4HBEA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
TEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 14
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hbeA00
4HARA 4HBEA 4HBOA
chains in the Genus database with same CATH superfamily
1JCHB 2DT0A 3KACA 4W5UA 1FKLA 1D6OA 4LAWA 1NSGA 2KE0A 3RFWA 1JNDA 4MAVA 2PV2A 3WD0A 1LQ0A 3CHFA 3WQVA 1QPLA 4MNLA 4ZPTR 1ZU8A 3RM4A 4GGQA 2MNTA 3RM8A 1E6NA 2LGOA 1YW5A 4DT4A 3UI5A 3O5LA 4NSBA 1LL6A 4DH0A 1YATA 3CHCA 3FY1A 4XAKA 3ARUA 2F4EA 2MLYA 3EIPA 5HTGA 4TYOA 1FFQA 3FXYA 4JYSA 3O5IA 2PI6A 5HWCA 4ODMA 4QT3A 3ARTA 4ODLA 5JH8A 2XP6A 2MLXA 3ARQA 3MDYB 2PPNA 2WLYA 1LG1A 4QT2A 4N19A 4DWSC 2MPHA 4ODNA 1ZL1A 3ARVA 2IF4A 3UQBA 1NWTA 5HT1A 1NWRA 1EIBA 3PRAA 1JNTA 1J6YA 5D75A 1E6RA 2IUZA 4URIA 3O5PA 1FKJA 1JNEA 2G8ZA 2KI3A 3AS3A 4J4OA 3WIJA 1L1PA 2LKNA 4DRKA 2DSWA 1IX5A 1TFVA 2LPVA 1XHGA 4MGVA 3CHEA 3AQUA 4W9OA 1D7HA 1W9PA 1W9VA 3ARWA 1GPFA 1WNOA 3WD1A 4IQCA 2RUCA 3NRKA 4C02B 1FKGA 2FAPA 2UZ5A 2L2SA 2WLZA 3ARZA 4LAVA 3FAPA 4HARA 2ZQTA 5HWBA 4P8VA 1NMWA 2F2DA 1ITXA 2WK2A 1ROTA 2Y78A 4IT4A 2LJ4A 3IKDA 2O9OA 4DRIA 1J4HA 1F8AB 2KO7A 4ZPWR 2RUQA 1FKRA 1FFRA 2ZQUA 2DT1A 2P4VA 3B8SA 4DRHA 3ALGA 1FKFA 1ZBVA 5DF0A 4Z2HA 1OWQA 4WKHA 2DPEA 2DSUA 3QOKA 3ARSA 4Q7NA 1E6ZA 3O5DA 4Z2KA 3O5EA 4KQZA 3RGCA 3B7XA 4MNJA 3B9EA 1Q1CA 1D7IA 4DZ2A 3WD2A 4TX0A 4Z2LA 4ITZA 1JVWA 3ARYA 3CHDA 5GQBA 2XPAA 1LL7A 2M2AA 4IT6A 4JFMA 2M1IA 2PV3A 4Q22A 4ODPA 3ARRA 2A3CA 3ARXA 4P8WA 4JFIA 3JYJA 1EDQA 3CZ8A 3ALFA 3ODKA 2VCDA 5DITA 4FN2A 3UI6A 4Z2IA 2DSVA 1HXVA 4LGXA 2ZR5A 3RMEA 4ODKA 3WD4A 1H0IA 2YBUA 3AS0A 4MNKA 1NH6A 4HBEA 3RM9A 1PBKA 4ML4A 4JFKA 1LG2A 2XP9A 1E15A 4IQ2A 4U84A 2AOSA 2DG9A 4U85A 3B9DA 1EHNA 3OOBA 4DWSB 5DO2A 5DIVA 3CGNA 5J6EA 4S3JA 3O5RA 4DRNA 5HUAA 2N87A 5DIUA 3VAWA 3PR9A 3GTYX 2EULA 3G6MA 1FJDA 1OGBA 3O5OA 1TCOC 3PA7A 3PRBA 1N1AA 2KFWA 4AY1A 3H9RB 4FAPA 3WL1A 1C9HA 1W9UA 3WH0A 3OA5A 4S3KA 3NTPA 1FKTA 4DZ3A 5BXJA 4QZVB 4W9PA 4LAXA 2B31A 1WAWA 4GIVA 2FDMA 4DWSA 3KADA 1HJXA 5I98A 2XP4A 3CGMA 5HW7A 4ZS6A 2JZVA 2DSZA 3KAGA 2ESCA 1OGGA 