4HBKA

Structure of the aldose reductase from schistosoma japonicum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
310
structure length
301
Chain Sequence
b'MEPLKMNNGRSIPVIGLGTWNSPPGEVGAAVKKALEIGYRHLDCAYVYRNEAEIGEALENALNSLRLKREDIFITSKLWNTFFRPEHVRKACEETLKNLRLNYLDLYLIHWPVPLKHGGDLFPTDSNGQLCLDNVPHEDTWKEMEKLVDEGLVKSIGLSNFNKRQIQNILEHCRIKPANLQIEIHANFPNIKLVEYAQSVGLTVTAYAPLGNLLTKPCVLEIAHRHKKTPAQVLLRYLLQRKLIVVPKSVTFKRIEENFQVFDFQLSNEEMHELNTESLNERQFTLLQMSGHQEYPFKEEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1, member B4 (Aldose reductase)
publication title Aldose reductase from Schistosoma japonicum: crystallization and structure-based inhibitor screening for discovering antischistosomal lead compounds.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Oxidoreductase
total genus 103
structure length 301
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4hbkA00
2PDWA 1LQAA 2ISFA 4XZLX 4YS1A 4I5XA 1Z8AA 1T41A 2HDJA 1S1RA 3CAQA 3V0UA 2IPJA 3FJNA 1EKOA 1X97A 2PDNA 4GCAA 2PDKA 5HNTA 4JQ2A 2FZDA 4YVPA 4YVXA 1OG6A 3GUGA 4H8NA 4HMNA 2IKJA 2PDCA 3ERPA 2INEA 3GHUA 1AFSA 1QWKA 3UG8A 5JH2A 1IEIA 4LBRA 3EAUA 4QBXA 3LBOA 4XVDA 3H4GA 2F2KA 4L1XA 2AGTA 4H7CA 1MZRA 1AH0A 4R9OA 2C91A 4EXAA 3M4HA 2PDUA 3BURA 3CMFA 1JEZA 4NKCA 3R43A 4XZHA 5LIKX 4LB3A 1GVEA 4GIEA 1VBJA 3WCZA 2ACQA 2DV0A 3UYIA 5HA7A 4LAUA 1LWIA 2IQDA 4GQ0A 3LZ3A 1YE6A 2R9RA 3LQGA 5M2FX 1X96A 2F38A 2IKHA 4QX4A 2INZA 4JTQA 4QR6A 2IPGA 1PZ1A 1PWLA 4XZNX 4JIIX 5C7HA 2IQ0A 2FZ9A 1YE4A 1ZUAX 3FX4A 2FVLA 3Q65A 2P5NA 2J8TA 1XJBA 1X98A 4AUBA 1PWMA 2PFHA 4L1WA 1M9HA 2PD5A 4EXBA 3LNMA 3WBWA 4YU1A 3G1RA 1Z89A 5JH1A 3BUVA 1RALA 4GACA 5LIWX 1ZQ5A 4RPQA 3M64A 3UFYA 3CV7A 4LAZA 3NTYA 4GABA 2PDHA 3R6IA 3T42A 4XVEA 2NVDA 4XK2A 1S2AA 3BCJA 4DBUA 3RX4A 3ONBA 1AZ2A 3Q67A 1C9WA 1PZ0A 4WDWA 2PF8A 3UZZA 4XO7A 2ACUA 5LIXX 4JIHA 4WGHA 4DBSA 4PUWA 2PDQA 3B3DA 1AH3A 1Q13A 1A80A 4HBKA 2HE5A 1S1PA 3C3UA 3CASA 2PDBA 4G5DA 3VXGA 3LEPA 3R94A 1K8CA 3MC5A 3LENA 2ACSA 3BV7A 3CAVA 4JTRA 3DOPA 3R8GA 4F40A 1Q5MA 4JIRA 4XO6A 2PDJA 3CV6A 4GQGA 3GHTA 4IGSA 1J96A 3U2CA 1ZGDA 2PDLA 1ZSXA 1MI3A 3R7MA 3R58A 3O3RA 2PD9A 3H7UA 4PUUA 3WBXA 3GHSA 4WDUA 2PEVA 2PDPA 3LD5A 2HV5A 4WDTA 4FZIA 2BGSA 1EXBA 2HVNA 3G5EA 2HE8A 1XGDA 3N2TA 4OTKA 2PDIA 4ZFCA 1AZ1A 4JTAA 4PRTA 1IHIA 4XZIA 2HEJA 5DANA 2PDMA 1SM9A 2IKIA 3UP8A 3LZ5A 5AZ0A 4WRHA 1HQTA 3RX2A 4PRRA 3ONCA 2IS7A 4LB4A 3V36A 1MRQA 4IJRA 4MHBA 5AZ1A 2PDFA 1US0A 2A79A 3DN5A 3D3FA 2PDXA 2PZNA 3LUTA 4JTCA 1Z9AA 2IPWA 1VP5A 3RX3A 1RY0A 4PMJA 3S3GA 3V0TA 3V0SA 1UR3M 2WZMA 4JQ3A 2CLPA 3KRBA 5LIYX 4QXIA 4XZMX 1YNPA 2R24A 4LBSA 4XAPA 3F7JA 3WBYA 4Q3MA 1AH4A 3N6QA 2DUZA 2PDYA 3UWEA 3EB3A 4JQ4A 1Z3NA 1XF0A 1QRQA 3UZYA 2IPFA 2FZBA 1ADSA 3QKZA 3H7RA 2HVOA 3LN3A 1R38A 4ICCX 3R8HA 2WZTA 1EF3A 1EL3A 5HNUA 1S2CA 4IJCA 3UGRA 2BGQA 2PDGA 1PYFA 2QXWA 4PR4A 4FALA 4JTDA 3GHRA 2ACRA 4JQAA 2IKGA 2FGBA 4Q7BA 4FAMA 3UZWA 2I16A 1YNQA 2ALRA 3COTA 3V35A 3WG6A 2NVCA 3EB4A 3M0IA 4DBWA 3P2VA 2DUXA 3O0KA 3MB9A 3UZXA 4FA3A 1T40A 5KETA 2I17A 1HW6A 2FZ8A 4GA8A 1RY8A 5LIUX 4JQ1A 4WDXA 3LQLA 2BP1A 4ASTA 1FRBA 2VDGA 4WEVX 4DZ5A 4YVVA
chains in the Genus database with same CATH superfamily
5RUBA 3WK3A 3EA2A 1BWVA 2PGWA 4PCSA 1ME8A 1IEQA 4UOZA 1TYGA 3CK5A 3NPUA 2JEQA 3B9NA 3CAQA 4PMDA 3TJ4A 3SGZA 1IIGA 3V5FA 2VENA 3NQ6A 1AL7A 1F3TA 2BY2A 3BARA 2CXGA 3BG9A 2BS9A 1ME7A 1ICSA 1I0BA 2A3EA 4K38A 3B4YA 3EX4A 1VBGA 1BKHA 2QUTA 1ENUA 2G3MA 1TMHA 5E0KA 1LOSA 2PP0A 4QLKA 3EDKA 1XLGA 1G7UA 3SI9A 1FOBA 4H8HA 3EAUA 2OFJA 3MKCA 1P7TB 5A6BD 4ECLA 3CIWA 4XQ6A 4AC1X 2HBXA 1TCDA 1JEZA 1LG2A 4UFIA 3W29A 1RQHA 4BKNA 3K13A 4R7OA 4GI4A 4W7WA 2R1MA 5GJMA 2POTA 2Y70A 4PSPA 4Q32A 5IFPA 4F0RA 1RP8A 1ZLPA 2VD8A 4C6MA 1UR9A 4FXFA 4US6A 4GQ0A 4REQB 3AUOA 3NR0A 4NRRA 3E2RA 3VM7A 3AXXA 2E5CA 4TV5A 5IOBA 2DH3A 3LDVA 2GJNA 4OOZA 4L6HA 3GR4A 2ADAA 3FDKA 3RFAA 2A3HA 3AS1A 4NJJA 2QV5A 1G01A 2GUUA 4MNJA 4ERGA 2DSZA 4RX0A 4AUBA 2ZUNA 1PWMA 2WC4A 3EKZA 3CZ8A 2X8RA 1FKXA 5HOSA 4R3UA 2VNCA 2D0HA 3GS6A 2IXVA 5T91A 1CXIA 1UP0A 1WAWA 1LZOA 3IVSA 1CTNA 4ZFMA 2QAFA 2FB2A 2VHLA 4B9ZA 3VZYA 3TA6A 2CBIA 4HYRA 1EGZA 3IEBA 1C8YA 5D8WA 1XYAA 3UWVA 3VYLA 2G8ZA 2VGFA 3R8RA 5AY7A 3MHGA 4KRZA 3VNKA 4MNMA 2PDQA 3CV1A 4L4LA 3B0YA 3WDHA 1Q13A 1THFD 3OGVA 4FNTA 1EIBA 2ZE3A 4W89A 3H22A 3NPWA 2CBJA 4IXXA 3NQAA 4PRWA 4HSHA 1YDNA 4NZJA 1XC6A 1OFOA 3L7RA 3A3XA 4PUEA 1NSJA 3ZJ7A 1BVWA 3MSYA 4F40A 3PF3A 3WFAA 4AVFA 4AD0A 2TODA 2YW4A 4C6OA 2HK0A 2WCGA 3M0HA 1KTBA 3I7SA 4MB1A 4HZ8A 3ZT7A 4PMNA 3W7HA 3G1XA 2WCAA 1EBGA 2PDJA 2PWVA 4BY3A 3CV6A 2J78A 2BTMA 1E51A 3T09A 4ADSA 1P6WA 3VX1A 4IGSA 4LY8A 3CWOX 2X40A 1UIPA 3AIQA 3Q58A 4INFA 2ZRUA 3B0UX 4U2YA 1NF7A 2FMNA 4XIAA 1QBBA 2F8QA 2D73A 1MI3A 5C5YA 4IG2A 7TAAA 4EVZA 4Q8UA 3SR7A 2OLSA 4JFUA 3L4ZA 1DIEA 2VQTA 3VIIA 4K37A 3GIQA 4RXFA 4CQ9A 4IX0A 4GO8A 4N9CA 3NYDA 1XSKA 4E8DA 4WDTA 2W91A 1Q8AA 5A2AA 3LI1A 4DPQA 4JYDA 3MSGA 5DANA 2YBUA 1F61A 2IW0A 2ZZ3A 5CPMA 3QPYA 3O9NA 1FP9A 4MUPA 1EX1A 1R30A 2IS7A 3UWYA 4YXGA 1SFSA 1ZBVA 3RAOA 3RM9A 3HZ3A 5CC6A 1W3NA 2NUXA 4IMGA 5JU6A 1TJ1A 3HA1A 5C0QA 