 2RUQA 2DG4A 4G2PA 1W1VA 4DRJA 3RM4A 2DT1A 3TDBA 1ZL1A 3JYJA 4WKAA 1NWTA 1F8AB 1HKJA 3WD1A 2PPOA 4LAXA 3ODKA 4ML4A 1D7IA 4QT2A 5GPRA 4LAWA 4ODPA 1LL4A 3CZ8A 1M5YA 3WD2A 3PA7A 2A3BA 3WD0A 5J6EA 5GQBA 3MDYB 1F40A 3KAGA 1EYMA 4QZVB 1YATA 4TX0A 1LL7A 2WLZA 3KACA 4MNMA 2AWGA 2MLZA 2PV1A 4G50A 3ARPA 1HKKA 1ZBCA 2DT2A 3NTPA 4TYOA 3RM9A 2WM0A 4P8WA 2YBTA 1N1AA 1PINA 1FKDA 1FKHA 1U79A 3B9AA 3WD3A 1FFQA 2G8ZA 4J4OA 1P5QA 4TW6A 1W26A 3ARUA 4MAVA 4DRMA 1FJDA 4URIA 1QPLA 2B31A 4XAKA 2LJ4A 2LKNA 1R9HA 2KE0A 1HKIA 3GTYX 3QOKA 3JYMA 4JFKA 1GOIA 1J6YA 4S3JA 2IUZA 1UR9A 5B8IC 2PN0A 4MTVA 3ARZA 3CGMA 1E6PA 2MNTA 2ZR5A 4IQ2A 1ZB5A
chains in the Genus database with same CATH topology
1GPFA 1JNDA 1Q6IA 2KO7A 1JNEA 4DH0A 4Z2HA 2PPNA 3CHFA 1BKFA 1X6NA 4DWSB 2MLYA 3O5EA 3AS2A 2K8IA 4ODNA 5HW6A 4NNRA 3UF8A 4ODOA 1WB0A 2LGOA 1NWUA 3FAPA 4IPXA 2IF4A 2OLHA 5GPGA 2XP8A 4DRPA 2O9OA 3IKDA 2L2SA 3AROA 3B9DA 4GIVA 3RGCA 3WQVA 2D9FA 1NH6A 2F2DA 2A3CA 1W9UA 4R5EA 4Z2GA 2FAPA 1SR0A 2KR7A 3I6CA 2XP6A 4L3NA 1HJXA 4NSBA 3WIJA 2DSWA 3O5RA 3KAIA 1D2KA 2ITKA 4W9PA 3RFWA 1D7HA 3WH0A 1QPFA 3AS1A 4HBEA 3O5PA 3LUOA 1ZBVA 2RQSA 1ZBWA 1ZU8A 4HARA 1NMWA 3FY1A 1A7XA 4DWSA 1IX5A 1LL6A 4MSPA 2DPEA 1ZBKA 2XP7A 4JYSA 3KAFA 5DIUA 1HJWA 1LJYA 2WLYA 5I98A 1LQ0A 2RUDA 3EY6A 5HBFA 4DRIA 2UZ5A 4P8UA 2XPBA 2XP9A 4JFIA 1NWSA 3OOBA 5JH8A 4AY1A 2VCDA 2A3EA 4Q22A 2M2AA 1UR8A 1FKFA 4JFLA 1FD9A 1LG1A 4ODKA 2DG3A 3PRBA 3UQIA 1HJVA 2ZR4A 1C9HA 3ARVA 4DZ2A 1TCOC 1Y0OA 3AQUA 1YW5A 4WJXA 1Q1CA 1ROUA 1FFRA 1W9PA 4L72B 4MGVA 3ALFA 3TC5A 2PV3A 3ARSA 2WK2A 1KT1A 1KFWA 3KCEA 1FKBA 4DZ3A 5HW8A 1XHGA 3G6LA 2FDMA 2G41A 3AS0A 4C02B 1K9TA 1HXVA 1H0GA 4W9QA 1ZCNA 2QF8A 2XP4A 4Z2JA 2N87A 1BL4A 1FKSA 4MNLA 1VF8A 2ZQVA 2ZQUA 1JNSA 1FKJA 4WKFA 4DRHA 3PRDA 3WD4A 1EHNA 3O5IA 2ZR6A 3H9RB 4R0XA 3O5QA 1X6LA 4JFMA 1WAWA 1OWQA 4TW8A 2PI6A 4Q7NA 2FKEA 2F4EA 3UI6A 1OGBA 5DO2A 2ESCA 2M1IA 3G6MA 1J4RA 4U84A 4ITZA 4MPKA 1ZK6A 4WK9A 2AOSA 1B6CA 