3KAFA 4WJXA 1J4RA 4W9QA 1LL4A 2QF8A 3IHZA 4BF8A 1E44A 4JFLA 5GPGA 4LAYA 4DIPA 1O6IA 3KAIA 1LJYA 2PN0A 4DRQA 4HBOA 1KFWA 1X6NA 2XP3A 3UI4A 4KR0B 1K9TA 4ODRA 3WL0A 3G6LA 3WKZA 2D9FA 1FD9A 3AROA 4PTMA 2OLHA 1P5QA 3WQWA 3PRDA 4G2PA 3NI6A 4ODQA 3O5JA 4NZCA 1UR8A 5HW8A 3TC5A 3O5FA 3O5MA 1XRVA 3KCEA 1EYMA 4U86A 5HBFA 1HJVA 4DROA 3WD3A 2PV1A 4Z2GA 1W1YA 2KGJA 4TW8A 3IK8A 3O5KA 2MLZA 3KABA 1BKFA 4IPXA 1ROUA 2A3AA 2ZR4A 1FKSA 1FAPA 1H0GA 4WKAA 2Q5AA 1NWSA 4WK9A 4NNRA 1GOIA 1FKDA 2F21A 1B6CA 2OFNA 1J4IA 3UQIA 1NMVA 3GPKA 1PINA 1U79A 4TW6A 3JXVA 1W26A 4WKFA 3W4RA 5HKGA 4DWSD 1F40A 2F23A 1D2KA 1FKBA 1E9LA 1QZ2A 2XP7A 4Z2JA 1GUVA 4MPKA 4TW7A 1WB0A 2FKEA 2A3EA 4P8UA 1ZB5A 2XP5A 2DG4A 2G41A 3B9AA 1ZBCA 2XPBA 4JFJA 2M08A 2MF9A 2DT3A 2RQSA 5B8IC 1EQ3A 2YBTA 2RUDA 2RURA 2KR7A 1Q6HA 2K8IA 3TCZA 1UR9A 3KAHA 1X6LA 1HKMA 3UQAA 1Q6UA 2ZQVA 4DRPA 3ARPA 1HJWA 3CH9A 3O5QA 5GPRA 1FKKA 3TDBA 1W1TA 1BL4A 2O92A 4R0XA 1HKKA 3JYMA 1W1VA 1D7JA 1FKIA 2WM0A 3BXWA 1NWUA 4TNSA 2ZQSA 3AS1A 4DRMA 3LUOA 2ETNA 1GRJA 1ZBKA 3AS2A 4O2TA 1JNSA 4G50A 4QIBA 2PPOA 1R9HA 1ZCNA 1Y0OA 2DG3A 1M5YA 4MSPA 2DT2A 2RSEA 2PPPA 1KT0A 1ZK6A 1HKJA 3IKGA 4UDMA 4R5EA 1T11A 2A3BA 2ITKA 3BMBA 4P8XA 2PBCA 2ZR6A 4ZPVR 2VN1A 1HKIA 1A7XA 1ZBWA 1QPFA 4L3NA 4J4NA 1KT1A 1SR0A 1RD6A 2B5UB 3EY6A 1E6PA 2AWGA 3GU0A 3KZ7A 1CTNA 5DEZA 3I6CA 1W1PA 1VF8A 5HW6A 4MNMA 4L72B 4ODOA 1SYTA 2XP8A 1Q6IA 3UF8A 4DRJA 4WIWA 4MTVA 1FKHA 3O5GA
chains in the Genus database with same CATH topology
2DT0A 3KACA 4W5UA 1FKLA 1D6OA 4LAWA 1NSGA 2KE0A 3RFWA 1JNDA 4MAVA 2PV2A 3WD0A 1LQ0A 3CHFA 3WQVA 1QPLA 4MNLA 4ZPTR 1ZU8A 3RM4A 4GGQA 2MNTA 3RM8A 1E6NA 2LGOA 1YW5A 4DT4A 3UI5A 3O5LA 4NSBA 1LL6A 4DH0A 1YATA 3CHCA 3FY1A 4XAKA 3ARUA 2F4EA 2MLYA 5HTGA 4TYOA 1FFQA 3FXYA 4JYSA 3O5IA 2PI6A 5HWCA 4ODMA 4QT3A 3ARTA 4ODLA 5JH8A 2XP6A 2MLXA 3ARQA 3MDYB 2PPNA 2WLYA 1LG1A 4QT2A 4N19A 4DWSC 2MPHA 4ODNA 1ZL1A 3ARVA 2IF4A 3UQBA 1NWTA 5HT1A 1NWRA 1EIBA 3PRAA 1JNTA 1J6YA 5D75A 1E6RA 2IUZA 4URIA 3O5PA 1FKJA 1JNEA 2G8ZA 2KI3A 3AS3A 4J4OA 3WIJA 1L1PA 2LKNA 4DRKA 2DSWA 