4HBOA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
96
structure length
79
Chain Sequence
EACVTSWLWSEGEGAVFYRVDLHFTMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 8
structure length 79
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hboA00
4HBOA 4HBEA 4HARA
chains in the Genus database with same CATH superfamily
1SR0A 4L3NA 3FXYA 2A3BA 2N87A 1X6LA 2ZQTA 4P8UA 4WJXA 3WIJA 4LAVA 1FKBA 2F23A 2OLHA 4Z2JA 5HW7A 1OGGA 4DRQA 2KR7A 4P8VA 3KCEA 4IT4A 2Y78A 4J4NA 3ARWA 3ARSA 1W1TA 3BXWA 2PV1A 1OWQA 1NSGA 3H9RB 1D7HA 1ZK6A 1QZ2A 1U79A 1KFWA 2XP9A 3ALFA 5BXJA 1LL7A 1ZB5A 4IT6A 4QT3A 2RUCA 4Z2KA 3AS3A 4IPXA 4U86A 5GQBA 2MNTA 5JH8A 1Q1CA 2DT0A 4TW8A 4ZPTR 5HUAA 2VN1A 1E15A 1PBKA 1ZBCA 4L72B 2O9OA 2G41A 1HKKA 4KQZA 3KAIA 3ARVA 4W9PA 1X6NA 4Z2HA 1TFVA 2JZVA 3ARQA 1F40A 3GU0A 1CTNA 3KACA 1QPLA 2RUDA 1NWRA 1WAWA 3CHFA 3WH0A 5HKGA 3ARUA 2KI3A 2AOSA 4UDMA 3B7XA 4DZ3A 4JFIA 1HXVA 1EQ3A 1GPFA 2ESCA 2RQSA 3O5JA 1GRJA 3TC5A 1FFRA 2FDMA 4P8XA 4MNJA 1E6ZA 2PPOA 3UI4A 3O5MA 4DWSD 4WKFA 3CHEA 2ZQUA 2KO7A 2A3EA 2DPEA 2DSVA 2F21A 1C9HA 2KGJA 2XP7A 1A7XA 4QIBA 1IX5A 3O5EA 1JNTA 1FKRA 3TDBA 4DRKA 4FAPA 3PRDA 3PRAA 3KAGA 3WKZA 1EHNA 3TCZA 4DRMA 3EY6A 5DEZA 1QPFA 1W9UA 4LAXA 4XAKA 5J6EA 5HT1A 3WQWA 1FKJA 1E6RA 4Q7NA 2ETNA 4WK9A 1LL6A 4DH0A 3ALGA 1FFQA 3WD0A 2IF4A 2MF9A 1NMVA 4ODMA 3UF8A 4MNKA 4JFJA 1N1AA 4DWSC 1UR9A 4Z2IA 3JXVA 5DO2A 1ITXA 1EDQA 4DRJA 1FKLA 1PINA 1Q6IA 2IUZA 5HWBA 2ZR5A 3CGMA 3CHCA 4DRPA 3ARTA 4ODLA 1P5QA 4URIA 2RUQA 1WNOA 4MTVA 1FD9A 4WKAA 1J6YA 1HJWA 4JFKA 5GPGA 1JVWA 2A3AA 1LQ0A 3KABA 2O92A 5GPRA 4DRHA 2FKEA 2UZ5A 4DZ2A 4IQ2A 4MNLA 2B31A 3AS1A 4Z2LA 2M2AA 3WL1A 3NI6A 4DRIA 1NWUA 1NWTA 1HKIA 2DSUA 2YBTA 4BF8A 2DSZA 2XPAA 3GTYX 3OA5A 2PN0A 2ZQSA 2ZR4A 4TX0A 1E44A 2ZR6A 1JNDA 2VCDA 2KE0A 1JCHB 1D6OA 4P8WA 2PPPA 3OOBA 3PRBA 1ZCNA 1TCOC 1OGBA 3GPKA 1NH6A 1ZU8A 1VF8A 4W9OA 5HTGA 3RM9A 4ODPA 1ROUA 4Z2GA 1FKIA 4ODKA 1D2KA 2DSWA 2DT1A 3O5LA 2KFWA 4J4OA 1YATA 3O5FA 3RGCA 3AS0A 