4HBOA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
96
structure length
79
Chain Sequence
b'EACVTSWLWSEGEGAVFYRVDLHFTMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
total genus 8
structure length 79
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hboA00
4HBEA 4HARA 4HBOA
chains in the Genus database with same CATH superfamily
4U85A 3O5FA 2PPOA 3ARXA 1OGBA 3B9EA 5DO2A 3O5DA 3UI4A 1NWUA 3WKZA 2DSVA 5HUAA 1W1VA 2LGOA 1Q1CA 1EHNA 2ESCA 3CGMA 2A3EA 3WQWA 4Q22A 5DEZA 3B9AA 2AWGA 1R9HA 3O5KA 3B9DA 5HWCA 4IQ2A 1GRJA 2YBUA 3B7XA 1BL4A 4DWSB 3KAFA 2PV2A 4HBEA 1JVWA 1VF8A 4U86A 4J4NA 4Z2GA 3UQAA 2WK2A 2ETNA 3O5MA 3WD3A 3CZ8A 3O5QA 2A3AA 1ZBCA 1FKGA 4JFKA 2ZQTA 4TYOA 3CHDA 3ARZA 1NSGA 3O5EA 4DT4A 4ODOA 1OWQA 3UF8A 3AQUA 1RD6A 1T11A 3NRKA 1E6PA 1HJWA 4ODNA 3G6LA 4MPKA 4QIBA 3KAHA 1E6ZA 1WNOA 1UR8A 1EYMA 4WKFA 1NH6A 2KR7A 3WIJA 1E15A 5HWBA 5BXJA 1F40A 4MNMA 4MNKA 4ODMA 4DRPA 2XP9A 4MNJA 1QPLA 3WL1A 2ZQUA 1SYTA 4Q7NA 3FY1A 3JYJA 4ML4A 3WL0A 4TW7A 2KE0A 2MLYA 1ZL1A 3ARUA 1FKFA 1E6RA 3AS0A 2LPVA 2D9FA 4P8UA 1ZU8A 4URIA 2DT1A 2P4VA 1X6LA 5GPRA 3EIPA 4WIWA 2B31A 1FFRA 1NWRA 4GGQA 3NTPA 1FKHA 1E6NA 4G50A 1FKJA 2RURA 4TX0A 2DT2A 2MF9A 3GPKA 2XPBA 3GU0A 3RM8A 3ARVA 1HKJA 1NWSA 3WH0A 3UI6A 1KT0A 2XP3A 3CHEA 5HT1A 1BKFA 4W9QA 2AOSA 3ARYA 1LG2A 2Y78A 4UDMA 1W1TA 1D7JA 2F4EA 3KABA 5GQBA 2PPNA 3TCZA 4DRHA 4LGXA 4JFMA 4JFJA 2O92A 4TW6A 1IX5A 1K9TA 1GUVA 4J4OA 5GPGA 1YW5A 4Z2HA 4QT2A 2A3CA 3QOKA 1ZBVA 3WQVA 3GTYX 1FAPA 2LKNA 2FDMA 2F23A 3MDYB 1J4IA 2MLZA 3CHFA 2ITKA 2RUCA 1HKIA 1KFWA 1JNSA 3JYMA 4HBOA 3IK8A 2VCDA 2YBTA 3FAPA 3JXVA 1X6NA 4FN2A 2FAPA 5HBFA 3ARPA 2ZQVA 4JYSA 4R0XA 4DZ3A 1LG1A 3AS2A 3PRAA 3TC5A 4ZPTR 4JFLA 1L1PA 1FFQA 3KAGA 2OLHA 3UQBA 2DT3A 1NMVA 1Q6UA 4W9OA 2RSEA 4HARA 4KR0B 3H9RB 4P8VA 4JFIA 1SR0A 2K8IA 4IT6A 4PTMA 5D75A 4KQZA 3O5GA 3O5LA 4L72B 3ARWA 1LL7A 1JNEA 1P5QA 4MSPA 4LAVA 1D2KA 3RFWA 1Y0OA 1HKMA 4R5EA 3CH9A 5JH8A 1QZ2A 4DRKA 2MPHA 1KT1A 2LJ4A 1H0GA 2PI6A 3ALFA 1EIBA 2RUQA 4WK9A 1FKKA 2DPEA 3WD0A 2N87A 1D7HA 1U79A 2PV1A 4NSBA 3CHCA 4IPXA 4WKAA 1W1PA 