4HBEA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
TEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
total genus 14
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hbeA00
4HBEA 4HARA 4HBOA
chains in the Genus database with same CATH superfamily
3ALFA 1JNEA 4DROA 2MNTA 1H0IA 4JFLA 1ZBCA 1T11A 4L3NA 4MNMA 2ZQVA 3WL1A 4WKHA 3BMBA 3ALGA 2ZR6A 1J6YA 5HBFA 4KR0B 3IHZA 4HBEA 1K9TA 3PRDA 2YBTA 4S3JA 3FXYA 1LJYA 1Q1CA 4U84A 1FKFA 3RM9A 2EULA 4W5UA 2XP3A 3B9AA 1VF8A 4DWSD 1KT1A 2KFWA 1E44A 1FKJA 3TCZA 4QT3A 3ARUA 1HKMA 2PPNA 3WH0A 1FKTA 1LL7A 3WQVA 4AY1A 1YW5A 3IK8A 2DPEA 2WM0A 1EDQA 3UI5A 2RQSA 1LL4A 1NWSA 3CGNA 3ARYA 2ITKA 2M2AA 1EIBA 4R5EA 2ZQTA 3WD2A 4FAPA 1D2KA 4TW7A 2DT3A 1E6PA 4LAXA 1C9HA 2WLZA 3O5FA 3RM4A 4DRQA 4DRHA 3ARVA 1ROUA 4W9OA 1OGGA 2A3EA 5DF0A 1FKGA 3KZ7A 4MNKA 4Z2IA 3O5DA 1H0GA 4MSPA 2AOSA 3PRBA 3O5IA 4ZPWR 1JCHB 2A3AA 3GTYX 3PR9A 3O5JA 4JFKA 2VN1A 2KR7A 1W9VA 2LGOA 2Y78A 3NRKA 1FKKA 4LGXA 3ARRA 1W9UA 3ARSA 3FAPA 4ODKA 2PV3A 3NTPA 3KAHA 2O9OA 2ESCA 4DWSB 2JZVA 3ARWA 1NH6A 4GIVA 1LG2A 4MNLA 4ITZA 5DIVA 3O5OA 2G8ZA 4N19A 3G6LA 3UI6A 2XPBA 2D9FA 2ZR4A 2XP4A 2PPOA 1ROTA 3TC5A 5HW6A 4XAKA 1FKLA 1W1VA 2DT0A 4DRNA 1W1PA 3G6MA 4DRIA 4IQCA 3B9EA 3CH9A 1WNOA 4DRJA 5HW7A 2DG3A 2FKEA 3FY1A 1JNTA 5GPGA 5HWCA 3KCEA 5I98A 1QZ2A 5DITA 3WD3A 2XP6A 1M5YA 3CHDA 2DT2A 4Q7NA 1ZBKA 1ZBVA 1WB0A 1ZL1A 1SYTA 1J4RA 1W1TA 1L1PA 3JYMA 4JYSA 4NSBA 2FDMA 1XRVA 1ZB5A 2ZQUA 2DG4A 1BKFA 3JXVA 3GPKA 4JFMA 4ODMA 5GPRA 2M08A 1EHNA 1PINA 2KO7A 4HBOA 3CHFA 1N1AA 5GQBA 2PBCA 4DWSC 4S3KA 3B8SA 4JFIA 1QPLA 4BF8A 4WK9A 1FFRA 4ODPA 4GGQA 3MDYB 4NNRA 4Z2GA 3UQBA 4TYOA 3O5RA 4HARA 1Q6IA 3CZ8A 1FKHA 2MLXA 2O92A 1D7JA 1HJXA 4ODOA 4Z2HA 2DSVA 1IX5A 3CHEA 4IPXA 1TFVA 3O5LA 5BXJA 3KADA 4DRPA 1NWTA 3B7XA 4W9PA 2FAPA 1ZU8A 4ODRA 4WKFA 4P8VA 1LG1A 3O5GA 1GUVA 4P8UA 2A3CA 3UF8A 2KI3A 1HKJA 2WLYA 4DWSA 5HUAA 4DIPA 3WD0A 1FKRA 1GPFA 3WIJA 2MPHA 2B5UB 1FJDA 4U86A 5DIUA 3NI6A 4URIA 2RUQA 1R9HA 2RUCA 2LPVA 2PN0A 2DT1A 1Q6HA 4MTVA 4TW8A 4Q22A 1ZCNA 3UI4A 4QIBA 2DSZA 2Q5AA 1QPFA 3KACA 