4JYSA 1E9LA 4HBOA 1FKFA 1J4HA 2M08A 3JYMA 3B9EA 1K9TA 1YW5A 1JNEA 3O5IA 1NMWA 2A3CA 4LGXA 2XP8A 4ZS6A 1GOIA 3ARPA 2DG3A 3KAHA 3FY1A 4DT4A 2LKNA 4LAWA 2M1IA 2P4VA 4MNMA 1HJVA 3FAPA 2XP6A 4S3KA 5DIUA 2MLZA 1HJXA 1NWSA 2LPVA 1ZL1A 4GGQA 4ZPVR 2K8IA 4ODNA 4DROA 5DIVA 1SYTA 1W26A 2D9FA 2WLYA 2WLZA 3RM8A 2YBUA 4G2PA 1D7JA 1Q6UA 4LAYA 2MLYA 3ARXA 3KZ7A 4O2TA 3IKDA 3CHDA 2OFNA 1B6CA 3WD4A 3NRKA 4W5UA 1FKSA 1W9VA 1FKHA 5HBFA 5I98A 4U84A 3B9DA 4ML4A 3NTPA 2RSEA 3O5RA 3CGNA 1J4RA 1W1YA 2MLXA 1FAPA 3WD2A 3I6CA 4NSBA 4TW7A 3MDYB 4R5EA 3AROA 3UQAA 3B9AA 2DT2A 3VAWA 2PPNA 1XHGA 3O5KA 2AWGA 2FAPA 4C02B 4U85A 1ZBKA 2XP3A 5HW8A 1HKMA 3QOKA 4KR0B 5DITA 3UI6A 2PV2A 1Q6HA 3PR9A 4MPKA 4QZVB 4QT2A 1FJDA 2MPHA 1J4IA 4DWSB 2PI6A 3O5OA 1WB0A 4DWSA 1Y0OA 2ZQVA 4PTMA 1W9PA 1BKFA 2XP5A 4TW6A 1LG2A 1R9HA 3G6MA 1XRVA 3W4RA 3B8SA 3O5GA 3BMBA 3JYJA 3KAFA 3KADA 3RFWA 4W9QA 4HBEA 1GUVA 4JFLA 2LGOA 4WKHA 2ITKA 2B5UB 4TNSA 4TYOA 2F2DA 3ARYA 1FKDA 2WM0A 2DT3A 4NNRA 4WIWA 1H0GA 3IHZA 4AY1A 2PBCA 5D75A 3WL0A 3CH9A 1LG1A 4S3JA 1BL4A 2EULA 3IK8A 1H0IA 3LUOA 1HKJA 3CZ8A 2LJ4A 1O6IA 4FN2A 1F8AB 3G6LA 3ARZA 2QF8A 5DF0A 1FKKA 2WK2A 4DRNA 3WD3A 5HW6A 3UQBA 3AS2A 4GIVA 1JNSA 1FKGA 3IKGA 4MGVA 3UI5A 3AQUA 4MAVA 1E6NA 2F4EA 4ODRA 3UQIA 2DG4A 3ARRA 4ITZA 5B8IC 1M5YA 3O5DA 4DIPA 4Q22A 3O5PA 2RURA 1LJYA 3RMEA 1E6PA 2XP4A 4N19A 2XPBA 5HWCA 3WD1A 1ROTA 1RD6A 4MSPA 4ODOA 3O5QA 1T11A 1KT1A 1L1PA 3RM4A 3WQVA 4NZCA 3ODKA 2G8ZA 4G50A 1EIBA 4ZPWR 2PV3A 4JFMA 1UR8A 2DG9A 2L2SA 4HARA 3EIPA 3PA7A 1W1PA 4ODQA 1FKTA 4IQCA 1KT0A 4R0XA 1ZBWA 1LL4A 2Q5AA 1W1VA 1D7IA 1EYMA 1ZBVA
chains in the Genus database with same CATH topology
1SR0A 4L3NA 3FXYA 2A3BA 2N87A 1X6LA 2ZQTA 4P8UA 4WJXA 3WIJA 4LAVA 1FKBA 2OLHA 4Z2JA 5HW7A 1OGGA 4DRQA 2KR7A 4P8VA 3KCEA 4IT4A 2Y78A 4J4NA 3ARWA 3ARSA 1W1TA 3BXWA 2PV1A 1OWQA 1NSGA 3H9RB 1D7HA 1ZK6A 1QZ2A 1U79A 1KFWA 2XP9A 3ALFA 5BXJA 1LL7A 1ZB5A 4IT6A 4QT3A 2RUCA 4Z2KA 3AS3A 4IPXA 4U86A 5GQBA 2MNTA 5JH8A 1Q1CA 