1LL4A 1YATA 4MAVA 2FKEA 2ZQSA 3PRBA 3KZ7A 3KAIA 2ZR6A 4DZ2A 1NMWA 2F2DA 2RUDA 2A3BA 2WM0A 1FKRA 2KI3A 3ARQA 4ZPWR 1FKIA 5HW8A 1E44A 3OOBA 1HJVA 1QPFA 2KFWA 1M5YA 3O5RA 1TFVA 2OFNA 1UR9A 4AY1A 4ITZA 4ZPVR 3AS3A 3O5OA 1EDQA 1GPFA 2PBCA 4ODLA 1W9UA 1E9LA 4Z2KA 4DRNA 3VAWA 3PRDA 3RM4A 3I6CA 1J4HA 4IT4A 2RQSA 2WLZA 2DG3A 4ODQA 3ARRA 1ZK6A 4WKHA 4ODKA 3UI5A 4DH0A 4DRMA 3UQIA 1Q6HA 1GOIA 2XP4A 1XHGA 4MTVA 4NNRA 5HTGA 4FAPA 4TNSA 4MNLA 5HW6A 2KGJA 1Q6IA 2IF4A 4S3KA 1WAWA 5HW7A 2DT0A 3G6MA 1FKDA 4MGVA 3W4RA 2KO7A 2XPAA 4S3JA 1FJDA 3IKGA 4XAKA 2F21A 2EULA 2XP7A 3ARSA 2PN0A 3LUOA 1A7XA 3AROA 2VN1A 5DIVA 3WD4A 1O6IA 3ALGA 1OGGA 3PA7A 2DSWA 1PBKA 2M2AA 3BMBA 3PR9A 4DWSD 4P8XA 3O5JA 3AS1A 3WD2A 1B6CA 4DIPA 4QZVB 3O5PA 1JNDA 1ZBKA 4W5UA 1LQ0A 2B5UB 3OA5A 2PV3A 2XP8A 3BXWA 3B8SA 1J6YA 4U84A 2L2SA 5DIUA 2DSZA 3EY6A 4QT3A 3WD1A 4ZS6A 1HXVA 4Z2JA 4W9PA 4N19A 1HKKA 3KACA 4O2TA 1W9PA 3RM9A 4NZCA 2PPPA 2UZ5A 3O5IA 4Z2LA 1TCOC 2O9OA 1FKBA 1LJYA 2MLXA 1N1AA 3NI6A 1LL6A 4DWSA 2DG4A 2G41A 2G8ZA 1NWTA 1PINA 3IKDA 4DROA 1C9HA 1ZB5A 1W9VA 4ODPA 1D6OA 1F8AB 4C02B 1FD9A 1FKSA 2QF8A 3ODKA 1ROTA 1D7IA 4L3NA 1ITXA 4DRQA 1J4RA 4WJXA 4ODRA 5DF0A 1CTNA 4P8WA 1EQ3A 5DITA 3KADA 3KCEA 2XP5A 1XRVA 2XP6A 1FKTA 1JCHB 2WLYA 2M1IA 4DWSC 4IQCA 3RMEA 2DSUA 4GIVA 4LAWA 3RGCA 5B8IC 1WB0A 2IUZA 4TW8A 2JZVA 4DRJA 1FKLA 4LAYA 3CGNA 5J6EA 1JNTA 4LAXA 2MNTA 1ZBWA 1ROUA 5HKGA 4DRIA 3ARTA 3TDBA 4G2PA 4BF8A 2M08A 2ZR4A 1H0IA 2Q5AA 1ZCNA 2ZR5A 4Z2IA 1HJXA 3IHZA 5I98A 2DG9A 1W26A 1W1YA 3FXYA
chains in the Genus database with same CATH topology
4U85A 3O5FA 2PPOA 3ARXA 1OGBA 3B9EA 5DO2A 3O5DA 3UI4A 1NWUA 3WKZA 2DSVA 5HUAA 1W1VA 2LGOA 1Q1CA 1EHNA 2ESCA 3CGMA 2A3EA 3WQWA 4Q22A 5DEZA 3B9AA 2AWGA 1R9HA 3O5KA 3B9DA 5HWCA 4IQ2A 2YBUA 3B7XA 1BL4A 4DWSB 3KAFA 2PV2A 4HBEA 1JVWA 1VF8A 4U86A 4J4NA 4Z2GA 3UQAA 2WK2A 3O5MA 3WD3A 3CZ8A 3O5QA 2A3AA 1ZBCA 1FKGA 4JFKA 2ZQTA 4TYOA 3CHDA 3ARZA 1NSGA 3O5EA 4DT4A 4ODOA 1OWQA 3UF8A 3AQUA 1RD6A 1T11A 3NRKA 1E6PA 1HJWA 4ODNA 3G6LA 4MPKA 4QIBA 3KAHA 1E6ZA 1WNOA 1UR8A 1EYMA 4WKFA 1NH6A 2KR7A 3WIJA 