1IX5A 1TFVA 2LPVA 1XHGA 4MGVA 3CHEA 3AQUA 4W9OA 1D7HA 1W9PA 1W9VA 3ARWA 1GPFA 1WNOA 3WD1A 4IQCA 2RUCA 3NRKA 4C02B 1FKGA 2FAPA 2UZ5A 2L2SA 2WLZA 3ARZA 4LAVA 3FAPA 4HARA 2ZQTA 5HWBA 4P8VA 1NMWA 2F2DA 1ITXA 2WK2A 1ROTA 2Y78A 4IT4A 2LJ4A 3IKDA 2O9OA 4DRIA 1J4HA 1F8AB 2KO7A 4ZPWR 2RUQA 1FKRA 1FFRA 2ZQUA 2DT1A 3B8SA 4DRHA 3ALGA 1FKFA 1ZBVA 5DF0A 4Z2HA 1OWQA 4WKHA 2DPEA 2DSUA 3QOKA 3ARSA 4Q7NA 1E6ZA 3O5DA 4Z2KA 3O5EA 4KQZA 3RGCA 3B7XA 4MNJA 3B9EA 1Q1CA 1D7IA 4DZ2A 3WD2A 4TX0A 4Z2LA 4ITZA 1JVWA 3ARYA 3CHDA 5GQBA 2XPAA 1LL7A 2M2AA 4IT6A 4JFMA 2M1IA 2PV3A 4Q22A 4ODPA 3ARRA 2A3CA 3ARXA 4P8WA 4JFIA 3JYJA 1EDQA 3CZ8A 3ALFA 3ODKA 2VCDA 5DITA 4FN2A 3UI6A 4Z2IA 2DSVA 1HXVA 4LGXA 2ZR5A 3RMEA 4ODKA 3WD4A 1H0IA 2YBUA 3AS0A 4MNKA 1NH6A 4HBEA 3RM9A 1PBKA 4ML4A 4JFKA 1LG2A 2XP9A 1E15A 4IQ2A 4U84A 2AOSA 2DG9A 4U85A 3B9DA 1EHNA 3OOBA 4DWSB 5DO2A 5DIVA 3CGNA 5J6EA 4S3JA 3O5RA 4DRNA 5HUAA 2N87A 5DIUA 3VAWA 3PR9A 3G6MA 1FJDA 1OGBA 3O5OA 1TCOC 3PA7A 3PRBA 1N1AA 2KFWA 4AY1A 3H9RB 4FAPA 3WL1A 1C9HA 1W9UA 3WH0A 3OA5A 4S3KA 3NTPA 1FKTA 4DZ3A 5BXJA 4QZVB 4W9PA 4LAXA 2B31A 1WAWA 4GIVA 2FDMA 4DWSA 3KADA 1HJXA 5I98A 2XP4A 3CGMA 5HW7A 4ZS6A 2JZVA 2DSZA 3KAGA 2ESCA 1OGGA 3KAFA 4WJXA 1J4RA 4W9QA 1LL4A 2QF8A 3IHZA 4BF8A 4JFLA 5GPGA 4LAYA 4DIPA 1O6IA 3KAIA 1LJYA 4DRQA 4HBOA 1KFWA 1X6NA 2XP3A 3UI4A 4KR0B 1K9TA 4ODRA 3WL0A 3G6LA 3WKZA 2D9FA 1FD9A 3AROA 4PTMA 2OLHA 1P5QA 3WQWA 3PRDA 4G2PA 3NI6A 4ODQA 3O5JA 4NZCA 1UR8A 5HW8A 3TC5A 3O5FA 3O5MA 1XRVA 3KCEA 1EYMA 4U86A 5HBFA 1HJVA 4DROA 3WD3A 2PV1A 4Z2GA 1W1YA 2KGJA 4TW8A 3IK8A 3O5KA 2MLZA 3KABA 1BKFA 4IPXA 1ROUA 2A3AA 2ZR4A 1FKSA 1FAPA 1H0GA 4WKAA 2Q5AA 1NWSA 4WK9A 4NNRA 1GOIA 1FKDA 2F21A 1B6CA 2OFNA 1J4IA 3UQIA 1NMVA 3GPKA 1PINA 1U79A 4TW6A 3JXVA 1W26A 4WKFA 3W4RA 5HKGA 4DWSD 1F40A 1D2KA 1FKBA 1E9LA 1QZ2A 2XP7A 4Z2JA 1GUVA 4MPKA 4TW7A 1WB0A 2FKEA 2A3EA 4P8UA 1ZB5A 2XP5A 2DG4A 2G41A 3B9AA 1ZBCA 2XPBA 4JFJA 2M08A 2MF9A 2DT3A 2RQSA 5B8IC 1EQ3A 2YBTA 2RUDA 2RURA 2KR7A 1Q6HA 2K8IA 3TCZA 1UR9A 3KAHA 1X6LA 1HKMA 3UQAA 1Q6UA 2ZQVA 4DRPA 3ARPA 1HJWA 3CH9A 