3HJEA 4Z1CA 4JL2A 4X9SA 1TWDA 3DI0A 3VDBA 4Z2LA 4N4QA 4S23A 4ZODA 3TW9A 7PTDA 5CQ1A 1XYMA 1K9FA 1R3SA 4NF7A 4ERAA 1DOSA 4WD0A 4HNNA 4LW7A 3V0SA 3TN6A 1SQ7A 1TV7A 5HR7A 5TIMA 1K7XA 1XCFA 1YXDA 2GZXA 5J5DA 4QXIA 2R24A 2YLAA 4GCXA 3F7JA 1JD9A 3ZVHA 1AH4A 3N6QA 3E9AA 2WHMA 4PUDA 2OX1A 5CC7A 1KFBA 3CUFA 4LSBA 2XIIA 4AZCB 6ENLA 3ALGA 4UFJA 4XAGA 1XLIA 5EB8A 4K8EA 3ZT5A 3R8HA 2WZTA 3IGSA 2JGQA 1JUKA 4MYAA 5HMEA 1Q65A 3CT2A 5FEXA 1FFRA 1MFUA 4M80A 1S2VA 4WKHA 4HYWA 3UJRA 2EO7A 2JGYA 3M5YA 4EACA 4FHAA 3FA5A 5LNVA 1MSSA 2XZ9A 2VC5A 3NJ3A 4AHQA 3GD6A 3RYSA 4W7UA 3PTKA 3QMTA 5M1TA 4GOAA 2BVWA 4I9JA 1LRQA 3MB9A 4GY1A 4TX8A 4LCRA 4HNOA 1M68A 3HU7A 3MJMA 1DBTA 4ZSTA 2BNJA 1TPC1 3VCCA 4J35A 2PGFA 1Q7MA 1E6PA 2CZVA 4DZ5A 3YPIA 5PTDA 2BDQA 2PDWA 3FYPA 5E0FA 3M41A 2BGNE 4URIA 2ISFA 2RDTA 5CSRA 3KBVA 2E9MA 3R13A 2DZAA 2YLLA 4M7SA 1S1RA 1TFVA 6ALDA 2W63A 5JBDA 3M9YA 2QJJA 2Y7GA 3AHVA 3GNOA 4UTIA 4HHPA 1LBLA 4ENLA 3LPFA 3TC7A 1J93A 4O1DA 2OMAA 2FHCA 3WFZA 1C92A 2Q8XA 4RE4A 3MV01 2PLMA 4J28A 3CHEA 1QWGA 3GUWA 3LK6A 1J11A 3ZSTA 1QOXA 3LCHA 1N2VA 3L9CA 4GI9A 4D71A 4XVDA 2ODOA 4ONVA 1MQRA 3LV5A 1JCNA 1K3UA 3N17A 1NWUA 3K4AA 1K9TA 4GUHA 1DJIA 5EFDA 5D05A 4W87A 2NV9A 2QDGA 1RH9A 4GIEA 4NAEB 4QP0A 4W5ZA 2JKAA 1EJVC 2FPTA 2JALA 3M43A 3UWUA 4C5ZA 2YDAA 3E6EA 4JKMA 3M44A 4RE2A 1I2QA 3C61A 5A6TC 2D1ZA 3SQSA 3V18A 3DENA 1G9HA 1V93A 3EEGA 6XIAA 4C7GA 2GDVA 3HGRA 3Q45A 5IHRA 1UWAA 3LRMA 3VU2A 2O7QA 2FZ9A 3DGRA 3STGA 3A5VA 4I9AA 1BWLA 2KAUC 1UWTA 3NQ7A 1JZ5A 1WZAA 5DF0A 1J0YA 1JCJA 3CPRA 1BYAA 5FKYA 1WDWA 4GYPA 4DELA 1JD7A 3C56A 2AQOA 4YTSA 4OOUA 2BVYA 5D9NA 2QKFA 3W88A 1VPXA 3W74A 2E1DA 1QPQA 4K1GA 4YTRA 2WM1A 1XYZA 4OIFA 3VO0A 2HMCA 4MM1A 1G4PA 2AMGA 1Y5VA 5D2YA 2UY5A 1S2AA 1F4HA 1MXGA 5B80A 4DBUA 3RX4A 1DORA 3BXWA 2XGZA 2HCVA 3GG7A 4XO7A 3H2AA 2E9LA 3SCUA 1A3WA 1UR4A 3LG3A 1KQYA 2Y8UA 3NA8A 4R33A 5CEWA 5BXSA 2CXEA 1BHGA 3W84A 3RK8A 5E09A 2C7FA 4FS9A 2OJPA 1M7XA 3DBNA 3BV4A 1J0HA 4JAWA 1TPUA 4M6QA 2WKLA 2WOQA 3AROA 3VIJA 2JBMA 4RV8A 4J1OA 2RJGA 1Q6GA 3POHA 3WQFA 2V5BA 1OFRA 3FAWA 4XD3A 5CSSA 4W5UA 3FGCB 4QNWA 4LUTB 3LHVA 3REQB 4JTRA 3WEZA 2Z1VA 3P7YA 3RGTA 3M16A 1UD2A 4MGGA 1RLDA 3E0FA 3PUGA 5ABTA 1D3HA 3RU6A 4XUGA 1XBZA 4BR1A 1WZLA 1FQ0A 4L1GA 3QEZA 3QLDA 1TPEA 9XIAA 5FF2A 5E1QA 2I9UA 5EKYA 2CNCA 1XIMA 2Y85A 4DIAA 2NQZA 3E5PA 4K6AA 2XN0A 2VRKA 4AZGA 4I5RA 1X8FA 4C1KA 4IGNA 4ZENA 2WJEA 5BMWA 1J0JA 3EA1A 1EWEA 3T8LA 4JL1A 5HJYA 3PBYA 3PAOA 2R94A 5AZ0A 2F6UA 1GYNA 1MRQA 4X2PA 3EA3A 3F5LA 1L2UA 2EPHA 5LGZA 4CCEA 1WOAA 1KCZA 1N8FA 1DJNA 3C0SA 2ZUUA 4HA3A 3W2LA 1OYCA 1G94A 8XIAA 5FJPA 3TZNA 2CHRA 1AODA 2C1IA 2WMIA 4P7RA 3GXIA 1R9YA 1J12A 1NQKA 2RGMA 2FYMA 1U5VA 3B04A 3IVTA 3DFPA 3OLIA 3G1AA 2OO6A 3N2OA 3IIZA 5U4NA 1XRSA 3L4VA 1V5XA 4B91A 2WMHA 2WVVB 4IGMA 3I4EA 3URAA 2PLCA 1JPHA 3U5UA 2J88A 4O8RA 2A3CA 1EPVA 1XD1A 4QSFA 4D6JA 7ODCA 4G7EB 4XG1A 2R8WA 5CPTA 4EE9A 4ROPA 2NX1A 4S1FA 2WW5A 1XF0A 3OBEA 3CIVA 1VFUA 3FJ4A 5C2XA 2H90A 3STPA 1IV8A 3CUXA 4ZXLA 4PMRA 5K3VA 2J24A 3GC4A 2XM2A 2W61A 4XTIA 3MUAA 3IIOA 5A8PA 4EX4A 3MY9A 2PU1A 3EYPA 1O1HA 1NP2A 3G77A 5A1AA 3SFKA 2D22A 3QKEA 2WKGA 4GYJA 4J9JA 2EPOA 3NZQA 1GUVA 3AJXA 4A35A 1VC4A 2XIMA 5G2IA 1Z69A 2XGBA 1S5MA 4JN6A 1PJ9A 3COTA 5D32A 2Q3OA 4HOXA 3P82A 3M0JA 4YL2A 2W0UA 1Q85A 1V7AA 2DIEA 3SCNA 3H24A 2X30A 1K8ZA 3MHUA 1UWUA 1PKNA 3E49A 4HMDA 1W5PA 5I3FA 2QCEA 4NASA 4BEQA 4B5TA 2CLIA 2NUYA 3GH4A 1Z6KA 1SW0A 4CU7A 4AMAA 1MW3A 1XSIA 3PFRA 4UIOA 4AZ7A 5FJJA 4E6MA 4PULA 2W92A 3M0ZA 3DYOA 4E2BA 5AOUA 4XZLX 4ZBCA 1Q2RA 1CLXA 3UR8A 3A47A 4M7TA 2XH4A 5EA9A 3U2EA 5CAHA 1KD0A 3FJNA 1U5JA 3C2YA 3ITOA 3SN4A 4KKXA 4GCAA 1NU5A 5H2ZA 2ZXBA 4F0KA 1V77A 2O92A 3HQOA 3AI0A 6CGTA 3S1GA 1M7JA 3BGAA 1QPOA 3ANYA 3RF9A 3CHVA 2IKJA 3EX2A 3GNDA 1NWRA 4Q33A 1HUVA 1E15A 3P61A 4JCMA 1OYAA 3AIEA 1PB0A 3B8UA 2JFEX 1ZHAA 3H4GA 2ZUTA 4XAZA 2A4AA 4IPIA 3ZJ8A 1E71M 3I6RA 4GZJA 4MMWA 2XH0A 1DXEA 1G69A 3T2OA 1BG4A 3BK0A 3LI0A 3GH7A 4JTUA 3IJ7A 3P93A 1Q4NX 3A9BA 2NQJA 3KBMA 3BLKA 3KLKA 3VNMA 5DX7A 3HGSA 3CEPA 5F2MA 1LWIA 3MW7A 4U33A 2YL6A 5DO8A 3CZKA 4LUIA 4GH1A 2ZYFA 2G3FA 3HQ1A 3V1PA 1PZ1A 3FYYA 4ADTA 3G1HA 3VIOA 1FA2A 1EHNA 1H5YA 4WF7A 1JYNA 3AXIA 1TVNA 1RCQA 3GIYA 3TTOA 1IR1A 3QOKA 2R1NA 4R9XA 4IIHA 1JZ3A 1R7AA 4FEZA 4HMCA 5GNYA 4NNAA 4HNVA 3FAXA 3MQTA 4JNZA 5HANA 2PFHA 1S5WA 4L1WA 2ISWA 3B8SA 2VDIA 1FWFC 3GDKA 1AG1O 2ZBTA 4UQBA 1C8VA 1TELA 4G56A 4WSHA 4O1BA 4FOUA 2C1GA 4L61A 3OODA 3GB6A 5CZKA 1ECQA 4GABA 5LHFA 1EDQA 5FAJA 4Q8OA 4S3JA 4WJXA 1H41A 5ABFB 3EDJA 5BMXA 4OBTA 5EBUA 3LHWA 5TQLA 2VR5A 4JIHA 2BX7A 4G6CA 4WJ8A 5KINA 2YA2A 1UWQA 3RR4A 5FF4A 4GLEA 1JIBA 1EP2A 2WZIA 4IG2B 4DYJA 1QW7A 3N4FA 3F4WA 3QGKC 5I06A 3HFTA 3ICJA 2EPLX 3WENA 4UNKA 4M3PA 1R87A 3WUBA 2NLYA 1XCXA 3R8GA 3SCQA 2VGIA 2WMKA 3TONA 1EXPA 2W62A 3M6DA 1VLIA 1T5AA 2CWNA 3QBUA 4GYPC 1TV8A 5DXYA 4BZYA 1IR2A 3W1RA 4P8VA 3PZNA 3UW6A 5BXTA 1FWDC 4DO4A 2F84A 1MEWA 3ITVA 3LA4A 4K68A 2PDLA 3WDPP 4PB3A 2EKCA 1EO7A 3GIPA 3G1FA 1YTKA 4Y6GA 7TIMA 2CLOA 4DNMA 3RJXA 4S3EA 3GC2A 1BTMA 1CXKA 3KE0A 3V7PA 3ISIX 1UBPC 2HV5A 2ZZ5A 4O1CA 1EXBA 1GOWA 1EB3A 