1E15A 5HWBA 5BXJA 1F40A 4MNMA 4MNKA 4ODMA 4DRPA 2XP9A 4MNJA 1QPLA 3WL1A 2ZQUA 1SYTA 4Q7NA 3FY1A 3JYJA 4ML4A 3WL0A 4TW7A 2KE0A 2MLYA 1ZL1A 3ARUA 1FKFA 1E6RA 3AS0A 2LPVA 2D9FA 4P8UA 1ZU8A 4URIA 2DT1A 1X6LA 5GPRA 4WIWA 2B31A 1FFRA 1NWRA 4GGQA 3NTPA 1FKHA 1E6NA 4G50A 1FKJA 2RURA 4TX0A 2DT2A 2MF9A 3GPKA 2XPBA 3RM8A 3ARVA 1HKJA 1NWSA 3WH0A 3UI6A 1KT0A 2XP3A 3CHEA 5HT1A 1BKFA 4W9QA 2AOSA 3ARYA 1LG2A 2Y78A 1W1TA 1D7JA 2F4EA 3KABA 5GQBA 2PPNA 3TCZA 4DRHA 4LGXA 4JFMA 4JFJA 2O92A 4TW6A 1IX5A 1K9TA 1GUVA 4J4OA 5GPGA 1YW5A 4Z2HA 4QT2A 2A3CA 3QOKA 1ZBVA 3WQVA 1FAPA 2LKNA 2FDMA 3MDYB 1J4IA 2MLZA 3CHFA 2ITKA 2RUCA 1HKIA 1KFWA 1JNSA 3JYMA 4HBOA 3IK8A 2VCDA 2YBTA 3FAPA 3JXVA 1X6NA 4FN2A 2FAPA 5HBFA 3ARPA 2ZQVA 4JYSA 4R0XA 4DZ3A 1LG1A 3AS2A 3PRAA 3TC5A 4ZPTR 4JFLA 1L1PA 1FFQA 3KAGA 2OLHA 3UQBA 2DT3A 1NMVA 1Q6UA 4W9OA 2RSEA 4HARA 4KR0B 3H9RB 4P8VA 4JFIA 1SR0A 2K8IA 4IT6A 4PTMA 5D75A 4KQZA 3O5GA 3O5LA 4L72B 3ARWA 1LL7A 1JNEA 1P5QA 4MSPA 4LAVA 1D2KA 3RFWA 1Y0OA 1HKMA 4R5EA 3CH9A 5JH8A 1QZ2A 4DRKA 2MPHA 1KT1A 2LJ4A 1H0GA 2PI6A 3ALFA 1EIBA 2RUQA 4WK9A 1FKKA 2DPEA 3WD0A 2N87A 1D7HA 1U79A 2PV1A 4NSBA 3CHCA 4IPXA 4WKAA 1W1PA 1LL4A 1YATA 4MAVA 2FKEA 2ZQSA 3PRBA 3KZ7A 3KAIA 2ZR6A 4DZ2A 1NMWA 2F2DA 2RUDA 2A3BA 2WM0A 1FKRA 2KI3A 3ARQA 4ZPWR 1FKIA 5HW8A 3OOBA 1HJVA 1QPFA 2KFWA 1M5YA 3O5RA 1TFVA 2OFNA 1UR9A 4AY1A 4ITZA 4ZPVR 3AS3A 3O5OA 1EDQA 1GPFA 2PBCA 4ODLA 1W9UA 1E9LA 4Z2KA 4DRNA 3VAWA 3PRDA 3RM4A 3I6CA 1J4HA 4IT4A 2RQSA 2WLZA 2DG3A 4ODQA 3ARRA 1ZK6A 4WKHA 4ODKA 3UI5A 4DH0A 4DRMA 3UQIA 1Q6HA 1GOIA 2XP4A 1XHGA 4MTVA 4NNRA 5HTGA 4FAPA 4TNSA 4MNLA 5HW6A 2KGJA 1Q6IA 2IF4A 4S3KA 1WAWA 5HW7A 2DT0A 3G6MA 1FKDA 4MGVA 3W4RA 2KO7A 2XPAA 4S3JA 1FJDA 3IKGA 4XAKA 2F21A 2XP7A 3ARSA 3LUOA 1A7XA 3AROA 2VN1A 5DIVA 3WD4A 1O6IA 3ALGA 1OGGA 3PA7A 2DSWA 1PBKA 2M2AA 3PR9A 4DWSD 4P8XA 3O5JA 3AS1A 3WD2A 1B6CA 4DIPA 4QZVB 3O5PA 1JNDA 1ZBKA 4W5UA 1LQ0A 3OA5A 2PV3A 2XP8A 3BXWA 3B8SA 1J6YA 4U84A 2L2SA 5DIUA 2DSZA 3EY6A 4QT3A 3WD1A 4ZS6A 1HXVA 4Z2JA 4W9PA 4N19A 1HKKA 3KACA 4O2TA 1W9PA 3RM9A 4NZCA 2PPPA 2UZ5A 3O5IA 