4HBKA

Structure of the aldose reductase from schistosoma japonicum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
310
structure length
301
Chain Sequence
MEPLKMNNGRSIPVIGLGTWNSPPGEVGAAVKKALEIGYRHLDCAYVYRNEAEIGEALENALNSLRLKREDIFITSKLWNTFFRPEHVRKACEETLKNLRLNYLDLYLIHWPVPLKHGGDLFPTDSNGQLCLDNVPHEDTWKEMEKLVDEGLVKSIGLSNFNKRQIQNILEHCRIKPANLQIEIHANFPNIKLVEYAQSVGLTVTAYAPLGNLLTKPCVLEIAHRHKKTPAQVLLRYLLQRKLIVVPKSVTFKRIEENFQVFDFQLSNEEMHELNTESLNERQFTLLQMSGHQEYPFKEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aldose reductase from Schistosoma japonicum: crystallization and structure-based inhibitor screening for discovering antischistosomal lead compounds.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1, member B4 (Aldose reductase)
total genus 103
structure length 301
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4hbkA00
1ZUAX 3GHRA 3UWEA 4GACA 4HMNA 3COTA 1JEZA 3RX4A 2PDMA 1VP5A 1EF3A 1ZGDA 4DZ5A 4XK2A 5JH1A 1S2CA 3R8HA 3N2TA 5AZ0A 2ACRA 3EB3A 2HEJA 4FAMA 2C91A 3N6QA 4JIHA 1IHIA 4R9OA 4GQ0A 2AGTA 1C9WA 3ERPA 1PZ1A 2BGQA 3R58A 2PEVA 4IJCA 2BP1A 3LQGA 1T41A 3UZWA 1YNPA 2WZTA 4YVXA 3R7MA 4WEVX 3MC5A 4AUBA 4PUWA 5KETA 1SM9A 2HV5A 3RX3A 4YU1A 1YE4A 1ADSA 3RX2A 3QKZA 4DBUA 1ZQ5A 2PDQA 2PDBA 3KRBA 2IPJA 2PF8A 2IKJA 4H8NA 4JTDA 2PDIA 2PDXA 3V0TA 2QXWA 3UZYA 2IPFA 4FA3A 2ACUA 4EXBA 1X96A 1VBJA 5HA7A 1XGDA 2A79A 3B3DA 3ONBA 4WDUA 1PZ0A 2FZBA 4GABA 2FZDA 4LB4A 3MB9A 4PUUA 3CV7A 4F40A 3V36A 4G5DA 2HVNA 3M4HA 1QWKA 3ONCA 4WDWA 4XZLX 2PDLA 2FZ9A 3Q65A 5LIXX 1S2AA 2PDGA 3M64A 3O3RA 2HVOA 3LEPA 3BV7A 1Q13A 4QXIA 3V0UA 3C3UA 2PD9A 4JTQA 2F2KA 2IQDA 3S3GA 4PMJA 4PR4A 3T42A 3V35A 2NVDA 1Z89A 5M2FX 2IQ0A 1S1PA 4DBSA 4XO6A 2PD5A 3CASA 2HE5A 3O0KA 3G5EA 4I5XA 3UFYA 1YNQA 1UR3M 1Q5MA 1AH3A 1AFSA 3WCZA 3R8GA 4LBRA 4XVEA 3WBXA 4PRTA 2INZA 3R6IA 3LZ3A 2PDJA 4GCAA 3GHUA 1Z9AA 5DANA 3DN5A 2IKGA 3D3FA 2IKHA 3CMFA 3F7JA 4L1WA 3LQLA 1EXBA 4JIIX 4FZIA 3DOPA 4YVPA 4XZHA 3BCJA 1EL3A 3LNMA 2PDPA 1LWIA 2PZNA 5AZ1A 1MI3A 1X97A 1PYFA 1US0A 2I16A 4ZFCA 4QX4A 4YS1A 2PDKA 3LZ5A 1J96A 1ZSXA 4GQGA 2ACQA 1XJBA 1HW6A 5LIYX 2PDFA 1A80A 3FX4A 3UYIA 4Q7BA 3WBYA 4LAUA 2PDNA 2ACSA 4JQ1A 1QRQA 3UZXA 2ALRA 2HE8A 3R94A 5LIKX 3LBOA 1LQAA 1R38A 2F38A 4WRHA 2P5NA 1MRQA 4XZIA 1K8CA 4DBWA 3UG8A 4WDTA 3BURA 2FZ8A 2FVLA 2PDUA 2R24A 3BUVA 4OTKA 3WBWA 4LBSA 2HDJA 3WG6A 1PWLA 2DUXA 2IPGA 4WDXA 4JTCA 4MHBA 4JQ3A 4NKCA 4JQAA 4ICCX 4Q3MA 4QBXA 1MZRA 4IGSA 5C7HA 1RY8A 1S1RA 3V0SA 5LIWX 1PWMA 2I17A 2VDGA 4RPQA 4JQ4A 1XF0A 3U2CA 2FGBA 3H4GA 3EAUA 5JH2A 4JIRA 1GVEA 4JTAA 1YE6A 1EKOA 3P2VA 3H7UA 1X98A 4EXAA 4XZMX 4LB3A 4YVVA 3LUTA 1AZ2A 1RALA 3CAQA 5HNTA 4XO7A 2PDCA 4GA8A 4IJRA 1IEIA 3LENA 5LIUX 4WGHA 3H7RA 2INEA 3EB4A 3GHSA 3NTYA 4XVDA 4H7CA 4XAPA 2ISFA 3GUGA 4LAZA 1HQTA 3UP8A 4JQ2A 3UZZA 2WZMA 2IPWA 1AZ1A 3R43A 3G1RA 3CV6A 4QR6A 3UGRA 3Q67A 3VXGA 1T40A 3CAVA 4XZNX 5HNUA 4ASTA 2NVCA 2BGSA 1OG6A 1Z8AA 4JTRA 2PFHA 3GHTA 1AH4A 3LD5A 1FRBA 3LN3A 1AH0A 4HBKA 2DUZA 1RY0A 2CLPA 1Z3NA 4L1XA 3FJNA 3M0IA 2J8TA 2IKIA 2PDWA 4GIEA 2R9RA 2PDYA 1M9HA 2DV0A 2IS7A 2PDHA 4FALA 4PRRA
chains in the Genus database with same CATH superfamily
3AWOA 3V3WA 2O55A 3I6TA 1EDGA 3GIYA 2VFEA 3WJSA 3H23A 3T0BA 3URNA 2TSYA 4YNGA 3KRZA 2JE8A 5HR7A 3TTSA 4HZMA 1WAWA 3TCEA 1IWAA 4QE4A 1YDYA 2EKGA 1G5AA 1W3KA 2V5CA 3BOLA 1VP5A 4JTFA 1VD6A 1FDZA 1Q6CA 2B31A 3AI0A 4YHEA 5DXYA 4LY4A 4P7NA 4PL1A 4F8XA 1FVPA 4HU0A 3QR3A 2DDXA 4CD7A 1PX4A 3MZ2A 1VBUA 2Z00A 1IXOA 1X38A 3CTTA 2IMRA 3U4AA 1W8GA 5ABGA 2EF9A 2PMQA 1VCVA 4PZVA 1GWJA 1EP3A 3HPSA 4MKNA 4H9ZA 1CDGA 2QJGA 3PBVA 3MKKA 3RRXA 3U2EA 3BPWA 2PWVA 4K2SA 3TR2A 3EXRA 1IXPA 3L4ZA 2HBVA 3KXQA 4MNLA 5HPOA 5DBUA 4GRSA 4REQB 2YL9A 4L65A 4PUEA 3MMUA 1E9YB 5E09A 3VOGA 5D30A 3W22A 1GEQA 4E6MA 3V1PA 5E0FA 3NIYA 3NL6A 1E0TA 3IANA 4OVXA 2GK1A 4QP0A 1OSEA 2ZUUA 1O68A 2BX7A 1XD1A 2A3HA 1P7TA 4S3CA 3S46A 2Z2AA 4B3KA 1D3HA 2ISSA 4XZ9A 3QV6A 3S5NA 1WXJA 1A5NC 4ADSA 3WLIA 4LNYA 3WLTA 4ZEPA 2WHMA 3UJSA 4CQ9A 3DECA 3DUGA 1WQ5A 2VFDA 5JQ9A 3EDEA 1R3RA 4LUJA 4JTTA 3VKDA 4A8LA 3IS4A 2CXEA 2G4FA 2OOFA 4J3WA 5I02A 1PL9A 2QF7A 1MSSA 1FWEC 4C1NA 3NQDA 1SFJA 3ZYZA 3A47A 4JCMA 1LBLA 1RP8A 4M6UA 4CUCA 5CPSA 3WL0A 6TIMA 2ABAA 2Z27A 4TMBA 1JUKA 1P0BA 1TMLA 4FB7A 1V0KA 2I5GA 3OVQA 2XIBA 2PA6A 4D8ZA 1I0DA 2E6AA 3GVQA 1DOSA 2Q3OA 3UR5A 4U10A 3ZWSA 2P10A 2QDGA 1E0VA 3R89A 2PSNA 4WCJA 3QC3A 1WXYA 4KPLA 2DW6A 2Y24A 1MUCA 2ZRUA 1W1YA 5M03A 3MJYA 1MW3A 1ME9A 2H8XA 4N4QA 5DMNA 4JOMA 3QY8A 2D1ZA 2VCBA 1KR0A 4NXSA 2QVNA 3LNMA 4U31A 5ABFB 5G5IA 3TXZA 3N4FA 1VFSA 3NO3A 1D7FA 2J8GA 1P0KA 3TFCA 4HPHA 3HZ3A 2D24A 1QNPA 4OHQA 2PDKA 1VENA 4IX2A 3HGRA 3L9CA 4GGBA 4R53A 4NQ1A 4JKLA 3LV6A 4W5UA 1DHPA 1QRQA 3LHWA 1GVYA 4FLOA 3LBOA 2H6RA 5E6ZA 3DG3A 1VCGA 4YIWA 1BFNA 1W0MA 4PE8A 3SAZA 5A1AA 1O95A 1KBKA 3AS3A 3WJWA 4IIHA 4KFNA 3Q45A 2W67A 3THUA 3BUVA 3UCCA 1BYDA 4OTKA 3TZNA 1J10A 2XM1A 4DJEC 4D6FA 1JD9A 3DFTA 3STEA 5B7ZA 1XFBA 3QFWA 4FLSA 3V16A 4AY8A 1QT1A 1ZB5A 3LCWA 1QATA 4O53A 1TPFA 5D2VA 3E2RA 4TTUA 3VYLA 1PS9A 3V0SA 4PEKA 4AY1A 3TC6A 2PRLA 3K13A 4LUTA 2VQTA 1F07A 