1XGDA 4JYEA 3VKJA 3N2TA 1ISXA 2Z1SA 5GNXA 3WLOA 3EWZA 3G18A 1QJWA 3QW4B 1SM9A 3C3NA 3W7RA 5JIWA 3W2UA 2XFYA 1VFOA 4AYGA 2A7PA 1DIKA 4DZIA 4IJRA 1RHCA 3DHDA 3D6NA 2C14A 2WAGA 4C1LA 2PDFA 1JDEA 3B9DA 1KTCA 4LVDA 3CL7A 3WK1A 2IQTA 1JDFA 3GTIA 4Q8PA 3VOIA 2VXNA 4Z2JA 2OKTA 2QDEA 1A3XA 5D03A 3SO7A 2NLIA 2VEGA 1JCMP 1GVFA 3SUUA 3N2MA 1HF6A 3THUA 3OLDA 1MW1A 4C6NA 4XBKA 2CLPA 3V5OA 1X1ZA 3FN9A 3SRDA 3O1NA 5K9CA 3SGGA 1SFJA 1NTHA 3N9KA 4U5KA 3AMGA 3C5QA 5G4HC 3VOCA 1PO9A 3SIZA 1F3EA 4ZE4A 4Q3MA 2Y88A 4Q22A 3PWAA 4HZ7A 4IPJA 1E6RA 3U7BA 3SUTA 3SN1A 5M03A 3FNDA 1UROA 2VELA 3A4JA 1NDYA 4NL1A 1UBSA 3BAKA 1LLOA 2VC7A 3UPMA 1B3OA 4FX6M 5MHBA 1EL3A 2Z1XA 2DVXA 4DB7A 4NUWA 3L68A 2AOSA 3GZ3A 3FSTA 1ITQA 3TCSA 4LT9A 4YCPA 2FDMA 1K70A 3O8AA 2FTWA 1A5BA 2ZADA 3HN3A 3BZGA 3DC0A 3XINA 1NFGA 1O60A 2QS8A 4RLIA 2WSYA 2D0GA 2NSOA 4PBEA 3UG5A 3MI2A 4DBWA 1AW2A 3P2VA 2OSYA 3PTMA 4AAJA 5DN1A 1FUYA 3WBAA 1KC7A 1VEMA 3EDEA 3GM8A 1KB3A 4QDWA 5CZJA 3GU2A 5HJLA 3UNTA 3EDDA 1MQPA 4H4IA 1V02A 3THQA 5I02A 1HW6A 2XZ7A 3ABXA 4DY1A 4AEFA 4KT2A 3E1F1 4WKAA 2WQDA 4EIVA 1EZWA 2L5HA 3FEMA 3QQ0A 3ABSA 2Y4SA 2VEMA 3IAQA 3HG3A 3L12A 3OQEA 3WDJA 1HL2A 3I7QA 2G3JA 4J2PA 2RKXA 4F0SA 2HDJA 2YB1A 1W8GA 3SJ3A 1J6OA 3H21A 3N9SA 2PF0A 2J77A 5C9ZA 4YVXA 4AZ5A 1OG6A 1BGGA 1C93A 3H2OA 1VRDA 4R53A 4F79A 5D37A 3T8QA 4BFAA 3MP3A 3UZJA 4BQ2A 2QPXA 3UWZA 5HPOA 3WH6A 3TSMA 1B4EA 4O28A 2FFCA 3BQ5A 2OSWA 3SCVA 1MUMA 1A0EA 1US2A 1OF6A 4G9PA 3AJ7A 4H41A 1SJCA 2QCLA 3GO2A 3CAWA 3CMGA 3W7CA 3P0WA 4XKMA 5KZEA 1O4UA 3R43A 4O0KA 3PPCA 3GNXA 2Y89A 5EMJA 5FOOA 3MUXA 1WAUA 4JN8A 1GVQA 3TWAA 4F0HA 3VPLA 3PG8A 3PULA 5H91A 4L4MA 5DQPA 4AZ6A 5DCEA 4LAUA 2YCLA 4PBFA 4E2VA 3LHUA 3MVTA 3TVAA 3WNLA 1SMDA 4H6RA 4ZQRA 3KEHA 4GIAA 1JGIA 1VYSX 2DSKA 2J7BA 3MUCA 2AAAA 3TC6A 2VQUA 1OT1A 4DUVA 4B2DA 1V7YA 3N2BA 1V3KA 3WDQA 3BAJA 4H8UA 3T44A 3J7HA 5A6MA 1V02E 3W75A 1S5NA 1VD6A 3E96A 1M5WA 4D6EA 5EPDA 4YN5A 1I8JA 1FTXA 2Y8VA 3KOWA 3WLQA 4JKLA 4LVAA 5BU6A 2QF7A 3LV6A 1K8XA 3MZ2A 5KEZA 3M1ZA 1Z89A 4HCHA 1OWQA 1XFBA 2C79A 1KBBA 3SZ8A 3PNZA 5XINA 1MMFA 4CNOA 4IUOA 3A3HA 3VAVA 4K1WA 3AYRA 4B4HA 1W31A 3FKRA 5L6UA 3LTYA 4XK2A 3S9YA 3DAQA 3ABQA 3BCJA 1QNPA 2WSKA 4FF5A 4DWSA 3QGAC 3BJSA 4ZO7A 3WUEA 2YGYA 3CHCA 3E2SA 1GVYA 4DLFA 2XH2A 3R12A 3ORWA 1GJPA 4ZSUA 1RJRA 1IGSA 2ZVIA 1V0MA 4W86A 1CENA 1FFQA 1UH2A 3CQIA 4RDWA 2W5FA 1F9CA 4PCNA 4B9YA 5XIMA 1E5NA 3NZ1A 1TV5A 1KGXA 4P5UA 5ECUA 1FH7A 3GBEA 5F2IA 1VIWA 3L0KA 3QJAA 2Z7KA 7XIMA 3OG2A 4NVTA 3GBDA 2Z2BA 5LZLA 1XIDA 4J5NA 3VINA 5K4XA 4AD3A 2QJHA 4NI8A 2VZOA 3R25A 3NQGA 1OY0A 5HULA 1H11A 4PTMA 1P43A 1M03A 3H70A 2ZE0A 3ES7A 1ONRA 4PCTA 4YYFA 5HWJA 3BSHA 1W17A 2BV9A 3BMWA 4OUEA 2FGZA 1F8IA 3P8JA 4Q4MA 3S4TA 4JHOA 2DZWA 2DZBA 4MWAA 4WVXA 2WMIB 3QSTA 4ORMA 2X0YA 4UB9A 1QATA 3PS7A 3SURA 1UD3A 2UY4A 3N9RA 2XIOA 1CGTA 2NVAA 3IJLA 4WY0A 1SR9A 4QJ3B 4HNLA 1K1DA 3UP8A 3A9IA 3UXKA 1EQCA 2B7NA 4O1EA 1S2TA 1ZJHA 2HS8A 1H60A 5EL1A 3CQKA 4LEQA 4JR5A 1SU5A 4IT1A 4RDZA 2V8ZA 1PSCA 1TCMA 4GUJA 2V81A 3Q94A 5BXRA 4XZBA 3WEMA 3G1YA 1IXPA 1DPMA 3P60A 4ZQCA 4HNTA 3UF9A 3PFMA 4JTTA 3BG5A 4GO9A 2PA6A 4DBEA 5KZMA 1HNYA 1NWTA 3S8HA 2BXVA 4XWUA 4EF8A 4CNPA 1E1CA 1H7NA 3H2MA 1BLIA 1JZ7A 4NZCA 2UZ9A 2VRQA 1KM1A 2VEKA 2Q6ZA 5LNUA 1S2WA 2V2HA 1EWDA 1ISYA 4AIBA 3SCOA 3QQWA 5BWAA 4XZMX 4NX5A 4LQ1A 3BW2A 3GYCA 1X38A 3FHQA 1YTDA 2QDHA 5L9FA 1GQLA 2O0TA 4ZQNA 4MLRA 5EMUA 2J27A 4TOQA 4PGLA 1EJSC 3B8IA 3TQ0A 1KGUA 2C0AA 2MUCA 3KVJA 4NRSA 2DT3A 4MZ8A 1U1UA 3MUY1 1QT1A 4R27A 2HVOA 1W9XA 4KRUA 3SW6A 3EWXA 3E0IA 4A21A 2VJXA 3S47A 4QM1A 2GVYA 3OGRA 1E70M 1JGMA 4PA8A 4MWAE 4FALA 3HM7A 4H1ZA 1YBQA 4WIWA 1G4TA 3LHYA 1VPYA 3TK7A 1I45A 5H8PA 4LNYA 3OLGA 4NNBA 1PHWA 3DG3A 1TV4A 3KL5A 3NQEA 3M0IA 3URBA 1KXHA 1C91A 2BVTA 4WSJA 3MV11 3UZXA 1OK6A 2I17A 3WMSA 5AHLA 4JBRA 1VJZA 5A6BA 3W1UA 3U2ZA 1DTUA 1JDDA 4GZ7A 1LLWA 2BP1A 1FRBA 1IWAA 4V1YA 1CI1A 1XX1A 1V79A 5AVHA 4U2ZA 1J6PA 3C8NA 3PZMA 4GZIA 4O14A 4S39A 1B2YA 2X42A 4M56A 5FSDC 3CTTA 2NSXA 5D02A 4F0MA 2POZA 3G0XA 5A8QA 3QY6A 1PTGA 3DFTA 2QIWA 2E6DA 3KAOA 2VOMA 3VMPA 2J6VA 1GVRA 4W8BA 5G1YA 3WKZA 3VKDA 3QFWA 1LJYA 1I6NA 2BY3A 3EWBX 2XG9A 1KNWA 3LBOA 1D3GA 4L1XA 2BHUA 4ZE5A 3GXNA 2J79A 3EWDA 5EU9A 4R9OA 4QCFA 1W32A 3LLDA 5I00A 4EXAA 1O5QA 3VKKA 3WL1A 1YPFA 1H4PA 3KDOA 2WJDA 2VX7A 3NVTA 4X22A 3TWBA 1VBJA 2ON3A 4P7QA 3TNBA 3PPFA 1XL9A 3JU2A 4D8ZA 3VIHA 2PODA 1JQXA 2PTZA 2JIEA 4XAYA 1OC5A 4L4PA 3KWXA 2A2IA 4YTUA 1TPVA 4AZHA 1F3WA 3NPVA 2INZA 3UZ5A 5KZDA 1Z44A 4QDMA 1JJKA 2Y0FA 3ZFHA 4JIIX 4HTYA 2CZFA 1DYSA 4K36A 2QDDA 1UOZA 1YE4A 1CXEA 1DWJM 1ZUAX 2DW6A 3MT1A 4Z2GA 1NWSA 2PP1A 3ZT6A 2G97A 1VAHA 1ZAHA 3A24A 1G0CA 2RH9A 3CPUA 1LTDA 4S3GA 1NVMA 2I14A 2Z26A 4KETA 2XTKA 1FHLA 1H3GA 3AZRA 5D30A 5DY3A 1ZENA 5U7SA 4DNHA 2AKMA 5C9WA 4HVXA 4KGLA 2BHYA 4HPHA 2Y63A 1V0LA 1YNYA 3AIVA 2E4TA 3W1MA 3W7QA 3I65A 2FVKA 3IJDA 4X61A 3N19B 1AZ2A 4LH8A 2C1HA 4LVBA 4DI9A 2X16A 4B90A 3MO7A 4MLJA 3LGEA 3U7VA 4HJWA 4UR9A 4X9YA 3L23A 5JIPA 2ZZ6A 3PWGA 1YDYA 1SZNA 4KCUA 3B3DA 5LXEA 3LGGA 2ZRZA 3O7UA 3UWQA 3THDA 1RPKA 2V63A 4MY1A 3BO9A 1TUXA 4IP5A 1OX4A 4PTXA 