4Z2LA 1TCOC 2O9OA 1FKBA 1LJYA 2MLXA 1N1AA 3NI6A 1LL6A 4DWSA 2DG4A 2G41A 2G8ZA 1NWTA 1PINA 3IKDA 4DROA 1C9HA 1ZB5A 1W9VA 4ODPA 1D6OA 1F8AB 4C02B 1FD9A 1FKSA 2QF8A 3ODKA 1ROTA 1D7IA 4L3NA 1ITXA 4DRQA 1J4RA 4WJXA 4ODRA 5DF0A 1CTNA 4P8WA 1EQ3A 5DITA 3KADA 3KCEA 2XP5A 1XRVA 2XP6A 1FKTA 2WLYA 2M1IA 4DWSC 4IQCA 3RMEA 2DSUA 4GIVA 4LAWA 3RGCA 5B8IC 1WB0A 2IUZA 4TW8A 2JZVA 4DRJA 1FKLA 4LAYA 3CGNA 5J6EA 1JNTA 4LAXA 2MNTA 1ZBWA 1ROUA 5HKGA 4DRIA 3ARTA 3TDBA 4G2PA 4BF8A 2M08A 2ZR4A 1H0IA 2Q5AA 1ZCNA 2ZR5A 4Z2IA 1HJXA 3IHZA 5I98A 2DG9A 1W26A 1W1YA 3FXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBE A;  4HAR A;  4HBO A; 
#chains in the Genus database with same CATH topology
 4U85 A;  3O5F A;  2PPO A;  3ARX A;  1OGB A;  3B9E A;  5DO2 A;  3O5D A;  3UI4 A;  1NWU A;  3WKZ A;  2DSV A;  5HUA A;  1W1V A;  2LGO A;  1Q1C A;  1EHN A;  2ESC A;  3CGM A;  2A3E A;  3WQW A;  4Q22 A;  5DEZ A;  3B9A A;  2AWG A;  1R9H A;  3O5K A;  3B9D A;  5HWC A;  4IQ2 A;  1GRJ A;  2YBU A;  3B7X A;  1BL4 A;  4DWS B;  3KAF A;  2PV2 A;  4HBE A;  1JVW A;  1VF8 A;  4U86 A;  4J4N A;  4Z2G A;  3UQA A;  2WK2 A;  2ETN A;  3O5M A;  3WD3 A;  3CZ8 A;  3O5Q A;  2A3A A;  1ZBC A;  1FKG A;  4JFK A;  2ZQT A;  4TYO A;  3CHD A;  3ARZ A;  1NSG A;  3O5E A;  4DT4 A;  4ODO A;  1OWQ A;  3UF8 A;  3AQU A;  1RD6 A;  1T11 A;  3NRK A;  1E6P A;  1HJW A;  4ODN A;  3G6L A;  4MPK A;  4QIB A;  3KAH A;  1E6Z A;  1WNO A;  1UR8 A;  1EYM A;  4WKF A;  1NH6 A;  2KR7 A;  3WIJ A;  1E15 A;  5HWB A;  5BXJ A;  1F40 A;  4MNM A;  4MNK A;  4ODM A;  4DRP A;  2XP9 A;  4MNJ A;  1QPL A;  3WL1 A;  2ZQU A;  1SYT A;  4Q7N A;  3FY1 A;  3JYJ A;  4ML4 A;  3WL0 A;  4TW7 A;  2KE0 A;  2MLY A;  1ZL1 A;  3ARU A;  1FKF A;  1E6R A;  3AS0 A;  2LPV A;  2D9F A;  4P8U A;  1ZU8 A;  4URI A;  2DT1 A;  2P4V A;  1X6L A;  5GPR A;  3EIP A;  4WIW A;  2B31 A;  1FFR A;  1NWR A;  4GGQ A;  3NTP A;  1FKH A;  1E6N A;  4G50 A;  1FKJ A;  2RUR A;  4TX0 A;  2DT2 A;  2MF9 A;  3GPK A;  2XPB A;  3GU0 A;  3RM8 A;  3ARV A;  1HKJ A;  1NWS A;  3WH0 A;  3UI6 A;  1KT0 A;  2XP3 A;  3CHE A;  5HT1 