4HBEA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
TEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 14
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hbeA00
4HARA 4HBOA 4HBEA
chains in the Genus database with same CATH superfamily
4Z2GA 3O5PA 3CHDA 4IQ2A 5DIVA 4DRJA 4MPKA 4DT4A 1OGGA 2WLZA 1YW5A 3JYJA 3ARPA 3WL1A 4BF8A 3W4RA 1F40A 3ARUA 5HKGA 3IK8A 3KAGA 4P8WA 4TNSA 1ZBKA 4AY1A 4U86A 2XP6A 1FKRA 3UF8A 4URIA 1PBKA 1D7IA 4DRQA 5HWBA 1O6IA 4DWSA 5GPRA 3UI5A 2WLYA 2XP3A 3BMBA 3IKDA 2QF8A 3KCEA 4LAVA 3PRBA 2A3EA 1E6RA 1XRVA 4MNJA 4Q7NA 2PPOA 5I98A 4UDMA 1F8AB 1VF8A 3RM9A 1OWQA 3O5RA 3RM4A 3AS2A 2F4EA 1EQ3A 1FKSA 4Z2LA 3WD4A 1HJVA 3RM8A 3ARWA 1ZCNA 2DT0A 4J4OA 1H0GA 1UR9A 1LG1A 3CHEA 1SR0A 4FAPA 3O5DA 1FAPA 2G8ZA 1JNTA 3WD2A 2LKNA 4KQZA 3ARYA 4MAVA 4R0XA 4NZCA 3EY6A 4DRHA 1NMWA 2ETNA 1J4HA 4GIVA 4ODRA 3ARVA 1J6YA 1E6ZA 1UR8A 1HJWA 3IKGA 4S3JA 1QZ2A 4ODLA 1W9PA 5DITA 4P8XA 2IF4A 3CHCA 2XP4A 1FKIA 2PPNA 3B9AA 2M2AA 4C02B 1LL4A 1NSGA 4ODMA 4PTMA 1FKHA 1CTNA 3PRAA 1D7HA 2WK2A 2F21A 3LUOA 2N87A 5HW6A 3O5KA 3B8SA 2A3BA 2EULA 3CGMA 4L72B 3O5OA 1FKBA 4DZ2A 1ROUA 2PV3A 4J4NA 1Q6UA 4ML4A 4ODNA 2G41A 1YATA 2FDMA 1HKMA 2Y78A 1JCHB 1EHNA 4U84A 5DO2A 4IPXA 1J4RA 3ARSA 4HBOA 2O92A 4DROA 1LG2A 4ZPWR 3KAFA 1BKFA 1W1VA 1A7XA 4N19A 4DWSD 4HARA 2ITKA 1FKGA 2KR7A 3NRKA 3WQWA 2OLHA 4JYSA 2FAPA 1ZBVA 4JFKA 3ARZA 2ZR4A 1GPFA 2MLZA 1D7JA 5HTGA 4WKHA 5GQBA 1SYTA 4MNLA 4MGVA 1BL4A 1IX5A 1FFQA 4WJXA 1KFWA 1R9HA 2MLXA 2ZR5A 3AQUA 3FXYA 4JFIA 1JVWA 1X6NA 3AS0A 3UQIA 4DIPA 1TCOC 3JXVA 4TX0A 4DZ3A 3ARRA 2VN1A 1T11A 1EIBA 4TYOA 1HKJA 1X6LA 2L2SA 3G6LA 3O5JA 1GOIA 4TW7A 2FKEA 1Q1CA 1TFVA 3IHZA 2XP9A 4GGQA 3WIJA 2DT2A 3UQBA 2PPPA 2PV1A 4QT2A 3WD0A 1K9TA 3OA5A 1W9VA 2MLYA 3PA7A 4QIBA 3WL0A 3AS1A 4P8UA 3CZ8A 5GPGA 5DF0A 2XPBA 4LAXA 1W1YA 2DT3A 2XP7A 3KACA 4KR0B 2DSWA 3TCZA 3O5QA 4W5UA 1NWRA 2Q5AA 3GU0A 3B9DA 4U85A 3UI4A 4ZPVR 2KE0A 4LAYA 4WK9A 3H9RB 1ZL1A 4MNMA 3O5FA 2YBUA 3PRDA 3TDBA 3WD3A 4MSPA 4DRIA 3QOKA 4G2PA 3O5EA 5HT1A 3I6CA 1B6CA 1C9HA 3O5IA 3KZ7A 1WNOA 1NH6A 1JNSA 