4FOJA 3KZPA 2GYIA 3LOTA 4HPJA 4FB7A 3LENA 5HMFA 1OHLA 2YL5A 3NM1A 1HJVA 3KRUA 5DT5A 4G1KA 1RUSA 1Q5MA 4JIRA 3UA4A 2J13A 1GORA 1QI3A 4KF1A 1IF2A 1NP0A 2G3IA 1KBIA 4QG6A 1KFWA 1FDZA 4XAFA 4GYFA 4HYVA 3GAKA 4EKJA 4S3BA 2FDSA 4DLMA 2A85A 2VX4A 2GQ3A 3O3RA 4PUUA 3E12A 4PTVA 1YX1A 2PDPA 2D3LA 4MYXA 4M1RA 2VVSA 4GBDA 2X1RA 4IMAA 1W3KA 4DO7A 2Z4GA 4DWSC 2Y24A 3ITLA 1YXCA 1XLKA 1VHCA 4HU4A 4Y96A 3KVKA 4C6FA 4IQEA 4N7QA 3WF2A 4OU1A 3O06A 4PRTA 4QROA 4RUBA 1POKA 1W1IE 1XBVA 3SUSA 4FLRA 2IKIA 3ARVA 3GXDA 1X1NA 1E4LA 2EEXA 4WRHA 5D9PA 1J0ZA 4PRRA 3HV9A 4MHBA 2I57A 1M7PA 2PTYA 5BOOA 3DGBA 3AHXA 3F4CA 2G3NA 5MKGA 4PODA 1P1XA 3VDCA 1J2WA 4D8LA 5AB3A 2DEPA 1RV8A 1Q6CA 3QM3A 1L0PA 1MVYA 1KFCA 1G5AA 3I68A 3PP7A 4AZBA 3HPZA 2F7FA 1KCXA 1B9BA 4H9XA 2XSBA 3IK4A 2W6RA 1UZ4A 3P5YA 4WSKA 3E02A 2JKEA 3L0NA 2ZDSA 2FLIA 3UY8A 4NZ4A 4TVUA 3IJ8A 2GJXA 2E7FA 4JFSA 4AB4A 3N3TA 2I9EA 4H8VA 1HP4A 3WDIA 4LBSA 2O9RA 3G1DA 4XZ9A 4MWAC 1I4NA 2EJ1A 1REQA 5I2UA 3CS2A 4QISA 3B8VA 3VCRA 3EX3A 1RJQA 5AC8A 3VIKA 4AY7A 4ACYA 2CLEA 4PMXA 2TMDA 2WVTA 1M04A 2YX0A 5IXEA 4JEJA 4EPKA 2ZIDA 1F05A 2IUZA 3GG8A 4L6OA 4DJFA 2XDFA 4TX9A 4BI5A 1GT8A 4UQ9A 1VENA 1QI0A 1BXBA 4HT3A 3ECQA 3S0CA 3T40A 4MOZA 4CKQA 1Q6DA 4O1FA 4CUCA 2YXGA 5A8OA 1GPWA 2VZUA 2XSXA 2Z6IA 1WX0A 5CSYA 1I2NA 1RK5A 2PWEA 4KWSA 4ROQA 4EF9A 2AL1A 1EPXA 4Y9OA 2CC0A 3D46A 1AQMA 4Z2HA 1CWYA 3RILA 1E0VA 1QK2A 1RY8A 2ZRXA 3W72A 3IANA 4ASTA 1JULA 1QCWA 2D69A 4WEVX 5CG0A 4BS0A 1XC4A 4LALA 3PHAA 4F3HA 3A23A 4FNSA 1LQ2A 1KBJA 2YA0A 2X1TA 2XVPA 3O0FA 3RM4A 1GPFA 3T6CA 2Y5SA 4YS1A 1Z8AA 3WBEA 3GWQA 3TYCA 2OLHA 4I6KA 3JR2A 2IPJA 2OZTA 3ITCA 3W85A 3PTDA 3QMSA 1W1B1 3LB0A 1V3JA 2XVGA 4CN4A 4B3KA 1EEPA 3S6DA 4DXKA 1KM5A 3I6EA 4QGCA 3BGGA 3GZAA 4FIRA 5C54A 1UP2A 1LL6A 2PLJA 2YCLB 2YJQA 5AHFA 1AFSA 1QWKA 3UG8A 4C5YA 5E9AA 1U1JA 4AWTA 1J2BA 1WDSA 1IEVA 2Z2UA 4GNKB 2F6KA 2CLLA 4UMCA 1XS2A 3VX0A 4NJKA 5B7ZA 3K5XA 1UC5A 1Q66A 4Z17A 3IJIA 3V4BA 2Y1HA 4UTFA 2GWGA 3TTYA 1OSEA 4UTMA 2PC8A 4K8GA 3NWRA 4F66A 3UJEA 3KCLA 3H54A 5CC3A 4AWSA 5GVJA 4NJGA 3P3BA 1H0GA 3VOGA 5FJOA 3WLKX 4HA0A 1FWIC 3UG3A 8CGTA 2J7EA 2E3ZA 3L67A 3SM0A 2VZTA 2IQ0A 3RU8X 2R14A 4GG9A 1SO3A 3O6AA 4MVAA 1QNSA 4DWSB 3OTRA 3GFXA 2J25A 1TJ2A 3AAMA 1SZGA 2FVLA 1TMLA 4O10A 3TR9A 4B5XA 3EWYA 5D04C 4D6IA 2OYLA 3C2VA 1CX9A 1T7LA 2FVMA 3ZWTA 5F2LA 1EJUC 3KS5A 1LL4A 2NV2A 4CEUC 2J7DA 1RBAA 1Q6RA 3DDMA 4ES4A 1XKJA 3GH5A 4ACZA 2V5KA 5ABGA 4E2OA 3WH8A 3IARA 4J40A 2EJAA 2BSLA 3HGJA 2AMXA 3W1LA 2PF8A 3VNJA 2QGHA 3INPA 4CVWA 4L4OA 5LIXX 4HK6A 2H8ZA 4JTGA 2QCHA 4ATLA 4QHRA 1UW9A 3BZJA 2DPEA 2ZXAA 1F6YA 1W6TA 3TTSA 3M0YA 1R7OA 2EPNA 3BAXA 3VD5A 3R4IA 2OVLA 2R91A 4MWAB 2ACSA 5H1WA 3BV7A 1XW8A 5A94A 1YQ2A 2EPMX 3PJUA 1UKOA 4GVIA 1EUNA 3VZZA 1C7TA 3EDFA 1FHDA 1OFQA 4FXSA 4D6HA 3QYQA 3S9IA 3VGDA 4GE8A 1QW8A 1NELA 3WLLA 4LGXA 3NG3A 1TTPA 2P3ZA 3VNLA 3I3DA 1PL9A 2ICSA 3KRSA 3R7MA 3N13A 3ZOAA 2XINA 1CGXA 3GHSA 4PSRA 4CN1A 4OZOA 5T26A 5HQEA 1XWYA 1ELSA 5CC5A 3LD5A 3L66A 1VYRA 3KOXA 1QO2A 4O13A 2DUAA 1TPFA 3NQMA 4E4PA 4S2CA 1ZTVA 2OEMA 4JTAA 3A64A 4YIWA 1E1CB 1UKSA 5LSMA 3CIXA 3VDHA 3WLJA 1XH2A 4AZCA 3G22A 5GJNA 3DESA 3RRAA 2IMRA 1OGGA 4PUMA 1CGYA 1F6PA 3CUGA 2W79A 3OVQA 4K7YA 5BRBA 3FJLA 1W1VA 3VVGA 3W6MA 1UR0A 3UGVA 4AD2A 4DWDA 1L9WA 1JAEA 1D3CA 2GJRA 2WLZA 2P76A 1XFCA 3VD7A 4NHVA 2J7HA 4LAMA 2FTYA 3RX3A 4KS0A 5FIPA 4OECA 3MA8A 1R8LA 4M6UA 3H55A 3V0TA 3H2EA 3F4VA 4U5IA 1SJBA 1UR3M 1D7FA 3KBWA 3HG2A 6A3HA 2WMGA 3S2CA 2PI6A 3PSWA 2P0OA 2V0TA 1Q8JA 3LCXA 3PZGA 5BNKA 5I6SA 3ZR5A 3I6TA 1KFJA 3WQWA 4BF9A 5M3WA 3N15A 1NH6A 1YBQB 4GFSA 3KTXA 1FWSA 1O95A 2V2DA 4D1IA 1EEXA 3T0CA 3S6TA 2PDYA 1ONXA 3P8IA 4GY7A 3TN4A 2CYGA 3MWCA 1HO1A 3TU9A 1KXTA 1W3LA 1JCYA 4UWMA 2Y7DA 5C9UA 2ZX7A 3TH6A 3LN3A 1Q7ZA 1B4KA 4TTGA 1I60A 5DMYA 3BMVA 3OZMA 3OPSA 5I0DA 2PTXA 3LCGA 3IJ9A 3RMEA 1XLBA 3WLMA 4GXMA 1BGAA 4GGBA 3K1GA 4JQAA 4IQJA 3MSDA 4PMZA 3NVDA 3ITYA 3GTXA 3W7NA 1EH9A 2WM0A 5IBXA 1TIWA 3U5YA 4A3HA 5XIAA 5D2XA 3M5VA 1A5AA 4ZO9A 1L8NA 1CEOA 1VFMA 3ZMRA 3HG5A 1R2TA 3BCDA 4A22A 3EZ4A 3VILA 2VCAA 4U10A 1CT5A 1WUEA 4KFOA 4D6GA 4UQCA 2WWDA 3VDAA 4JZ5A 2DY3A 3WMLA 5FF0A 1ZRQA 1OX5A 2EGZA 2YXOA 3STCA 3K46A 4LAOA 4TTUA 3AIBA 4WX2A 1P4CA 3T0AA 3FA4A 1VS1A 3LCIA 3K1DA 3UJFA 3RPTA 5LNRA 1XIBA 2V5JA 1JNEA 3CUIA 2FZNA 1S46A 4DJFC 3LXBA 4IJBA 2F9RA 5JH2A 3VD9A 3OW1A 1JF6A 1U30A 2D24A 3GC5A 2V82A 4LANA 4CNNA 1CIUA 3RLVA 3W3OA 2EPKX 3DFQA 3FDGA 2HTMA 4S38A 1R3RA 5I3HA 3VE9A 2OQLA 3DFHA 3W86A 3DI1A 4OT7A 3WJZA 4WOQA 1H0IA 5I3KA 1G4EA 2PGEA 1X7FA 3BG3A 2PCEA 4OE7A 4RCXA 2CHNA 1DJWA 1NY1A 4PUJA 4GKLA 2Y5EA 4H6KA 2PWGA 1UCWA 1B57A 1H61A 2IQDA 2QJNA 3M07A 1VFLA 1UA7A 4F2TA 4DWSD 4PN2A 2F38A 2IKHA 2FH8A 3O07A 3GKFA 3EKLA 1WZKA 1XDLA 5BZAA 2ZVRA 1YPIA 2A0NA 2DVTA 3FS2A 3A4WA 4HA1A 1JUBA 3GNPA 1GOXA 4Y90A 1DHKA 5D2TA 4CNUA 1YDOA 3HGOA 4QLJA 5I24A 3F03K 5EMMA 1VIZA 3GU1A 3H26A 4EXBA 2QUNA 1VF8A 2XIBA 2TRSA 4NAFA 2AAMA 3K4WA 3W24A 4NILA 3WQ6A 2HNEA 1OX4B 3WNMA 5LIWX 5AC4A 3BAWA 3RDKA 3WD3A 3R6IA 5DT7A 4PFMA 2ZQ0A 1UB3A 2YCKX 1GVIA 1ODZA 1I0DA 4AIOA 4HN8A 3CB3A 1Q6QA 1H49A 3KP0A 3WH7A 4HCLA 