A;  1BKF A;  4W9Q A;  2AOS A;  3ARY A;  1LG2 A;  2Y78 A;  4UDM A;  1W1T A;  1D7J A;  2F4E A;  3KAB A;  5GQB A;  2PPN A;  3TCZ A;  4DRH A;  4LGX A;  4JFM A;  4JFJ A;  2O92 A;  4TW6 A;  1IX5 A;  1K9T A;  1GUV A;  4J4O A;  5GPG A;  1YW5 A;  4Z2H A;  4QT2 A;  2A3C A;  3QOK A;  1ZBV A;  3WQV A;  3GTY X;  1FAP A;  2LKN A;  2FDM A;  2F23 A;  3MDY B;  1J4I A;  2MLZ A;  3CHF A;  2ITK A;  2RUC A;  1HKI A;  1KFW A;  1JNS A;  3JYM A;  4HBO A;  3IK8 A;  2VCD A;  2YBT A;  3FAP A;  3JXV A;  1X6N A;  4FN2 A;  2FAP A;  5HBF A;  3ARP A;  2ZQV A;  4JYS A;  4R0X A;  4DZ3 A;  1LG1 A;  3AS2 A;  3PRA A;  3TC5 A;  4ZPT R;  4JFL A;  1L1P A;  1FFQ A;  3KAG A;  2OLH A;  3UQB A;  2DT3 A;  1NMV A;  1Q6U A;  4W9O A;  2RSE A;  4HAR A;  4KR0 B;  3H9R B;  4P8V A;  4JFI A;  1SR0 A;  2K8I A;  4IT6 A;  4PTM A;  5D75 A;  4KQZ A;  3O5G A;  3O5L A;  4L72 B;  3ARW A;  1LL7 A;  1JNE A;  1P5Q A;  4MSP A;  4LAV A;  1D2K A;  3RFW A;  1Y0O A;  1HKM A;  4R5E A;  3CH9 A;  5JH8 A;  1QZ2 A;  4DRK A;  2MPH A;  1KT1 A;  2LJ4 A;  1H0G A;  2PI6 A;  3ALF A;  1EIB A;  2RUQ A;  4WK9 A;  1FKK A;  2DPE A;  3WD0 A;  2N87 A;  1D7H A;  1U79 A;  2PV1 A;  4NSB A;  3CHC A;  4IPX A;  4WKA A;  1W1P A;  1LL4 A;  1YAT A;  4MAV A;  2FKE A;  2ZQS A;  3PRB A;  3KZ7 A;  3KAI A;  2ZR6 A;  4DZ2 A;  1NMW A;  2F2D A;  2RUD A;  2A3B A;  2WM0 A;  1FKR A;  2KI3 A;  3ARQ A;  4ZPW R;  1FKI A;  5HW8 A;  1E44 A;  3OOB A;  1HJV A;  1QPF A;  2KFW A;  1M5Y A;  3O5R A;  1TFV A;  2OFN A;  1UR9 A;  4AY1 A;  4ITZ A;  4ZPV R;  3AS3 A;  3O5O A;  1EDQ A;  1GPF A;  2PBC A;  4ODL A;  1W9U A;  1E9L A;  4Z2K A;  4DRN A;  3VAW A;  3PRD A;  3RM4 A;  3I6C A;  1J4H A;  4IT4 A;  2RQS A;  2WLZ A;  2DG3 A;  4ODQ A;  3ARR A;  1ZK6 A;  4WKH A;  4ODK A;  3UI5 A;  4DH0 A;  4DRM A;  3UQI A;  1Q6H A;  1GOI A;  2XP4 A;  1XHG A;  4MTV A;  4NNR A;  5HTG A;  4FAP A;  4TNS A;  4MNL A;  5HW6 A;  2KGJ A;  1Q6I A;  2IF4 A;  4S3K A;  1WAW A;  5HW7 A;  2DT0 A;  3G6M A;  1FKD A;  4MGV A;  3W4R A;  2KO7 A;  2XPA A;  4S3J A;  1FJD A;  3IKG A;  4XAK A;  2F21 A;  2EUL A;  2XP7 A;  3ARS