5HW7A 5HUAA 1NWRA 3PRAA 4P8XA 4W5UA 2DSVA 3KAHA 4FN2A 4LGXA 3O5KA 1H0IA 4Z2LA 2DG9A 3O5GA 4IQCA 2ZQSA 1D6OA 3O5FA 5HWCA 4DIPA 4QIBA 5HWBA 5BXJA 4U85A 4ZPWR 2Q5AA 2O92A 1JVWA 5DITA 4W9OA 1EDQA 2YBUA 3KADA 1Q6UA 4IT4A 2RSEA 2PBCA 2ZQTA 1ITXA 5DIVA 2DT3A 3W4RA 3GPKA 1HKMA 4ODRA 3RM8A 4DWSD 3B8SA 3AS3A 1FKRA 1FKIA 4MNJA 4ZS6A 4P8VA 4IT6A 3O5JA 1W1YA 4U86A 1E6RA 3ARWA 5DEZA 3CHCA 1J4IA 1D7JA 4O2TA 2XPAA 5HKGA 4LAVA 3UI5A 4S3KA 4ZPTR 3ALGA 3OA5A 2DSZA 2KGJA 1W9VA 1Q6HA 1T11A 4KQZA 3IK8A 2OFNA 4ZPVR 4DROA 1W1PA 2RURA 5DF0A 3CHEA 3O5DA 1J4HA 3IHZA 4PTMA 1JNTA 5HT1A 1OGGA 4KR0B 4GGQA 3CGNA 2XP3A 3UQAA 1GUVA 3JXVA 4Z2KA 2M08A 4Z2IA 3FXYA 4JFJA 1RD6A 2JZVA 4WIWA 3O5OA 1FKLA 2MLXA 2PV2A 3O5MA 3PR9A 3ARRA 4ODQA 1NSGA 2VN1A 5HTGA 1WNOA 4MNKA 1KT0A 3CH9A 1E6ZA 3IKGA 3B9EA 4BF8A 4DRKA 1EIBA 4DWSC 3O5LA 4LAYA 1LG2A 3UI4A 3WQWA 1QZ2A 5D75A 2MF9A 1PBKA 2PPPA 2A3AA 3TCZA 1E15A 2MPHA 2XP5A 3ARTA 2Y78A 3B7XA 4ODMA 1FKGA 3WL0A 4NZCA 3NI6A 2KI3A 2F21A 2RUCA 4TW7A 1ROTA 1SYTA 3BXWA 4WKHA 2KFWA 1TFVA 1L1PA 3NRKA 3ARYA 3ARQA 3WL1A 1FKKA 3CHDA 3UQBA 4DT4A 1FKTA 4QT3A 3KZ7A 2LPVA 1W1TA 4HBOA 1XRVA 4DRQA 3RMEA 1CTNA 3WKZA 1FAPA 2DT0A 4J4NA 4N19A 2DSUA 4FAPA 1EQ3A 1E9LA 3ARXA 3VAWA 4DRNA 1NMVA 1O6IA 4TNSA 3KABA 4ODLA 1E6NA 2RUQA 2DG4A 4G2PA 1W1VA 4DRJA 3RM4A 2DT1A 3TDBA 1ZL1A 3JYJA 4WKAA 1NWTA 1F8AB 1HKJA 3WD1A 2PPOA 4LAXA 3ODKA 4ML4A 1D7IA 4QT2A 5GPRA 4LAWA 4ODPA 1LL4A 3CZ8A 1M5YA 3WD2A 3PA7A 2A3BA 3WD0A 5J6EA 5GQBA 3MDYB 1F40A 3KAGA 1EYMA 4QZVB 1YATA 4TX0A 1LL7A 2WLZA 3KACA 4MNMA 2AWGA 2MLZA 2PV1A 4G50A 3ARPA 1HKKA 1ZBCA 2DT2A 3NTPA 4TYOA 3RM9A 2WM0A 4P8WA 2YBTA 1N1AA 1PINA 1FKDA 1FKHA 1U79A 3B9AA 3WD3A 1FFQA 2G8ZA 4J4OA 1P5QA 4TW6A 1W26A 3ARUA 4MAVA 4DRMA 1FJDA 4URIA 1QPLA 2B31A 4XAKA 2LJ4A 2LKNA 1R9HA 2KE0A 1HKIA 3QOKA 3JYMA 4JFKA 1GOIA 1J6YA 4S3JA 2IUZA 1UR9A 5B8IC 4MTVA 3ARZA 3CGMA 1E6PA 2MNTA 2ZR5A 4IQ2A 1ZB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAR A;  4HBO A;  4HBE A; 