1UR8A 2KGJA 5HTGA 2MLYA 3O5PA 3O5EA 3ODKA 5JH8A 2YBUA 1W1YA 4P8WA 4DT4A 3RGCA 2F23A 4W9QA 1OWQA 2M1IA 3ARPA 4MPKA 1NMWA 1RD6A 1ITXA 3AROA 3CHCA 1D7IA 2F2DA 4R0XA 3RFWA 2WK2A 3JYJA 4P8XA 2QF8A 4IQ2A 4DRMA 3OOBA 3GU0A 3AS2A 5D75A 5HWBA 3PA7A 4WIWA 1FKIA 1E15A 2F21A 1FAPA 4LAYA 2ZR5A 4Z2LA 2ZQSA 1ZBWA 5J6EA 5HKGA 1HJVA 4DH0A 4UDMA 1X6NA 4MNJA 1E6ZA 2IUZA 4NZCA 3RMEA 1LL6A 3CGMA 1GOIA 5DEZA 3VAWA 4WKAA 4G50A 2ETNA 3EIPA 2XP5A 2RURA 3IKGA 4ZPVR 1NWUA 4L72B 3WD4A 2AWGA 1NWRA 3ARTA 1HKIA 4C02B 1O6IA 1WAWA 4DZ3A 4ZPTR 1J4HA 3AS1A 1XHGA 2PI6A 1U79A 2F4EA 2RSEA 1HKKA 2MLZA 1NMVA 1SR0A 3BXWA 3EY6A 1JNSA 1HJWA 1YATA 3WQWA 4G2PA 3UQIA 1Y0OA 4Z2KA 2G41A 1LQ0A 3AS0A 4JFJA 4IT6A 3WKZA 4LAVA 4MGVA 3O5KA 1W26A 2XP8A 4ZS6A 3UQAA 1X6LA 1E6NA 4IT4A 3OA5A 3ARQA 1B6CA 3ARXA 3IKDA 1NSGA 1CTNA 1EYMA 2OLHA 4LAWA 2XPAA 1EQ3A 1E9LA 1F40A 1OGBA 4KQZA 4Z2JA 2B31A 1D7HA 2PPPA 1FKDA 2XP7A 5HT1A 2DSWA 2LJ4A 2A3BA 3ARZA 3PRAA 1E6RA 4FN2A 1JNDA 3TDBA 4DZ2A 1Q6UA 2OFNA 1UR9A 3RM8A 1ZK6A 2IF4A 3KAFA 4TW6A 3H9RB 1P5QA 4WJXA 3I6CA 4U85A 3O5QA 1W9PA 4O2TA 4TNSA 2MF9A 4J4NA 1GRJA 4QT2A 4TX0A 4ODQA 2DG9A 4ODNA 1KFWA 1A7XA 2RUDA 1BL4A 2UZ5A 3KAIA 1D6OA 1TCOC 5HW8A 2P4VA 4ODLA 4DRKA 2PV2A 3AS3A 2L2SA 2N87A 1FKSA 2LKNA 4QZVB 2DSUA 3QOKA 3LUOA 2K8IA 2PV1A 3O5MA 1F8AB 2VCDA 1J4IA 5B8IC 1HXVA 4MAVA 3KAGA 4PTMA 1FD9A 1FFQA 3B9DA 3KABA 4ML4A 5DO2A 3WD1A 3WL0A 1FKBA 4J4OA 3W4RA 3AQUA 1PBKA 2KE0A 2XP9A 1KT0A 1JVWA
chains in the Genus database with same CATH topology
3ALFA 1JNEA 4DROA 2MNTA 1H0IA 4JFLA 1ZBCA 1T11A 4L3NA 4MNMA 2ZQVA 3WL1A 4WKHA 3ALGA 2ZR6A 1J6YA 5HBFA 4KR0B 3IHZA 4HBEA 1K9TA 3PRDA 2YBTA 4S3JA 3FXYA 1LJYA 1Q1CA 4U84A 1FKFA 3RM9A 4W5UA 2XP3A 3B9AA 1VF8A 4DWSD 1KT1A 2KFWA 1FKJA 3TCZA 4QT3A 3ARUA 1HKMA 2PPNA 3WH0A 1FKTA 1LL7A 3WQVA 4AY1A 1YW5A 3IK8A 2DPEA 2WM0A 1EDQA 3UI5A 2RQSA 1LL4A 1NWSA 3CGNA 3ARYA 2ITKA 2M2AA 1EIBA 4R5EA 2ZQTA 3WD2A 4FAPA 1D2KA 4TW7A 2DT3A 1E6PA 4LAXA 1C9HA 2WLZA 3O5FA 3RM4A 4DRQA 4DRHA 3ARVA 1ROUA 4W9OA 1OGGA 2A3EA 5DF0A 1FKGA 3KZ7A 4MNKA 4Z2IA 3O5DA 1H0GA 4MSPA 2AOSA 