A;  2PN0 A;  3LUO A;  1A7X A;  3ARO A;  2VN1 A;  5DIV A;  3WD4 A;  1O6I A;  3ALG A;  1OGG A;  3PA7 A;  2DSW A;  1PBK A;  2M2A A;  3BMB A;  3PR9 A;  4DWS D;  4P8X A;  3O5J A;  3AS1 A;  3WD2 A;  1B6C A;  4DIP A;  4QZV B;  3O5P A;  1JND A;  1ZBK A;  4W5U A;  1LQ0 A;  2B5U B;  3OA5 A;  2PV3 A;  2XP8 A;  3BXW A;  3B8S A;  1J6Y A;  4U84 A;  2L2S A;  5DIU A;  2DSZ A;  3EY6 A;  4QT3 A;  3WD1 A;  4ZS6 A;  1HXV A;  4Z2J A;  4W9P A;  4N19 A;  1HKK A;  3KAC A;  4O2T A;  1W9P A;  3RM9 A;  4NZC A;  2PPP A;  2UZ5 A;  3O5I A;  4Z2L A;  1TCO C;  2O9O A;  1FKB A;  1LJY A;  2MLX A;  1N1A A;  3NI6 A;  1LL6 A;  4DWS A;  2DG4 A;  2G41 A;  2G8Z A;  1NWT A;  1PIN A;  3IKD A;  4DRO A;  1C9H A;  1ZB5 A;  1W9V A;  4ODP A;  1D6O A;  1F8A B;  4C02 B;  1FD9 A;  1FKS A;  2QF8 A;  3ODK A;  1ROT A;  1D7I A;  4L3N A;  1ITX A;  4DRQ A;  1J4R A;  4WJX A;  4ODR A;  5DF0 A;  1CTN A;  4P8W A;  1EQ3 A;  5DIT A;  3KAD A;  3KCE A;  2XP5 A;  1XRV A;  2XP6 A;  1FKT A;  1JCH B;  2WLY A;  2M1I A;  4DWS C;  4IQC A;  3RME A;  2DSU A;  4GIV A;  4LAW A;  3RGC A;  5B8I C;  1WB0 A;  2IUZ A;  4TW8 A;  2JZV A;  4DRJ A;  1FKL A;  4LAY A;  3CGN A;  5J6E A;  1JNT A;  4LAX A;  2MNT A;  1ZBW A;  1ROU A;  5HKG A;  4DRI A;  3ART A;  3TDB A;  4G2P A;  4BF8 A;  2M08 A;  2ZR4 A;  1H0I A;  2Q5A A;  1ZCN A;  2ZR5 A;  4Z2I A;  1HJX A;  3IHZ A;  5I98 A;  2DG9 A;  1W26 A;  1W1Y A;  3FXY A; 
#chains in the Genus database with same CATH homology
 4U85 A;  3O5F A;  2PPO A;  3ARX A;  1OGB A;  3B9E A;  5DO2 A;  3O5D A;  3UI4 A;  1NWU A;  3WKZ A;  2DSV A;  5HUA A;  1W1V A;  2LGO A;  1Q1C A;  1EHN A;  2ESC A;  3CGM A;  2A3E A;  3WQW A;  4Q22 A;  5DEZ A;  3B9A A;  2AWG A;  1R9H A;  3O5K A;  3B9D A;  5HWC A;  4IQ2 A;  2YBU A;  3B7X A;  1BL4 A;  4DWS B;  3KAF A;  2PV2 A;  4HBE A;  1JVW A;  1VF8 A;  4U86 A;  4J4N A;  4Z2G A;  3UQA A;  2WK2 A;  3O5M A;  3WD3 A;  3CZ8 A;  3O5Q A;  2A3A A;  1ZBC A;  1FKG A;  4JFK A;  2ZQT A;  4TYO A;  3CHD A;  3ARZ A;  1NSG A;  3O5E A;  4DT4 A;  4ODO A;  1OWQ A;  3UF8 A;  3AQU A;  1RD6 A;  1T11 A;  3NRK A;  