3O5QA 5GPRA 1FKKA 3TDBA 1W1TA 1BL4A 2O92A 4R0XA 1HKKA 3JYMA 1W1VA 1D7JA 1FKIA 2WM0A 3BXWA 1NWUA 4TNSA 2ZQSA 3AS1A 4DRMA 3LUOA 1ZBKA 3AS2A 4O2TA 1JNSA 4G50A 4QIBA 2PPOA 1R9HA 1ZCNA 1Y0OA 2DG3A 1M5YA 4MSPA 2DT2A 2RSEA 2PPPA 1KT0A 1ZK6A 1HKJA 3IKGA 4R5EA 1T11A 2A3BA 2ITKA 4P8XA 2PBCA 2ZR6A 4ZPVR 2VN1A 1HKIA 1A7XA 1ZBWA 1QPFA 4L3NA 4J4NA 1KT1A 1SR0A 1RD6A 3EY6A 1E6PA 2AWGA 3KZ7A 1CTNA 5DEZA 3I6CA 1W1PA 1VF8A 5HW6A 4MNMA 4L72B 4ODOA 1SYTA 2XP8A 1Q6IA 3UF8A 4DRJA 4WIWA 4MTVA 1FKHA 3O5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAR A;  4HBE A;  4HBO A; 
#chains in the Genus database with same CATH topology
 1JCH B;  2DT0 A;  3KAC A;  4W5U A;  1FKL A;  1D6O A;  4LAW A;  1NSG A;  2KE0 A;  3RFW A;  1JND A;  4MAV A;  2PV2 A;  3WD0 A;  1LQ0 A;  3CHF A;  3WQV A;  1QPL A;  4MNL A;  4ZPT R;  1ZU8 A;  3RM4 A;  4GGQ A;  2MNT A;  3RM8 A;  1E6N A;  2LGO A;  1YW5 A;  4DT4 A;  3UI5 A;  3O5L A;  4NSB A;  1LL6 A;  4DH0 A;  1YAT A;  3CHC A;  3FY1 A;  4XAK A;  3ARU A;  2F4E A;  2MLY A;  3EIP A;  5HTG A;  4TYO A;  1FFQ A;  3FXY A;  4JYS A;  3O5I A;  2PI6 A;  5HWC A;  4ODM A;  4QT3 A;  3ART A;  4ODL A;  5JH8 A;  2XP6 A;  2MLX A;  3ARQ A;  3MDY B;  2PPN A;  2WLY A;  1LG1 A;  4QT2 A;  4N19 A;  4DWS C;  2MPH A;  4ODN A;  1ZL1 A;  3ARV A;  2IF4 A;  3UQB A;  1NWT A;  5HT1 A;  1NWR A;  1EIB A;  3PRA A;  1JNT A;  1J6Y A;  5D75 A;  1E6R A;  2IUZ A;  4URI A;  3O5P A;  1FKJ A;  1JNE A;  2G8Z A;  2KI3 A;  3AS3 A;  4J4O A;  3WIJ A;  1L1P A;  2LKN A;  4DRK A;  2DSW A;  1IX5 A;  1TFV A;  2LPV A;  1XHG A;  4MGV A;  3CHE A;  3AQU A;  4W9O A;  1D7H A;  1W9P A;  1W9V A;  3ARW A;  1GPF A;  1WNO A;  3WD1 A;  4IQC A;  2RUC A;  3NRK A;  4C02 B;  1FKG A;  2FAP A;  2UZ5 A;  2L2S A;  2WLZ A;  3ARZ A;  4LAV A;  3FAP A;  4HAR A;  2ZQT A;  5HWB A;  4P8V A;  1NMW A;  2F2D A;  1ITX A;  2WK2 A;  1ROT A;  2Y78 A;  4IT4 A;  2LJ4 A;  3IKD A;  2O9O A;  4DRI A;  1J4H A;  1F8A B;  2KO7 A;  4ZPW R;  2RUQ A;  1FKR A;  1FFR A;  2ZQU A;  2DT1 A;  2P4V A;  3B8S A;  4DRH A;  3ALG A;  1FKF A;  1ZBV A;  5DF0 A;  