3PRBA 3O5IA 4ZPWR 3PR9A 2A3AA 3O5JA 4JFKA 2VN1A 2KR7A 1W9VA 2LGOA 2Y78A 3NRKA 1FKKA 4LGXA 3ARRA 1W9UA 3ARSA 3FAPA 4ODKA 2PV3A 3NTPA 3KAHA 2O9OA 2ESCA 4DWSB 2JZVA 3ARWA 1NH6A 4GIVA 1LG2A 4MNLA 4ITZA 5DIVA 3O5OA 2G8ZA 4N19A 3G6LA 3UI6A 2XPBA 2D9FA 2ZR4A 2XP4A 2PPOA 1ROTA 3TC5A 5HW6A 4XAKA 1FKLA 1W1VA 2DT0A 4DRNA 1W1PA 3G6MA 4DRIA 4IQCA 3B9EA 3CH9A 1WNOA 4DRJA 5HW7A 2DG3A 2FKEA 3FY1A 1JNTA 5GPGA 5HWCA 3KCEA 5I98A 1QZ2A 5DITA 3WD3A 2XP6A 1M5YA 3CHDA 2DT2A 4Q7NA 1ZBKA 1ZBVA 1WB0A 1ZL1A 1SYTA 1J4RA 1W1TA 1L1PA 3JYMA 4JYSA 4NSBA 2FDMA 1XRVA 1ZB5A 2ZQUA 2DG4A 1BKFA 3JXVA 3GPKA 4JFMA 4ODMA 5GPRA 2M08A 1EHNA 1PINA 2KO7A 4HBOA 3CHFA 1N1AA 5GQBA 2PBCA 4DWSC 4S3KA 3B8SA 4JFIA 1QPLA 4BF8A 4WK9A 1FFRA 4ODPA 4GGQA 3MDYB 4NNRA 4Z2GA 3UQBA 4TYOA 3O5RA 4HARA 1Q6IA 3CZ8A 1FKHA 2MLXA 2O92A 1D7JA 1HJXA 4ODOA 4Z2HA 2DSVA 1IX5A 3CHEA 4IPXA 1TFVA 3O5LA 5BXJA 3KADA 4DRPA 1NWTA 3B7XA 4W9PA 2FAPA 1ZU8A 4ODRA 4WKFA 4P8VA 1LG1A 3O5GA 1GUVA 4P8UA 2A3CA 3UF8A 2KI3A 1HKJA 2WLYA 4DWSA 5HUAA 4DIPA 3WD0A 1FKRA 1GPFA 3WIJA 2MPHA 1FJDA 4U86A 5DIUA 3NI6A 4URIA 2RUQA 1R9HA 2RUCA 2LPVA 2DT1A 1Q6HA 4MTVA 4TW8A 4Q22A 1ZCNA 3UI4A 4QIBA 2DSZA 2Q5AA 1QPFA 3KACA 1UR8A 2KGJA 5HTGA 2MLYA 3O5PA 3O5EA 3ODKA 5JH8A 2YBUA 1W1YA 4P8WA 4DT4A 3RGCA 4W9QA 1OWQA 2M1IA 3ARPA 4MPKA 1NMWA 1RD6A 1ITXA 3AROA 3CHCA 1D7IA 2F2DA 4R0XA 3RFWA 2WK2A 3JYJA 4P8XA 2QF8A 4IQ2A 4DRMA 3OOBA 3AS2A 5D75A 5HWBA 3PA7A 4WIWA 1FKIA 1E15A 2F21A 1FAPA 4LAYA 2ZR5A 4Z2LA 2ZQSA 1ZBWA 5J6EA 5HKGA 1HJVA 4DH0A 1X6NA 4MNJA 1E6ZA 2IUZA 4NZCA 3RMEA 1LL6A 3CGMA 1GOIA 5DEZA 3VAWA 4WKAA 4G50A 3IKGA 2XP5A 2RURA 4ZPVR 1NWUA 4L72B 3WD4A 2AWGA 1NWRA 3ARTA 1HKIA 4C02B 1O6IA 1WAWA 4DZ3A 4ZPTR 1J4HA 3AS1A 1XHGA 2PI6A 1U79A 2F4EA 2RSEA 1HKKA 2MLZA 1NMVA 1SR0A 3BXWA 3EY6A 1JNSA 1HJWA 1YATA 3WQWA 4G2PA 3UQIA 1Y0OA 4Z2KA 2G41A 1LQ0A 3AS0A 4JFJA 4IT6A 3WKZA 4LAVA 4MGVA 3O5KA 1W26A 2XP8A 4ZS6A 3UQAA 1X6LA 1E6NA 4IT4A 3OA5A 3ARQA 1B6CA 3ARXA 3IKDA 1NSGA 1CTNA 1EYMA 2OLHA 4LAWA 2XPAA 1EQ3A 1E9LA 1F40A 1OGBA 4KQZA 4Z2JA 2B31A 1D7HA 2PPPA 1FKDA 2XP7A 5HT1A 2DSWA 