3H8AA 4P7NA 3VD3A 4XISA 4AZIA 2GJPA 3CWHA 4FNUA 4DF1A 4E0CA 3AUJA 4HNUA 3LMZA 3G24A 3N1AA 1AH3A 4WHBA 1HXJA 1BAGA 1TV3A 2NWSA 1I2OA 5E9XA 2X1UA 1PE1A 3K8KA 4GQQA 1BXCA 4W8LA 3ZLFA 1UZHA 1VR6A 1XIFA 1J9YA 4FK9A 3G3DA 3TQVA 1CGUA 3B8WA 3NQ8A 5CCZA 3M0LA 3TYBA 1JI2A 3O63A 1U2YA 4ZZ9A 5FACA 5IFTA 1EIXA 3A21A 5BROA 2R1KA 4RZBA 3DG7A 1QO5A 2RJHA 2VGBA 2VUYA 5CZ0A 1Q6FA 3CO4A 3E2VA 4BA0A 3MP4A 3W7KA 2RGLA 4H9UA 5DRCA 3L5MA 2F2HA 1AJ2A 1FHVA 3IGXA 3R58A 4FP1A 3UPBA 3WBXA 4AY8A 5MKGB 1B0IA 2GGJA 3H6OA 2ATSA 3GDTA 3N29A 3MZNA 4JIQA 5FJRA 3QXBA 5G2HA 1BWKA 3CH9A 2CPUA 4UTHA 1E9LA 2E68A 4LCQA 5HATA 1O66A 4E3VA 3MDWA 4ZQPA 2BOEX 2P8BA 1YW1A 1ZL1A 3BJTA 3TLQA 4DJEA 3BH4A 3CAKA 4UTLA 6XIMA 2JIWA 3BW3A 1VJSA 3ONCA 4L65A 4AXKA 2GJXB 3DYMA 1XP3A 2DORA 3EMCA 5CXPA 2BXYA 4PB4A 4LX4A 4H6QA 4CLMA 1XR2A 1LG1A 1US0A 2WSQA 2GVJA 2QAPA 1A4MA 3GW3A 1MEHA 1GHSA 4BI6A 2P10A 1REQB 1E0TA 1HKJA 1X8CA 2ZZ1A 3LUTA 5BU9A 2FTPA 3AXKA 3QF0A 4NXSA 3U0HA 2DIJA 4ICNA 3LMYA 1PVNA 2ABAA 1HO4A 1PAMA 4QJ1A 3LGDA 4RW3A 3LYEA 2Z00A 3SAZA 9RUBA 1TJPA 2XFWA 5LNSA 1JNDA 4MNKA 3KFTA 4MKNA 1PS9A 4G1NA 2Z1BA 2RDUA 1F5ZA 1TR9A 5FJIA 3WJWA 1XUUA 3DHFA 3C0JA 4DEFA 1WYIA 1F2JA 4XAPA 2DSUA 3WBYA 2ZZ2A 2XSAA 3NQ2A 5AYXA 1YADA 3O15A 3FIGA 3V16A 3GQYA 3M0XA 2GGHA 5I3GA 4YCOA 4AY1A 3SY1A 1EGVA 4HHMA 3EB3A 1ECEA 4LV4A 4UMAA 4UOJA 4R7JA 1ISVA 4HA4A 3B0XA 1A5MC 2P8CA 2BWGA 1L6YA 1TB3A 2C8NA 2Q01A 3TLLA 5FL0A 4ADUA 3AHTA 3PVFA 2QXWA 1IXQA 1WXYA 4HQVA 4MTVA 5K2ZA 4W93A 4K2SA 3CEUA 2I7GA 1VRXA 5J5RA 1J0KA 2ALRA 2YYUA 3ZLGA 2E0PA 2QW5A 4KBXA 1QI2A 2H3DA 4Q7IA 3OJGA 1PCWA 3U48A 3P5ZA 4DO5A 4XUYA 3QPZA 5I3DA 1JYXA 3QPEA 4K7VA 1FCVA 3VFCA 2JE8A 3HG4A 1XQKA 5I79A 1WCGA 2QUUA 2XYLA 2ZRVA 1UIOA 3EGJA 4B92A 1SW7A 4DBDA 3TKFA 5CH9A 1CXLA 3N12A 1UWRA 2J75A 4NY2A 1LQAA 4KPLA 2DZUA 1SW3A 3ITXA 3SJNA 2ZC1A 2Z2AA 2I56A 1KLYA 4C6QA 1DWGM 1OM0A 4BI7A 4NYYA 1A0CA 2PAJA 1XG3A 2Y7FA 4RE0A 3LLXA 2ZUWA 1W56A 2J9YA 3WQVA 3KOYA 8RUCA 1ICQA 1Y65A 1ZU8A 3ERPA 1W1YA 4IZGA 1EDGA 4CD5A 1M6JA 2KZHA 1H1NA 3M5XA 2WO5A 3RRXA 1HZYA 1RD6A 3WIJA 4DO6A 3AMCA 3C86A 5IBXC 1S2UA 1FX6A 3VOJA 3RUBL 3M4HA 4CCZA 3CGTA 5JBFA 4LXFA 2CW6A 4UQDA 3W1TA 5HWNA 3N4EA 1NIUA 2JF7A 5ABFA 4NXKA 5A2BA 3MI3A 3NEHA 3DHUA 3UR2A 5HUPA 2HROA 3UYIA 3V1HA 3EOOA 1XQLA 3N6JA 3ZZ1A 4RNIA 3WQ8A 1N8IA 2PGRA 4D72A 1QVBA 4OKDA 3KUMA 4QR6A 1V8EA 3EOLA 4GXPA 1PWLA 4UTKA 1KLZA 2QMJA 4ACZB 4V28A 4KQNA 2JK2A 1KWKA 3RXZA 3K8LA 4G2DA 1DWAM 3W7GA 4W7VA 5CG7A 2OPJA 2HXTA 3L21A 1JAKA 3Q65A 5FL1A 2ISDA 3UEQA 2YW3A 2TSYA 2ZC8A 4UC5A 1WBHA 4Q4SA 2YOCA 1LOQA 2E25A 1SYTA 3GKAA 4NZFA 4R34A 2V30A 1FP8A 3JVAA 2B0MA 2OB3A 1FXPA 1E9YB 1DQXA 3T2QA 1W9UA 3WD0A 3CV7A 4H83A 3GW0A 4J3XA 3WO8A 3SSJA 3W83A 1H50A 4I5UA 4I9TA 1UD8A 4DM1A 2ANUA 3HO8A 4JEQA 2ZWYA 1PBGA 1G67A 3DC8A 1OJXA 1TE1A 5CZSA 5CJ5A 1Y0EA 3O05A 2WCSA 4P7LA 4LJ3A 4HOZA 1VJIA 1UQYA 4PUWA 4AWEA 3NPXA 1H7XA 2VR4A 5A3HA 1S1PA 1FWEC 1QU4A 3IRSA 3QTGA 4CD7A 2INFA 4IHCA 4FMVA 2DZXA 1BFNA 1J79A 1XLHA 1AA1B 4K8HA 3ZS4A 4F48A 3KVLA 1TSIA 3W7LA 2Q02A 1GQIA 3GTFA 2ZFAA 4W9TA 3V3WA 3WNOA 1JPIA 5CZTA 3KBSA 2AQVA 1MFVA 5LA0A 3XIMA 4JY8A 4MAVA 1ZSXA 2R1LA 4H9YA 1JVNA 3VIMA 1NARA 5TAOA 1X7IA 4CD4A 3CT7A 4AIUA 1RQEA 1NDZA 5SWUA 5CPNA 3WNKA 3KOFA 1D2KA 1SZFA 4YNGA 4I90A 4XIMA 1QASA 4AXNA 4B5UA 4HU8A 4H2HA 1A5NC 4FZIA 2HVNA 1H1YA 1QBAA 3UR5A 4LV9A 4ZFCA 2E5BA 3NZRA 1CDGA 3D3AA 2XGIA 1KRMA 2V68A 1MW2A 1O6IA 2WXDM 4XSLA 4LUYA 4EK7A 4H6EA 1HJWA 2ZX9A 3VNZA 1AJZA 4JNYA 3W6LA 5JBEA 3FK4A 4A8NA 3O2LA 1SSGA 4DJFD 1W5QA 3DX5A 1UKPA 1S5VA 4WJEA 4DAIA 3NURA 1OINA 4PMOA 3RO6A 1AQHA 4IPLA 2ZA2A 5KITA 5DBTA 4GUGA 3L5AA 4R85A 3S5YA 1VBUA 2VFHA 4HU3A 1EX5A 4FXRA 1DJGA 1XM3A 2O7SA 3PBGA 3NL5A 1FVPA 4JY9A 4RR4A 3C52A 4HNCA 4JCLA 4UZUA 4JTLA 4JIEA 2DUZA 3T08A 3OZOA 1GTEA 2JKPA 3CTLA 5A8GA 1C8QA 1V3HA 4JD4A 2WC7A 4DJEC 1VEOA 4Q8WA 3NZGA 4JTJA 3M5ZA 1E3ZA 1QDSA 1WA3A 3PZTA 2BHZA 4LYQA 4AEOA 2QT3A 2C3ZA 1RAKA 4M29A 4D1JA 5DMLA 1XLAA 4N02A 2VDHA 3B9OA 2YDSA 3QRHA 4TMCA 3M7SA 4NQ1A 4QS6A 2QIIA 5BXPA 1HVQA 1WDDA 3W6YA 5DXXA 2VX6A 4ZO6A 1K6WA 4CNTA 1GCYA 2VFIA 5A8NA 1LYXA 1XYLA 3UXLA 1GOMA 5A6SA 3NSNA 4IIDA 2VI0A 4TR9A 4LEFA 5K4ZA 2A6LA 2EXOA 3WD4A 1QAPA 1DXIA 4KFPA 4NNCA 1LWHA 2CWXA 2WC3A 1E6SM 4CQDA 4FF7A 1W9PA 3S2LA 3C2FA 5HK4A 3VTRA 4KCTA 4QAWA 1C29A 4LRTA 4GINA 3TAKA 4H7ZA 4MJMA 2ZRYA 2UV8G 1WDRA 4E4UA 1DJHA 1UG6A 4DN1A 2C19A 3M47A 3NQVA 1O5XA 1X97A 1OCBA 3ELFA 3B0VC 3KOZA 3SFWA 4QS5A 3UERA 4Z42C 3FKKA 1WNOA 2P0IA 1K4GA 5EGRA 1XUZA 4JTFA 1US3A 1H62A 3RHGA 3PTQA 3JRKA 1YTEA 1IYXA 1KRCC 3SQLA 3MBFA 4PH6A 4ZOBA 4UTJA 1XI3A 4K39A 2J74A 4H01A 2G41A 1W3IA 4H7CA 1HX0A 2Z24A 4C60A 1NFPA 5EMKA 4S3FA 3UCQA 3LXCA 1YYAA 4XZHA 1I1WA 2YL8A 4AD4A 1QW9A 3NIYA 1W9VA 5I77A 1NF0A 4MNLA 4C6DA 3VC5A 4WKFA 3BAYA 1CW2A 2YFNA 4NAFB 3LZ3A 4NYUA 1UHVA 1RZMA 3SCRA 2ASHA 4RNJA 4WLCA 4EANA 4J7RA 2WQPA 3VNDA 1N7KA 1XV8A 3BPWA 2PWDA 3N34A 1EC9A 1GOIA 1V6TA 5T9BG 3SCWA 3VIPA 4KERA 3BLEA 1RQBA 4GH3A 1UASA 3NL3A 4KFNA 1LWJA 3HJZA 4IISA 4C65A 1ADDA 4HK7A 1XRVA 3ARQA 3W38A 3NSXA 3UXIA 3UCCA 4UTUA 3S1VA 4RPQA 3NOEA 2PWFA 2ISVA 1CLVA 1MZHA 