1KT0A 2LPVA 4Q22A 1E6NA 3CGNA 2RURA 3EIPA 4JFMA 4IQCA 5HBFA 1ROTA 1M5YA 4DWSB 1XHGA 2MPHA 4L3NA 4DRKA 2RUDA 2UZ5A 1EDQA 1LL6A 2RQSA 1WB0A 1FD9A 5HWCA 1E44A 1FKKA 5JH8A 1ZK6A 1NWTA 5HW7A 2KI3A 3O5MA 1ZBCA 2DT1A 3BXWA 4QZVB 4JFLA 1NMVA 4IT4A 3B7XA 1LJYA 3RFWA 1FKDA 2XP8A 4ODOA 4S3KA 4ODKA 4MNKA 4W9OA 2XP5A 2YBTA 1H0IA 1HXVA 1NWUA 4LAWA 2DSVA 5HW8A 4FN2A 4NNRA 3FY1A 1QPFA 2JZVA 2F2DA 3O5GA 3ALGA 1EYMA 3NI6A 4WIWA 2M08A 2PN0A 1JNEA 1N1AA 1W1TA 4W9QA 2DG4A 1FKTA 2ESCA 2DSZA 3RGCA 4DH0A 2OFNA 1LL7A 1WAWA 4QT3A 1LQ0A 3JYMA 4ITZA 2WM0A 2DPEA 4G50A 3ARQA 3UQAA 3ODKA 1E15A 3MDYB 2KGJA 3ARXA 1KT1A 2PBCA 1FFRA 2MF9A 1W1PA 4Z2KA 3KABA 3AS3A 3WH0A 1D6OA 1Y0OA 5HUAA 1HKKA 2K8IA 5DIUA 2VCDA 1D2KA 3WD1A 1QPLA 1ZU8A 3O5LA 4TW8A 4WKFA 1W9UA 5DEZA 2AWGA 1P5QA 2DG3A 2RSEA 4ZPTR 4Z2IA 2KO7A 1JNDA 1PINA 3VAWA 1GUVA 3OOBA 1HKIA 1U79A 2O9OA 4DRPA 5J6EA 1GRJA 2DSUA 3CH9A 2RUQA 2M1IA 4ODQA 1ZB5A 1FKLA 3AROA 5BXJA 2LGOA 4DWSC 2ZR6A 3NTPA 5D75A 1ITXA 3GTYX 3KAIA 4MTVA 2F23A 4P8VA 3TC5A 3WQVA 3KAHA 4W9PA 2IUZA 2RUCA 3UI6A 2ZQUA 1NWSA 2ZQVA 4DRNA 3RMEA 2ZQTA 4O2TA 1RD6A 1L1PA 2P4VA 4TW6A 2KFWA 1FJDA 1W26A 2ZQSA 4ZS6A 5B8IC 3ARTA 1E9LA 4JFJA 1J4IA 2DG9A 4NSBA 1Q6HA 2D9FA 1FKFA 4DRMA 3CHFA 4WKAA 2PV2A 4IT6A 3WKZA 1OGBA 4R5EA 2A3AA 3B9EA 3KADA 4XAKA 2B31A 2AOSA 2PI6A 4ODPA 4HBEA 1E6PA 2B5UB 1HJXA 4LGXA 2A3CA 4Z2HA 3GPKA 3FAPA 1FKJA 3G6MA 2XPAA 3PR9A 2LJ4A 4Z2JA 1Q6IA 1ZBWA 2MNTA 3ALFA
chains in the Genus database with same CATH topology
4Z2GA 3O5PA 3CHDA 4IQ2A 5DIVA 4DRJA 4MPKA 4DT4A 1OGGA 2WLZA 1YW5A 3JYJA 3ARPA 3WL1A 4BF8A 3W4RA 1F40A 3ARUA 5HKGA 3IK8A 3KAGA 4P8WA 4TNSA 1ZBKA 4AY1A 4U86A 2XP6A 1FKRA 3UF8A 4URIA 1PBKA 1D7IA 4DRQA 5HWBA 1O6IA 4DWSA 5GPRA 3UI5A 2WLYA 2XP3A 3IKDA 2QF8A 3KCEA 4LAVA 3PRBA 2A3EA 1E6RA 1XRVA 4MNJA 4Q7NA 2PPOA 5I98A 1F8AB 1VF8A 3RM9A 1OWQA 3O5RA 3RM4A 3AS2A 2F4EA 1EQ3A 1FKSA 4Z2LA 3WD4A 1HJVA 3RM8A 3ARWA 1ZCNA 2DT0A 4J4OA 1H0GA 1UR9A 1LG1A 3CHEA 1SR0A 4FAPA 3O5DA 1FAPA 2G8ZA 1JNTA 3WD2A 4KQZA 2LKNA 3ARYA 4MAVA 4R0XA 4NZCA 3EY6A 4DRHA 1NMWA 4GIVA 1J4HA 