4Z2H A;  1OWQ A;  4WKH A;  2DPE A;  2DSU A;  3QOK A;  3ARS A;  4Q7N A;  1E6Z A;  3O5D A;  4Z2K A;  3O5E A;  4KQZ A;  3RGC A;  3B7X A;  4MNJ A;  3B9E A;  1Q1C A;  1D7I A;  4DZ2 A;  3WD2 A;  4TX0 A;  4Z2L A;  4ITZ A;  1JVW A;  3ARY A;  3CHD A;  5GQB A;  2XPA A;  1LL7 A;  2M2A A;  4IT6 A;  4JFM A;  2M1I A;  2PV3 A;  4Q22 A;  4ODP A;  3ARR A;  2A3C A;  3ARX A;  4P8W A;  4JFI A;  3JYJ A;  1EDQ A;  3CZ8 A;  3ALF A;  3ODK A;  2VCD A;  5DIT A;  4FN2 A;  3UI6 A;  4Z2I A;  2DSV A;  1HXV A;  4LGX A;  2ZR5 A;  3RME A;  4ODK A;  3WD4 A;  1H0I A;  2YBU A;  3AS0 A;  4MNK A;  1NH6 A;  4HBE A;  3RM9 A;  1PBK A;  4ML4 A;  4JFK A;  1LG2 A;  2XP9 A;  1E15 A;  4IQ2 A;  4U84 A;  2AOS A;  2DG9 A;  4U85 A;  3B9D A;  1EHN A;  3OOB A;  4DWS B;  5DO2 A;  5DIV A;  3CGN A;  5J6E A;  4S3J A;  3O5R A;  4DRN A;  5HUA A;  2N87 A;  5DIU A;  3VAW A;  3PR9 A;  3GTY X;  2EUL A;  3G6M A;  1FJD A;  1OGB A;  3O5O A;  1TCO C;  3PA7 A;  3PRB A;  1N1A A;  2KFW A;  4AY1 A;  3H9R B;  4FAP A;  3WL1 A;  1C9H A;  1W9U A;  3WH0 A;  3OA5 A;  4S3K A;  3NTP A;  1FKT A;  4DZ3 A;  5BXJ A;  4QZV B;  4W9P A;  4LAX A;  2B31 A;  1WAW A;  4GIV A;  2FDM A;  4DWS A;  3KAD A;  1HJX A;  5I98 A;  2XP4 A;  3CGM A;  5HW7 A;  4ZS6 A;  2JZV A;  2DSZ A;  3KAG A;  2ESC A;  1OGG A;  3KAF A;  4WJX A;  1J4R A;  4W9Q A;  1LL4 A;  2QF8 A;  3IHZ A;  4BF8 A;  1E44 A;  4JFL A;  5GPG A;  4LAY A;  4DIP A;  1O6I A;  3KAI A;  1LJY A;  2PN0 A;  4DRQ A;  4HBO A;  1KFW A;  1X6N A;  2XP3 A;  3UI4 A;  4KR0 B;  1K9T A;  4ODR A;  3WL0 A;  3G6L A;  3WKZ A;  2D9F A;  1FD9 A;  3ARO A;  4PTM A;  2OLH A;  1P5Q A;  3WQW A;  3PRD A;  4G2P A;  3NI6 A;  4ODQ A;  3O5J A;  4NZC A;  1UR8 A;  5HW8 A;  3TC5 A;  3O5F A;  3O5M A;  1XRV A;  3KCE A;  1EYM A;  4U86 A;  5HBF A;  1HJV A;  4DRO A;  3WD3 A;  2PV1 A;  4Z2G A;  1W1Y A;  2KGJ A;  4TW8 A;  3IK8 A;  3O5K A;  2MLZ A;  3KAB A;  1BKF A;  4IPX A;  1ROU A;  2A3A A;  2ZR4 A;  1FKS A;  1FAP A;  1H0G A;  4WKA A;  2Q5A A;  1NWS A;  4WK9 A;  4NNR A;  1GOI A;  1FKD A;  2F21 A;  1B6C A;  2OFN A;  1J4I A;  3UQI