3FLUA 4WZHA 4GC4A 1OD8A 3GTNA 3VDGA 4ZQOA 1PYMA 1F7BA 4C1NA 1J10A 3LS9A 1F07A 3ZYZA 2BB0A 2B7QA 1BF6A 2O55A 3HF3A 1SZEA 4P8UA 3EOEA 1DE6A 2ONEA 3S46A 3H2CA 3MDUA 4KWWA 3PWIA 1S5TA 3DECA 3U4FA 4LBUA 4YTTA 1LRTA 3RNDA 4CEXC 2V6AA 2C6QA 5DMNA 2OEJA 4S2BA 1VFTA 5HJXA 4F8XA 3NAVA 1H7RA 3B9AA 1XLCA 4G5DA 1Z42A 3WD1A 5IDZA 5G4WA 1O94A 1CBGA 3QZ6A 2XWEA 3CAVA 3LPPA 1W0MA 1BRLA 3R0UA 1TZ7A 3ANVA 4QEHA 2WNNA 5DCDA 4IQDA 1A49A 5F1VA 2CZDA 2D23A 4ZVJA 4BJHA 2GWNA 1PTAA 2NV1A 1LUCA 2GSHA 1H7WA 4UQEA 1OADA 3CL6A 1EDTA 1TX2A 1XHGA 4RZ6A 2HSAA 3Q37A 1GNXA 2QJIA 1Z32X 4LY4A 4UXDA 4PTWA 5FAGA 5BWFA 3O6DA 4IMDA 3OIHA 4Q6JA 1IEXA 4A05A 1GZJA 3CZLA 8A3HA 3W01A 3S5ZA 4KEMA 3LTSA 2WB5A 1X6UA 3N11A 4UCGA 2PDMA 4UR8A 4DYEA 2XU2A 3L2MA 2PRLA 1KV8A 2WV8A 4OV9A 2ZCGA 3E38A 3O6YX 4R5EA 4H9VA 4RDYA 1JCTA 4V1XA 4TVCA 4O17A 4Z2IA 4UNIA 1JUEA 2VEPA 3D3FA 5IDIA 4AISA 5J04A 1ZPTA 1Z9AA 5BRPA 3MWAA 1B3YA 1N55A 3TYDA 3W71A 1ZP4A 3T4WA 1NFBA 4CU6A 5HMSA 3K4DA 5GPRA 1P0NA 3RITA 1QXLA 4HKPA 4OQVA 4J3SA 1GZGA 2OWXA 4PBGA 5LNWA 3SY5A 3KTSA 3KM8A 4IIGA 4D9PA 1BTCA 3UR7A 4XZWA 1N82A 3EPMA 1MUWA 3UWEA 5AC5A 1A47A 1EGMA 5HNRA 4HD5A 2QCDA 3IACA 3E3HA 3H7RA 4IMEA 4DVOA 1R38A 4JTIA 4WXZA 4ZOEA 4GI8A 3WNNA 2V5DA 4Q4OA 3FA3A 4S3DA 1TE6A 3RLHA 1QHPA 2PDGA 4L9ZA 1PYFA 2VFDA 4C6EA 3W00A 3BLFA 5D9OA 2ACRA 2PB1A 4WY0F 3I3BA 1KFLA 3NNTA 3EKGA 1YNQA 4JFVA 1OT2A 5GNZA 1JPMA 3W1NA 1W3HA 4E8GA 3ATYA 4ML9A 1M01A 2NVCA 1NDVA 4H19A 3SEPA 1F76A 4M24A 3GG0A 1B9ZA 3FVDA 1ICPA 2IXUA 4GQBA 1FCBA 4A8RA 1HN1A 4AWUA 3LQLA 3LSBA 3DYPA 4JNMA 4E5TA 3ZR4A 4L6DA 2QPSA 4I9MA 4DX3A 1GK8A 1LLZA 2VZSA 3DERA 3QV7A 1M41A 2ZA3A 5GJPA 3V0UA 1KCLA 1P0BA 5CJMA 3MKVA 4CN6A 1TV2A 1JZ8A 1VFSA 5I5RA 4JQ2A 5A6JA 4XBJA 1OGBA 4YVPA 3ARYA 3GUGA 5A69A 2G0WA 5C55A 4C6BA 4LCSA 1WUFA 3CM4A 4Y8EA 5K9DA 2OEKA 1BXNA 1Z48A 2X41A 4N2YA 2HRWA 3SRKA 1UPMB 1CXFA 3IUDA 3RLGA 2E1WA 1RPXA 3WQDA 2NQ9A 3U2OA 4DXVA 3E5BA 4YWIA 2EF9A 3OGSA 2HVMA 1SFLA 4QLLA 4A29A 2RFGA 1SUXA 3OA5A 4RZ4A 3WQCA 4ZMGA 3H23A 3WQ5A 3GXTA 2ZXDA 5BW6A 1WV2A 4TO8A 3QY8A 1BEUA 3BSGA 4GUFA 2DV0A 3MHFA 2VT0A 1R3TA 3T9PA 1OG0A 3AWNA 3R11A 1LBMA 4XD5A 4B5VA 1TTIA 3RO8A 3T0DA 4D6FA 1TPH1 3E2QA 1OBAA 3P14A 2H8XA 3B05A 1WBJA 1A5SA 1H09A 3AS2A 3TE9A 3TTEA 2WPGA 1FWAC 4P7OA 2DT0A 2ZX8A 3BLLA 3R79A 4GJJA 1KR1A 1RLCL 1CGWA 3BLOA 1TWSA 2ZUVA 3ZVIA 2VYOA 3VNIA 5K7JA 1XD0A 1W2PA 1H2JA 1RVKA 1EFZA 5A95A 1DQWA 4M1BA 3C2EA 5CPLA 3W1AA 3ARRA 5JH1A 2ZZ7A 1WPCA 1TQJA 2P88A 2FPVA 3NDYA 3BOXA 2Z25A 3OBAA 1SSDA 1BF2A 1ZQ5A 5TBOA 3M64A 5AHEA 2PCQA 4A3UA 1ADOA 1VQTA 1J8VA 2GVGA 3OEXA 1VBRA 1A0DA 3R89A 1R9XA 3Q67A 1MW0A 3SECA 4QE5A 3CLWA 3LHZA 1JF5A 1QR7A 2FH6A 2ACUA 3DXIA 3MCNA 4ZL1A 1O5RA 4HP5A 4M5PA 4WGHA 3OHIA 1MXSA 1LOLA 2BOFX 1HL8A 5A5WA 4J3ZA 2HE5A 2PU0A 3MMUA 3JZUA 3CASA 3TXVA 4FLSA 4LF1A 4MZYA 5BRQA 4DJED 3MTWA 3TYUA 3RCMA 4ICMA 3W27A 3LEPA 1K8CA 4ILSA 3MC5A 3H2NA 1BKSA 3WLTA 1J5TA 3KHDA 1TWWA 3LU2A 1TVPA 1V3IA 2PWUA 3A12A 1ISWA 4CCCA 2QCCA 3URNA 2OQYA 3PC0A 3W25A 3GDLA 3G8RA 1VCGA 5ENLA 1J96A 3W2JA 1JZ2A 1BD0A 2WJFA 2O9PA 3HPFA 5EY5A 4NU7A 4IICA 4DAFA 2PMQA 1IEWA 4MIMA 2QYGA 3H7UA 1CLKA 5H6HA 3EWUA 1PKMA 3ME3A 4I3GA 1OCJA 2QCFA 3UT0A 1RP9A 5CLTA 2XVNA 3G1SA 4ZR8A 1MO0A 5C8BB 4E3TA 2VL4A 2ZA1A 2EG6A 2O4QA 1BQGA 3W73A 4H00A 1B3WA 5G1TA 1R6WA 3H53A 4J27A 4AHPA 4HZ6A 5CGMA 5AKQA 1HQTA 2GVLA 2NQLA 2CITA 4ZA0A 5CAKA 5CJNA 1HGWA 2Y61A 3WY1A 1V3LA 1PUDA 1W54A 4XB3A 1H7PA 2A79A 1EJTC 1WKYA 2WYSA 1ZZMA 3VGEA 1AJ0A 2PBGA 3A4XA 3WH9A 1R2SA 3FV9A 1W1PA 4FSAA 1YLVA 3SSZA 1XGEA 2QEZA 5T8GA 4MB3A 5ABEA 1QHOA 1HJQA 2X7VA 2GGIA 1TPWA 1EJ7L 3M0KA 1E5JA 3W26A 2BVDA 2VEFA 4KWUA 2QCGA 2V3FA 4MJ2A 3NGFA 1F73A 3B8DA 3W4RA 3W7PA 1FXQA 3UCDA 2CLKA 1PZ2A 3B8TA 4O15A 5LIYX 3VFLA 1W8SA 2VZVA 3KBNA 3CUHA 4HZMA 5REQA 2ZWZA 1HJSA 1EZ2A 3TR2A 4C6LA 1E72M 4GNJA 2XIQA 1HJUA 2VGGA 4N9BA 3W28A 3PANA 1ZJAA 1O7AA 3GXPA 1XPYA 3EB2A 1R3YA 1D9EA 3WK0A 1Q2SA 1BQCA 3NQBA 4V2XA 4HSNA 3VNYA 5DFAA 4IFKA 4HOWA 1E1FA 1FWJC 4L64A 5D38A 3TFCA 3AXHA 1S2CA 4Y9MA 2B7OA 1GKRA 1M3UA 3F5KA 3ID7A 1OFAA 4ZCWA 2HPMA 4GJIA 5HQLA 1V0KA 4GFIA 3LPOA 4FAMA 3QR0A 1R0MA 1HIZA 3W7EA 2CZEA 4FX7A 2GOUA 4GWEA 3SGUA 4KIRA 4RV3A 3RMJA 4Z1YA 1XKYA 2OXNA 4D2JA 3LRLA 4YTQA 3PB0A 2WJZA 3IJ6A 1SMAA 4GA8A 1W1ZA 2GFTA 3OVPA 4C6IA 4IX2A 3FCPA 2LLEA 3BGJA 3UBPC 4PEEA 4LTSA 1KCKA 5G1MA 2G96A 3EX1A 4N9DA 1GVOA 4UFHA 2YCEA 4OBSA 1E6NA 3APTA 3M46A 4J3WA 4WQ6A 1OEPA 4XV0A 1EKOA 1Z41A 4B15A 4O18A 1H51A 4M0XA 5FJTA 4GIRA 3LERA 3GU9A 4O0ZA 3HPAA 4NZ5A 5LKYA 1XG4A 4G8TA 1SO4A 1K9DA 3TCEA 2PUZA 3DFSA 3KZSA 2GK1A 4A8LA 2C0HA 1B3VA 4JOMA 4GUIA 4LYRA 4AVOA 4ZB0A 3HTWA 5M5DA 3II1A 4QNEA 1LL7A 2YCJA 3PY2A 1BVZA 2OZ8A 1G6CA 2I5QA 2YR1A 2H9AA 4PL2A 3CMJA 1F6KA 1TZZA 4NKCA 4GX9A 4M6PA 1KXQA 4EPBC 4WR3A 1DWFM 3W7MA 1BG9A 4NG3A 1IWBA 1PV8A 5CPQA 1F74A 3LCFA 1KM0A 2VC9A 3IUHA 1UMYA 1PXGA 4NI3A 2ZZ4A 4O0QA 4BQ4A 4F9JA 2NXGA 2ZOXA 2X05A 4O8AA 2IPGA 3FXYA 1TPDA 2HBVA 4JDBA 2WMJA 3MI6A 3BOFA 4MG4A 2W9MA 7REQB 3C0LA 5DY2A 5F1UA 3SB0A 4RXGA 4ZEPA 4C1NB 3T0TA 1OFPA 5LXXA 4HJFA 3GVRA 1GW1A 3SRHA 2XFRA 1RD5A 4ALDA 2HISA 4IIEA 2CU0A 