4ODRA 3ARVA 1J6YA 1E6ZA 1UR8A 1HJWA 3IKGA 4S3JA 1QZ2A 4ODLA 1W9PA 5DITA 4P8XA 2IF4A 3CHCA 2XP4A 1FKIA 2PPNA 3B9AA 2M2AA 4C02B 1LL4A 1NSGA 4ODMA 4PTMA 1FKHA 1CTNA 3PRAA 1D7HA 2WK2A 2F21A 3LUOA 2N87A 5HW6A 3O5KA 3B8SA 2A3BA 3CGMA 4L72B 3O5OA 1FKBA 4DZ2A 1ROUA 2PV3A 4J4NA 1Q6UA 4ML4A 4ODNA 2G41A 1YATA 2FDMA 1HKMA 2Y78A 1EHNA 4U84A 5DO2A 4IPXA 1J4RA 3ARSA 4HBOA 2O92A 4DROA 1LG2A 4ZPWR 3KAFA 1BKFA 1W1VA 1A7XA 4N19A 4DWSD 4HARA 2ITKA 1FKGA 2KR7A 3NRKA 3WQWA 2OLHA 4JYSA 2FAPA 1ZBVA 4JFKA 3ARZA 2ZR4A 1GPFA 2MLZA 1D7JA 5HTGA 4WKHA 5GQBA 1SYTA 4MNLA 4MGVA 1BL4A 1IX5A 1FFQA 4WJXA 1KFWA 1R9HA 2MLXA 2ZR5A 3AQUA 3FXYA 4JFIA 1JVWA 1X6NA 3AS0A 3UQIA 4DIPA 1TCOC 3JXVA 4TX0A 4DZ3A 3ARRA 2VN1A 1T11A 1EIBA 4TYOA 1HKJA 1X6LA 2L2SA 3G6LA 3O5JA 1GOIA 4TW7A 2FKEA 1Q1CA 1TFVA 3IHZA 2XP9A 4GGQA 3WIJA 2DT2A 3UQBA 2PPPA 2PV1A 4QT2A 3WD0A 1K9TA 3OA5A 1W9VA 2MLYA 3PA7A 4QIBA 3WL0A 3AS1A 4P8UA 3CZ8A 5GPGA 5DF0A 2XPBA 4LAXA 1W1YA 2DT3A 2XP7A 3KACA 4KR0B 2DSWA 3TCZA 3O5QA 4W5UA 1NWRA 2Q5AA 3B9DA 4U85A 3UI4A 4ZPVR 2KE0A 4LAYA 4WK9A 3H9RB 1ZL1A 4MNMA 3O5FA 2YBUA 3PRDA 3TDBA 3WD3A 4MSPA 4DRIA 3QOKA 4G2PA 3O5EA 5HT1A 3I6CA 1B6CA 1C9HA 3O5IA 3KZ7A 1WNOA 1NH6A 1JNSA 1KT0A 2LPVA 4Q22A 1E6NA 3CGNA 2RURA 4JFMA 4IQCA 5HBFA 1ROTA 1M5YA 4DWSB 1XHGA 2MPHA 4L3NA 4DRKA 2RUDA 2UZ5A 1EDQA 1LL6A 2RQSA 1WB0A 1FD9A 5HWCA 1FKKA 5JH8A 1ZK6A 1NWTA 5HW7A 2KI3A 3O5MA 1ZBCA 2DT1A 3BXWA 4QZVB 4JFLA 1NMVA 4IT4A 3B7XA 1LJYA 3RFWA 1FKDA 2XP8A 4ODOA 4S3KA 4ODKA 4MNKA 4W9OA 2XP5A 2YBTA 1H0IA 1HXVA 1NWUA 4LAWA 2DSVA 5HW8A 4FN2A 4NNRA 3FY1A 1QPFA 2JZVA 2F2DA 3O5GA 3ALGA 1EYMA 3NI6A 4WIWA 2M08A 1JNEA 1N1AA 1W1TA 4W9QA 2DG4A 1FKTA 2ESCA 2DSZA 3RGCA 4DH0A 2OFNA 1LL7A 1WAWA 4QT3A 1LQ0A 3JYMA 4ITZA 2WM0A 2DPEA 4G50A 3ARQA 3UQAA 3ODKA 1E15A 3MDYB 2KGJA 3ARXA 1KT1A 2PBCA 1FFRA 2MF9A 1W1PA 4Z2KA 3KABA 3AS3A 3WH0A 1D6OA 1Y0OA 5HUAA 1HKKA 2K8IA 5DIUA 2VCDA 1D2KA 3WD1A 1QPLA 1ZU8A 3O5LA 4TW8A 4WKFA 1W9UA 5DEZA 2AWGA 1P5QA 2DG3A 2RSEA 4ZPTR 4Z2IA 2KO7A 1PINA 1JNDA 3VAWA 1GUVA 3OOBA 1HKIA 1U79A 2O9OA 4DRPA 5J6EA 2DSUA 3CH9A 2RUQA 