3VNJA 4I3GA 3CL6A 2BZNA 3KAOA 2FTPA 2V63A 3PZOA 2F6XA 4AZ5A 1IZCA 1M7OA 2O7QA 4I90A 1GORA 5D2YA 3QQWA 3ABSA 5LXEA 3STFA 5L9FA 4DXKA 3G6MA 2YCIX 1QW7A 1SZGA 1YMYA 2OX1A 4L5ZA 3QR1A 5LIUX 1QHPA 1UR2A 1TV5A 3B0UX 4XAPA 1UWUA 1KGUA 1BYAA 2Z6IA 1R9YA 4AF0A 2EG6A 3GNNA 4QG6A 4KS0A 1H49A 1M68A 1DHKA 3UZZA 2XUCA 5AC6A 3IGUA 3R43A 5A8PA 3VDBA 1G7UA 4URIA 1EOMA 4I9MA 2VMFA 3UGRA 4C6DA 2CLMA 5IDIA 2JK2A 4I9TA 2NVCA 1O5XA 2QCMA 5I5RA 1Q8JA 3P5ZA 1S5NA 1WZKA 2PUZA 1JDAA 2W4XA 1NFPA 5AYYA 2UWFA 3H26A 4Q32A 3CHEA 5DELA 1F6PA 4GI9A 4YPJA 1TWZA 1PTAA 1B3XA 1DJIA 4TR9A 1AD4A 3NDZA 3TU9A 1SZRA 4IUGA 1U1JA 3NDYA 5D9MA 3IJ6A 1RUSA 1MQRA 4YTSA 4FI4A 1VS1A 1PZ3A 4IWWA 3MCOA 4S3KA 4PTWA 3P6LA 3F5KA 4LJ3A 1EXPA 3N4EA 2XIQA 3NXLA 2IS7A 4HSHA 4ERGA 3WDQA 4M8UA 2POTA 1GK8A 2PBOA 3S2MA 4GXWA 3L5LA 1TPB1 3UWZA 4QFUA 4RPPA 4Y8EA 1DWGM 4Q8QA 2YBUA 1Q65A 3G1FA 3OQEA 7ODCA 3G1AA 3KOWA 1GKRA 1QW8A 2EGZA 2GDQA 3BAJA 2PWFA 3CAWA 3RO6A 5AC8A 1JVNA 2YL6A 3FYPA 4XZWA 1QI0A 1X1ZA 4DWSC 4GQ0A 3ITYA 4F2UA 1KQZA 2GOKA 5XIMA 2ZICA 4IH3A 1QK2A 3UCDA 5CGMA 4WLCA 4CQBA 4FNSA 3MHFA 5EPDA 1PYMA 4C6BA 3AS2A 9CGTA 3RG6A 4EPBC 4PBEA 2Q02A 4B92A 1PCWA 3NURA 5HWNA 2WXDM 4GLEA 2FGZA 2ZXAA 4AUBA 1RR2A 4E0CA 3QRHA 1IIGA 5CZTA 5C9WA 4TMCA 3VIOA 1KFBA 3PUEA 2NQHA 3P5YA 4ZTXA 5DMMA 3W7QA 3SIZA 1ADSA 2JBMA 3NQGA 3MUAA 4FMVA 1FHVA 4LEFA 4DM2A 1HJXA 3WNOA 1H50A 5T9CE 2V82A 1C3FA 2XIJA 2VFHA 4Y7EA 4GI8A 5EMMA 4UTJA 3NQ6A 5HUPA 4GC3A 3SCVA 3WUEA 2WCSA 4NJGA 1UC5A 3CEPA 2J9YA 5D2WA 3RDKA 3KBMA 5D9OA 1VJZA 2QIWA 4GBUA 3DZ1A 3CGTA 1HP5A 3A3WA 3WQWA 2NT0A 3BSHA 4OKDA 2FZBA 1E0WA 2FZDA 1G4SA 3OQ8A 2X7WA 3AHTA 5F4WA 3PWGA 5FCZA 1QWKA 4AC1X 1OZQA 1A5BA 8XIMA 1DJXA 1ME7A 3B03A 2OXNA 4D6JA 1DXFA 1NF0A 1PIIA 3WH9A 1I6NA 2ZRYA 2CC0A 2VVNA 4ACYA 1GKQA 4P7QA 1K70A 2ALDA 4GI4A 1HL2A 2XIOA 4RL3A 5FJRA 2QGHA 4XZBA 1EJUC 1UR4A 5M2FX 4W8BA 4X3ZA 4O4VA 5LHFA 5XINA 1QPNA 3SGZA 1CENA 1H1ZA 3L12A 1C9DA 1X8CA 3MMDA 1OIFA 1VF8A 1V08A 3RK8A 3R11A 4CU7A 1NARA 2E5CA 3GSMA 4DYJA 1JPDX 3NR0A 3M0XA 1HFBA 4ML4A 2ZX6A 3QMSA 4LY8A 3W6MA 5F7UA 2DSKA 4GISA 3DESA 2BVDA 1RCQA 3KRSA 2AGKA 3M5XA 1M5WA 5U7SA 1T5AA 4S3GA 4OJYA 5E70A 3Q2DA 5CSRA 1JRCA 2I5IA 3URBA 4IFKB 1JPMA 3W1AA 4ZENA 3DCPA 1LTDA 4W8AA 1QBAA 2X8RA 4C6LA 3ZIZA 1F2JA 1FBAA 3SSZA 1JGIA 2HE8A 2PTZA 4WX2A 1WDPA 3OLGA 4WRHA 1K8YA 5BXRA 3SSJA 3RMJA 3P60A 5CPLA 4RXGA 3BURA 3GKFA 1WYIA 2P3EA 1HJWA 4O54A 2AQWA 1EF2A 5H1WA 2CLOA 2PRHA 3CUFA 4ORIA 3UPWA 3ABQA 3WG6A 3WF2A 2XJ7A 4S3AA 4H2CA 2AMXA 3ZS4A 1OB0A 1XFCA 1UKTA 2C6QA 5KEZA 3KL5A 3BLIA 3F4WA 4JYFA 3W1UA 3GRIA 4O16A 1EBGA 1XBZA 3BLLA 3O6YX 3KE0A 4DJDC 1D2KA 3C2YA 4JQ4A 1WB0A 1XSKA 1XDLA 4JIRA 3LRMA 2E5BA 1YHTA 2TYSA 4JFVA 3JU2A 3S8HA 4PUMA 2YL8A 2Z1BA 3R13A 2GPTA 3SB0A 3L2IA 1GOWA 1NJJA 4G1NA 4HMEA 4MKSA 3R0DA 1N2VA 1IEIA 4MWAA 1Y0EA 2VM8A 1MEWA 4XVDA 4H7CA 2IXVA 3H2MA 3N4AA 3UR2A 3WK3A 4DI9A 5F1UA 3TN4A 2E8YA 2WMGA 3IPWA 1RV8A 6TAAA 4GZJA 1HQTA 4QHRA 3MO7A 4JGDA 2WMHA 4US5D 1UH4A 4EPKA 5KITA 1CI1A 2DVUA 5H8MA 3CPUA 4WY0F 1NEYA 5DCBA 3T0TA 4H6KA 5EGRA 4J9JA 1K8ZA 2QIIA 2FDSA 1KWKA 2VYOA 1LOLA 3N04A 1LG1A 2O92A 5F4XA 4LYPA 3ZJ6A 2J27A 3LV5A 4UUIA 2O4QA 1S2WA 4NAFB 4QLLA 2ZIDA 1C8VA 1JNDA 5I07A 5LGZA 4LAKA 4HU8A 4GKLA 3O2LA 1P0DA 2D0GA 4S2CA 2ONEA 2OLAA 3MJMA 4O28A 3T09A 3SEPA 1FQ0A 1CXKA 3M46A 4RE2A 1QHZA 5G4WA 3WNNA 1UA3A 1XIGA 3WYZA 2V2HA 3WBAA 4ILSA 4B5UA 4JX4A 3K8MA 4W7VA 3DIPA 5HXMA 1KV5A 4Z2LA 3EWXA 1I60A 1W56A 5A5WA 2XFWA 1S2CA 4O15A 4PCFA 4AD4A 4TTGA 4LXFA 2GQAA 3RRAA 1W31A 2E1DA 4JTKA 1GQKA 1IT7A 3XINA 4UQAA 3LMYA 4LC6A 1V0NA 1S39A 1CX9A 4DUOA 1J01A 3CT2A 3N2XA 2F9RA 3L4WA 2WLYA 1YRRA 1EGVA 2VD9A 2C79A 4JTGA 1G67A 3AYTA 1A49A 3RUBL 2Z7GA 3L4XA 2VJXA 1A50A 1MMFA 4X63A 1W5QA 4OV4A 1WCGA 3M16A 4TVCA 4UFIA 2WW5A 4WJEA 1E1CB 3G3DA 4P8VA 1R2TA 3RCNA 1S3HA 3BW4A 5DFAA 1KTNA 3M0HA 3TCSA 1CNVA 1HKKA 1HKIA 1YE4A 2CIPA 3KOXA 1VYPX 2PTYA 1P1XA 3QKZA 1PXGA 1TPDA 4KFPA 4XSMA 1F3TA 2WK2A 4KFOA 1R3TA 3ARQA 4FF7A 1TV2A 2C7FA 1E9LA 2J6XA 4GNJA 3NYDA 2OSYA 2G3MA 1X96A 5DT5A 4LV9A 2EPLX 3P80A 1R86A 4HSOA 5H91A 3PG9A 1RXOB 4W9TA 3PNUA 4Q4OA 1EJSC 3SY8A 1N8IA 3CH0A 3VCCA 1R47A 1YPFA 4GABA 3MUZ1 5CSYA 3DKJA 1U1UA 3L0NA 2PTDA 5FF3A 1CEOA 1EPXA 1I2OA 3P61A 3WLSA 1G6CA 3TAOA 2Y7FA 4I9JA 3GY1A 1M6JA 3O3RA 4IMAA 1JDFA 1VEOA 1M3UA 1TX0A 3LM7A 3W28A 2WKJA 2CCRA 2W63A 2VP8A 1UJPA 3CJPA 3SUVA 3KRUA 5C7VA 1ML1A 3U2OA 2DIKA 1AJZA 1BD0A 2F2KA 2TAAA 3MHGA 2GUUA 4PR4A 2QJJA 1WP6A 1EFZA 1VFMA 2Z2UA 4DF1A 1A4LA 4XO6A 5M1TA 1X7IA 1M65A 2QDHA 5I6SA 4O19A 3HG4A 3AZTA 3HPZA 5G2HA 5I09A 4P2VA 4AZGA 3WBXA 4QISA 4PCTA 1EJWC 3IIOA 3AS0A 3DN5A 3TKFA 4BI6A 3CMFA 2QCDB 5I3FA 3WK2A 1KBIA 4GINA 3SIMA 3EWBX 1RAKA 2HISA 2NUXA 1OABA 5G2WA 5CPTA 3IJDA 1XWYA 1SO3A 1J6PA 2VUYA 1S2VA 2PAJA 1TE6A 4W4QA 1A5CA 3H2EA 3M0LA 4D8LA 2DZVA 2QAPA 4ZFCA 3GXFA 1CWYA 2GOUA 3CLWA 3RLVA 2V3DA 3IV3A 3V5FA 4U5KA 2ZUSA 2CHOA 2XIMA 4MB3A 4IXHA 4HOZA 3G0UA 4FX7A 1UASA 1BF6A 2QR6A 1WDWA 3CUIA 2R82A 4BI7A 2XN0A 1MRQA 3TJIA 4US5A 4J40A 4P8XA 1JQVA 3SCWA 3GVWA 3M1ZA 3CBWA 3C56A 1SW7A 3TYZA 3UGVA 1UYQA 4MDPA 3NL5A 4U33A 4GD0A 3TW9A 