#chains in the Genus database with same CATH topology
 1GPF A;  1JND A;  1Q6I A;  2KO7 A;  1JNE A;  4DH0 A;  4Z2H A;  2PPN A;  3CHF A;  1BKF A;  1X6N A;  4DWS B;  2MLY A;  3O5E A;  3AS2 A;  2K8I A;  4ODN A;  5HW6 A;  4NNR A;  3UF8 A;  4ODO A;  1WB0 A;  2LGO A;  1NWU A;  3FAP A;  4IPX A;  2IF4 A;  2OLH A;  5GPG A;  2XP8 A;  4DRP A;  2O9O A;  3IKD A;  2L2S A;  3ARO A;  3B9D A;  4GIV A;  3RGC A;  3WQV A;  2D9F A;  1NH6 A;  2F2D A;  2A3C A;  1W9U A;  4R5E A;  4Z2G A;  2FAP A;  1SR0 A;  2KR7 A;  2F23 A;  3I6C A;  2XP6 A;  4L3N A;  1HJX A;  4NSB A;  3WIJ A;  2DSW A;  3O5R A;  3KAI A;  1D2K A;  2ITK A;  4W9P A;  3RFW A;  1D7H A;  3WH0 A;  1QPF A;  1E44 A;  3AS1 A;  4HBE A;  3O5P A;  3LUO A;  2P4V A;  1ZBV A;  2RQS A;  1JCH B;  1ZBW A;  1ZU8 A;  4HAR A;  1NMW A;  3FY1 A;  1A7X A;  4DWS A;  1IX5 A;  1LL6 A;  4MSP A;  2DPE A;  1ZBK A;  2XP7 A;  4JYS A;  3KAF A;  5DIU A;  1HJW A;  1LJY A;  2WLY A;  5I98 A;  1LQ0 A;  2RUD A;  3EY6 A;  5HBF A;  4DRI A;  2UZ5 A;  4P8U A;  2XPB A;  2XP9 A;  4JFI A;  1NWS A;  3OOB A;  5JH8 A;  4AY1 A;  2VCD A;  2A3E A;  4Q22 A;  2M2A A;  1UR8 A;  1FKF A;  4JFL A;  1FD9 A;  2B5U B;  1LG1 A;  4ODK A;  2DG3 A;  3PRB A;  3UQI A;  1HJV A;  2ZR4 A;  1C9H A;  3ARV A;  4DZ2 A;  1TCO C;  1Y0O A;  3AQU A;  2EUL A;  1YW5 A;  4WJX A;  1Q1C A;  1ROU A;  1FFR A;  1W9P A;  4L72 B;  4UDM A;  4MGV A;  3ALF A;  3TC5 A;  2PV3 A;  3ARS A;  2WK2 A;  1KT1 A;  1KFW A;  3KCE A;  1FKB A;  4DZ3 A;  5HW8 A;  1XHG A;  3G6L A;  2FDM A;  2G41 A;  3AS0 A;  4C02 B;  1K9T A;  1HXV A;  1H0G A;  4W9Q A;  1ZCN A;  2QF8 A;  2XP4 A;  4Z2J A;  1GRJ A;  1BL4 A;  1FKS A;  2N87 A;  4MNL A;  1VF8 A;  2ZQV A;  2ZQU A;  1JNS A;  1FKJ A;  4WKF A;  4DRH A;  3PRD A;  3WD4 A;  1EHN A;  3O5I A;  2ZR6 A;  3H9R B;  4R0X A;  1X6L A;  3O5Q A;  4JFM A;  1WAW A;  1OWQ A;  4TW8 A;  2PI6 A;  4Q7N A;  2FKE A;  2F4E A;  3UI6 A;  1OGB A;  5DO2 A;  2ESC A;  2M1I A;  