2DT0A 4TW8A 4ZPTR 5HUAA 2VN1A 1E15A 1PBKA 1ZBCA 4L72B 2O9OA 2G41A 1HKKA 4KQZA 3KAIA 3ARVA 4W9PA 1X6NA 4Z2HA 1TFVA 2JZVA 3ARQA 1F40A 1CTNA 3KACA 1QPLA 2RUDA 1NWRA 1WAWA 3CHFA 3WH0A 5HKGA 3ARUA 2KI3A 2AOSA 3B7XA 4DZ3A 4JFIA 1HXVA 1EQ3A 1GPFA 2ESCA 2RQSA 3O5JA 3TC5A 1FFRA 2FDMA 4P8XA 4MNJA 1E6ZA 2PPOA 3UI4A 3O5MA 4DWSD 4WKFA 3CHEA 2ZQUA 2KO7A 2A3EA 2DPEA 2DSVA 2F21A 1C9HA 2KGJA 2XP7A 1A7XA 4QIBA 1IX5A 3O5EA 1JNTA 1FKRA 3TDBA 4DRKA 4FAPA 3PRDA 3PRAA 3KAGA 3WKZA 1EHNA 3TCZA 4DRMA 3EY6A 5DEZA 1QPFA 1W9UA 4LAXA 4XAKA 5J6EA 5HT1A 3WQWA 1FKJA 1E6RA 4Q7NA 4WK9A 1LL6A 4DH0A 3ALGA 1FFQA 3WD0A 2IF4A 2MF9A 1NMVA 4ODMA 3UF8A 4MNKA 4JFJA 1N1AA 4DWSC 1UR9A 4Z2IA 3JXVA 5DO2A 1ITXA 1EDQA 4DRJA 1FKLA 1PINA 1Q6IA 2IUZA 5HWBA 2ZR5A 3CGMA 3CHCA 4DRPA 3ARTA 4ODLA 1P5QA 4URIA 2RUQA 1WNOA 4MTVA 1FD9A 4WKAA 1J6YA 1HJWA 4JFKA 5GPGA 1JVWA 2A3AA 1LQ0A 3KABA 2O92A 5GPRA 4DRHA 2FKEA 2UZ5A 4DZ2A 4IQ2A 4MNLA 2B31A 3AS1A 4Z2LA 2M2AA 3WL1A 3NI6A 4DRIA 1NWUA 1NWTA 1HKIA 2DSUA 2YBTA 4BF8A 2DSZA 2XPAA 3OA5A 2ZQSA 2ZR4A 4TX0A 2ZR6A 1JNDA 2VCDA 2KE0A 1D6OA 4P8WA 2PPPA 3OOBA 3PRBA 1ZCNA 1TCOC 1OGBA 3GPKA 1NH6A 1ZU8A 1VF8A 4W9OA 5HTGA 3RM9A 4ODPA 1ROUA 4Z2GA 1FKIA 4ODKA 1D2KA 2DSWA 2DT1A 3O5LA 2KFWA 4J4OA 1YATA 3O5FA 3RGCA 3AS0A 4JYSA 1E9LA 4HBOA 1FKFA 1J4HA 2M08A 3JYMA 3B9EA 1K9TA 1YW5A 1JNEA 3O5IA 1NMWA 2A3CA 4LGXA 2XP8A 4ZS6A 1GOIA 3ARPA 2DG3A 3KAHA 3FY1A 4DT4A 2LKNA 4LAWA 2M1IA 4MNMA 1HJVA 3FAPA 2XP6A 4S3KA 5DIUA 2MLZA 1HJXA 1NWSA 2LPVA 1ZL1A 4GGQA 4ZPVR 2K8IA 4ODNA 4DROA 5DIVA 1SYTA 1W26A 2D9FA 2WLYA 2WLZA 3RM8A 2YBUA 4G2PA 1D7JA 1Q6UA 4LAYA 2MLYA 3ARXA 3KZ7A 4O2TA 3IKDA 3CHDA 2OFNA 1B6CA 3WD4A 3NRKA 4W5UA 1FKSA 1W9VA 1FKHA 5HBFA 5I98A 4U84A 3B9DA 4ML4A 3NTPA 2RSEA 3O5RA 3CGNA 1J4RA 1W1YA 2MLXA 1FAPA 3WD2A 3I6CA 4NSBA 4TW7A 3MDYB 4R5EA 3AROA 3UQAA 3B9AA 2DT2A 3VAWA 2PPNA 1XHGA 3O5KA 2AWGA 2FAPA 4C02B 4U85A 1ZBKA 2XP3A 5HW8A 1HKMA 3QOKA 4KR0B 5DITA 3UI6A 2PV2A 1Q6HA 3PR9A 4MPKA 4QZVB 4QT2A 1FJDA 2MPHA 1J4IA 4DWSB 