4MWAD 1XH0A 3UPMA 5DXXA 4EP8C 2P3ZA 4I9AA 1AW2A 4UIOA 4MHBA 3PTKA 3LSBA 3PR2A 3ZJ8A 3A23A 3FHAA 3EPOA 2XIIA 4GVHA 3G24A 4I7UA 2WVVA 1SO4A 1YW1A 5TIMA 3RAOA 4L80A 3TP4A 5FEZA 3ATYA 4IJBA 1SJAA 3H7VA 3T0AA 3H7UA 1B4KA 2DORA 4KIEA 4XZMX 1YEYA 4YTUA 1QASA 4H9XA 4ML9A 2DU2A 2X1TA 1E1FA 4AD3A 3QLDA 2W66A 1KM2A 3VMNA 1W5OA 2JF6A 2CBVA 2PDCA 3OBEA 3GZAA 4JFWA 3E96A 3AXIA 3H7RA 3QYSA 2INEA 5FIPA 4O14A 3STPA 3DERA 3KVKA 3ENLA 3VDCA 3F03K 2HXTA 4AIOA 1JYXA 2J79A 2EHHA 4QM1A 4D2JA 3TONA 2G8ZA 2D0FA 3OG2A 3BK0A 1EUAA 2ZADA 4JBRA 3OG3A 1HG3A 3KUMA 1A3WA 1QUMA 1SYTA 2Z1WA 1ZENA 1JJKA 1KRAC 3KW3A 3W37A 4N6FA 3VIJA 4BR1A 3ANUA 4HCDA 2TMDA 3BARA 3ZM8A 5LNVA 4OE7A 4Z0JA 3C5QA 4CQAA 3L5MA 4F48A 1WZLA 1JFHA 2XYLA 1J12A 5K2ZA 4HOXA 2CERA 4ZO6A 3MBFA 2WO5A 2J6VA 5HWJA 1UJQA 5AC4A 5IM51 3M43A 5E93A 1DE6A 2VFIA 1K02A 1PB0A 2FB3A 4BZYA 3PTMA 3WY1A 2WJDA 1G0CA 2PDYA 4PB5A 2ZBTA 4RK8A 3UZJA 4ZQPA 3KDOA 5DRIA 1CXIA 1NP2A 4M24A 4PUNA 4LCQA 3EWCA 2VGGA 1OD0A 2OR2A 4XTIA 3TAKA 4H9MA 2XHYA 3TFXA 3O6CA 4TV6A 2D2JA 1V7YA 2XVNA 5D37A 1NQ6A 2E9LA 4XK2A 5JH1A 1J5SA 3HBLA 2P50A 4C1KA 4K3ZA 3W1NA 2CLKA 2C71A 2E68A 2R1KA 4CU8A 4DAIA 1PKYA 3QQ1A 1E51A 4WKAA 2C91A 1J5TA 5DX7A 5A6MA 4JN8A 5D38A 2CHRA 1VB9A 2Z29A 6A3HA 4ACZB 1KCKA 4H9VA 4U2ZA 1NU5A 1MFUA 5C8BB 4C6JA 4L6HA 3VNLA 4MJ2A 4AMCA 3AWNA 3WBEA 4C5ZA 4NZ4A 2Y5EA 1WAUA 1WBHA 4ZR8A 4IFOA 4UQCA 3W7HA 2WHKA 3BZJA 1WXZA 2O4MA 1EJTC 1F3EA 3CZEA 4F0HA 2X0YA 2YW3A 1UKOA 2ZXQA 3IJ9A 3MC5A 2J77A 1UROA 2QJMA 2YB4A 4O8RA 1I75A 2NSXA 3QZ6A 5C9RA 3OODA 1DTUA 3WLOA 2YBVA 2O0TA 3P62A 1TFVA 3SCOA 3W1LA 3NQAA 2OT1A 3W29A 1WOAA 4LYRA 1OX4A 2PGRA 1TWDA 1XPGA 4IGHA 5DCDA 2WNWA 2WJFA 3DI0A 5REQB 3PBWA 4H8NA 5FEXA 4NAFA 3MVIA 4EF9A 3BW2A 1JUEA 2I5QA 4J3UA 2ATMA 3E0WA 3AZSA 2UBPC 1LL6A 2OYLA 1TJ2A 1SW0A 2A5HA 3ID7A 4R88A 5AYXA 4JXCA 5F1VA 3W01A 4AD1A 1PJ9A 4IMGA 2YXOA 4AZCA 4FOJA 1XRTA 1UPMB 3ARUA 3CV2A 2GJPA 3MB9A 1TJPA 2VX7A 5AC7A 4LX4A 3IRDA 4GC4A 2VCAA 3N14A 5C71A 1IF2A 4LUTB 3TYBA 1S2AA 3FV9A 4GXPA 3BV7A 4NY2A 3FXGA 2WCAA 1GQLA 4K7VA 3K5XA 1UHVA 1V77A 2BGNE 4MNKA 4UQEA 3U5UA 3RM9A 4B2DD 1R7OA 2ZZ3A 2VEPA 3KTCA 1MZHA 3WN6A 2G5WA 4WD0A 3SDOA 2P53A 4MVAA 3OGVA 4YCPA 3TWBA 1H7WA 1ELSA 2WMKA 1RCOB 3BLEA 2X09A 2XDFA 1JZ4A 2HMCA 1F8MA 4W5ZA 3VE9A 3VGBA 4OBRA 4PYSA 5IRPA 2HXUA 4GIAA 3KS6A 5DANA 1KTCA 4KCUA 4A2SA 3SRFA 3OHIA 3UWUA 3SN1A 4IP7A 3ZFHA 2YA1A 5I03A 4FZIA 2QUUA 1TRDA 1ZAJA 4RNFA 3KHDA 3B9OA 4GY0A 5GJNA 1US0A 3ES8A 4J28A 3IK4A 2OLSA 5H6HA 1H7RA 3UR7A 2QUTA 2ACQA 4HIBA 5DY2A 5C2XA 3WBYA 1JR1A 5G2IA 3G6LA 3M07A 3VD7A 2Y7EA 2O9PA 4GI6A 2ZDSA 2BNJA 2G3JA 1KFLA 3W84A 1UWTA 3C2OA 3TIMA 3UG3A 2QS8A 2ON3A 3GVGA 3INPA 5BWAA 1QCWA 4JTIA 2V5JA 4JTEA 1CCWB 5D03A 4IQLA 2PDUA 3STGA 2J7CA 2BY2A 1LRTA 4R7OA 4WUIA 3KP0A 4AYSA 3WJYA 3LGGA 1J11A 1BSIA 4IUOA 3E3HA 3UNTA 3KLLA 4FNUA 1PX8A 4Y9NA 1SR9A 2YZ5A 2VWTA 5JBDA 3GR8A 3ITXA 3SN4A 4AWSA 5CKSA 4CD4A 1JF5A 4QE5A 2DZWA 4MNJA 3C61A 4IGSA 3CHVA 3VAVA 4OECA 4UTTC 5GQBA 4HZ8A 3R4IA 3GIPA 4H9UA 4DLFA 4YYCA 3NAVA 4EIVA 3KVMA 2VX4A 4C6NA 3PPGA 3S5SA 3W2JA 3EKZA 4FR6A 1FWFC 1PX3A 4D71A 4HMDA 4DJFA 3GO2A 3B8UA 2OB3A 4AVOA 1H41A 3CPRA 1FUYA 1V4YA 2QV5A 3OIXA 3TN6A 5JBEA 3POCA 4P7OA 4J3XA 2YCLA 4QEEA 4N4PA 3AO0A 4PODA 4C6IA 1E3XA 3L23A 1MQPA 3DFOA 4JQ2A 5BYWA 4UFJA 2PGEA 3LX9A 2BV9A 2WM0A 4ROQA 3QSTA 3NUKA 1XUUA 3KBNA 1JPHA 1F6YA 5HNUA 5IDZA 2BGSA 1OG6A 3A9IA 3JR2A 1EX5A 4DB7A 1Z8AA 3W73A 3F2DA 5HPCA 3C2EA 3GH4A 2QV4A 3S1UA 3GHTA 5C9UA 5HULA 4DI8A 1LT7A 5C2CA 4MYXA 3WF1A 2DVXA 1SJDA 5ECUA 4MZ8A 5A8QA 2DIEA 9XIMA 1EX1A 1DJHA 3OBKA 2CKSA 1JRBA 1TUFA 3E38A 4BQ3A 1VLIA 8TIMA 2WJZA 2PDHA 2YIHA 4GO8A 3GYCA 5BMXA 4G1KA 3R0UA 1LYXA 4NYYA 1VRDA 4Q6XA 3KLKA 3H12A 4DVOA 2OODA 3DBNA 3GXIA 2V38A 1O94A 4ADTA 5HMSA 1EIBA 3A5VA 2PDMA 1TZ7A 2ABBA 2DZBA 3AIUA 4HA4A 2WCGA 1MUWA 2PCQA 4IGMA 2A85A 3AYSA 1GHRA 4L56A 5BWFA 5FJJA 4Z1BA 4IIDA 2CXGA 3B9NA 4ZO7A 4ICNA 2JIWA 3N2CA 3W74A 3T2QA 1R7AA 2CESA 2JIEA 2AGTA 5GNZA 2OYKA 4GUFA 4LT9A 1JL8A 4IXXA 4ES4A 4MIMA 2A0NA 2AMGA 1JPIA 3LY0A 3UZWA 3N11A 4NU7A 1JCTA 3BAXA 1WZAA 1EC9A 4EOUA 1OIMA 3FA4A 3G1DA 1XISA 4CVUA 3QGKC 2FFCA 2G3IA 4EWND 4J3VA 3HN3A 4IQJA 1MDRA 4K68A 3ZLHA 3BZGA 4RX0A 1IR2A 3G77A 4RKAA 5A6KA 2ASHA 5JMUA 1OK6A 4HYRA 5EU9A 3WD1A 3WLQA 8RUCA 4C6PA 3VX0A 5C55A 1BQGA 1HVQA 5C70A 1ITUA 1LLWA 3AIQA 2C1IA 1FXPA 2PDBA 2IPJA 5JVLA 2PF8A 1UBPC 1Q3NA 2TODA 4C91A 2PDIA 4WKFA 3LU2A 3LYEA 1E9ZB 4DPPA 2ZRZA 4B5WA 1MNZA 1I2QA 1TRIA 1GZ1A 1HJUA 1PCKA 3VNYA 1E4MM 4MY9A 1BVWA 3TN3A 4F0MA 4DO4A 2CZVA 2ANUA 3NOEA 3B0VC 3O6AA 1UD6A 4JEQA 1POKA 1JFXA 1H1NA 1J4EA 4LS1A 3IGHX 4FSAA 4TVUA 2PB1A 4B3ZA 5F2GA 2ZDRA 4RW5A 4G7EA 1FWDC 1QNOA 3W00A 2OO6A 3QW4B 2WHLA 4GNVA 3TTEA 5K9CA 4JFSA 2NV1A 3ARVA 4JDYA 3W7JA 1Q4NX 4TOQA 1AL8A 1EZWA 2Y0FA 9RUBA 1F5ZA 1VPQA 1Z32X 3W6YA 1SVDA 3MPGA 1KGWA 3GTIA 1FKXA 1Y65A 1UWSA 3M44A 4AZ6A 2IQDA 4E8GA 3PM6A 4F0RA 3MBDA 4P7LA 1Z42A 4DYKA 5A95A 5PTDA 3VD5A 3EMQA 5CC3A 4ADUA 2G37A 3TV8A 4DF2A 3PWAA 1KM4A 3BWWA 4AHOA 4BCEA 2ZYFA 3UFYA 1DQUA 1JZ6A 1BEUA 1Q5MA 3WH5A 1TO3A 6XIAA 5C5YA 4ZB0A 5J5DA 3WMLA 4DELA 3PK7A 3S2NA 