2LJ4A 2A3BA 3ARZA 3PRAA 1E6RA 4FN2A 1JNDA 3TDBA 4DZ2A 1Q6UA 2OFNA 1UR9A 3RM8A 1ZK6A 2IF4A 3KAFA 4TW6A 3H9RB 1P5QA 4WJXA 3I6CA 4U85A 3O5QA 1W9PA 4O2TA 4TNSA 2MF9A 4J4NA 4QT2A 4TX0A 4ODQA 2DG9A 4ODNA 1KFWA 1A7XA 2RUDA 1BL4A 2UZ5A 3KAIA 1D6OA 1TCOC 5HW8A 4ODLA 4DRKA 2PV2A 3AS3A 2L2SA 2N87A 1FKSA 2LKNA 4QZVB 2DSUA 3QOKA 3LUOA 2K8IA 2PV1A 3O5MA 1F8AB 2VCDA 1J4IA 5B8IC 1HXVA 4MAVA 3KAGA 4PTMA 1FD9A 1FFQA 3B9DA 3KABA 4ML4A 5DO2A 3WD1A 3WL0A 1FKBA 4J4OA 3W4RA 3AQUA 1PBKA 2KE0A 2XP9A 1KT0A 1JVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBE A;  4HAR A;  4HBO A; 
#chains in the Genus database with same CATH topology
 3ALF A;  1JNE A;  4DRO A;  2MNT A;  1H0I A;  4JFL A;  1ZBC A;  1T11 A;  4L3N A;  4MNM A;  2ZQV A;  3WL1 A;  4WKH A;  3BMB A;  3ALG A;  2ZR6 A;  1J6Y A;  5HBF A;  4KR0 B;  3IHZ A;  4HBE A;  1K9T A;  3PRD A;  2YBT A;  4S3J A;  3FXY A;  1LJY A;  1Q1C A;  4U84 A;  1FKF A;  3RM9 A;  2EUL A;  4W5U A;  2XP3 A;  3B9A A;  1VF8 A;  4DWS D;  1KT1 A;  2KFW A;  1E44 A;  1FKJ A;  3TCZ A;  4QT3 A;  3ARU A;  1HKM A;  2PPN A;  3WH0 A;  1FKT A;  1LL7 A;  3WQV A;  4AY1 A;  1YW5 A;  3IK8 A;  2DPE A;  2WM0 A;  1EDQ A;  3UI5 A;  2RQS A;  1LL4 A;  1NWS A;  3CGN A;  3ARY A;  2ITK A;  2M2A A;  1EIB A;  4R5E A;  2ZQT A;  3WD2 A;  4FAP A;  1D2K A;  4TW7 A;  2DT3 A;  1E6P A;  4LAX A;  1C9H A;  2WLZ A;  3O5F A;  3RM4 A;  4DRQ A;  4DRH A;  3ARV A;  1ROU A;  4W9O A;  1OGG A;  2A3E A;  5DF0 A;  1FKG A;  3KZ7 A;  4MNK A;  4Z2I A;  3O5D A;  1H0G A;  4MSP A;  2AOS A;  3PRB A;  3O5I A;  4ZPW R;  1JCH B;  2A3A A;  3GTY X;  3PR9 A;  3O5J A;  4JFK A;  2VN1 A;  2KR7 A;  1W9V A;  2LGO A;  2Y78 A;  3NRK A;  1FKK A;  4LGX A;  3ARR A;  1W9U A;  3ARS A;  3FAP A;  4ODK A;  2PV3 A;  3NTP A;  3KAH A;  2O9O A;  2ESC A;  4DWS B;  2JZV A;  3ARW A;  1NH6 A;  4GIV A;  1LG2 A;  4MNL A;  4ITZ A;  5DIV A;  3O5O A;  2G8Z A;  4N19 A;  3G6L A;  3UI6 A;  2XPB A;  2D9F A;  2ZR4 A;  2XP4 A;  2PPO A;  1ROT A;  3TC5 A;  5HW6 A;  4XAK A;  1FKL A;  1W1V A;  2DT0 A;  4DRN A;  1W1P A;  3G6M A;  4DRI A;  4IQC