A;  1NMV A;  3GPK A;  1PIN A;  1U79 A;  4TW6 A;  3JXV A;  1W26 A;  4WKF A;  3W4R A;  5HKG A;  4DWS D;  1F40 A;  2F23 A;  1D2K A;  1FKB A;  1E9L A;  1QZ2 A;  2XP7 A;  4Z2J A;  1GUV A;  4MPK A;  4TW7 A;  1WB0 A;  2FKE A;  2A3E A;  4P8U A;  1ZB5 A;  2XP5 A;  2DG4 A;  2G41 A;  3B9A A;  1ZBC A;  2XPB A;  4JFJ A;  2M08 A;  2MF9 A;  2DT3 A;  2RQS A;  5B8I C;  1EQ3 A;  2YBT A;  2RUD A;  2RUR A;  2KR7 A;  1Q6H A;  2K8I A;  3TCZ A;  1UR9 A;  3KAH A;  1X6L A;  1HKM A;  3UQA A;  1Q6U A;  2ZQV A;  4DRP A;  3ARP A;  1HJW A;  3CH9 A;  3O5Q A;  5GPR A;  1FKK A;  3TDB A;  1W1T A;  1BL4 A;  2O92 A;  4R0X A;  1HKK A;  3JYM A;  1W1V A;  1D7J A;  1FKI A;  2WM0 A;  3BXW A;  1NWU A;  4TNS A;  2ZQS A;  3AS1 A;  4DRM A;  3LUO A;  2ETN A;  1GRJ A;  1ZBK A;  3AS2 A;  4O2T A;  1JNS A;  4G50 A;  4QIB A;  2PPO A;  1R9H A;  1ZCN A;  1Y0O A;  2DG3 A;  1M5Y A;  4MSP A;  2DT2 A;  2RSE A;  2PPP A;  1KT0 A;  1ZK6 A;  1HKJ A;  3IKG A;  4UDM A;  4R5E A;  1T11 A;  2A3B A;  2ITK A;  3BMB A;  4P8X A;  2PBC A;  2ZR6 A;  4ZPV R;  2VN1 A;  1HKI A;  1A7X A;  1ZBW A;  1QPF A;  4L3N A;  4J4N A;  1KT1 A;  1SR0 A;  1RD6 A;  2B5U B;  3EY6 A;  1E6P A;  2AWG A;  3GU0 A;  3KZ7 A;  1CTN A;  5DEZ A;  3I6C A;  1W1P A;  1VF8 A;  5HW6 A;  4MNM A;  4L72 B;  4ODO A;  1SYT A;  2XP8 A;  1Q6I A;  3UF8 A;  4DRJ A;  4WIW A;  4MTV A;  1FKH A;  3O5G A; 
#chains in the Genus database with same CATH homology
 2DT0 A;  3KAC A;  4W5U A;  1FKL A;  1D6O A;  4LAW A;  1NSG A;  2KE0 A;  3RFW A;  1JND A;  4MAV A;  2PV2 A;  3WD0 A;  1LQ0 A;  3CHF A;  3WQV A;  1QPL A;  4MNL A;  4ZPT R;  1ZU8 A;  3RM4 A;  4GGQ A;  2MNT A;  3RM8 A;  1E6N A;  2LGO A;  1YW5 A;  4DT4 A;  3UI5 A;  3O5L A;  4NSB A;  1LL6 A;  4DH0 A;  1YAT A;  3CHC A;  3FY1 A;  4XAK A;  3ARU A;  2F4E A;  2MLY A;  5HTG A;  4TYO A;  1FFQ A;  3FXY A;  4JYS A;  3O5I A;  2PI6 A;  5HWC A;  4ODM A;  4QT3 A;  3ART A;  4ODL A;  5JH8 A;  2XP6 A;  2MLX A;  3ARQ A;  3MDY B;  2PPN A;  2WLY A;  1LG1 A;  4QT2 A;  4N19 A;  4DWS C;  2MPH A;  4ODN A;  1ZL1 A;  3ARV A;  2IF4 A;  3UQB