4NAEA 1ZJBA 1Q2RA 4KQNA 1TMHA 2EO7A 5CPQA 1UD8A 3EWUA 2VZVA 3Q37A 1GOMA 2KX9A 1UKSA 4FX6M 4LH8A 4K37A 4K1GA 3OBAA 5BNKA 1MI3A 1M7PA 3UEQA 3C0QA 3ZVHB 4LNCA 1OFQA 3OO2A 5KZMA 3IJ7A 1SJBA 2VCCA 4O1AA 3NEVA 4O8AA 3PZNA 2PP0A 3TR9A 1S38A 1XJBA 3NNTA 1TZ9A 5LIYX 4HNOA 1XYZA 2VOMA 1UH3A 4PCSA 1F05A 4AX7A 1SFTA 2GZXA 2E7FA 3GG7A 4QS5A 3UZ5A 5DN1A 2DVTA 3EOOA 1L6FA 1UP3A 3F4CA 2UV8G 1XIFA 2QPSA 4AWUA 3TUUA 4AC7C 1HTIA 3ME3A 2FVLA 3ECQA 1S3TC 3HGJA 7TAAA 4HA3A 3B4YA 1EOKA 1TPUA 2GQ8A 4XAZA 1KM5A 1XLAA 2QCGA 4HOWA 1GOOA 1WUFA 3HFTA 1FWWA 3CIWA 1YADA 1EQPA 3BJFA 4ERAA 1IZKA 4JQ3A 1F61A 2LLEA 1YQ2A 2HS8A 2BXYA 3BLDA 2F6UA 1O5QA 4MZ1A 4RNHA 1MXDA 1PWMA 4LGXA 3LBCA 3SW6A 1YXCA 1FFRA 3BAWA 1IEXA 1NVMA 2YA0A 4BA0A 3GTNA 3EAUA 4DRSA 1QWGA 1GVEA 1EKOA 3MV01 4CNPA 4M51A 1VAHA 1IEQA 3WQ8A 4KWSA 4NI3A 3UG4A 3V18A 4GK8A 4QJ5B 4YVVA 3T0DA 4KRZA 1BXNA 3JUGA 4NZ5A 1FWTA 2CW6A 3LCLA 1U30A 2E0PA 3KFTA 4DWSA 1B3OA 3TSDA 3N19B 3T2PA 3DXIA 1ZP4A 2GGEA 3AMGA 5J5RA 3GB6A 5T8GA 3LS9A 1AG1O 3CUHA 3HB9A 3NQEA 3ITCA 3UF9A 4NJHA 3OB8A 3RGTA 4U5IA 4JY8A 4UNKA 1FHLA 1K9EA 4IT1A 1XL9A 3UWWA 1I9CB 4AIBA 2V3GA 5DEZA 3T9PA 3MI2A 5D09A 2SFPA 2X1SA 2OYMA 1GQJA 4PTXA 1RP9A 5CC7A 1DORA 1Z48A 1K9FA 2OQHA 4UFMA 2Q8LA 2C0AA 2WMIB 3ARTA 2X41A 1G94A 2GUYA 4ZL1A 2FTYA 3F2CA 3RO8A 2DEPA 4IICA 1UP0A 4HSNA 3U57A 5CBIA 1L2QA 3EPNA 5MKGB 3GU9A 2B81A 5BXSA 1OFRA 4A4AA 4GQBA 2CLPA 3WEZA 3M47A 3W70A 3FJNA 2A3LA 3M0IA 4RXFA 3NQFA 3GNPA 4NX0A 4CD6A 3UG5A 4Q8VA 4J7RA 4GMEA 3I4KA 4PRRA 1LQ0A 1EZ2A 3G1VA 3TQKA 1ZBVA 1CTNA 1XC4A 2Z1XA 4MAZA 1R30A 3LOTA 3UCQA 1RBOB 1REQA 3APGA 4HMNA 2QCLA 4D6HA 5E9XA 1A5KC 1P4CA 3S2JA 4V28A 4IP5A 4DJFD 3Q58A 1KV8A 3W81A 2E9BA 5IOBA 3DFPA 1J0ZA 1PSCA 2PF0A 3BMWA 2DUAA 3TA6A 1N7KA 2YDRA 2RGMA 4D6EA 4IPNB 3LTYA 3OA3A 1O1ZA 3MSGA 4RE4A 3LERA 3MYPA 3S5ZA 1W3TA 3BLKA 2EPOA 4FNTA 4G56A 4XKYB 3LQGA 1T41A 3HM7A 5IFTA 1F76A 4NVTA 4OUEA 5FL0A 1ISXA 4HJWA 4W88A 2CKRA 1BRLB 1YPXA 2Q71A 1QPKA 3BCFA 2FQIA 3IK2A 4MTVA 5E1QA 3MMTA 5CPMA 1TV4A 4PUWA 4AWEA 5A2BA 4B9ZA 4I5RA 5KETA 3QHOA 1AMKA 3O0FA 5M17A 1TVPA 3WFZA 2J9XA 1ONEA 2GVJA 1F3XA 4RDWA 1W1VA 5A8MA 5FACA 1VYRA 3AUOA 3NZQA 2YSWA 1BQCA 1KKOA 5REQA 4UMCA 1L6GA 4YCOA 1VFLA 2ZCGA 4GIRA 1EB3A 1LWHA 3N18A 1DTNA 4GYPA 1JG9A 2NX3A 4JZ5A 4HNCA 2OEKA 1OK4A 2A3EA 1RVGA 1OC7A 7XIMA 4PTVA 5FESA 4GZEA 2XH2A 1PDYA 4NUWA 2PTWA 4DJDA 2OTDA 3KM8A 3BJTA 1YIXA 3HF3A 3PP7A 3NZPA 4XZLX 2J7HA 2VZSA 3WIJA 4PUJA 4EAMA 3M64A 4HA0A 4LF1A 1PPIA 1DJZA 4NIRA 1AW1A 4PTMA 1W8SA 1UZDA 4UCFA 5TBOA 3RPDA 5KZDA 2YX0A 3K8KA 4MSSA 3HU7A 2FH8A 1XPYA 5GNYA 1P43A 4I7VA 2CWNA 2C14A 1R46A 2QCDA 1KGXA 3CASA 4OV9A 5C54A 3G5EA 4O0KA 2B7PA 4EK7A 2OZ0A 5LA1A 1E40A 4PRTA 2D2OA 1XCWA 3EX3A 5U4NA 1ZS2A 4HK5A 3T05A 1UC4A 1VC4A 4M0XA 1XIHA 1VJSA 3VZZA 3DOPA 4Q4RA 2J62A 1X97A 2W61A 3PJTA 3UWYA 5AB3A 4L4MA 4GVIA 4MGGA 3HPFA 1MW1A 1A0EA 3AISA 1E4NA 5CG7A 1UZ4A 3N6HA 4Z42C 3GDKA 1L9WA 4GZ7A 2XFYA 2DIJA 3UZXA 2E77A 1XYFA 1ZBKA 4XZIA 4X0VA 1YKWA 1H7OA 1BPLB 1XW8A 1CGVA 3C0JA 4A29A 1I2NA 1FP8A 1O7AA 2XU2A 1OD8A 1KXVA 2Y61A 2X05A 4ZQNA 2O7SA 3K30A 5D33A 3NO1A 2WOQA 3URAA 1EUNA 5EBAA 3MS8A 3ABZA 4RCXA 2NX1A 3WLPA 2W79A 4Z1CA 2JKAA 3HMJG 4KW2A 3L5AA 1IXQA 3S9ZA 1CZ1A 4JNYA 3H4GA 2WPBA 4GVGA 1GONA 3IRSA 2R1PA 3N29A 3P84A 3E0VA 1KBJA 2VENA 1X98A 1CLKA 2AAMA 3GVVA 3VOIA 3H70A 1W9VA 1SJCA 1BRLA 1B9ZA 3LUTA 2O9OA 5HNRA 3RM8A 5J8LA 3CAQA 5HNTA 5K3VA 1KRBC 4GA8A 2QZRA 4KRUA 4MNMA 3V1HA 1RA0A 2EKCA 1F6KA 2XSXA 3CZGA 1V3KA 1C29A 3O06A 4LUSA 1VHNA 3ZVIA 2Y5JA 1NQKA 3A4JA 1ME8A 4E4PA 4NZJA 3G1SA 4WGXA 5CSSA 2XSBA 3GTHA 2W3ZA 2Y8VA 2GWNA 3FKKA 1AZ1A 3RPTA 1EC8A 3TX9A 1JAKA 3W72A 1E56A 4XZNX 3NPXA 1BKSA 3SCRA 2GVEA 4CD8A 4JN6A 4KWUA 3M6DA 4OFCA 3WF4A 4GO9A 3FEQA 4GJ1A 2YA2A 2CZEA 3ZXWA 4WHBA 4A35A 4UCGA 4LS2A 1G9HA 1W3LA 3DH7A 2Z26A 1UWIA 1RY0A 1VIZA 1Q6QA 3FIGA 3N34A 1OFDA 3CL7A 4GX8A 3BAYA 5CJMA 1E73M 4M80A 4ZQOA 3MWCA 2NQJA 9XIAA 2Z25A 4N9BA 3ARYA 4J5NA 3QOKA 3APYA 3KCLA 3KWXA 1Q6RA 3GNOA 4M81A 4X22A 5FJOA 5LGXA 4NASA 3TOYA 3QEZA 3PTQA 3ZQ9A 1Q85A 1O66A 2VELA 3G1HA 3TTYA 4XX6A 3SCTA 3BLFA 4X9YA 4EXQA 3G1XA 1M04A 3WQOA 4KEUA 4QTGA 3VIFA 3ZSSA 1YX1A 1ODUA 3QLLA 3N6QA 1IHIA 3AJ7A 4M56A 3ERPA 3MZNA 1PZ1A 3GDLA 8XIAA 3MV11 3G1YA 3EMZA 4WIWA 1YNPA 5CGTA 4CEXC 4MB5A 3EOSA 5CZJA 2E4TA 1KM0A 3ZMRA 2J7GA 1V79A 1S5TA 5ECVA 3CHFA 3MUXA 1XLBA 4V1YA 4HVXA 4EVZA 3PZ9A 4IMFA 4LF2A 1K1DA 5D04C 2NLYA 4BQ4A 1WA3A 5CZ0A 4LAOA 3T7VA 3EWYA 4LRTA 1EH9A 3DAQA 3MI6A 1OFPA 4QROA 1RVKA 5IHRA 4H01A 4BEQA 1R2RA 3NGJA 4AFYA 3VM5A 3QGAC 5CCZA 1UH2A 3HG3A 4W85A 4Q8WA 3VGHA 4DHGA 1U5VA 1OC6A 4L1GA 2GJXB 3RU6A 2EG8A 3H4XA 4ZSUA 5D2XA 5CC6A 1LT8A 1K4HA 1A3XA 4TV5A 4WJ8A 3EZ4A 1KCZA 3SGUA 1UZ1A 1YDOA 1UR9A 1L0PA 3CIXA 3KHJA 3BL3A 3EOUA 3LK6A 3PTDA 1P7TB 4ZO8A 1R3SA 1SSGA 1H7PA 4P7RA 1LUCB 1EJRC 2QLYA 1NWSA 2XZ9A 3SRHA 3LPGA 3R0KA 3ZJKA 2CWXA 5LXXA 3MUCA 1XRSA 3S2CA 3VDGA 2DT2A 1WKEA 1KNWA 2OZTA 4H83A 5FAJA 3IUIA 5C9ZA 4BF5A 2A7RA 1E6NA 2Y4SA 3UT0A 1M41A 2P88A 2QEZA 2PTXA 1W5NA 1DIDA 5BOFA 1XLJA 1R2SA 3LPOA 1JI1A 3FYYA 2CFFA 1UUQA 1W3HA 1XR2A 3T42A 5A2AA 1WDSA 2NQLA 