3G6M A;  1J4R A;  4U84 A;  4ITZ A;  4MPK A;  1ZK6 A;  4WK9 A;  2AOS A;  1B6C A;  5HW7 A;  5HUA A;  1NWR A;  3PRA A;  4P8X A;  4W5U A;  2DSV A;  3KAH A;  4FN2 A;  4LGX A;  3O5K A;  1H0I A;  4Z2L A;  2DG9 A;  3O5G A;  4IQC A;  2ZQS A;  1D6O A;  3O5F A;  5HWC A;  4DIP A;  4QIB A;  5HWB A;  5BXJ A;  4U85 A;  4ZPW R;  2Q5A A;  2O92 A;  1JVW A;  3BMB A;  5DIT A;  4W9O A;  1EDQ A;  2YBU A;  3KAD A;  1Q6U A;  4IT4 A;  2RSE A;  2PBC A;  2ZQT A;  1ITX A;  5DIV A;  2DT3 A;  3W4R A;  3GPK A;  1HKM A;  4ODR A;  3RM8 A;  4DWS D;  3B8S A;  3AS3 A;  1FKR A;  1FKI A;  4MNJ A;  4ZS6 A;  4P8V A;  4IT6 A;  3O5J A;  1W1Y A;  4U86 A;  1E6R A;  2ETN A;  3ARW A;  5DEZ A;  3CHC A;  1J4I A;  1D7J A;  4O2T A;  2XPA A;  5HKG A;  4LAV A;  3UI5 A;  4S3K A;  4ZPT R;  3ALG A;  3OA5 A;  2DSZ A;  2KGJ A;  1W9V A;  1Q6H A;  1T11 A;  4KQZ A;  3IK8 A;  2OFN A;  4ZPV R;  4DRO A;  1W1P A;  2RUR A;  5DF0 A;  3CHE A;  3O5D A;  1J4H A;  3IHZ A;  4PTM A;  1JNT A;  5HT1 A;  1OGG A;  4KR0 B;  4GGQ A;  3CGN A;  2XP3 A;  3UQA A;  1GUV A;  3GU0 A;  3JXV A;  4Z2K A;  2M08 A;  4Z2I A;  3FXY A;  4JFJ A;  1RD6 A;  2JZV A;  4WIW A;  3O5O A;  1FKL A;  2MLX A;  2PV2 A;  3O5M A;  3PR9 A;  3ARR A;  4ODQ A;  1NSG A;  2VN1 A;  5HTG A;  1WNO A;  4MNK A;  1KT0 A;  3CH9 A;  1E6Z A;  3IKG A;  3B9E A;  4BF8 A;  4DRK A;  1EIB A;  4DWS C;  3O5L A;  4LAY A;  1LG2 A;  3UI4 A;  3WQW A;  1QZ2 A;  5D75 A;  2MF9 A;  1PBK A;  2PPP A;  2A3A A;  3TCZ A;  1E15 A;  2MPH A;  2XP5 A;  3ART A;  2Y78 A;  3B7X A;  4ODM A;  1FKG A;  3WL0 A;  4NZC A;  3NI6 A;  2KI3 A;  2F21 A;  2RUC A;  4TW7 A;  1ROT A;  1SYT A;  3BXW A;  4WKH A;  2KFW A;  1TFV A;  1L1P A;  3NRK A;  3ARY A;  3ARQ A;  3WL1 A;  1FKK A;  3CHD A;  3UQB A;  4DT4 A;  1FKT A;  4QT3 A;  3KZ7 A;  2LPV A;  1W1T A;  4HBO A;  1XRV A;  4DRQ A;  3RME A;  1CTN A;  3WKZ A;  1FAP A;  2DT0 A;  4J4N A;  4N19 A;  3EIP A;  2DSU A;  4FAP A;  1EQ3 A;  1E9L A;  3ARX A;  3VAW A;  4DRN