A;  1NWT A;  5HT1 A;  1NWR A;  1EIB A;  3PRA A;  1JNT A;  1J6Y A;  5D75 A;  1E6R A;  2IUZ A;  4URI A;  3O5P A;  1FKJ A;  1JNE A;  2G8Z A;  2KI3 A;  3AS3 A;  4J4O A;  3WIJ A;  1L1P A;  2LKN A;  4DRK A;  2DSW A;  1IX5 A;  1TFV A;  2LPV A;  1XHG A;  4MGV A;  3CHE A;  3AQU A;  4W9O A;  1D7H A;  1W9P A;  1W9V A;  3ARW A;  1GPF A;  1WNO A;  3WD1 A;  4IQC A;  2RUC A;  3NRK A;  4C02 B;  1FKG A;  2FAP A;  2UZ5 A;  2L2S A;  2WLZ A;  3ARZ A;  4LAV A;  3FAP A;  4HAR A;  2ZQT A;  5HWB A;  4P8V A;  1NMW A;  2F2D A;  1ITX A;  2WK2 A;  1ROT A;  2Y78 A;  4IT4 A;  2LJ4 A;  3IKD A;  2O9O A;  4DRI A;  1J4H A;  1F8A B;  2KO7 A;  4ZPW R;  2RUQ A;  1FKR A;  1FFR A;  2ZQU A;  2DT1 A;  3B8S A;  4DRH A;  3ALG A;  1FKF A;  1ZBV A;  5DF0 A;  4Z2H A;  1OWQ A;  4WKH A;  2DPE A;  2DSU A;  3QOK A;  3ARS A;  4Q7N A;  1E6Z A;  3O5D A;  4Z2K A;  3O5E A;  4KQZ A;  3RGC A;  3B7X A;  4MNJ A;  3B9E A;  1Q1C A;  1D7I A;  4DZ2 A;  3WD2 A;  4TX0 A;  4Z2L A;  4ITZ A;  1JVW A;  3ARY A;  3CHD A;  5GQB A;  2XPA A;  1LL7 A;  2M2A A;  4IT6 A;  4JFM A;  2M1I A;  2PV3 A;  4Q22 A;  4ODP A;  3ARR A;  2A3C A;  3ARX A;  4P8W A;  4JFI A;  3JYJ A;  1EDQ A;  3CZ8 A;  3ALF A;  3ODK A;  2VCD A;  5DIT A;  4FN2 A;  3UI6 A;  4Z2I A;  2DSV A;  1HXV A;  4LGX A;  2ZR5 A;  3RME A;  4ODK A;  3WD4 A;  1H0I A;  2YBU A;  3AS0 A;  4MNK A;  1NH6 A;  4HBE A;  3RM9 A;  1PBK A;  4ML4 A;  4JFK A;  1LG2 A;  2XP9 A;  1E15 A;  4IQ2 A;  4U84 A;  2AOS A;  2DG9 A;  4U85 A;  3B9D A;  1EHN A;  3OOB A;  4DWS B;  5DO2 A;  5DIV A;  3CGN A;  5J6E A;  4S3J A;  3O5R A;  4DRN A;  5HUA A;  2N87 A;  5DIU A;  3VAW A;  3PR9 A;  3G6M A;  1FJD A;  1OGB A;  3O5O A;  1TCO C;  3PA7 A;  3PRB A;  1N1A A;  2KFW A;  4AY1 A;  3H9R B;  4FAP A;  3WL1 A;  1C9H A;  1W9U A;  3WH0 A;  3OA5 A;  4S3K A;  3NTP A;  1FKT A;  4DZ3 A;  5BXJ A;  4QZV B;  4W9P A;  4LAX A;  2B31 A;  1WAW A;  4GIV A;  2FDM A;  4DWS A;  3KAD A;  1HJX A;  5I98 A;  2XP4 A;  3CGM A;  5HW7 A;  4ZS6 A;  2JZV A;  2DSZ A;  3KAG A;  2ESC A;  1OGG A;  3KAF A;  4WJX A;  1J4R A;  4W9Q A;  1LL4 A;  