2PI6A 3O5OA 1WB0A 4DWSA 1Y0OA 2ZQVA 4PTMA 1W9PA 1BKFA 2XP5A 4TW6A 1LG2A 1R9HA 3G6MA 1XRVA 3W4RA 3B8SA 3O5GA 3JYJA 3KAFA 3KADA 3RFWA 4W9QA 4HBEA 1GUVA 4JFLA 2LGOA 4WKHA 2ITKA 4TNSA 4TYOA 2F2DA 3ARYA 1FKDA 2WM0A 2DT3A 4NNRA 4WIWA 1H0GA 3IHZA 4AY1A 2PBCA 5D75A 3WL0A 3CH9A 1LG1A 4S3JA 1BL4A 3IK8A 1H0IA 3LUOA 1HKJA 3CZ8A 2LJ4A 1O6IA 4FN2A 1F8AB 3G6LA 3ARZA 2QF8A 5DF0A 1FKKA 2WK2A 4DRNA 3WD3A 5HW6A 3UQBA 3AS2A 4GIVA 1JNSA 1FKGA 3IKGA 4MGVA 3UI5A 3AQUA 4MAVA 1E6NA 2F4EA 4ODRA 3UQIA 2DG4A 3ARRA 4ITZA 5B8IC 1M5YA 3O5DA 4DIPA 4Q22A 3O5PA 2RURA 1LJYA 3RMEA 1E6PA 2XP4A 4N19A 2XPBA 5HWCA 3WD1A 1ROTA 1RD6A 4MSPA 4ODOA 3O5QA 1T11A 1KT1A 1L1PA 3RM4A 3WQVA 4NZCA 3ODKA 2G8ZA 4G50A 1EIBA 4ZPWR 2PV3A 4JFMA 1UR8A 2DG9A 2L2SA 4HARA 3PA7A 1W1PA 4ODQA 1FKTA 4IQCA 1KT0A 4R0XA 1ZBWA 1LL4A 2Q5AA 1W1VA 1D7IA 1EYMA 1ZBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBO A;  4HBE A;  4HAR A; 
#chains in the Genus database with same CATH topology
 1SR0 A;  4L3N A;  3FXY A;  2A3B A;  2N87 A;  1X6L A;  2ZQT A;  4P8U A;  4WJX A;  3WIJ A;  4LAV A;  1FKB A;  2F23 A;  2OLH A;  4Z2J A;  5HW7 A;  1OGG A;  4DRQ A;  2KR7 A;  4P8V A;  3KCE A;  4IT4 A;  2Y78 A;  4J4N A;  3ARW A;  3ARS A;  1W1T A;  3BXW A;  2PV1 A;  1OWQ A;  1NSG A;  3H9R B;  1D7H A;  1ZK6 A;  1QZ2 A;  1U79 A;  1KFW A;  2XP9 A;  3ALF A;  5BXJ A;  1LL7 A;  1ZB5 A;  4IT6 A;  4QT3 A;  2RUC A;  4Z2K A;  3AS3 A;  4IPX A;  4U86 A;  5GQB A;  2MNT A;  5JH8 A;  1Q1C A;  2DT0 A;  4TW8 A;  4ZPT R;  5HUA A;  2VN1 A;  1E15 A;  1PBK A;  1ZBC A;  4L72 B;  2O9O A;  2G41 A;  1HKK A;  4KQZ A;  3KAI A;  3ARV A;  4W9P A;  1X6N A;  4Z2H A;  1TFV A;  2JZV A;  3ARQ A;  1F40 A;  3GU0 A;  1CTN A;  3KAC A;  1QPL A;  2RUD A;  1NWR A;  1WAW A;  3CHF A;  3WH0 A;  5HKG A;  3ARU A;  2KI3 A;  2AOS A;  4UDM A;  3B7X A;  4DZ3 A;  4JFI A;  1HXV A;  1EQ3 A;  1GPF A;  2ESC A;  2RQS A;  3O5J A;  1GRJ A;  3TC5 A;  1FFR A;  2FDM A;  4P8X A;  4MNJ A;  1E6Z A;  2PPO A;  3UI4 A;  3O5M