2M1IA 4ODQA 1ZB5A 1FKLA 3AROA 5BXJA 2LGOA 4DWSC 2ZR6A 3NTPA 5D75A 1ITXA 3KAIA 4MTVA 4P8VA 3TC5A 3WQVA 3KAHA 4W9PA 2IUZA 2RUCA 3UI6A 2ZQUA 1NWSA 2ZQVA 4DRNA 3RMEA 2ZQTA 4O2TA 1RD6A 1L1PA 4TW6A 2KFWA 1FJDA 1W26A 2ZQSA 4ZS6A 5B8IC 3ARTA 1E9LA 4JFJA 1J4IA 2DG9A 4NSBA 1Q6HA 2D9FA 1FKFA 4DRMA 3CHFA 4WKAA 2PV2A 4IT6A 3WKZA 1OGBA 4R5EA 2A3AA 3B9EA 3KADA 4XAKA 2B31A 2AOSA 2PI6A 4ODPA 4HBEA 1E6PA 1HJXA 4LGXA 2A3CA 4Z2HA 3GPKA 3FAPA 1FKJA 3G6MA 2XPAA 3PR9A 2LJ4A 4Z2JA 1Q6IA 1ZBWA 2MNTA 3ALFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAR A;  4HBO A;  4HBE A; 
#chains in the Genus database with same CATH topology
 4Z2G A;  3O5P A;  3CHD A;  4IQ2 A;  5DIV A;  4DRJ A;  4MPK A;  4DT4 A;  1OGG A;  2WLZ A;  1YW5 A;  3JYJ A;  3ARP A;  3WL1 A;  4BF8 A;  3W4R A;  1F40 A;  3ARU A;  5HKG A;  3IK8 A;  3KAG A;  4P8W A;  4TNS A;  1ZBK A;  4AY1 A;  4U86 A;  2XP6 A;  1FKR A;  3UF8 A;  4URI A;  1PBK A;  1D7I A;  4DRQ A;  5HWB A;  1O6I A;  4DWS A;  5GPR A;  3UI5 A;  2WLY A;  2XP3 A;  3BMB A;  3IKD A;  2QF8 A;  3KCE A;  4LAV A;  3PRB A;  2A3E A;  1E6R A;  1XRV A;  4MNJ A;  4Q7N A;  2PPO A;  5I98 A;  4UDM A;  1F8A B;  1VF8 A;  3RM9 A;  1OWQ A;  3O5R A;  3RM4 A;  3AS2 A;  2F4E A;  1EQ3 A;  1FKS A;  4Z2L A;  3WD4 A;  1HJV A;  3RM8 A;  3ARW A;  1ZCN A;  2DT0 A;  4J4O A;  1H0G A;  1UR9 A;  1LG1 A;  3CHE A;  1SR0 A;  4FAP A;  3O5D A;  1FAP A;  2G8Z A;  1JNT A;  3WD2 A;  2LKN A;  4KQZ A;  3ARY A;  4MAV A;  4R0X A;  4NZC A;  3EY6 A;  4DRH A;  1NMW A;  2ETN A;  1J4H A;  4GIV A;  4ODR A;  3ARV A;  1J6Y A;  1E6Z A;  1UR8 A;  1HJW A;  3IKG A;  4S3J A;  1QZ2 A;  4ODL A;  1W9P A;  5DIT A;  4P8X A;  2IF4 A;  3CHC A;  2XP4 A;  1FKI A;  2PPN A;  3B9A A;  2M2A A;  4C02 B;  1LL4 A;  1NSG A;  4ODM A;  4PTM A;  1FKH A;  1CTN A;  3PRA A;  1D7H A;  2WK2 A;  2F21 A;  3LUO A;  2N87 A;  5HW6 A;  3O5K A;  3B8S A;  2A3B A;  2EUL A;  3CGM A;  4L72 B;  3O5O A;  1FKB A;  4DZ2 A;  1ROU A;  2PV3 A;  4J4N A;  1Q6U A;  4ML4 A;  4ODN A;  2G41 A;  1YAT A;  2FDM A;  1HKM A;  2Y78 A;  1JCH B;  1EHN A;  4U84 A;  