1E6P A;  1HJW A;  4ODN A;  3G6L A;  4MPK A;  4QIB A;  3KAH A;  1E6Z A;  1WNO A;  1UR8 A;  1EYM A;  4WKF A;  1NH6 A;  2KR7 A;  3WIJ A;  1E15 A;  5HWB A;  5BXJ A;  1F40 A;  4MNM A;  4MNK A;  4ODM A;  4DRP A;  2XP9 A;  4MNJ A;  1QPL A;  3WL1 A;  2ZQU A;  1SYT A;  4Q7N A;  3FY1 A;  3JYJ A;  4ML4 A;  3WL0 A;  4TW7 A;  2KE0 A;  2MLY A;  1ZL1 A;  3ARU A;  1FKF A;  1E6R A;  3AS0 A;  2LPV A;  2D9F A;  4P8U A;  1ZU8 A;  4URI A;  2DT1 A;  1X6L A;  5GPR A;  4WIW A;  2B31 A;  1FFR A;  1NWR A;  4GGQ A;  3NTP A;  1FKH A;  1E6N A;  4G50 A;  1FKJ A;  2RUR A;  4TX0 A;  2DT2 A;  2MF9 A;  3GPK A;  2XPB A;  3RM8 A;  3ARV A;  1HKJ A;  1NWS A;  3WH0 A;  3UI6 A;  1KT0 A;  2XP3 A;  3CHE A;  5HT1 A;  1BKF A;  4W9Q A;  2AOS A;  3ARY A;  1LG2 A;  2Y78 A;  1W1T A;  1D7J A;  2F4E A;  3KAB A;  5GQB A;  2PPN A;  3TCZ A;  4DRH A;  4LGX A;  4JFM A;  4JFJ A;  2O92 A;  4TW6 A;  1IX5 A;  1K9T A;  1GUV A;  4J4O A;  5GPG A;  1YW5 A;  4Z2H A;  4QT2 A;  2A3C A;  3QOK A;  1ZBV A;  3WQV A;  1FAP A;  2LKN A;  2FDM A;  3MDY B;  1J4I A;  2MLZ A;  3CHF A;  2ITK A;  2RUC A;  1HKI A;  1KFW A;  1JNS A;  3JYM A;  4HBO A;  3IK8 A;  2VCD A;  2YBT A;  3FAP A;  3JXV A;  1X6N A;  4FN2 A;  2FAP A;  5HBF A;  3ARP A;  2ZQV A;  4JYS A;  4R0X A;  4DZ3 A;  1LG1 A;  3AS2 A;  3PRA A;  3TC5 A;  4ZPT R;  4JFL A;  1L1P A;  1FFQ A;  3KAG A;  2OLH A;  3UQB A;  2DT3 A;  1NMV A;  1Q6U A;  4W9O A;  2RSE A;  4HAR A;  4KR0 B;  3H9R B;  4P8V A;  4JFI A;  1SR0 A;  2K8I A;  4IT6 A;  4PTM A;  5D75 A;  4KQZ A;  3O5G A;  3O5L A;  4L72 B;  3ARW A;  1LL7 A;  1JNE A;  1P5Q A;  4MSP A;  4LAV A;  1D2K A;  3RFW A;  1Y0O A;  1HKM A;  4R5E A;  3CH9 A;  5JH8 A;  1QZ2 A;  4DRK A;  2MPH A;  1KT1 A;  2LJ4 A;  1H0G A;  2PI6 A;  3ALF A;  1EIB A;  2RUQ A;  4WK9 A;  1FKK A;  2DPE A;  3WD0 A;  2N87 A;  1D7H A;  1U79 A;  2PV1 A;  4NSB A;  3CHC A;  4IPX A;  4WKA A;  1W1P A;  1LL4 A;  1YAT A;  4MAV A;  2FKE A;  2ZQS A;  3PRB A;  3KZ7 A;  3KAI A;  2ZR6 A;  4DZ2 A;  1NMW A;  2F2D A;  2RUD A;  2A3B A;  2WM0 A;  1FKR A;  2KI3 A;  3ARQ A;  4ZPW R;  1FKI A;  5HW8 A;  