A;  4DWS D;  4WKF A;  3CHE A;  2ZQU A;  2KO7 A;  2A3E A;  2DPE A;  2DSV A;  2F21 A;  1C9H A;  2KGJ A;  2XP7 A;  1A7X A;  4QIB A;  1IX5 A;  3O5E A;  1JNT A;  1FKR A;  3TDB A;  4DRK A;  4FAP A;  3PRD A;  3PRA A;  3KAG A;  3WKZ A;  1EHN A;  3TCZ A;  4DRM A;  3EY6 A;  5DEZ A;  1QPF A;  1W9U A;  4LAX A;  4XAK A;  5J6E A;  5HT1 A;  3WQW A;  1FKJ A;  1E6R A;  4Q7N A;  2ETN A;  4WK9 A;  1LL6 A;  4DH0 A;  3ALG A;  1FFQ A;  3WD0 A;  2IF4 A;  2MF9 A;  1NMV A;  4ODM A;  3UF8 A;  4MNK A;  4JFJ A;  1N1A A;  4DWS C;  1UR9 A;  4Z2I A;  3JXV A;  5DO2 A;  1ITX A;  1EDQ A;  4DRJ A;  1FKL A;  1PIN A;  1Q6I A;  2IUZ A;  5HWB A;  2ZR5 A;  3CGM A;  3CHC A;  4DRP A;  3ART A;  4ODL A;  1P5Q A;  4URI A;  2RUQ A;  1WNO A;  4MTV A;  1FD9 A;  4WKA A;  1J6Y A;  1HJW A;  4JFK A;  5GPG A;  1JVW A;  2A3A A;  1LQ0 A;  3KAB A;  2O92 A;  5GPR A;  4DRH A;  2FKE A;  2UZ5 A;  4DZ2 A;  4IQ2 A;  4MNL A;  2B31 A;  3AS1 A;  4Z2L A;  2M2A A;  3WL1 A;  3NI6 A;  4DRI A;  1NWU A;  1NWT A;  1HKI A;  2DSU A;  2YBT A;  4BF8 A;  2DSZ A;  2XPA A;  3GTY X;  3OA5 A;  2PN0 A;  2ZQS A;  2ZR4 A;  4TX0 A;  1E44 A;  2ZR6 A;  1JND A;  2VCD A;  2KE0 A;  1JCH B;  1D6O A;  4P8W A;  2PPP A;  3OOB A;  3PRB A;  1ZCN A;  1TCO C;  1OGB A;  3GPK A;  1NH6 A;  1ZU8 A;  1VF8 A;  4W9O A;  5HTG A;  3RM9 A;  4ODP A;  1ROU A;  4Z2G A;  1FKI A;  4ODK A;  1D2K A;  2DSW A;  2DT1 A;  3O5L A;  2KFW A;  4J4O A;  1YAT A;  3O5F A;  3RGC A;  3AS0 A;  4JYS A;  1E9L A;  4HBO A;  1FKF A;  1J4H A;  2M08 A;  3JYM A;  3B9E A;  1K9T A;  1YW5 A;  1JNE A;  3O5I A;  1NMW A;  2A3C A;  4LGX A;  2XP8 A;  4ZS6 A;  1GOI A;  3ARP A;  2DG3 A;  3KAH A;  3FY1 A;  4DT4 A;  2LKN A;  4LAW A;  2M1I A;  2P4V A;  4MNM A;  1HJV A;  3FAP A;  2XP6 A;  4S3K A;  5DIU A;  2MLZ A;  1HJX A;  1NWS A;  2LPV A;  1ZL1 A;  4GGQ A;  4ZPV R;  2K8I A;  4ODN A;  4DRO A;  5DIV A;  1SYT A;  1W26 A;  2D9F A;  2WLY A;  2WLZ A;  3RM8 A;  2YBU A;  4G2P A;  1D7J A;  1Q6U A;  4LAY A;  2MLY A;  3ARX A;  3KZ7 