5DO2 A;  4IPX A;  1J4R A;  3ARS A;  4HBO A;  2O92 A;  4DRO A;  1LG2 A;  4ZPW R;  3KAF A;  1BKF A;  1W1V A;  1A7X A;  4N19 A;  4DWS D;  4HAR A;  2ITK A;  1FKG A;  2KR7 A;  3NRK A;  3WQW A;  2OLH A;  4JYS A;  2FAP A;  1ZBV A;  4JFK A;  3ARZ A;  2ZR4 A;  1GPF A;  2MLZ A;  1D7J A;  5HTG A;  4WKH A;  5GQB A;  1SYT A;  4MNL A;  4MGV A;  1BL4 A;  1IX5 A;  1FFQ A;  4WJX A;  1KFW A;  1R9H A;  2MLX A;  2ZR5 A;  3AQU A;  3FXY A;  4JFI A;  1JVW A;  1X6N A;  3AS0 A;  3UQI A;  4DIP A;  1TCO C;  3JXV A;  4TX0 A;  4DZ3 A;  3ARR A;  2VN1 A;  1T11 A;  1EIB A;  4TYO A;  1HKJ A;  1X6L A;  2L2S A;  3G6L A;  3O5J A;  1GOI A;  4TW7 A;  2FKE A;  1Q1C A;  1TFV A;  3IHZ A;  2XP9 A;  4GGQ A;  3WIJ A;  2DT2 A;  3UQB A;  2PPP A;  2PV1 A;  4QT2 A;  3WD0 A;  1K9T A;  3OA5 A;  1W9V A;  2MLY A;  3PA7 A;  4QIB A;  3WL0 A;  3AS1 A;  4P8U A;  3CZ8 A;  5GPG A;  5DF0 A;  2XPB A;  4LAX A;  1W1Y A;  2DT3 A;  2XP7 A;  3KAC A;  4KR0 B;  2DSW A;  3TCZ A;  3O5Q A;  4W5U A;  1NWR A;  2Q5A A;  3GU0 A;  3B9D A;  4U85 A;  3UI4 A;  4ZPV R;  2KE0 A;  4LAY A;  4WK9 A;  3H9R B;  1ZL1 A;  4MNM A;  3O5F A;  2YBU A;  3PRD A;  3TDB A;  3WD3 A;  4MSP A;  4DRI A;  3QOK A;  4G2P A;  3O5E A;  5HT1 A;  3I6C A;  1B6C A;  1C9H A;  3O5I A;  3KZ7 A;  1WNO A;  1NH6 A;  1JNS A;  1KT0 A;  2LPV A;  4Q22 A;  1E6N A;  3CGN A;  2RUR A;  3EIP A;  4JFM A;  4IQC A;  5HBF A;  1ROT A;  1M5Y A;  4DWS B;  1XHG A;  2MPH A;  4L3N A;  4DRK A;  2RUD A;  2UZ5 A;  1EDQ A;  1LL6 A;  2RQS A;  1WB0 A;  1FD9 A;  5HWC A;  1E44 A;  1FKK A;  5JH8 A;  1ZK6 A;  1NWT A;  5HW7 A;  2KI3 A;  3O5M A;  1ZBC A;  2DT1 A;  3BXW A;  4QZV B;  4JFL A;  1NMV A;  4IT4 A;  3B7X A;  1LJY A;  3RFW A;  1FKD A;  2XP8 A;  4ODO A;  4S3K A;  4ODK A;  4MNK A;  4W9O A;  2XP5 A;  2YBT A;  1H0I A;  1HXV A;  1NWU A;  4LAW A;  2DSV A;  5HW8 A;  4FN2 A;  4NNR A;  3FY1 A;  1QPF A;  2JZV A;  2F2D A;  3O5G A;  3ALG A;  1EYM A;  3NI6 A;  4WIW A;  2M08 A;  2PN0 A;  1JNE A;  1N1A A;  1W1T A;  4W9Q A;  2DG4 A;  1FKT A;  2ESC A;  2DSZ A;  3RGC A;  4DH0 A;  2OFN A;  1LL7 A;  1WAW