A;  1NMV A;  1O6I A;  4TNS A;  3KAB A;  4ODL A;  1E6N A;  2RUQ A;  2DG4 A;  4G2P A;  1W1V A;  4DRJ A;  3RM4 A;  2DT1 A;  3TDB A;  1ZL1 A;  3JYJ A;  4WKA A;  1NWT A;  1F8A B;  1HKJ A;  3WD1 A;  2PPO A;  4LAX A;  3ODK A;  4ML4 A;  1D7I A;  4QT2 A;  5GPR A;  4LAW A;  4ODP A;  1LL4 A;  3CZ8 A;  1M5Y A;  3WD2 A;  3PA7 A;  2A3B A;  3WD0 A;  5J6E A;  5GQB A;  3MDY B;  1F40 A;  3KAG A;  1EYM A;  4QZV B;  1YAT A;  4TX0 A;  1LL7 A;  2WLZ A;  3KAC A;  4MNM A;  2AWG A;  2MLZ A;  2PV1 A;  4G50 A;  3ARP A;  1HKK A;  1ZBC A;  2DT2 A;  3NTP A;  4TYO A;  3RM9 A;  2WM0 A;  4P8W A;  2YBT A;  1N1A A;  1PIN A;  1FKD A;  1FKH A;  1U79 A;  3B9A A;  3WD3 A;  1FFQ A;  2G8Z A;  4J4O A;  1P5Q A;  4TW6 A;  1W26 A;  3ARU A;  4MAV A;  4DRM A;  1FJD A;  4URI A;  1QPL A;  2B31 A;  4XAK A;  2LJ4 A;  2LKN A;  1R9H A;  2KE0 A;  1HKI A;  3GTY X;  3QOK A;  3JYM A;  4JFK A;  1GOI A;  1J6Y A;  4S3J A;  2IUZ A;  1UR9 A;  5B8I C;  2PN0 A;  4MTV A;  3ARZ A;  3CGM A;  1E6P A;  2MNT A;  2ZR5 A;  4IQ2 A;  1ZB5 A; 
#chains in the Genus database with same CATH homology
 1GPF A;  1JND A;  1Q6I A;  2KO7 A;  1JNE A;  4DH0 A;  4Z2H A;  2PPN A;  3CHF A;  1BKF A;  1X6N A;  4DWS B;  2MLY A;  3O5E A;  3AS2 A;  2K8I A;  4ODN A;  5HW6 A;  4NNR A;  3UF8 A;  4ODO A;  1WB0 A;  2LGO A;  1NWU A;  3FAP A;  4IPX A;  2IF4 A;  2OLH A;  5GPG A;  2XP8 A;  4DRP A;  2O9O A;  3IKD A;  2L2S A;  3ARO A;  3B9D A;  4GIV A;  3RGC A;  3WQV A;  2D9F A;  1NH6 A;  2F2D A;  2A3C A;  1W9U A;  4R5E A;  4Z2G A;  2FAP A;  1SR0 A;  2KR7 A;  3I6C A;  2XP6 A;  4L3N A;  1HJX A;  4NSB A;  3WIJ A;  2DSW A;  3O5R A;  3KAI A;  1D2K A;  2ITK A;  4W9P A;  3RFW A;  1D7H A;  3WH0 A;  1QPF A;  3AS1 A;  4HBE A;  3O5P A;  3LUO A;  1ZBV A;  2RQS A;  1ZBW A;  1ZU8 A;  4HAR A;  1NMW A;  3FY1 A;  1A7X A;  4DWS A;  1IX5 A;  1LL6 A;  4MSP A;  2DPE A;  1ZBK A;  2XP7 A;  4JYS A;  3KAF A;  5DIU A;  1HJW A;  1LJY A;  2WLY A;  5I98 A;  1LQ0 A;  2RUD