3HA1A 2IQ0A 7CGTA 4ZQCA 5I3KA 5KZEA 4UNLA 1RK5A 3BSGA 1H3GA 2OJPA 3PZUA 3F5JA 4E3TA 2A2IA 1AFSA 4MWAC 5B80A 5ABFA 3WCZA 1VFTA 1A0DA 3WEMA 3R6IA 2HNEA 4K8HA 1Z9AA 2R8WA 3W7RA 2IKGA 3A4AA 4L1WA 1ONWA 3MCMA 3BCJA 2ZZ7A 3B06A 4QSHA 5K9DA 2ZXDA 4PMXA 3I3DA 3FKRA 3I7RA 1PE1A 3VABA 4WSJA 4H9YA 4UFHA 3EDFA 2RFGA 3W2UA 4RUBA 1ZNNA 4OBSA 3LHYA 3FHQA 4Q4PA 4NI8A 5ABTA 2FFIA 1NELA 4CQDA 2Y7GA 2VR2A 1J9YA 4B9YA 5LIKX 3K4WA 1YLVA 1ZZMA 4PGLA 3EXTA 3MU7A 1MRAA 1W5MA 2HPIA 2BY0A 1MYRA 3ZJ7A 3VFCA 3B8IA 3GK0A 3FNDA 3NSXA 4J2MA 4MF4A 5TNVA 3K1GA 2V5KA 4AD2A 3N2MA 4X61A 2OO0A 1XS2A 2AQOA 4NZ1A 1GGOA 1B2YA 3W02A 2Z7KA 1K9DA 5A6BD 2QJNA 3NDOA 2YDSA 2W62A 2Y2WA 3FDKA 2VZTA 2MNRA 3VIKA 2VO5A 3HURA 1GVSA 1JYVA 1U5HA 1HJSA 3U2ZA 2L5HA 4JHMA 2PLMA 5C7HA 4O0QA 2VEKA 2PWEA 1BSLA 4ZO9A 5BROA 2BBFA 1V3HA 4C1LA 4GY7A 3VD3A 1CBGA 1BGGA 4JTAA 3USZA 3GXPA 3BOXA 2EPMX 3H21A 1WPCA 4HK6A 5DRCA 3GIQA 3H4WA 2Y7DA 4L4OA 4HHPA 3BCDA 1UD3A 4POCA 3B97A 3USBA 4D8AA 3WDPP 1I1WA 2EPNA 1K6AA 1DYSA 3JZEA 2R1NA 3IWPA 3Q94A 3GG1A 2ISFA 2DZSA 3QVQA 3T0CA 3KWSA 3HFYA 1ZU8A 2WZMA 1DQWA 4U3AA 4WY0B 3CYJA 3CQIA 1AQMA 1CW2A 3M7WA 2X0SA 4PMYA 3VINA 3GTFA 3TYCA 1GOIA 2BVYA 4IF2A 3EBVA 5T9BG 4ZSTA 4S3JA 4LV4A 1WO2A 3IAQA 3VKKA 1AMYA 2H90A 4XWUA 3OTRA 4GY1A 5FAGA 3ANYA 1XDMA 2VQUA 3WQVA 4DM1A 1Q6OA 4UOJA 2DPEA 1FCUA 2CU0A 1FRBA 1QO5A 3N9SA 4F9DA 4GBDA 3WNMA 5D4YA 1BLIA 2YW4A 4AW7A 2PDWA 4HKPA 4PSPA 5A6LA 3W3OA 3JVAA 3THAA 1JCNA 2YPIA 3BGJA 3PUGA 1J6OA 1VCFA 4WQ6A 3MUY1 1ZUAX 4IG2B 4KBXA 1X1OA 3DFSA 2JEQA 3EKGA 1YTKA 1FWSA 1V6UA 1YNYA 4FOUA 1TVNA 1XIDA 3RX4A 4CD5A 2BMBA 4U3CA 1ITQA 4KCWA 4XUGA 5D02A 2WWCA 3R8HA 3TSMA 1SMDA 3L67A 3HQPA 4TQTA 4GH3A 3P0WA 1V6XA 3DFYA 4BQ2A 1EO5A 4G2DA 5AVNA 3H2CA 1H5YA 1UPPA 4K7YA 2CHNA 3UWVA 1LDCA 4LCRA 1XDJA 4DIAA 2BGQA 3BANA 3TJXA 3BLOA 1ISZA 1EP1A 3UA4A 2WZTA 1L2UA 1EDQA 2OSXA 1M7JA 1GPWA 3SECA 3D0CA 3LI1A 4PCPA 3W1XA 3M0MA 3VE7A 2J8FA 3VOJA 1E70M 1X8FA 2NV9A 5IFPA 3A12A 5AVHA 4WJXA 3ANVA 3H24A 4JKKA 3KZSA 3PZGA 3WO8A 1WDQA 4YU1A 1TQXA 4F0SA 3G18A 3L65A 2RJHA 1ZQ5A 1XLFA 3QPZA 4TU1A 4Y9MA 4JIQA 3S6TA 3W7EA 4FPSA 2UY3A 3BG3A 2YLLA 2WVUA 1JD7A 2ZOXA 3EMCA 1FWGC 4UQ9A 4H04A 3I65A 3N2BA 1R9XA 1SMAA 3ZR4A 1GVRA 3T07A 1RK6A 5L6UA 3GH7A 4GGHA 3U7BA 5H2ZA 4MUPA 3E5PA 2A79A 4H3DA 3NZ1A 3ZWTA 3TTOA 1S2UA 1SUXA 4BI5A 3ZZ1A 1UUMA 3O63A 3A22A 1ECQA 4AF0B 1JDDA 1PKNA 3IIPA 2IQTA 4IIBA 1UWRA 4IG2A 5AKQA 3GNRA 2VGIA 4O12A 2PWGA 3HPXA 2XVGA 2WMFA 1H1YA 4BQ5A 1I0BA 5LIXX 1EYEA 3LLXA 2Z6JA 6ALDA 4GG9A 2XN1A 3B4UA 2EPHA 3B8SA 4B91A 4GVFA 1KCLA 2DZXA 6CGTA 1SU5A 3P14A 2XWEA 4NJIA 4Z2GA 1MEIA 3WF0A 5DCEA 4JFTA 3VI2A 4RDZA 1HIZA 2VDIA 4KMQA 3IVTA 2NW0A 4BWLA 4ORMA 4DPQA 1CIUA 4ZGYA 3SY5A 2PCEA 4ZQRA 3WFLA 4ZBCA 3W1RA 1LF1A 3NQ8A 1HO1A 1W9BM 2X1RA 3QPYA 5JXQA 1MW2A 2QCHA 2PZ0A 1FWBC 4I7WA 1NOUA 3EDDA 2OPJA 2XGIA 4I5XA 3FDGA 3L2LA 4UTTA 4DJED 1TWWA 4IL2A 2FJKA 1IIHA 4EACA 2ZX9A 4DN1A 4QITA 1B57A 4DJFC 4HK7A 1JYNA 3GFZA 2QULA 4QRNA 4EAYA 4OT7A 3R5EA 1HGWA 3QW3A 3RR1A 1BXCA 1OX4B 1ZHAA 4KESA 4YVPA 5HR6A 3QV8A 4K39A 4LUIA 3WQ6A 1MQQA 3P7YA 1BKHA 3GH5A 1MEHA 1K7XA 1PBGA 4ZCWA 4PB4A 1M01A 2C1HA 3W07A 5FL1A 4Y2WA 5D2TA 1V6VA 5C6MA 3W87A 2UY2A 3E2VA 5T26A 2DH3A 3OLDA 5FI8A 5I3HA 1O12A 1R8LA 4G8TA 3F4DA 4IZGA 4PMQA 5CQ1A 2QCFA 1BXBA 1AD1A 3SN0A 4RV3A 3SQMA 3HG5A 4RW3A 3ZT5A 2X2YA 4UZUA 1RJQA 2HVMA 1P48A 1KR1A 1WOBA 4JNZA 1W3NA 1UOZA 3IGSA 3E2QA 1HF6A 4MJ4A 2DUXA 3VKBA 3RU8X 3KZPA 1B54A 2WANA 3VZYA 5HUOA 2XM2A 3HJZA 1REQB 1SR0A 2CZFA 2OX4A 1QJWA 2QGYA 3C2RA 5A6JA 1UIPA 2BSLA 5DMYA 4LOCA 2GLKA 2E28A 2YDQA 4D9PA 4HHHA 5D32A 3U5YA 2BVTA 1EA9C 4N9CA 4JHOA 3LHUA 1BYBA 3EWWA 1XYBA 4O1DA 4HNUA 1AZ2A 3F2BA 1ZY9A 5A94A 2WC7A 1TA3B 4AB4A 3S6DA 5G1YA 1F8IA 4ZXLA 3PN8A 1V3LA 3VNKA 3WQPA 4J27A 4IP4A 5AN7A 2PBGA 2DH2A 3KBJA 1DIOA 1OX5A 1XLEA 5AHEA 4JNMA 3RFAA 3ZT6A 3HV9A 1MXGA 3BQ5A 4GKTA 1UUOA 2DP3A 3DI1A 3GDMA 1JCYA 4MAVA 3HV8A 3VK5A 3WH8A 4LW7A 3RR4A 4GYPC 3GUWA 4RE0A 1AW5A 4QR6A 1OEPA 2CZDA 2GGHA 3DC0A 1FX6A 2B7QA 4QCFA 4MLJA 3KOZA 2JKPA 1G01A 5BRPA 1ZBCA 3P8JA 4JTRA 5AYIA 1AQFA 1GTHA 2RDUA 1XIBA 3LCIA 4CU6A 1XUZA 2G97A 4CVWA 3DG7A 1E55A 3U7VA 1C8XA 2A3CA 3OEXA 4GQQA 3E12A 3SJ3A 1LROA 3WDHA 1TV3A 2Q3RA 3WLLA 2PU0A 2E3ZA 3UWQA 3ARSA 3V4BA 3PB2A 1OBAA 3W7DA 2VC5A 1UWQA 3T1GA 3LLDA 3C2VA 1M53A 3LTSA 2D0HA 1X6LA 4HU3A 3UA3A 3UWEA 2B4GA 1QNSA 3WUGA 3WDIA 3ZO9A 3WJZA 1PO9A 4G7FA 3T8LA 1QNVA 4QAWA 3OIHA 4KT2A 4AX6A 1QI3A 2WLZA 2OWCA 1ICQA 2YYTA 3N2TA 1FH9A 2OQYA 1I2RA 2D3LA 5I06A 4A22A 3O9NA 1RJPA 3EA2A 3HIJA 1FHDA 3NOYA 1NFGA 1J0JA 3W38A 4PBFA 2GQ3A 1TMQA 3R58A 2PEVA 1CB2A 3UXAA 4Y9PA 2D23A 3LG3A 2POZA 2AL2A 3FS2A 4JCLA 2V68A 4UR9A 4GUHA 3EWZA 4OU1A 1GG1A 4PH6A 2NV2A 3BICA 3H2NA 1Q63A 2J9ZA 4R27A 3R7MA 4F0KA 3WX7A 3ZR6A 2QPUA 4ENLA 3NFUA 4G6CA 5FJTA 1OINA 3M0VA 2TPSA 5HNNA 4PFHA 3O8AA 1RPKA 1UD2A 1TJRA 1OZMA 4PEEA 3TN5A 2E6FA 5J04A 3F1QA 3W86A 4GYKA 3M0ZA 1EGMA 1Q45A 4IIEA 5MKGA 2QJIA 1A0CA 2YOCA 3O05A 1JCLA 1W91A 3CO4A 1ICPA 3CWOX 4FA3A 3FW6A 5A6BA 3P67A 1FWNA 4Q8NA 5CG0A 4XBSA 3VMOA 1V02E 3HQNA 3OPSA 4Q7NA 3WD4A 2P0IA 1ISYA 1I2PA 3DHPA 