A;  4QT3 A;  1LQ0 A;  3JYM A;  4ITZ A;  2WM0 A;  2DPE A;  4G50 A;  3ARQ A;  3UQA A;  3ODK A;  1E15 A;  3MDY B;  2KGJ A;  3ARX A;  1KT1 A;  2PBC A;  1FFR A;  2MF9 A;  1W1P A;  4Z2K A;  3KAB A;  3AS3 A;  3WH0 A;  1D6O A;  1Y0O A;  5HUA A;  1HKK A;  2K8I A;  5DIU A;  2VCD A;  1D2K A;  3WD1 A;  1QPL A;  1ZU8 A;  3O5L A;  4TW8 A;  4WKF A;  1W9U A;  5DEZ A;  2AWG A;  1P5Q A;  2DG3 A;  2RSE A;  4ZPT R;  4Z2I A;  2KO7 A;  1JND A;  1PIN A;  3VAW A;  1GUV A;  3OOB A;  1HKI A;  1U79 A;  2O9O A;  4DRP A;  5J6E A;  1GRJ A;  2DSU A;  3CH9 A;  2RUQ A;  2M1I A;  4ODQ A;  1ZB5 A;  1FKL A;  3ARO A;  5BXJ A;  2LGO A;  4DWS C;  2ZR6 A;  3NTP A;  5D75 A;  1ITX A;  3GTY X;  3KAI A;  4MTV A;  2F23 A;  4P8V A;  3TC5 A;  3WQV A;  3KAH A;  4W9P A;  2IUZ A;  2RUC A;  3UI6 A;  2ZQU A;  1NWS A;  2ZQV A;  4DRN A;  3RME A;  2ZQT A;  4O2T A;  1RD6 A;  1L1P A;  2P4V A;  4TW6 A;  2KFW A;  1FJD A;  1W26 A;  2ZQS A;  4ZS6 A;  5B8I C;  3ART A;  1E9L A;  4JFJ A;  1J4I A;  2DG9 A;  4NSB A;  1Q6H A;  2D9F A;  1FKF A;  4DRM A;  3CHF A;  4WKA A;  2PV2 A;  4IT6 A;  3WKZ A;  1OGB A;  4R5E A;  2A3A A;  3B9E A;  3KAD A;  4XAK A;  2B31 A;  2AOS A;  2PI6 A;  4ODP A;  4HBE A;  1E6P A;  2B5U B;  1HJX A;  4LGX A;  2A3C A;  4Z2H A;  3GPK A;  3FAP A;  1FKJ A;  3G6M A;  2XPA A;  3PR9 A;  2LJ4 A;  4Z2J A;  1Q6I A;  1ZBW A;  2MNT A;  3ALF A; 
#chains in the Genus database with same CATH homology
 4Z2G A;  3O5P A;  3CHD A;  4IQ2 A;  5DIV A;  4DRJ A;  4MPK A;  4DT4 A;  1OGG A;  2WLZ A;  1YW5 A;  3JYJ A;  3ARP A;  3WL1 A;  4BF8 A;  3W4R A;  1F40 A;  3ARU A;  5HKG A;  3IK8 A;  3KAG A;  4P8W A;  4TNS A;  1ZBK A;  4AY1 A;  4U86 A;  2XP6 A;  1FKR A;  3UF8 A;  4URI A;  1PBK A;  1D7I A;  4DRQ A;  5HWB A;  1O6I A;  4DWS A;  5GPR A;  3UI5 A;  2WLY A;  2XP3 A;  3IKD A;  2QF8 A;  3KCE A;  4LAV A;  3PRB A;  2A3E A;  1E6R A;  1XRV A;  4MNJ A;  4Q7N A;  2PPO A;  5I98 A;  1F8A B;  1VF8 A;  3RM9 A;  1OWQ A;  3O5R A;  3RM4 A;  3AS2 A;  2F4E A;  1EQ3 A;  1FKS A;  4Z2L A;  3WD4 A;  1HJV A;  3RM8 A;  3ARW A;  1ZCN A;  2DT0 