A;  3EY6 A;  5HBF A;  4DRI A;  2UZ5 A;  4P8U A;  2XPB A;  2XP9 A;  4JFI A;  1NWS A;  3OOB A;  5JH8 A;  4AY1 A;  2VCD A;  2A3E A;  4Q22 A;  2M2A A;  1UR8 A;  1FKF A;  4JFL A;  1FD9 A;  1LG1 A;  4ODK A;  2DG3 A;  3PRB A;  3UQI A;  1HJV A;  2ZR4 A;  1C9H A;  3ARV A;  4DZ2 A;  1TCO C;  1Y0O A;  3AQU A;  1YW5 A;  4WJX A;  1Q1C A;  1ROU A;  1FFR A;  1W9P A;  4L72 B;  4MGV A;  3ALF A;  3TC5 A;  2PV3 A;  3ARS A;  2WK2 A;  1KT1 A;  1KFW A;  3KCE A;  1FKB A;  4DZ3 A;  5HW8 A;  1XHG A;  3G6L A;  2FDM A;  2G41 A;  3AS0 A;  4C02 B;  1K9T A;  1HXV A;  1H0G A;  4W9Q A;  1ZCN A;  2QF8 A;  2XP4 A;  4Z2J A;  2N87 A;  1BL4 A;  1FKS A;  4MNL A;  1VF8 A;  2ZQV A;  2ZQU A;  1JNS A;  1FKJ A;  4WKF A;  4DRH A;  3PRD A;  3WD4 A;  1EHN A;  3O5I A;  2ZR6 A;  3H9R B;  4R0X A;  3O5Q A;  1X6L A;  4JFM A;  1WAW A;  1OWQ A;  4TW8 A;  2PI6 A;  4Q7N A;  2FKE A;  2F4E A;  3UI6 A;  1OGB A;  5DO2 A;  2ESC A;  2M1I A;  3G6M A;  1J4R A;  4U84 A;  4ITZ A;  4MPK A;  1ZK6 A;  4WK9 A;  2AOS A;  1B6C A;  5HW7 A;  5HUA A;  1NWR A;  3PRA A;  4P8X A;  4W5U A;  2DSV A;  3KAH A;  4FN2 A;  4LGX A;  3O5K A;  1H0I A;  4Z2L A;  2DG9 A;  3O5G A;  4IQC A;  2ZQS A;  1D6O A;  3O5F A;  5HWC A;  4DIP A;  4QIB A;  5HWB A;  5BXJ A;  4U85 A;  4ZPW R;  2Q5A A;  2O92 A;  1JVW A;  5DIT A;  4W9O A;  1EDQ A;  2YBU A;  3KAD A;  1Q6U A;  4IT4 A;  2RSE A;  2PBC A;  2ZQT A;  1ITX A;  5DIV A;  2DT3 A;  3W4R A;  3GPK A;  1HKM A;  4ODR A;  3RM8 A;  4DWS D;  3B8S A;  3AS3 A;  1FKR A;  1FKI A;  4MNJ A;  4ZS6 A;  4P8V A;  4IT6 A;  3O5J A;  1W1Y A;  4U86 A;  1E6R A;  3ARW A;  5DEZ A;  3CHC A;  1J4I A;  1D7J A;  4O2T A;  2XPA A;  5HKG A;  4LAV A;  3UI5 A;  4S3K A;  4ZPT R;  3ALG A;  3OA5 A;  2DSZ A;  2KGJ A;  1W9V A;  1Q6H A;  1T11 A;  4KQZ A;  3IK8 A;  2OFN A;  4ZPV R;  4DRO A;  1W1P A;  2RUR A;  5DF0 A;  3CHE A;  3O5D A;  1J4H A;  3IHZ A;  4PTM A;  1JNT A;  5HT1 A;  1OGG A;  4KR0 B;  4GGQ A;  3CGN A;  2XP3 A;  3UQA A;  