A;  3B9E A;  3CH9 A;  1WNO A;  4DRJ A;  5HW7 A;  2DG3 A;  2FKE A;  3FY1 A;  1JNT A;  5GPG A;  5HWC A;  3KCE A;  5I98 A;  1QZ2 A;  5DIT A;  3WD3 A;  2XP6 A;  1M5Y A;  3CHD A;  2DT2 A;  4Q7N A;  1ZBK A;  1ZBV A;  1WB0 A;  1ZL1 A;  1SYT A;  1J4R A;  1W1T A;  1L1P A;  3JYM A;  4JYS A;  4NSB A;  2FDM A;  1XRV A;  1ZB5 A;  2ZQU A;  2DG4 A;  1BKF A;  3JXV A;  3GPK A;  4JFM A;  4ODM A;  5GPR A;  2M08 A;  1EHN A;  1PIN A;  2KO7 A;  4HBO A;  3CHF A;  1N1A A;  5GQB A;  2PBC A;  4DWS C;  4S3K A;  3B8S A;  4JFI A;  1QPL A;  4BF8 A;  4WK9 A;  1FFR A;  4ODP A;  4GGQ A;  3MDY B;  4NNR A;  4Z2G A;  3UQB A;  4TYO A;  3O5R A;  4HAR A;  1Q6I A;  3CZ8 A;  1FKH A;  2MLX A;  2O92 A;  1D7J A;  1HJX A;  4ODO A;  4Z2H A;  2DSV A;  1IX5 A;  3CHE A;  4IPX A;  1TFV A;  3O5L A;  5BXJ A;  3KAD A;  4DRP A;  1NWT A;  3B7X A;  4W9P A;  2FAP A;  1ZU8 A;  4ODR A;  4WKF A;  4P8V A;  1LG1 A;  3O5G A;  1GUV A;  4P8U A;  2A3C A;  3UF8 A;  2KI3 A;  1HKJ A;  2WLY A;  4DWS A;  5HUA A;  4DIP A;  3WD0 A;  1FKR A;  1GPF A;  3WIJ A;  2MPH A;  2B5U B;  1FJD A;  4U86 A;  5DIU A;  3NI6 A;  4URI A;  2RUQ A;  1R9H A;  2RUC A;  2LPV A;  2PN0 A;  2DT1 A;  1Q6H A;  4MTV A;  4TW8 A;  4Q22 A;  1ZCN A;  3UI4 A;  4QIB A;  2DSZ A;  2Q5A A;  1QPF A;  3KAC A;  1UR8 A;  2KGJ A;  5HTG A;  2MLY A;  3O5P A;  3O5E A;  3ODK A;  5JH8 A;  2YBU A;  1W1Y A;  4P8W A;  4DT4 A;  3RGC A;  2F23 A;  4W9Q A;  1OWQ A;  2M1I A;  3ARP A;  4MPK A;  1NMW A;  1RD6 A;  1ITX A;  3ARO A;  3CHC A;  1D7I A;  2F2D A;  4R0X A;  3RFW A;  2WK2 A;  3JYJ A;  4P8X A;  2QF8 A;  4IQ2 A;  4DRM A;  3OOB A;  3GU0 A;  3AS2 A;  5D75 A;  5HWB A;  3PA7 A;  4WIW A;  1FKI A;  1E15 A;  2F21 A;  1FAP A;  4LAY A;  2ZR5 A;  4Z2L A;  2ZQS A;  1ZBW A;  5J6E A;  5HKG A;  1HJV A;  4DH0 A;  4UDM A;  1X6N A;  4MNJ A;  1E6Z A;  2IUZ A;  4NZC A;  3RME A;  1LL6 A;  3CGM A;  1GOI A;  5DEZ A;  3VAW A;  4WKA A;  4G50 A;  2ETN A;  3EIP A;  2XP5 A;  2RUR A;  3IKG A;  4ZPV R;  1NWU A;  4L72 B;  3WD4 A;  2AWG A;  1NWR A;  3ART A;  1HKI A;  4C02 B;  1O6I A;  1WAW A;  4DZ3 A;  