A;  4J4O A;  1H0G A;  1UR9 A;  1LG1 A;  3CHE A;  1SR0 A;  4FAP A;  3O5D A;  1FAP A;  2G8Z A;  1JNT A;  3WD2 A;  4KQZ A;  2LKN A;  3ARY A;  4MAV A;  4R0X A;  4NZC A;  3EY6 A;  4DRH A;  1NMW A;  4GIV A;  1J4H A;  4ODR A;  3ARV A;  1J6Y A;  1E6Z A;  1UR8 A;  1HJW A;  3IKG A;  4S3J A;  1QZ2 A;  4ODL A;  1W9P A;  5DIT A;  4P8X A;  2IF4 A;  3CHC A;  2XP4 A;  1FKI A;  2PPN A;  3B9A A;  2M2A A;  4C02 B;  1LL4 A;  1NSG A;  4ODM A;  4PTM A;  1FKH A;  1CTN A;  3PRA A;  1D7H A;  2WK2 A;  2F21 A;  3LUO A;  2N87 A;  5HW6 A;  3O5K A;  3B8S A;  2A3B A;  3CGM A;  4L72 B;  3O5O A;  1FKB A;  4DZ2 A;  1ROU A;  2PV3 A;  4J4N A;  1Q6U A;  4ML4 A;  4ODN A;  2G41 A;  1YAT A;  2FDM A;  1HKM A;  2Y78 A;  1EHN A;  4U84 A;  5DO2 A;  4IPX A;  1J4R A;  3ARS A;  4HBO A;  2O92 A;  4DRO A;  1LG2 A;  4ZPW R;  3KAF A;  1BKF A;  1W1V A;  1A7X A;  4N19 A;  4DWS D;  4HAR A;  2ITK A;  1FKG A;  2KR7 A;  3NRK A;  3WQW A;  2OLH A;  4JYS A;  2FAP A;  1ZBV A;  4JFK A;  3ARZ A;  2ZR4 A;  1GPF A;  2MLZ A;  1D7J A;  5HTG A;  4WKH A;  5GQB A;  1SYT A;  4MNL A;  4MGV A;  1BL4 A;  1IX5 A;  1FFQ A;  4WJX A;  1KFW A;  1R9H A;  2MLX A;  2ZR5 A;  3AQU A;  3FXY A;  4JFI A;  1JVW A;  1X6N A;  3AS0 A;  3UQI A;  4DIP A;  1TCO C;  3JXV A;  4TX0 A;  4DZ3 A;  3ARR A;  2VN1 A;  1T11 A;  1EIB A;  4TYO A;  1HKJ A;  1X6L A;  2L2S A;  3G6L A;  3O5J A;  1GOI A;  4TW7 A;  2FKE A;  1Q1C A;  1TFV A;  3IHZ A;  2XP9 A;  4GGQ A;  3WIJ A;  2DT2 A;  3UQB A;  2PPP A;  2PV1 A;  4QT2 A;  3WD0 A;  1K9T A;  3OA5 A;  1W9V A;  2MLY A;  3PA7 A;  4QIB A;  3WL0 A;  3AS1 A;  4P8U A;  3CZ8 A;  5GPG A;  5DF0 A;  2XPB A;  4LAX A;  1W1Y A;  2DT3 A;  2XP7 A;  3KAC A;  4KR0 B;  2DSW A;  3TCZ A;  3O5Q A;  4W5U A;  1NWR A;  2Q5A A;  3B9D A;  4U85 A;  3UI4 A;  4ZPV R;  2KE0 A;  4LAY A;  4WK9 A;  3H9R B;  1ZL1 A;  4MNM A;  3O5F A;  2YBU A;  3PRD A;  3TDB A;  3WD3 A;  4MSP A;  4DRI A;  3QOK A;  4G2P A;  3O5E A;  5HT1 A;  3I6C A;  1B6C A;  1C9H A;  3O5I A;  3KZ7 A;  1WNO A;  1NH6 A;  1JNS A;  1KT0 A;  2LPV A;  4Q22 A;  1E6N A;  3CGN A;  2RUR A;  