1GUV A;  3JXV A;  4Z2K A;  2M08 A;  4Z2I A;  3FXY A;  4JFJ A;  1RD6 A;  2JZV A;  4WIW A;  3O5O A;  1FKL A;  2MLX A;  2PV2 A;  3O5M A;  3PR9 A;  3ARR A;  4ODQ A;  1NSG A;  2VN1 A;  5HTG A;  1WNO A;  4MNK A;  1KT0 A;  3CH9 A;  1E6Z A;  3IKG A;  3B9E A;  4BF8 A;  4DRK A;  1EIB A;  4DWS C;  3O5L A;  4LAY A;  1LG2 A;  3UI4 A;  3WQW A;  1QZ2 A;  5D75 A;  2MF9 A;  1PBK A;  2PPP A;  2A3A A;  3TCZ A;  1E15 A;  2MPH A;  2XP5 A;  3ART A;  2Y78 A;  3B7X A;  4ODM A;  1FKG A;  3WL0 A;  4NZC A;  3NI6 A;  2KI3 A;  2F21 A;  2RUC A;  4TW7 A;  1ROT A;  1SYT A;  3BXW A;  4WKH A;  2KFW A;  1TFV A;  1L1P A;  3NRK A;  3ARY A;  3ARQ A;  3WL1 A;  1FKK A;  3CHD A;  3UQB A;  4DT4 A;  1FKT A;  4QT3 A;  3KZ7 A;  2LPV A;  1W1T A;  4HBO A;  1XRV A;  4DRQ A;  3RME A;  1CTN A;  3WKZ A;  1FAP A;  2DT0 A;  4J4N A;  4N19 A;  2DSU A;  4FAP A;  1EQ3 A;  1E9L A;  3ARX A;  3VAW A;  4DRN A;  1NMV A;  1O6I A;  4TNS A;  3KAB A;  4ODL A;  1E6N A;  2RUQ A;  2DG4 A;  4G2P A;  1W1V A;  4DRJ A;  3RM4 A;  2DT1 A;  3TDB A;  1ZL1 A;  3JYJ A;  4WKA A;  1NWT A;  1F8A B;  1HKJ A;  3WD1 A;  2PPO A;  4LAX A;  3ODK A;  4ML4 A;  1D7I A;  4QT2 A;  5GPR A;  4LAW A;  4ODP A;  1LL4 A;  3CZ8 A;  1M5Y A;  3WD2 A;  3PA7 A;  2A3B A;  3WD0 A;  5J6E A;  5GQB A;  3MDY B;  1F40 A;  3KAG A;  1EYM A;  4QZV B;  1YAT A;  4TX0 A;  1LL7 A;  2WLZ A;  3KAC A;  4MNM A;  2AWG A;  2MLZ A;  2PV1 A;  4G50 A;  3ARP A;  1HKK A;  1ZBC A;  2DT2 A;  3NTP A;  4TYO A;  3RM9 A;  2WM0 A;  4P8W A;  2YBT A;  1N1A A;  1PIN A;  1FKD A;  1FKH A;  1U79 A;  3B9A A;  3WD3 A;  1FFQ A;  2G8Z A;  4J4O A;  1P5Q A;  4TW6 A;  1W26 A;  3ARU A;  4MAV A;  4DRM A;  1FJD A;  4URI A;  1QPL A;  2B31 A;  4XAK A;  2LJ4 A;  2LKN A;  1R9H A;  2KE0 A;  1HKI A;  3QOK A;  3JYM A;  4JFK A;  1GOI A;  1J6Y A;  4S3J A;  2IUZ A;  1UR9 A;  5B8I C;  4MTV A;  3ARZ A;  3CGM A;  1E6P A;  2MNT A;  2ZR5 A;  4IQ2 A;  1ZB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...