3OOB A;  1HJV A;  1QPF A;  2KFW A;  1M5Y A;  3O5R A;  1TFV A;  2OFN A;  1UR9 A;  4AY1 A;  4ITZ A;  4ZPV R;  3AS3 A;  3O5O A;  1EDQ A;  1GPF A;  2PBC A;  4ODL A;  1W9U A;  1E9L A;  4Z2K A;  4DRN A;  3VAW A;  3PRD A;  3RM4 A;  3I6C A;  1J4H A;  4IT4 A;  2RQS A;  2WLZ A;  2DG3 A;  4ODQ A;  3ARR A;  1ZK6 A;  4WKH A;  4ODK A;  3UI5 A;  4DH0 A;  4DRM A;  3UQI A;  1Q6H A;  1GOI A;  2XP4 A;  1XHG A;  4MTV A;  4NNR A;  5HTG A;  4FAP A;  4TNS A;  4MNL A;  5HW6 A;  2KGJ A;  1Q6I A;  2IF4 A;  4S3K A;  1WAW A;  5HW7 A;  2DT0 A;  3G6M A;  1FKD A;  4MGV A;  3W4R A;  2KO7 A;  2XPA A;  4S3J A;  1FJD A;  3IKG A;  4XAK A;  2F21 A;  2XP7 A;  3ARS A;  3LUO A;  1A7X A;  3ARO A;  2VN1 A;  5DIV A;  3WD4 A;  1O6I A;  3ALG A;  1OGG A;  3PA7 A;  2DSW A;  1PBK A;  2M2A A;  3PR9 A;  4DWS D;  4P8X A;  3O5J A;  3AS1 A;  3WD2 A;  1B6C A;  4DIP A;  4QZV B;  3O5P A;  1JND A;  1ZBK A;  4W5U A;  1LQ0 A;  3OA5 A;  2PV3 A;  2XP8 A;  3BXW A;  3B8S A;  1J6Y A;  4U84 A;  2L2S A;  5DIU A;  2DSZ A;  3EY6 A;  4QT3 A;  3WD1 A;  4ZS6 A;  1HXV A;  4Z2J A;  4W9P A;  4N19 A;  1HKK A;  3KAC A;  4O2T A;  1W9P A;  3RM9 A;  4NZC A;  2PPP A;  2UZ5 A;  3O5I A;  4Z2L A;  1TCO C;  2O9O A;  1FKB A;  1LJY A;  2MLX A;  1N1A A;  3NI6 A;  1LL6 A;  4DWS A;  2DG4 A;  2G41 A;  2G8Z A;  1NWT A;  1PIN A;  3IKD A;  4DRO A;  1C9H A;  1ZB5 A;  1W9V A;  4ODP A;  1D6O A;  1F8A B;  4C02 B;  1FD9 A;  1FKS A;  2QF8 A;  3ODK A;  1ROT A;  1D7I A;  4L3N A;  1ITX A;  4DRQ A;  1J4R A;  4WJX A;  4ODR A;  5DF0 A;  1CTN A;  4P8W A;  1EQ3 A;  5DIT A;  3KAD A;  3KCE A;  2XP5 A;  1XRV A;  2XP6 A;  1FKT A;  2WLY A;  2M1I A;  4DWS C;  4IQC A;  3RME A;  2DSU A;  4GIV A;  4LAW A;  3RGC A;  5B8I C;  1WB0 A;  2IUZ A;  4TW8 A;  2JZV A;  4DRJ A;  1FKL A;  4LAY A;  3CGN A;  5J6E A;  1JNT A;  4LAX A;  2MNT A;  1ZBW A;  1ROU A;  5HKG A;  4DRI A;  3ART A;  3TDB A;  4G2P A;  4BF8 A;  2M08 A;  2ZR4 A;  1H0I A;  2Q5A A;  1ZCN A;  2ZR5 A;  4Z2I A;  1HJX A;  3IHZ A;  5I98 A;  2DG9 A;  1W26 A;  1W1Y A;  3FXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...