4ZPT R;  1J4H A;  3AS1 A;  1XHG A;  2PI6 A;  1U79 A;  2F4E A;  2RSE A;  1HKK A;  2MLZ A;  1NMV A;  1SR0 A;  3BXW A;  3EY6 A;  1JNS A;  1HJW A;  1YAT A;  3WQW A;  4G2P A;  3UQI A;  1Y0O A;  4Z2K A;  2G41 A;  1LQ0 A;  3AS0 A;  4JFJ A;  4IT6 A;  3WKZ A;  4LAV A;  4MGV A;  3O5K A;  1W26 A;  2XP8 A;  4ZS6 A;  3UQA A;  1X6L A;  1E6N A;  4IT4 A;  3OA5 A;  3ARQ A;  1B6C A;  3ARX A;  3IKD A;  1NSG A;  1CTN A;  1EYM A;  2OLH A;  4LAW A;  2XPA A;  1EQ3 A;  1E9L A;  1F40 A;  1OGB A;  4KQZ A;  4Z2J A;  2B31 A;  1D7H A;  2PPP A;  1FKD A;  2XP7 A;  5HT1 A;  2DSW A;  2LJ4 A;  2A3B A;  3ARZ A;  3PRA A;  1E6R A;  4FN2 A;  1JND A;  3TDB A;  4DZ2 A;  1Q6U A;  2OFN A;  1UR9 A;  3RM8 A;  1ZK6 A;  2IF4 A;  3KAF A;  4TW6 A;  3H9R B;  1P5Q A;  4WJX A;  3I6C A;  4U85 A;  3O5Q A;  1W9P A;  4O2T A;  4TNS A;  2MF9 A;  4J4N A;  1GRJ A;  4QT2 A;  4TX0 A;  4ODQ A;  2DG9 A;  4ODN A;  1KFW A;  1A7X A;  2RUD A;  1BL4 A;  2UZ5 A;  3KAI A;  1D6O A;  1TCO C;  5HW8 A;  2P4V A;  4ODL A;  4DRK A;  2PV2 A;  3AS3 A;  2L2S A;  2N87 A;  1FKS A;  2LKN A;  4QZV B;  2DSU A;  3QOK A;  3LUO A;  2K8I A;  2PV1 A;  3O5M A;  1F8A B;  2VCD A;  1J4I A;  5B8I C;  1HXV A;  4MAV A;  3KAG A;  4PTM A;  1FD9 A;  1FFQ A;  3B9D A;  3KAB A;  4ML4 A;  5DO2 A;  3WD1 A;  3WL0 A;  1FKB A;  4J4O A;  3W4R A;  3AQU A;  1PBK A;  2KE0 A;  2XP9 A;  1KT0 A;  1JVW A; 
#chains in the Genus database with same CATH homology
 3ALF A;  1JNE A;  4DRO A;  2MNT A;  1H0I A;  4JFL A;  1ZBC A;  1T11 A;  4L3N A;  4MNM A;  2ZQV A;  3WL1 A;  4WKH A;  3ALG A;  2ZR6 A;  1J6Y A;  5HBF A;  4KR0 B;  3IHZ A;  4HBE A;  1K9T A;  3PRD A;  2YBT A;  4S3J A;  3FXY A;  1LJY A;  1Q1C A;  4U84 A;  1FKF A;  3RM9 A;  4W5U A;  2XP3 A;  3B9A A;  1VF8 A;  4DWS D;  1KT1 A;  2KFW A;  1FKJ A;  3TCZ A;  4QT3 A;  3ARU A;  1HKM A;  2PPN A;  3WH0 A;  1FKT A;  1LL7 A;  3WQV A;  4AY1 A;  1YW5 A;  3IK8 A;  2DPE A;  2WM0 A;  1EDQ A;  3UI5 A;  2RQS A;  1LL4 A;  1NWS A;  3CGN A;  3ARY A;  2ITK A;  2M2A A;  1EIB A;  4R5E A;  2ZQT A;  3WD2 A;  4FAP A;  1D2K A;  4TW7 A;  2DT3 