4JFM A;  4IQC A;  5HBF A;  1ROT A;  1M5Y A;  4DWS B;  1XHG A;  2MPH A;  4L3N A;  4DRK A;  2RUD A;  2UZ5 A;  1EDQ A;  1LL6 A;  2RQS A;  1WB0 A;  1FD9 A;  5HWC A;  1FKK A;  5JH8 A;  1ZK6 A;  1NWT A;  5HW7 A;  2KI3 A;  3O5M A;  1ZBC A;  2DT1 A;  3BXW A;  4QZV B;  4JFL A;  1NMV A;  4IT4 A;  3B7X A;  1LJY A;  3RFW A;  1FKD A;  2XP8 A;  4ODO A;  4S3K A;  4ODK A;  4MNK A;  4W9O A;  2XP5 A;  2YBT A;  1H0I A;  1HXV A;  1NWU A;  4LAW A;  2DSV A;  5HW8 A;  4FN2 A;  4NNR A;  3FY1 A;  1QPF A;  2JZV A;  2F2D A;  3O5G A;  3ALG A;  1EYM A;  3NI6 A;  4WIW A;  2M08 A;  1JNE A;  1N1A A;  1W1T A;  4W9Q A;  2DG4 A;  1FKT A;  2ESC A;  2DSZ A;  3RGC A;  4DH0 A;  2OFN A;  1LL7 A;  1WAW A;  4QT3 A;  1LQ0 A;  3JYM A;  4ITZ A;  2WM0 A;  2DPE A;  4G50 A;  3ARQ A;  3UQA A;  3ODK A;  1E15 A;  3MDY B;  2KGJ A;  3ARX A;  1KT1 A;  2PBC A;  1FFR A;  2MF9 A;  1W1P A;  4Z2K A;  3KAB A;  3AS3 A;  3WH0 A;  1D6O A;  1Y0O A;  5HUA A;  1HKK A;  2K8I A;  5DIU A;  2VCD A;  1D2K A;  3WD1 A;  1QPL A;  1ZU8 A;  3O5L A;  4TW8 A;  4WKF A;  1W9U A;  5DEZ A;  2AWG A;  1P5Q A;  2DG3 A;  2RSE A;  4ZPT R;  4Z2I A;  2KO7 A;  1PIN A;  1JND A;  3VAW A;  1GUV A;  3OOB A;  1HKI A;  1U79 A;  2O9O A;  4DRP A;  5J6E A;  2DSU A;  3CH9 A;  2RUQ A;  2M1I A;  4ODQ A;  1ZB5 A;  1FKL A;  3ARO A;  5BXJ A;  2LGO A;  4DWS C;  2ZR6 A;  3NTP A;  5D75 A;  1ITX A;  3KAI A;  4MTV A;  4P8V A;  3TC5 A;  3WQV A;  3KAH A;  4W9P A;  2IUZ A;  2RUC A;  3UI6 A;  2ZQU A;  1NWS A;  2ZQV A;  4DRN A;  3RME A;  2ZQT A;  4O2T A;  1RD6 A;  1L1P A;  4TW6 A;  2KFW A;  1FJD A;  1W26 A;  2ZQS A;  4ZS6 A;  5B8I C;  3ART A;  1E9L A;  4JFJ A;  1J4I A;  2DG9 A;  4NSB A;  1Q6H A;  2D9F A;  1FKF A;  4DRM A;  3CHF A;  4WKA A;  2PV2 A;  4IT6 A;  3WKZ A;  1OGB A;  4R5E A;  2A3A A;  3B9E A;  3KAD A;  4XAK A;  2B31 A;  2AOS A;  2PI6 A;  4ODP A;  4HBE A;  1E6P A;  1HJX A;  4LGX A;  2A3C A;  4Z2H A;  3GPK A;  3FAP A;  1FKJ A;  3G6M A;  2XPA A;  3PR9 A;  2LJ4 A;  4Z2J A;  1Q6I A;  1ZBW A;  2MNT A;  3ALF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...