3PZQA 5BOEA 1UBSA 3ZVHA 2ZTJA 1CXHA 3LDVA 1XP3A 4WDUA 2Q6ZA 3VA8A 1PZ0A 3W7KA 1TIMA 3N3TA 4RR4A 4HPXA 5KSWA 1UD5A 3RN6A 2HVNA 2GYIA 1DWHM 3M4HA 3CUXA 4ZXOA 3I3BA 2ZC8A 4H00A 2PDGA 4CGTA 1OFBA 4IFRA 3NL2A 1LG2A 3GR4A 4R3UA 3U3HA 3AQUA 3T55A 4PA8A 2FPTA 1AJ2A 3T6CA 1H7XA 5IXEA 4QXIA 3G0XA 4OWGA 4FNPA 1ZAIA 3FA5A 4XQ6A 1PEZA 2CNCA 1LRQA 4M6VA 5I00A 1X7FA 3KOYA 1O1HA 2ZRXA 5G1TA 3CIVA 2RH9A 1D3CA 3UJEA 1JAEA 4DWSD 4JY9A 4F79A 3MSDA 4OGZA 1QO2A 3GM8A 1UR3M 1PTGA 4HNTA 1AA1B 1K03A 1O5RA 4QJ1A 4XG1A 3UPBA 1NDYA 1TWIA 4WR3A 2VRJA 4FXFA 4MYAA 5FSDC 2OEJA 3FA3A 4Y90A 4GUIA 2GJRA 3WUFA 4HNNA 3KCJA 3OYZA 5CBBA 1DBTA 1QHOA 2WKGA 4QIUA 5AY7A 1GUVA 1W1A1 3DKLA 3AJXA 2VNCA 1JIBA 1Z7AA 1WKFA 4YS1A 3ARXA 4PB3A 4C6CA 3L4UA 1B90A 1FWAC 2NX9A 2PDFA 4XSLA 1HO4A 3BTNA 3GX9A 3R94A 1R38A 2XGZA 5HQEA 3CO8A 4WF7A 5E6YA 1X6NA 2RHGA 4ZOEA 1AUSL 2BOFX 1WKDA 2VFGA 2FZ8A 1OT1A 1Q4WA 3BSMA 1RQBA 4YTRA 2MUCA 5K7JA 2NWSA 1MVYA 4NRRA 4AIUA 2YFNA 3VD9A 3VGEA 3ABXA 2EJ1A 1E4LA 1KFCA 3TWAA 2QUVA 3QM3A 4XD5A 2E25A 3PSWA 3FGCA 3II1A 4D1JA 5CXPA 1QR7A 1V3MA 3VDHA 2V3EA 5EMLA 1VHCA 3RJXA 1XF0A 2W5FA 3LSCA 2OG9A 1KCXA 2ZUWA 1CLVA 2Y85A 1O5KA 2Z2BA 3CHCA 3HQ1A 1VPXA 1XSJA 2ZZ5A 2GGIA 2XPKA 5MF5A 3FJ4A 2WVSA 4YTQA 1RALA 2HZGA 3DHDA 5E9AA 1B3YA 3AOFA 4HMCA 4WGHA 4A6GA 3AS1A 2IUZA 1K7FA 3M0YA 3V5CA 1YDNA 3AIVA 1IE7C 1JCMP 2X1UA 1B3WA 3R10A 4HD5A 6REQA 1VIWA 4QGCA 3G1RA 3HO8A 4L64A 3WFAA 3LPPA 4BEUA 3W2NA 4ZQMA 1DJNA 2Y8UA 2WJEA 1ODZA 4HT3A 2BG5A 3ABRA 1G4EA 1H7NA 3SZ8A 3W2MA 5C2GA 1OT2A 5CJ5A 5DT7A 2DZPA 3F4NA 1W3JA 1NFBA 1J18A 3MP4A 4UTKA 1ITXA 3WF3A 2XH7A 1RJRA 2E09A 3N2OA 1WX0A 2P76A 1JZ5A 2YL5A 2RDWA 3S1VA 3TC7A 4ICMA 1LOQA 2J47A 4LANA 3VU2A 2IKIA 1I1XA 3QYQA 3W23A 2Y63A 4ZB2A 3DYOA 1WKYA 5BCAA 3QGVA 4ZOAA 1K6WA 3S2LA 2V6AA 2Y70A 1GKPA 3S1WA 3FSUA 1GPFA 1LZOA 1DP0A 4LQ1A 6REQB 3CQ0A 2B7OA 2ZA3A 3COTA 1N8WA 1BVNP 1CXLA 3TH6A 2C1GA 1ZGDA 4GYFA 4QLJA 3B9EA 3PANA 3WL1A 4BF7A 4DZ5A 3DG6A 4LSBA 2J88A 5I2UA 4DJDD 3GG8A 3HQOA 1XLCA 5CC5A 1RQHA 3QZAA 3KL3A 2NLIA 4IIFA 3KTXA 1ZJAA 2HROA 4IMEA 4R9OA 2HQAA 4A21A 3LCHA 1DEDA 1ZPTA 4NSBA 2R94A 4MWAB 3AU2A 3S47A 4ATWA 3BAKA 4MKVA 5EMJA 2BP1A 3O16A 1RPXA 1TPC1 3Q4DA 3K4DA 2QVHA 2CLFA 1QOQA 2JF7A 3R12A 1NWUA 4A3HA 1B9BA 1N82A 2CITA 1TUXA 3DFNA 3E0LA 3FAXA 4QQ3A 3EB2A 3CMGA 2WVVB 3RX3A 4BS0A 4BKNA 2CBJA 5M5DA 3VX1A 4TIMA 2PLCA 4QEHA 1NY1A 4DBUA 4C6FA 4DBDA 2PWHA 3CU2A 2V30A 1P1MA 4FLRA 5D9NA 2J7DA 3T44A 5XIAA 2RDXA 4D72A 1ICSA 1WE5A 2PDXA 4ZOBA 4UTWC 1TSIA 2C18A 3WNKA 3UESA 5A8OA 1A5OC 2WQPA 3L2MA 1GVIA 5HA7A 1VH7A 1A4MA 4C6MA 3GD6A 1KC7A 3L4TA 5AHMA 1GVFA 2ZX5A 3RLGA 3BOFA 3B3DA 1V93A 2VR4A 2YFOA 4Y9AA 4ZODA 2ZRVA 4FP1A 4N2YA 4M5PA 1KBBA 4L9ZA 1SFSA 4UQDA 3PBUA 4HN4A 1T6MA 1U22A 2JGYA 1IXNA 1TPWA 1GJWA 1OGSA 4DJEA 1DWIM 3A4WA 1XSIA 2PC8A 3GDBA 4BHYA 2BOGX 4KKXA 6PTDA 3QMTA 3C3UA 3VCNA 2YLAA 4M7SA 1NSJA 1XYCA 3PPCA 1CLXA 1M7XA 1Z89A 1RLCL 7REQB 1TV7A 1TWSA 4B5TA 3OOQA 4HNVA 4NP7A 1PKMA 3EEGA 1PDZA 4IIGA 3SADA 5K4XA 3W7OA 4AVFA 1FDJA 4IGNA 3LBMA 2P0OA 1Y5WA 1AH3A 4LRSA 1OG0A 4ERIA 4LBRA 5EB8A 4H7VA 4H7ZA 4LPCA 2QCEA 3MTWA 2V0TA 2V81A 2OOGA 3OVPA 2INZA 1OCBA 2PDJA 3LZ3A 4Z1YA 3T40A 3JRKA 3WDJA 3ATZA 3SUWA 1XH1A 1KRCC 2PRMA 3QC0A 4AHPA 3F7JA 3LQLA 3CS2A 4XAYA 1DE5A 1V3JA 1WDDA 4KEVA 4IMDA 1EIXA 2PZNA 4H6EA 2YR1A 1XQKA 2GSEA 5FF7A 2R91A 1E3ZA 5LYRA 2WNNA 3S5OA 3MVTA 2A7NA 1ZSXA 4KGLA 1HW6A 1DXIA 5G1MA 1BWVA 1XC6A 2PU1A 2XN2A 3N6JA 4HYVA 5I7GA 4PMVA 4ZVJA 3WQGA 1G69A 2BY1A 1EYWA 2FVMA 1V02A 3MKVA 3LTPA 4ZB5A 2F6KA 4MOZA 4AMAA 5DLCA 2OWWA 1JUBA 1KM1A 3UXDA 1XD0A 3GU2A 4INFA 1Q7MA 1XGEA 3M0JA 5AFDA 2ESCA 2WBGA 2R24A 2ZVRA 3DBPA 3PNZA 2VZOA 3FCPA 2FHCA 3BAIA 4Q8OA 5A3HA 3KBWA 4O10A 4UZSA 5HBFA 2DSZA 5AHLA 5JBFA 3DHUA 2F7FA 5T91A 4A05A 3KL0A 4Q3MA 1MZRA 2X30A 4PUDA 1EDTA 1CXFA 1RY8A 4Z2IA 2ZZ2A 3U6WA 3E1F1 7A3HA 1UOKA 2OKTA 3GNDA 4E5TA 3QN3A 3MQTA 1ONRA 1GHSA 2W91A 2PPGA 3RIKA 2CLIA 3BG9A 3C52A 5KMYA 3TE9A 5AHNA 2VX6A 2FTWA 3ARZA 4YWSA 4RNJA 2X16A 4F3HA 3NSNA 1EJXC 1RQEA 4Z2JA 4A3YA 1IZJA 3CUJA 5A8NA 3A3HA 2ZX7A 4IFKA 1NOFA 2W6RA 5EKYA 2CLLA 3UY7A 3MI3A 4IISA 3PBMA 4LAMA 3BC9A 2PP3A 4JYDA 1NP0A 3APTA 5KINA 2ZVIA 3NEHA 4LU0A 2YYUA 4QE1A 3ARRA 1TYGA 4ACZA 1LOSA 2BXVA 1RH9A 2DT0A 1XLDA 3W83A 3NM1A 1DIEA 3P8IA 1YYAA 4NNCA 4TXEA 4Z0SA 1RLDA 4W86A 2J13A 4EKJA 1AH4A 2PS2A 4Q4QA 1HKVA 4HGXA 2RJGA 2F84A 5LA2A 1CGYA 3KBVA 1PIGA 4WOZA 5HJYA 4UOZA 2WC3A 3H6OA 2X40A 4Q4MA 2JKEA 2VR5A 3TNBA 4PMDA 2FMOA 1XLLA 3LHTA 1E0XA 1WBJA 2A4AA 3M9YA 4CN1A 3SRDA 4CQCA 3W88A 3V75A 3UVIA 3SCQA 3W7PA 4UTWA 2ISVA 1GYMA 3URQA 4O50A 1XKJA 4AVNA 1CGTA 4KWOA 2J25A 4B4HA 3B8VA 1Q6EA 2HCVA 1EJ7L 5IBXC 4DO6A 4GFIA 2GVLA 3IIXA 3PUDA 4PULA 1T99A 2NVAA 2VI0A 1FA2A 2ZTKA 2YZRA 2WVTA 2YCJA 2ZZ1A 1H62A 3MYOA 3RM4A 1W32A 1H51A 4M6QA 1UWAA 1FFQA 4F66A 3NG3A 1UB3A 3QBUA 1IT0A 1ESWA 4PTDA 4H6QA 5EFFA 2HTMA 3QF0A 3W7GA 4RZBA 1DPMA 3AIWA 1FCVA 2ZQ0A 1T7LA 4YVXA 4E2DA 1E4IA 5LZLA 4UTLA 2VGFA 1EWEA 3H54A 3AXMA 2A6LA 2G3FA 1HKJA 1XCFA 3CL8A 2NQ9A 1HJVA 2FHFA 2VDHA 5AOUA 5K9XA 3ZOAA 4QDPA 3LA4A 4DUXA 4ZZ9A 5G4HC 2GFTA 3EDKA 2DFAA 2XVKA 