A;  1E6P A;  4LAX A;  1C9H A;  2WLZ A;  3O5F A;  3RM4 A;  4DRQ A;  4DRH A;  3ARV A;  1ROU A;  4W9O A;  1OGG A;  2A3E A;  5DF0 A;  1FKG A;  3KZ7 A;  4MNK A;  4Z2I A;  3O5D A;  1H0G A;  4MSP A;  2AOS A;  3PRB A;  3O5I A;  4ZPW R;  3PR9 A;  2A3A A;  3O5J A;  4JFK A;  2VN1 A;  2KR7 A;  1W9V A;  2LGO A;  2Y78 A;  3NRK A;  1FKK A;  4LGX A;  3ARR A;  1W9U A;  3ARS A;  3FAP A;  4ODK A;  2PV3 A;  3NTP A;  3KAH A;  2O9O A;  2ESC A;  4DWS B;  2JZV A;  3ARW A;  1NH6 A;  4GIV A;  1LG2 A;  4MNL A;  4ITZ A;  5DIV A;  3O5O A;  2G8Z A;  4N19 A;  3G6L A;  3UI6 A;  2XPB A;  2D9F A;  2ZR4 A;  2XP4 A;  2PPO A;  1ROT A;  3TC5 A;  5HW6 A;  4XAK A;  1FKL A;  1W1V A;  2DT0 A;  4DRN A;  1W1P A;  3G6M A;  4DRI A;  4IQC A;  3B9E A;  3CH9 A;  1WNO A;  4DRJ A;  5HW7 A;  2DG3 A;  2FKE A;  3FY1 A;  1JNT A;  5GPG A;  5HWC A;  3KCE A;  5I98 A;  1QZ2 A;  5DIT A;  3WD3 A;  2XP6 A;  1M5Y A;  3CHD A;  2DT2 A;  4Q7N A;  1ZBK A;  1ZBV A;  1WB0 A;  1ZL1 A;  1SYT A;  1J4R A;  1W1T A;  1L1P A;  3JYM A;  4JYS A;  4NSB A;  2FDM A;  1XRV A;  1ZB5 A;  2ZQU A;  2DG4 A;  1BKF A;  3JXV A;  3GPK A;  4JFM A;  4ODM A;  5GPR A;  2M08 A;  1EHN A;  1PIN A;  2KO7 A;  4HBO A;  3CHF A;  1N1A A;  5GQB A;  2PBC A;  4DWS C;  4S3K A;  3B8S A;  4JFI A;  1QPL A;  4BF8 A;  4WK9 A;  1FFR A;  4ODP A;  4GGQ A;  3MDY B;  4NNR A;  4Z2G A;  3UQB A;  4TYO A;  3O5R A;  4HAR A;  1Q6I A;  3CZ8 A;  1FKH A;  2MLX A;  2O92 A;  1D7J A;  1HJX A;  4ODO A;  4Z2H A;  2DSV A;  1IX5 A;  3CHE A;  4IPX A;  1TFV A;  3O5L A;  5BXJ A;  3KAD A;  4DRP A;  1NWT A;  3B7X A;  4W9P A;  2FAP A;  1ZU8 A;  4ODR A;  4WKF A;  4P8V A;  1LG1 A;  3O5G A;  1GUV A;  4P8U A;  2A3C A;  3UF8 A;  2KI3 A;  1HKJ A;  2WLY A;  4DWS A;  5HUA A;  4DIP A;  3WD0 A;  1FKR A;  1GPF A;  3WIJ A;  2MPH A;  1FJD A;  4U86 A;  5DIU A;  3NI6 A;  4URI A;  2RUQ A;  1R9H A;  2RUC A;  2LPV A;  2DT1 A;  1Q6H A;  4MTV A;  4TW8 A;  4Q22 A;  1ZCN A;  3UI4 A;  4QIB A;  2DSZ A;  2Q5A A;  1QPF A;  3KAC A;  1UR8 A;  2KGJ A;  5HTG A;  2MLY A;  3O5P A;  3O5E A;  3ODK A;  5JH8 A;  2YBU A;  