2J8FA 5BYWA 3BAIA 3VGGA 1F8MA 3SUWA 2D20A 4E2DA 3BOLA 2PD5A 3HMJG 2V3EA 4U28A 3KBJA 3WF3A 3IS4A 1J01A 3BTNA 1NM9A 1UWSA 4LNCA 3TUUA 4QIUA 1AMKA 3E0WA 3V5CA 1VCFA 2DZVA 4LPCA 2NX9A 4XTDA 2XHYA 4MFDA 1S3HA 2XWDA 1EA0A 4ZOAA 4HPXA 1BRLB 2WMFA 3Q2DA 5I3JA 4CQCA 2W4XA 2FJKA 1OFDA 1WXJA 4ATDA 1PDYA 8TIMA 3PJTA 3TC3A 1LUCB 2Y5JA 1MQQA 2VR2A 3EEZA 4O4WA 1UKQA 3ITGA 3B40A 2QUMA 4L9XA 3LBCA 3WD2A 7A3HA 3CJPA 3O16A 2E6FA 2PDBA 3CZJA 4IIBA 1VCVA 2GQ9A 5I09A 1KTNA 1ITXA 3MUIA 1UWIA 2BBFA 3RIKA 4A2RA 3THCA 3QVQA 4PMVA 1FWRA 3MMTA 3EXSA 2XUCA 3DZ1A 1HTIA 3AMDA 1ZB5A 3UPWA 4GX8A 3LHTA 4EAYA 2ZICA 2XM1A 2WBGA 2O9TA 1EP1A 2UWFA 2YL9A 1WKEA 4QRNA 4PE8A 2HQAA 2OODA 1GZ1A 3VKBA 2V5LA 4BEUA 2PD9A 5HDRA 1O5KA 1KKOA 2VCCA 2G4FA 3ABOA 5DMMA 3IV8A 4YHEA 2KX9A 1LCOA 4FO4A 3ZR6A 4DYKA 3RR1A 4BF5A 3JW7A 4R7WA 1AD4A 4DF2A 3RLUA 5C70A 2PDIA 3W87A 3QV8A 3WJSA 4YJ5A 4UFMA 2F61A 1LF1A 4YLWA 2OT1A 1NEYA 1IIHA 1VH7A 1S3TC 3M0VA 4GGHA 2TYSA 3V36A 3AZTA 4DRSA 5MF5A 1YEYA 5KSWA 2VC6A 3TAOA 3AIWA 1RVGA 2EKGA 2PS2A 3IJQA 3N4AA 4GD0A 3IAPA 2QCDB 4LC8A 1MDRA 2VUNA 2VO5A 4OHQA 1HKVA 4O53A 4MKVA 5DEZA 3TQKA 1R9ZA 1F3XA 2A5HA 1FDJA 3PK7A 3WLNA 4AU0A 3F4DA 3LM7A 3UD6A 1XYFA 3WJYA 1CZ1A 4IGHA 2OTDA 2R82A 5CBIA 4P61A 4IWWA 3EMQA 1SJAA 1RSCA 3W2NA 2YSWA 1P1MA 1UD4A 3AXMA 2DSWA 3VI2A 2GL5A 3W02A 4FNQA 3G8EA 2E8ZA 2GDUA 1TRDA 1TVLA 4RKAA 3UZYA 2PURA 2BOGX 2YCIX 1NDWA 2J9ZA 3EMZA 3QKZA 3F5JA 3NM3A 4P8WA 1EF3A 4LAKA 4IMFA 5C2CA 2BASA 4L56A 3CZEA 5CPSA 3W81A 4UFLA 4S3CA 4JTDA 3GHRA 3DUGA 4AIEA 3L65A 4ZB5A 3BQ6A 1Z7AA 3IK2A 3UZWA 3ARTA 1JCLA 3THAA 3E0LA 2GJLA 1LT8A 4M8UA 2QPUA 3S2JA 4QQUA 4MFEA 5AC7A 4HMEA 1MNSA 3W7JA 4GQRA 2V3DA 4HU0A 3M6YA 3LTPA 4X0NA 2V9DA 5FJUA 3OHMB 4F2UA 4FLQA 4FA3A 2WLYA 4ORIA 2FZ8A 3DFNA 4KCVA 4PMQA 2PLKA 4BF7A 5KMYA 2WZHA 4IP7A 1TO3A 1VBHA 3GX9A 3AS0A 1U1HA 5HNNA 4J3VA 3UG4A 3LXAA 1RA5A 3QZEA 1XIGA 1KW1A 4HHHA 5CBJA 4UMBA 1K7EA 3WF1A 3KS6A 4H3DA 1W37A 3HOJA 3HURA 4IXHA 1ISZA 3KL0A 4ML4A 3S42A 2ZRWA 2PDKA 3PBUA 4JX4A 2HNHA 1YMYA 3EWWA 1OZQA 4KEVA 4UQAA 5J8LA 4LUSA 5HINA 1U5HA 3G1VA 1X39A 1ITCA 4NZ1A 3GK0A 3W2MA 3T2PA 2DU2A 2C13A 2R6OA 2RDWA 2X1SA 3PZIA 4JIPA 1IEIA 4LBRA 4HPNA 4MF4A 1HL9A 2Y62A 4MPQA 3WSUA 3AIRA 4US5D 3VKAA 4FIQA 2O4MA 3N04A 3R2GA 3CMFA 3BURA 4UFKA 4M19A 3RPDA 4HN4A 1XLMA 1GTHA 2VFFA 3WCZA 2AQWA 2YYTA 1FWWA 1EJWC 2WK2A 3DCPA 2W27A 1KM3A 4IL2A 1MWOA 3L2LA 3M7WA 1TR1A 3U8GA 2WZEA 3CPGA 3S9ZA 3TQPA 4JTQA 4O11A 3W1XA 4HCDA 2J62A 3TMQA 5AECA 4CCDA 3NOYA 3QHNA 1KBKA 3IVUA 3G0UA 3LLFA 3MPGA 4IM4A 1SVDA 2Q71A 2B31A 3JS3A 4GC3A 4QG9A 4JKKA 5E6ZA 5A6AA 4GI6A 4XKYA 3GG1A 3S83A 1C8XA 4DQWA 1XJBA 4MY9A 2ESCA 3RPMA 3CQ0A 4MB4A 3TX9A 1TJ0A 3FW6A 3LM3A 1NOFA 1M65A 1ALDA 4N6FA 2GSEA 1XH1A 1TQXA 1UUQA 2E40A 3AHYA 2PSNA 4GVHA 2XIJA 3KXQA 1XIEA 5F4XA 2GGGA 2OWCA 3RN6A 3TJIA 3W23A 3NTYA 1NAL1 2GUBA 1FWHC 1AW5A 3ZIZA 4O1AA 4U3CA 3AALA 3RG6A 3E74A 1KRBC 1SO5A 1R2RA 1EC8A 1N8WA 4GPNA 3VMNA 1RJPA 2J66A 3NCOA 4F9DA 1BSIA 1QPNA 1KO0A 2G95A 3GVVA 3S1WA 4Q4RA 3AU2A 3TZFA 1QHZA 3MUZ1 4Y7EA 1JFXA 5FEZA 4Q8TA 2GLKA 3GDBA 4QE4A 2Z7GA 3OZYA 1A80A 4HBKA 1DE5A 3SQMA 4QFUA 4TIMA 2AKZA 3DFOA 1PHQA 3ATZA 3VZXA 3EBVA 1GG1A 2FFIA 1RBLA 2CLHA 5I03A 3DOPA 1DKWA 2WNQA 1C3FA 1M7OA 1LT7A 1VPQA 1T8XA 4MZ1A 2QNEA 4RL3A 3WQOA 3QC3A 2AGKA 3TYZA 3CQJA 3WX7A 4IOTA 1D8WA 3ZO9A 3D0CA 3PZOA 5I3IA 2FB3A 2I5IA 4E8CA 1U33A 2HPIA 2BLEA 5D33A 3QZAA 1ML1A 2VWSA 2YB4A 4QE1A 2YPIA 5JQ9A 4AVNA 2CERA 1R85A 3DFYA 2X7WA 3CZGA 2Z6JA 1HVXA 2A3LA 3AC0A 3OYZA 1MEIA 4A4AA 1GVSA 3W37A 3WK2A 3USZA 1OIMA 1OX6A 4OBRA 1XH0A 2HE8A 4GNVA 3WQ4A 3LPGA 1UQZA 1A5OC 1HKWA 1XRTA 5H8UA 1PZ3A 3VABA 5E70A 1B90A 1EYWA 1K77A 2HEJA 1W9DM 3W1QA 2BY1A 3LZ5A 3WZ0E 3SCTA 3R10A 1UR1A 3RX2A 1DWIM 4ZXOA 3ARZA 1JFHA 1EOMA 1XIHA 3BMXA 3SY8A 3TNOA 4I6VA 5DLCA 1W5OA 5REQB 3FYOA 1Q6EA 4FI4A 3DN5A 1TMQA 3HMCA 3XISA 5AVNA 3SBFA 4JPGA 2IPWA 4O19A 4J3UA 3QFEA 1W9BM 4O4VA 1EO5A 1AL8A 4EPDC 3H4WA 1EQPA 1XIJA 3NO3A 1XICA 2OGJA 2WZMA 4XBSA 1W2VA 4IFKB 5HUOA 3U57A 1UOKA 1FWCC 3KRBA 1JL8A 3OBKA 2XISA 3OG3A 4KWVA 3F2BA 1KA9F 4A3YA 4TXEA 3T55A 1TA3A 3T1GA 4HHLA 2W3ZA 5F7UA 5D4YA 5LA2A 2R1PA 2V3GA 3L4TA 1FBAA 4U31A 2ZX5A 4O54A 1QRQA 3ENLA 1GEHA 1BVNP 3BJFA 3PZVA 4UTWA 4DXXA 1TZ9A 4ZGYA 1CCWB 2ISSA 3OOQA 2E5DA 2QR6A 4PL1A 1OCQA 3WUFA 1Y5WA 1P0DA 2I5GA 2QLYA 3UGRA 1PX8A 2PRHA 1KQZA 2XPKA 4IPNB 2VX5A 3HFYA 3GVGA 1OQFA 4Q7BA 4B5SA 3TDFA 2QVHA 4A3RA 3RJYA 1QFEA 3P62A 3I4KA 2QHAA 1V6WA 2OT0A 1I9CB 1H7OA 2CIPA 1E56A 1C7SA 5FSEC 4FX8A 2VOTA 1O12A 3TEVA 1QNVA 1HP5A 3ZWSA 5D2WA 4GVFA 3N2CA 5KETA 4KEZA 2E8YA 3IV3A 2GK1B 3L4WA 5LIUX 3AYSA 5E6YA 3Q4DA 4A2SA 4WDXA 3BSMA 2JQXA 2D2GA 3ZVHB 2PBOA 5FEPA 1B54A 4PFHA 4YVVA 3B9EA 4Y9AA 4CQAA 3CC1A 5AHNA 4F2BA 1KBLA 1XYBA 2UY3A 2H9AB 3FJ6A 4J2MA 1WDQA 3GSMA 2E67A 3PBMA 3GNNA 4FR1A 4GJ1A 1CNVA 2PTDA 3T4CA 5FF3A 5AHIA 2FZDA 1HKKA 4HPGA 3CWNA 2EHHA 2WVSA 2ZTKA 4H8NA 3EWCA 4AC7C 1FWBC 2HXUA 3GHUA 4IP4A 3L4XA 4E4FA 2DSVA 3TW6A 3ZXWA 4TV6A 4GVGA 3EOUA 4Q4PA 3PZUA 2F2KA 4JGDA 4X0VA 1C9DA 2P3EA 3KWSA 2QJMA 4Z0SA 2OZ0A 1FWTA 1XIIA 4AEEA 2NQHA 4GMEA 2I1OA 2PDUA 3F2CA 3TYEA 3CYVA 