1LL7A 2GJNA 1OCQA 2IKJA 4IMCA 3UXKA 5K4ZA 1D8CA 4O1CA 4WZHA 4YJ5A 4U28A 4KETA 4L4LA 3W2KA 4Q7IA 1GW9A 3F4VA 4DXVA 3AALA 4LVDA 3EGJA 3GFXA 1GQIA 1WDRA 3KDNA 1QPOA 4JHZA 3VNMA 2ATSA 4JTSA 4DWDA 4P5UA 3C86A 4R9XA 4JICA 2DT3A 3V36A 3HG2A 1D8WA 3ONCA 2FZ9A 3Q65A 3OZOA 3LCXA 4AAJA 2HVOA 4JX5A 3VD4A 3LXAA 4Q8TA 3ISIX 5FSEC 3C8NA 3RITA 2J75A 4Q6JA 4A2RA 1JF6A 2V2DA 4OOZA 2J24A 1S5WA 2XSAA 4KH2A 5LSMA 2GUBA 3RNDA 1DWFM 3S3GA 3T8QA 3J7HA 4PC8A 1W1ZA 3S4TA 1VBHA 1XCXA 3DX5A 1TTQA 1B4EA 3CC1A 4WXYA 3CPGA 4JYEA 5GJPA 4EANA 5HJLA 5DQPA 4X2RA 4Z2KA 2FVKA 2YGYA 3CZJA 3IEBA 4V2XA 3GHUA 2E6DA 3E2SA 3AHXA 4UMBA 1Q6FA 5EYWA 1JDEA 3A5FA 3A13A 3GW0A 4BY3A 3MP3A 1V6TA 3K4AA 4QNWA 5HMEA 3NJ3A 2E40A 4R34A 1VLWA 1UR8A 1F9CA 1IEVA 3ORWA 2ZA2A 6XIMA 4UMAA 4UFKA 1EHAA 1QNRA 4L4PA 3NYZA 5IHSA 3CM4A 3W53A 1A80A 1P0NA 4Q7BA 1ZALA 3CUGA 5HK4A 4MG4A 4R5EA 1J0KA 3WLRA 4DO5A 2ALRA 1XINA 2PURA 1LUCA 4P8WA 2PI6A 3KTSA 1LLZA 3E5BA 4L9YA 2NWRA 4QJ3B 3U9IA 3VILA 4Y9OA 3UG8A 1EEPA 2CBIA 2WBKA 4IOTA 2PLKA 4DXXA 2H8ZA 3DFHA 3CWNA 4HCLA 4DUWA 5I77A 1H60A 3QZEA 3UU0A 4Z1DA 3MHUA 3AMKA 4JIPA 2IPGA 5C0QA 1VYSX 1DIKA 2PE4A 3ITOA 4EF8A 1R5YA 2ZZ6A 1J0HA 1R3YA 4JX6A 1HX0A 2EJAA 4DLMA 1IWBA 2H3DA 4EX4A 4QS6A 4D6DA 1OX6A 3GG0A 1JCXA 3M5ZA 5LKYA 3TQ0A 1N8FA 4W89A 2FDMA 2FGBA 3JS3A 4A3UA 1CGWA 1C7SA 3QFEA 1YE6A 3AXKA 1GYNA 4CNUA 1W37A 5HQMA 4I8YA 3C2FA 4B5VA 3ITLA 1E5JA 1XG4A 4HNLA 5HATA 3G22A 2OVLA 2ZUNA 2V3FA 4UB9A 3OW1A 1W3IA 3NZGA 3FXYA 1B30A 1SPQA 3ITGA 3RLUA 3RXZA 4FS9A 1W2VA 2OKOA 4LVFA 2Y1HA 4BJHA 3S9IA 5LNSA 1W9XA 1XM3A 5I79A 2C16A 5G4EA 2IPWA 4MB1A 2DJXA 3POHA 4L61A 4PMRA 4S3BA 2D73A 4JS3A 4MUZA 4NL1A 3VTRA 1VFHA 2Q09A 4V1XA 3NO5A 4C1NB 3OVGA 1L6WA 3IIZA 2ZFAA 4MMWA 3P74A 3SGGA 1V3IA 1OWQA 2XFRA 2XISA 3H8AA 3WUBA 3AIEA 1ZBWA 3VKAA 3BE7A 3WQEA 4PMUA 4J3TA 1HKWA 4BK9A 2X2GA 2YDAA 2DUZA 2OZ3A 3FEMA 1LJYA 4XAGA 3ABOA 3MDUA 5CEWA 4GIEA 4EE9A 4RLIA 3C6CA 3LXCA 3WKZA 2XINA 3PJUA 2DQXA 3VMPA 1TTIA 3H55A 2J7BA 5GVJA 4UQBA 2QUMA 3CB8A 1QTWA 1BG9A 3SUSA 3EXSA 1Z44A 5CGQA 1JEZA 3B05A 1P6CA 2ZWYA 1SFLA 1EF3A 2F61A 1OY0A 1UQYA 2QMJA 3HPAA 3VKCA 3M5VA 3CZLA 4RDYA 3VIHA 3NGFA 1I45A 2FHBA 3O6DA 3G2GA 2ZKMX 2PLJA 1J8VA 3RCMA 1LBFA 4NJJA 3E0FA 3WDRA 2NZLA 4LVAA 4XIAA 2MANA 2WC4A 5FKYA 3QV9A 5HMFA 3EWDA 3QQ0A 2HS6A 1JGMA 1ZAHA 2W9MA 3MSYA 3FFSA 3RLHA 3AAMA 4H19A 1HXJA 4HPNA 2HJPA 1TIWA 4MB4A 4WEVX 5I3IA 1Z6KA 2GJXA 1HGYA 1NWTA 4HHLA 2BASA 4P8UA 3OYXA 1JZ2A 5GPRA 1SM9A 3SFWA 1XIMA 1P0EA 3WD3A 5D05A 3BV4A 5ABHA 1IGWA 3W76A 1HNYA 1W17A 3V7PA 3ZLFA 4F4RA 3GXDA 1HN1A 5BW6A 2ZUTA 1SGJA 3I4EA 4LBUA 2Z1VA 4XUYA 3MSRA 4V27A 1PHWA 3JW7A 1JYWA 1VGAA 1VFUA 3NVTA 3B9AA 2I9EA 1TA3A 2IPFA 4B5XA 5CPOA 1E5NA 1UA7A 2VT0A 1LP6A 3A4XA 4YTTA 2AKZA 1VZWA 4GCXA 3I7QA 2Z4GA 4Z08A 3SCUA 3JZUA 1F73A 1H4PA 2I7GA 3DGRA 1E72M 2D22A 4UNIA 3N15A 4B4FA 3VOCA 4NZFA 4E2BA 2BOEX 1XV8A 4LB4A 1PHQA 1B1YA 1EQCA 2VXNA 3CZKA 3O07A 1P6BA 2XWDA 4WDWA 2R6OA 3AU6A 3NVDA 3G8RA 3OGSA 1GVQA 1QXLA 2GSHA 2WMJA 3L4VA 2BXZA 4QG8A 1UR1A 1GOQA 3LNPA 5LA0A 3P81A 2WQDA 1QNQA 2ISWA 2C0HA 3WQDA 2BY3A 1J79A 4MFEA 3WLKX 1L6YA 3TROA 4C6EA 4G9PA 3SI9A 3L0KA 3V35A 4MJMA 3ZSTA 3S83A 3ES7A 3BXWA 3QTPA 3AICA 4DBSA 4HU4A 3DU0A 4FXJA 3RJYA 3MUIA 1YTEA 3TQVA 3EKLA 3GR7A 5DO8A 4QJ4B 3R8GA 1C8QA 1Q6LA 3TJLA 2YXGA 4P61A 3AIRA 1EC7A 3CTLA 1ZRQA 1U5JA 1VR6A 2O9TA 1G1YA 1K7EA 3B8WA 2DZUA 2QUNA 5TAOA 1CGUA 1JULA 2VTFA 3UW6A 2XFFA 2VC7A 1E0UA 2IKHA 5TQLA 2XVLA 3HGSA 3I7SA 1L6SA 2Y89A 4LVGA 2BHUA 3AZRA 2Z0IA 3CLMA 2YXXA 2HWGA 4AZCB 1VKFA 3NQ2A 2QT3A 1ZTVA 1W9PA 4QX4A 4WSHA 3VDAA 1J96A 3PZVA 4EPDC 1CT5A 1ISVA 1OQFA 2WAGA 4XBJA 1UQZA 2Y8KA 3LRLA 1R3VA 4JQ1A 3AHVA 1H0IA 4GE8A 1W1TA 3LCGA 3TYDA 1LM1A 4CN4A 3G3MA 4S38A 2QF8A 3K1DA 3SY1A 3QY7A 1JPKA 2INFA 1A3HA 1F7BA 4AEEA 4WDTA 5HDRA 1KLZA 5MHBA 4TO8A 3TTQA 3NQVA 1FHUA 4Q8UA 1S5VA 2HDJA 1E6RA 2HPMA 1T8XA 2BODX 4UC5A 1XH2A 1PWLA 1TCMA 2NQ5A 3PBGA 4IPLA 3OU8A 1B0IA 4NKCA 2I56A 2VFFA 1KW1A 2DW7A 4ICCX 2ZZ4A 3KBSA 1HJQA 1OF8A 1PUDA 1FDYA 4NHVA 4TUFA 3TVAA 3GE7A 4AQLA 3T08A 1W6TA 5CH9A 3OZPA 2VDGA 3LRKA 3CQHA 1ONXA 3MCNA 2AL2B 2FIQA 4CNOA 1XLMA 3R79A 4K6AA 3P2VA 2EQDA 3NA8A 1JDCA 4UTMA 3AMDA 3PPHA 1MO0A 4EXAA 5I0DA 2OELA 1NDVA 1EP2A 1NDZA 4S3FA 1VEMA 4ZTYA 1KXQA 1AQHA 4K36A 3PSVA 4BWLC 4AZIA 4XO7A 5CBJA 3CB3A 3BGGA 4X60A 4E3VA 1DXEA 1Q7ZA 5JIPA 2VVSA 4QSFA 2OLHA 5BRQA 2E9MA 2D2HA 4GX9A 2W0UA 1GYLA 4N02A 1J0YA 5JIWA 3W0KA 4LTSA 3VNIA 2OEMA 3M6YA 3U8GA 2VUNA 1UD4A 1ZJHA 5I78A 4XKYA 2OZ8A 4KRTA 2FPYA 2PFHA 2BLEA 3FJ6A 3W1MA 1TVLA 5FD0A 1B3ZA 3U4FA 5DBTA 3O7UA 4J2PA 3PY2A 3PC0A 3AYRA 3WLNA 3LD5A 3LN3A 4MPQA 2FZMA 1Y5XA 3SBFA 3QKEA 3BDKA 3O15A 4WOQA 2XTKA 4YL2A 3OZMA 4ROPA 4W7UA 2OMAA 4JN7A 2P1FA 1M9HA 3ALGA 1RCXB 1SZEA 1QPQA 4RZ4A 2A7PA 2CLHA 3WMCA 4B90A 4XIMA 3LCFA 4GACA 1UZHA 3FN9A 4O11A 1TTJA 3NPWA 4AG0A 2BHYA 4M82A 4R7WA 3S0CA 4C6OA 5CZKA 4M3PA 3IJ8A 2IW0A 4MDOA 1LWJA 3PHAA 3RF9A 3UQNA 1GOXA 4Y96A 4KWVA 2HEJA 3CQJA 5BZAA 1S46A 2VZUA 3VUPA 3REQB 4JIHA 2ZE0A 3GDRA 3UR8A 3N25A 2RGLA 2ICSA 1BYCA 2G3NA 4GYJA 3DDMA 1R3WA 3SCNA 3THCA 4HHMA 2E6YA 3WJXA 1UR0A 1EPVA 4AIEA 3WLJA 