2QF8 A;  3IHZ A;  4BF8 A;  4JFL A;  5GPG A;  4LAY A;  4DIP A;  1O6I A;  3KAI A;  1LJY A;  4DRQ A;  4HBO A;  1KFW A;  1X6N A;  2XP3 A;  3UI4 A;  4KR0 B;  1K9T A;  4ODR A;  3WL0 A;  3G6L A;  3WKZ A;  2D9F A;  1FD9 A;  3ARO A;  4PTM A;  2OLH A;  1P5Q A;  3WQW A;  3PRD A;  4G2P A;  3NI6 A;  4ODQ A;  3O5J A;  4NZC A;  1UR8 A;  5HW8 A;  3TC5 A;  3O5F A;  3O5M A;  1XRV A;  3KCE A;  1EYM A;  4U86 A;  5HBF A;  1HJV A;  4DRO A;  3WD3 A;  2PV1 A;  4Z2G A;  1W1Y A;  2KGJ A;  4TW8 A;  3IK8 A;  3O5K A;  2MLZ A;  3KAB A;  1BKF A;  4IPX A;  1ROU A;  2A3A A;  2ZR4 A;  1FKS A;  1FAP A;  1H0G A;  4WKA A;  2Q5A A;  1NWS A;  4WK9 A;  4NNR A;  1GOI A;  1FKD A;  2F21 A;  1B6C A;  2OFN A;  1J4I A;  3UQI A;  1NMV A;  3GPK A;  1PIN A;  1U79 A;  4TW6 A;  3JXV A;  1W26 A;  4WKF A;  3W4R A;  5HKG A;  4DWS D;  1F40 A;  1D2K A;  1FKB A;  1E9L A;  1QZ2 A;  2XP7 A;  4Z2J A;  1GUV A;  4MPK A;  4TW7 A;  1WB0 A;  2FKE A;  2A3E A;  4P8U A;  1ZB5 A;  2XP5 A;  2DG4 A;  2G41 A;  3B9A A;  1ZBC A;  2XPB A;  4JFJ A;  2M08 A;  2MF9 A;  2DT3 A;  2RQS A;  5B8I C;  1EQ3 A;  2YBT A;  2RUD A;  2RUR A;  2KR7 A;  1Q6H A;  2K8I A;  3TCZ A;  1UR9 A;  3KAH A;  1X6L A;  1HKM A;  3UQA A;  1Q6U A;  2ZQV A;  4DRP A;  3ARP A;  1HJW A;  3CH9 A;  3O5Q A;  5GPR A;  1FKK A;  3TDB A;  1W1T A;  1BL4 A;  2O92 A;  4R0X A;  1HKK A;  3JYM A;  1W1V A;  1D7J A;  1FKI A;  2WM0 A;  3BXW A;  1NWU A;  4TNS A;  2ZQS A;  3AS1 A;  4DRM A;  3LUO A;  1ZBK A;  3AS2 A;  4O2T A;  1JNS A;  4G50 A;  4QIB A;  2PPO A;  1R9H A;  1ZCN A;  1Y0O A;  2DG3 A;  1M5Y A;  4MSP A;  2DT2 A;  2RSE A;  2PPP A;  1KT0 A;  1ZK6 A;  1HKJ A;  3IKG A;  4R5E A;  1T11 A;  2A3B A;  2ITK A;  4P8X A;  2PBC A;  2ZR6 A;  4ZPV R;  2VN1 A;  1HKI A;  1A7X A;  1ZBW A;  1QPF A;  4L3N A;  4J4N A;  1KT1 A;  1SR0 A;  1RD6 A;  3EY6 A;  1E6P A;  2AWG A;  3KZ7 A;  1CTN A;  5DEZ A;  3I6C A;  1W1P A;  1VF8 A;  5HW6 A;  4MNM A;  4L72 B;  4ODO A;  1SYT A;  2XP8 A;  1Q6I A;  3UF8 A;  4DRJ A;  4WIW A;  4MTV A;  1FKH A;  3O5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...