1V3MA 3C2RA 1GVEA 1DEDA 1B3XA 3E0VA 4GZEA 2ACQA 4ATWA 5HQMA 3L2IA 3MVIA 4NSBA 4ZOCA 5F2GA 3QH2A 2QGYA 1G4SA 4PCPA 4RPPA 4JTEA 5D09A 2Q8ZA 1GYLA 4Z1AA 5HPCA 1HJXA 5E93A 4I7VA 2BFGA 2WPBA 4L5ZA 4MB5A 3ZLHA 2PPGA 3EPOA 4LOCA 4JHZA 1X98A 4LVFA 3OLEA 2DW7A 1CXHA 1XRFA 2NXHA 2EG7A 2WNZA 1MDLA 2EAWA 3WBWA 3G1RA 3H4XA 4TUFA 3FOKA 1RALA 4GACA 2NW0A 4UTTA 3VMOA 3BLPX 1VZWA 4GXWA 4LS2A 4W84A 3W7OA 1AVAA 5D8ZA 2BY0A 2Y2WA 1WOBA 3SADA 3VE7A 2CBVA 3G3MA 4JN7A 4EWJA 2DZPA 2A7RA 1XSJA 1GJWA 3PUEA 2QCNA 3PM6A 2Z29A 1MNZA 2OO0A 1QPRA 5IM51 1WB0A 3ABRA 4Y8FA 2H6RA 3SUVA 1Q7QA 3NDZA 1H5VA 4M6VA 3U9IA 1HG3A 1E3XA 1FH9A 3HIJA 4QITA 4JX5A 2VMFA 4DJDA 4JFWA 4IH3A 3VXGA 1BYDA 1UH3A 3HQPA 1DJZA 3TFXA 1PKYA 4EP8C 4MY8A 1GQNA 3URQA 5C71A 1ZBCA 3N6HA 1AW1A 2X09A 2C18A 3WLIA 3V75A 3IRDA 3LCLA 1A4LA 1GOQA 4YMZA 3BE7A 1EJRC 4N4PA 5EMLA 3QR3A 1Y7VA 3GAYA 4GQGA 4MSSA 3GHTA 1JZ6A 3PPGA 4ERIA 2WANA 1R3VA 4B3LA 4AMCA 3PJXA 3TJXA 4RE3A 4PZVA 1E1EA 3NXLA 4QDPA 2DDXA 3WDRA 4CVUA 1NQ6A 3CHFA 1XLLA 1UR2A 4WDUA 1VEPA 1IZKA 1I1XA 2J6XA 1XLJA 1LORA 1XLDA 2GQAA 2BGSA 1RCXB 4AF0A 3KP1A 1K6AA 4OTKA 3VGFA 3CBWA 1IT8A 4PTNA 3ZJKA 4JXCA 2Z27A 2REQA 1Q3NA 1YIXA 5HBFA 2OYMA 3O6CA 4ZQMA 2BODX 3H2FA 1K7FA 3OU8A 3W82A 4LB4A 1LRNA 3OP2A 2NUWA 1QNOA 3DKJA 1U83A 2X2GA 2OX4A 4Q8NA 1LDCA 4B16A 3W1PA 1A3HA 3WL0A 1T99A 3RM8A 3UVAA 4AD5A 4GK8A 1VP5A 3MU7A 3QSRA 5CKSA 4DUXA 2J4GA 1RY0A 1VFHA 3VGHA 1UD5A 4I7UA 1WE5A 4W88A 5ABHA 2WBKA 3AMKA 1GJUA 1LBFA 3NXFA 1JI1A 3CLMA 3VUSA 4POCA 2YXXA 2RDXA 3B0PA 3GR7A 4CGTA 4IQLA 1LM1A 4N9EA 4C91A 3ZJ6A 3AZSA 1V6XA 3WLRA 2EQDA 5JXQA 3TW7A 4X2RA 3C8FA 5C2GA 1ODUA 1TREA 4WOZA 3WLSA 5A6KA 4XD4A 2YDRA 4IL0A 1E4NA 3WF0A 1A53A 1RA0A 4RNHA 3R1ZA 2OKOA 3AICA 3C0QA 1LP6A 1VKFA 2ZUSA 3CO8A 4CQBA 3DHPA 2ZX6A 3P74A 1JXKA 1QNRA 3I7RA 2NQ5A 2Y8KA 4S3AA 3STFA 4PMUA 1GYMA 4M51A 1A5UA 4A3QA 2X0SA 3NO5A 1E6QM 3QN3A 3AO0A 1OABA 1HKIA 3APGA 3DIPA 2X0HA 4C6KA 2G4JA 1AUSL 2XN2A 2NZLA 1MUCA 2NT1A 3MSRA 1HKMA 2UY2A 3ARWA 4RK8A 1P0KA 3AWOA 3TYAA 2DJXA 5E0CA 1V6VA 1FWGC 1X1OA 3S1XA 1DJXA 1PIFA 3PSVA 1I2RA 2Z28A 4CQ8A 1YHTA 4IMCA 4LUSB 1E43A 4X3ZA 3BDKA 1DJYA 5D9MA 1WP6A 5DBUA 3GRIA 3W07A 4NZ3A 3NQCA 1I75A 1GONA 3TSBA 2NX3A 3N18A 1YXYA 2ZXQA 4LU0A 1PX4A 1QMLA 1UPPA 2A7NA 4FOKA 3VIFA 4L80A 3VOHA 3WLHA 3U3HA 4LRSA 2A3AA 1KV5A 4M82A 1FH8A 1ZY9A 3LX9A 3ABZA 3EPNA 1F4AA 7CGTA 1Y5XA 4UTWC 5I78A 4JTKA 4OFCA 2OZ3A 5HNTA 1DXFA 2CEQA 1T6MA 5FF7A 5FD0A 4HB7A 3BC9A 1ZCCA 3KLLA 4LC6A 4Q8MA 3W7IA 5CLWA 3TOPA 3SN0A 3CUZA 2FIQA 4V15A 6TAAA 4Y2WA 3KW3A 2OGYA 3NFUA 2QVNA 4JFTA 4MAZA 4NX0A 4LVGA 3NQDA 4MADA 3F2DA 3TA9A 1ITUA 2AGTA 3PZ9A 5HXMA 1UJPA 1UZ1A 4BQ5A 1MZRA 3PG9A 3TMLA 3TOYA 3MCOA 2F6XA 3VK5A 2OSXA 1R5YA 1XGZA 5A8MA 3TIMA 3A3WA 4PUNA 5TD4A 5HR6A 4XKYB 1SPQA 2X2YA 1ZJBA 3ARXA 2X1IA 1A5KC 3IPWA 2DQXA 4LWWA 3ITTA 1WO2A 6PTDA 2XVKA 3VUPA 1SZRA 3S6OA 1UYQA 5M2FX 1W5NA 4WUIA 1K8YA 3TJLA 4KH2A 2CFFA 2DZSA 3OYXA 3UESA 3TTQA 5FEWA 1PX3A 5C7HA 5I07A 1RR2A 3GXFA 4LYKA 4C7DA 1O68A 3FX4A 2O56A 2OYKA 4MUZA 3M0MA 5AYIA 4LF2A 2OOGA 1HGYA 2HZGA 3TP4A 3U6WA 3PN8A 2Q3RA 3JUGA 2VTFA 4C7FA 1PIIA 1Q45A 3LNMA 4GYKA 4NT0A 3BUVA 1JQVA 5AYYA 1FWNA 2WVUA 3NO1A 4D6CA 1OD0A 1L6WA 4IFOA 4LAZA 1R3WA 2WSRA 1FHUA 4NIRA 3OA3A 3T42A 4XVEA 1QTWA 3I3EA 4Z1BA 2XVLA 3A13A 2ZUMA 2GOKA 3TN5A 2GDQA 3ES8A 1I2PA 3UZZA 1PCKA 3GFZA 3S5OA 3SCSA 1B30A 3QLLA 3UYCA 1RBOB 4LYPA 3USBA 3QV9A 4AHOA 1R47A 3BLIA 2E77A 3WQGA 1GGOA 1QI5A 4W4QA 3UU0A 2B7PA 3C3UA 2MANA 3OVRA 1L2QA 3LCWA 4OJYA 2OWWA 3R94A 3H12A 3W0KA 3GVWA 4Q7NA 4H9MA 1XPGA 3VCNA 2NWRA 1TKKA 1IZJA 3I10A 1XXXA 1GHRA 3F4NA 4FXJA 2VM8A 1E9IA 1ZCOA 3QHMA 1JPDX 3LSCA 1EBHA 4Q8QA 1JRBA 1S38A 1CB2A 1KFEA 2P53A 2YZRA 3CB8A 2V69A 4UTTC 2E6AA 4WXYA 3IWPA 4X63A 5AYZA 1QI4A 5C9XA 2WWCA 2Y6ZA 5CSUA 3OO2A 3MO4A 1UP3A 4O12A 2B4GA 3EXRA 3CL8A 1JDCA 2GSJA 3WYZA 1NOWA 2CBUA 3DG6A 1XISA 1HT6A 3OIXA 2C15A 2P1FA 2V5CA 1V6UA 4FPSA 3T78A 2WSPA 5F4SA 2OOFA 1IT0A 3NL6A 4ZO8A 3ARUA 4UOQA 2CLFA 3WLPA 4PC8A 4B5NA 4DJDC 2TAAA 3TSDA 5FESA 4ZB2A 3PJWA 1J5SA 4LS0A 4PTDA 1TA3B 4KGJA 1FY6A 4ZTXA 2PDXA 2PZNA 1JG9A 4JTCA 1XBXA 1TG7A 3BWWA 1B31A 3AU6A 1ZJIA 4JX6A 2VD9A 3NL2A 1PEZA 4AH7A 2J7GA 3UNDA 4OV4A 4AX7A 3FVMA 3GE7A 2AL2A 1V03A 3WQPA 2D2JA 1UUOA 4RDVA 3MYOA 3NUKA 3ALFA 1WQ5A 2DZTA 3B4UA 6REQA 3C6CA 3HPXA 3CYJA 1V4YA 2V67A 2HJPA 4OUIA 1G1YA 5DRIA 3T07A 1YNPA 1E6XM 3OZPA 3S5SA 5I23A 1U22A 3P80A 4R88A 4RNFA 1EUAA 2GQ8A 1E6ZA 1UH4A 2DIKA 3WMBA 3IIXA 3OQ8A 3A5FA 3L5LA 1YDVA 4B4FA 4BHYA 2QCMA 2W66A 4DF0A 3N73A 3EXTA 1Z3NA 1EOKA 4JQ4A 5CGTA 5FA5A 1YRRA 1L6SA 4DHGA 4BCEA 4MDPA 1TJRA 2A6NA 2YKKA 2YFOA 1IXOA 1OC7A 2IPFA 2FZBA 3T0BA 5IRPA 1W5MA 3P67A 2OLAA 1MXDA 3BCFA 4YPJA 1IXNA 4W8AA 1G7VA 1XYCA 1V08A 2ATMA 2VFEA 1L6FA 4Z08A 3GDRA 1PPIA 1W1A1 2CHOA 5DELA 3UY7A 2FMOA 3AQUA 3WH5A 2IKGA 4LUJA 2G37A 4U3AA 2ZDRA 5C9RA 4X60A 2A1YA 2RAGA 5G2WA 3WNPA 3O0KA 3W70A 1UD6A 3PBWA 1T40A 4C6CA 3N3MA 1TRIA 3C2OA 3GR8A 1XLFA 1CB7B 1EJXC 1L6GA 2BG5A 2VDGA 1P6CA 5D2VA 5M17A 5FCZA 4TQTA 1XLEA 2DJLA 3MKKA 3STEA 1T41A 2Z0IA 1TPB1 2WNWA 3D47A 1T96A 3LY0A 4L9YA 2DT1A 2C71A 2PDNA 4WCJA 4BK9A