4AXNA 4AWTA 3AXXA 3WMBA 3THDA 4CNSA 4RE3A 3UJ2A 2FB2A 2E67A 6ENLA 4FK9A 4FXSA 1UKQA 2A3BA 3PZIA 3GKAA 1B5TA 1KFJA 4JTHA 4AZ7A 3BVJA 1QFEA 1KWGA 1HP4A 3RX2A 3TSBA 3LXBA 1XBXA 4S3EA 3IV8A 3L4YA 4UR8A 2CBUA 4S1FA 1YBQA 3OZYA 1ADOA 5FJIA 3DHFA 5I3DA 1C7TA 2QW5A 3RPMA 1ZLPA 2ACUA 4EXBA 4Q33A 3W82A 1Q2SA 3MDWA 3CWHA 3MWAA 3GFYA 1IV8A 4RDVA 1OADA 2QKFA 4X0NA 1KLYA 4PRWA 4H1ZA 4JAWA 2A3AA 2C19A 3T78A 3BQ6A 1T0OA 3RHGA 7PTDA 4KCTA 5IBXA 3ONBA 1RD5A 4H41A 3TJ4A 3ARPA 3CV7A 1AODA 3S1XA 4C90A 2C3ZA 2Q8ZA 4S2BA 4AH7A 2ZA1A 2FLIA 3B0PA 5KZ6A 4WVXA 2P8BA 1ENUA 1NOWA 2C15A 1SQ7A 2F8QA 2WPGA 5AYBA 5BXTA 4LUYA 4D6CA 5F4SA 2D69A 4OUIA 3B40A 3KOFA 3WD2A 1UMLA 2X7VA 1CECA 4QAIA 3V0UA 1QDSA 1V5XA 1GTEA 3KVLA 2CPUA 4Z17A 1W9UA 2NVDA 3VUSA 2WYSA 3LGDA 1S1PA 1F4HA 3VO0A 1DKWA 4X2PA 1VPYA 1YNQA 2WNZA 2DQWA 1QK0A 4LCSA 1C93A 1EJVC 1TPH1 4XAFA 4BFAA 3LMZA 4NILA 4GCAA 4HCHA 3IARA 1TJ1A 1EXBA 3T4CA 2QYGA 4HYWA 1GW1A 2PODA 2BTMA 2WZIA 1GT8A 4GQRA 2DT1A 4IPIA 3W7CA 3QMRA 3RILA 5AZ1A 2Z28A 4PMOA 5CZSA 3CK5A 3EA1A 1UG6A 4AHQA 4IQEA 5RUBA 2XZ7A 3H2AA 3PFRA 4MJZA 3GC2A 5H8PA 3S42A 3C8FA 3GNXA 2G4JA 2G41A 1K9TA 1OHLA 1G4TA 2NUYA 7REQA 5I3JA 1RZMA 4TX6A 1VFFA 4AD0A 1J2BA 1NH6A 1DV7A 1O60A 1OGGA 4H8UA 1GCYA 5DF0A 2AQVA 2F38A 3R1ZA 4CCCA 5HINA 2GVGA 1ZJIA 3LI0A 2PWDA 1IT8A 5ABEA 3UJRA 1FWIC 3QXBA 4WSKA 3EA3A 4O1FA 4ZE5A 3IACA 3VVGA 4M1RA 3P3BA 5CAHA 3E9AA 2V8ZA 1V03A 1BWKA 5HOSA 5BMWA 4H2HA 4ZOCA 4WDXA 1UCWA 4AD5A 3TMQA 3VC6A 4B5SA 1US2A 1KM3A 2V67A 2UY4A 4QBXA 3BJSA 3AMCA 4AZBA 2R1MA 4RPQA 2ZX8A 3B0YA 4XD6A 1JZ3A 2RDTA 2WWDA 2ZWZA 1KXHA 3QJAA 2JEPA 4C6QA 4HP5A 1KB3A 1YBQB 3EX1A 2EAWA 4UWMA 4FR1A 3A24A 2NXHA 4B16A 3I10A 4GIYA 1OYBA 4KWWA 3WENA 1SSDA 4MADA 4DF0A 4IJRA 1BTMA 3LENA 2JALA 3N12A 3ITVA 1RBAA 4IPPA 4LS0A 5EFDA 2WM1A 3N9RA 2G96A 1XHGA 3VOHA 4E8DA 4ZE4A 2W27A 1LLOA 1KXTA 3EX6A 5CJNA 5EBUA 2XGBA 1XYLA 4IX0A 3NL3A 4J35A 3CV6A 4HZ7A 1J0IA 3VNDA 1T40A 4R33A 2WHJA 2JFEX 1PKLA 3E02A 3ALFA 3PVFA 2AL1A 3W1QA 2ZC1A 3PUOA 3AUJA 4TX8A 4YLWA 1AVAA 3QH2A 4LWWA 1Y7VA 2BFGA 3MANA 3AHZA 2H9AA 4D6GA 5LNWA 1R3QA 2QJHA 2VD8A 4HBKA 3WNPA 3PJWA 4DY1A 4LALA 3WLHA 5JU6A 2PGWA 1XYMA 2YBTA 1HVXA 4JD4A 1W1IE 1PV8A 1E9IA 1XGZA 1GG0A 3DYMA 5BXPA 1W2PA 3FGCB 4US6A 3N1AA 3H2FA 3QV7A 4Q4SA 3AYVA 1H0GA 4DO7A 1R9ZA 5HQLA 2TRSA 1A5LC 4UBPC 3DFQA 5FEPA 2VEFA 2X1IA 4NYUA 4GZIA 2R1LA 5A6TC 2RUSA 2GJLA 2YKKA 3CHDA 2ACRA 5AZ0A 1FWRA 1FWCC 2DZTA 3OLIA 1WV2A 3CAKA 3L7RA 4MFDA 2G95A 3AXHA 4HN8A 5E0CA 1U33A 4RJEA 1XIIA 4FXRA 5M3WA 2GWGA 1KD0A 1E1EA 1KBLA 1CB7B 2ISDA 4CNTA 4A8NA 4MPKA 1FTXA 4ZA0A 2OCZA 3BMXA 4CLMA 1TE1A 3ITTA 3H2OA 1MDLA 1VEPA 1QMLA 5A69A 5HANA 3WQ4A 4KEZA 2QCCA 3M0KA 2HV5A 3L21A 3BG5A 4HJFA 4E2OA 1YXYA 5I3GA 4QNEA 1PVNA 4JPGA 3TYEA 1JZ7A 2VEGA 4NG3A 1Q6DA 2H3BA 3LM3A 3W24A 1ALDA 3MKCA 1M03A 3WELA 2A1YA 3BGAA 2OGYA 1ZFJA 2OFJA 3IVSA 1E1CA 3L68A 4K1WA 1XQLA 4PTNA 4D6IA 3SM0A 1UMYA 2ZRWA 1A53A 1E71M 4QQUA 4E8CA 4HQVA 1XGDA 5EMKA 4AEOA 3EOEA 1XIJA 1A47A 4E4FA 1KM6A 5CPNA 3R2GA 3B9DA 3GAKA 3W7LA 4O17A 4UXDA 3W26A 4DNHA 3SURA 3UNDA 4F40A 3B04A 4G5DA 4C60A 2E8ZA 4XV0A 4OOUA 3WSUA 4CNNA 2F2HA 1EHNA 3GC5A 1OF6A 2WMIA 2QNEA 5A2CA 1SO6A 1Q6GA 4HB7A 4W84A 2Q01A 4FO4A 4HPGA 1SZFA 4AISA 4PCNA 3QHMA 1TG7A 2DZAA 3V5OA 4N0RA 3P82A 3W7NA 4K8EA 4CCZA 1KFEA 4QDMA 5JUVA 1R0MA 3ZLGA 2HBXA 3C3NA 4GXMA 5TF0A 5FF2A 3H22A 1KTBA 3SQSA 3YPIA 3AIBA 4B2DA 3CYVA 3I6EA 2QDDA 2WKLA 4PL2A 4FNQA 1A5MC 2FMNA 3KX6A 4TVDA 1HUVA 3FVMA 3OHMB 3FJLA 3TMLA 1JQXA 5B7YA 3C4UA 1JCJA 3CXOA 4UTIA 4CQ8A 4XVEA 1OFEA 3NCOA 4ECLA 1TKKA 4O1BA 5CAKA 4I6VA 1H63A 2OSWA 1PAMA 3IJLA 3CUZA 3PPFA 4C7FA 5BOOA 3EPMA 3EDJA 5C9XA 1FCQA 1BF2A 3TC3A 4C7GA 3N9KA 3S1GA 3B8TA 4C6KA 4JL2A 1FCBA 4J3SA 4S23A 3GC4A 4E4UA 1PYFA 3REQA 4HPJA 3PB0A 3W25A 3A9BA 1K4GA 4QDWA 1SW3A 3LZ5A 1DJWA 3HGOA 5CLTA 3TZFA 2WV8A 3FX4A 1TTPA 4BF9A 2ACSA 5D8WA 3PJXA 1JZ8A 3D47A 3GZ3A 1XYAA 3NZRA 1RA5A 3WD0A 1BAGA 3A21A 4DBWA 4ZFMA 4H6RA 4UTHA 2Z1KA 2GGGA 4KGJA 2V69A 3BLPX 2VWSA 4DAFA 2DGAA 3WK0A 1OJXA 1OC5A 4IPJA 3WBWA 3WQ5A 1XLKA 4XD3A 1LORA 4O4WA 3UETA 3W1TA 4GNKB 4L6DA 3UVAA 1KFKA 4FIRA 2V9DA 1TPEA 2CZ5A 5BU9A 3PBYA 2CETA 1RBLA 3SJNA 1TZZA 3CT7A 4REQA 3GU1A 1NTHA 1T8QA 5ENLA 3EYPA 3SUUA 4JR5A 4GOAA 2XH4A 3SR7A 3T81A 1KQYA 3UXIA 3LHZA 2WZEA 3MA8A 3DYPA 4FF5A 1SZNA 2I14A 2EBNA 2I9UA 4U4MA 3VIGA 1GVOA 4M7TA 4LB3A 1IEWA 2CEQA 3UBPC 3B0XA 1XX1A 2ZUVA 2BHZA 4O18A 3B8DA 1ECEA 2DSUA 3IUHA 3AROA 4FIQA 4MZYA 2REQB 3FVDA 3DEQA 3NXFA 4S39A 1IWPA 4NF7A 3PAJA 4NZ3A 4NT0A 3NQMA 1B31A 1QU4A 1OVDA 3W6LA 3GHSA 3NTYA 3VKJA 1BTCA 3GBDA 3VC5A 2QAFA 4DUVA 3NQ7A 4N9DA 1M1BA 1XRFA 2DSWA 1LBMA 4RV8A 4JL1A 1QOXA 4A8RA 4J4KA 4KIRA 4Y6GA 3STCA 2BWGA 1V6YA 5EMUA 2VEIA 1XLGA 3HTWA 4U2YA 3TA9A 4B5NA 4OZOA 5SWUA 3W7IA 1H09A 2WNQA 1HKMA 3KP1A 1FY6A 1DJGA 1OFAA 2GDVA 3FK4A 3WQCA 3GWQA 1MFVA 3VCRA 2ODOA 4Q4KA 2FJUB 2NXIA 1C91A 1E6PA 4W87A 1Z3NA 3VPLA 4L1XA 2EXOA 3L66A 1US3A 3MT1A 2J8TA 3LLFA 4Q8PA 4EPEC 2WSKA 1D7KA 3EX4A 4MWAE 1LRNA 4LEQA 4N6EA 2RAGA 5GJMA 3NM3A 2J74A 4YXGA 1EBHA 3GHRA 2NUWA 4N42A 3VNZA 4DZAA 2HK1A 3IAPA 1P6WA 1Q66A 2OQLA 3VGGA