1W1Y A;  4P8W A;  4DT4 A;  3RGC A;  4W9Q A;  1OWQ A;  2M1I A;  3ARP A;  4MPK A;  1NMW A;  1RD6 A;  1ITX A;  3ARO A;  3CHC A;  1D7I A;  2F2D A;  4R0X A;  3RFW A;  2WK2 A;  3JYJ A;  4P8X A;  2QF8 A;  4IQ2 A;  4DRM A;  3OOB A;  3AS2 A;  5D75 A;  5HWB A;  3PA7 A;  4WIW A;  1FKI A;  1E15 A;  2F21 A;  1FAP A;  4LAY A;  2ZR5 A;  4Z2L A;  2ZQS A;  1ZBW A;  5J6E A;  5HKG A;  1HJV A;  4DH0 A;  1X6N A;  4MNJ A;  1E6Z A;  2IUZ A;  4NZC A;  3RME A;  1LL6 A;  3CGM A;  1GOI A;  5DEZ A;  3VAW A;  4WKA A;  4G50 A;  3IKG A;  2XP5 A;  2RUR A;  4ZPV R;  1NWU A;  4L72 B;  3WD4 A;  2AWG A;  1NWR A;  3ART A;  1HKI A;  4C02 B;  1O6I A;  1WAW A;  4DZ3 A;  4ZPT R;  1J4H A;  3AS1 A;  1XHG A;  2PI6 A;  1U79 A;  2F4E A;  2RSE A;  1HKK A;  2MLZ A;  1NMV A;  1SR0 A;  3BXW A;  3EY6 A;  1JNS A;  1HJW A;  1YAT A;  3WQW A;  4G2P A;  3UQI A;  1Y0O A;  4Z2K A;  2G41 A;  1LQ0 A;  3AS0 A;  4JFJ A;  4IT6 A;  3WKZ A;  4LAV A;  4MGV A;  3O5K A;  1W26 A;  2XP8 A;  4ZS6 A;  3UQA A;  1X6L A;  1E6N A;  4IT4 A;  3OA5 A;  3ARQ A;  1B6C A;  3ARX A;  3IKD A;  1NSG A;  1CTN A;  1EYM A;  2OLH A;  4LAW A;  2XPA A;  1EQ3 A;  1E9L A;  1F40 A;  1OGB A;  4KQZ A;  4Z2J A;  2B31 A;  1D7H A;  2PPP A;  1FKD A;  2XP7 A;  5HT1 A;  2DSW A;  2LJ4 A;  2A3B A;  3ARZ A;  3PRA A;  1E6R A;  4FN2 A;  1JND A;  3TDB A;  4DZ2 A;  1Q6U A;  2OFN A;  1UR9 A;  3RM8 A;  1ZK6 A;  2IF4 A;  3KAF A;  4TW6 A;  3H9R B;  1P5Q A;  4WJX A;  3I6C A;  4U85 A;  3O5Q A;  1W9P A;  4O2T A;  4TNS A;  2MF9 A;  4J4N A;  4QT2 A;  4TX0 A;  4ODQ A;  2DG9 A;  4ODN A;  1KFW A;  1A7X A;  2RUD A;  1BL4 A;  2UZ5 A;  3KAI A;  1D6O A;  1TCO C;  5HW8 A;  4ODL A;  4DRK A;  2PV2 A;  3AS3 A;  2L2S A;  2N87 A;  1FKS A;  2LKN A;  4QZV B;  2DSU A;  3QOK A;  3LUO A;  2K8I A;  2PV1 A;  3O5M A;  1F8A B;  2VCD A;  1J4I A;  5B8I C;  1HXV A;  4MAV A;  3KAG A;  4PTM A;  1FD9 A;  1FFQ A;  3B9D A;  3KAB A;  4ML4 A;  5DO2 A;  3WD1 A;  3WL0 A;  1FKB A;  4J4O A;  3W4R A;  3AQU A;  1PBK A;  2KE0 A;  2XP9 A;  1KT0 A;  1JVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...