A;  4O2T A;  3IKD A;  3CHD A;  2OFN A;  1B6C A;  3WD4 A;  3NRK A;  4W5U A;  1FKS A;  1W9V A;  1FKH A;  5HBF A;  5I98 A;  4U84 A;  3B9D A;  4ML4 A;  3NTP A;  2RSE A;  3O5R A;  3CGN A;  1J4R A;  1W1Y A;  2MLX A;  1FAP A;  3WD2 A;  3I6C A;  4NSB A;  4TW7 A;  3MDY B;  4R5E A;  3ARO A;  3UQA A;  3B9A A;  2DT2 A;  3VAW A;  2PPN A;  1XHG A;  3O5K A;  2AWG A;  2FAP A;  4C02 B;  4U85 A;  1ZBK A;  2XP3 A;  5HW8 A;  1HKM A;  3QOK A;  4KR0 B;  5DIT A;  3UI6 A;  2PV2 A;  1Q6H A;  3PR9 A;  4MPK A;  4QZV B;  4QT2 A;  1FJD A;  2MPH A;  1J4I A;  4DWS B;  2PI6 A;  3O5O A;  1WB0 A;  4DWS A;  1Y0O A;  2ZQV A;  4PTM A;  1W9P A;  1BKF A;  2XP5 A;  4TW6 A;  1LG2 A;  1R9H A;  3G6M A;  1XRV A;  3W4R A;  3B8S A;  3O5G A;  3BMB A;  3JYJ A;  3KAF A;  3KAD A;  3RFW A;  4W9Q A;  4HBE A;  1GUV A;  4JFL A;  2LGO A;  4WKH A;  2ITK A;  2B5U B;  4TNS A;  4TYO A;  2F2D A;  3ARY A;  1FKD A;  2WM0 A;  2DT3 A;  4NNR A;  4WIW A;  1H0G A;  3IHZ A;  4AY1 A;  2PBC A;  5D75 A;  3WL0 A;  3CH9 A;  1LG1 A;  4S3J A;  1BL4 A;  2EUL A;  3IK8 A;  1H0I A;  3LUO A;  1HKJ A;  3CZ8 A;  2LJ4 A;  1O6I A;  4FN2 A;  1F8A B;  3G6L A;  3ARZ A;  2QF8 A;  5DF0 A;  1FKK A;  2WK2 A;  4DRN A;  3WD3 A;  5HW6 A;  3UQB A;  3AS2 A;  4GIV A;  1JNS A;  1FKG A;  3IKG A;  4MGV A;  3UI5 A;  3AQU A;  4MAV A;  1E6N A;  2F4E A;  4ODR A;  3UQI A;  2DG4 A;  3ARR A;  4ITZ A;  5B8I C;  1M5Y A;  3O5D A;  4DIP A;  4Q22 A;  3O5P A;  2RUR A;  1LJY A;  3RME A;  1E6P A;  2XP4 A;  4N19 A;  2XPB A;  5HWC A;  3WD1 A;  1ROT A;  1RD6 A;  4MSP A;  4ODO A;  3O5Q A;  1T11 A;  1KT1 A;  1L1P A;  3RM4 A;  3WQV A;  4NZC A;  3ODK A;  2G8Z A;  4G50 A;  1EIB A;  4ZPW R;  2PV3 A;  4JFM A;  1UR8 A;  2DG9 A;  2L2S A;  4HAR A;  3EIP A;  3PA7 A;  1W1P A;  4ODQ A;  1FKT A;  4IQC A;  1KT0 A;  4R0X A;  1ZBW A;  1LL4 A;  2Q5A A;  1W1V A;  1D7I A;  1EYM A;  1ZBV A; 
#chains in the Genus database with same CATH homology
 1SR0 A;  4L3N A;  3FXY A;  2A3B A;  2N87 A;  1X6L A;  2ZQT A;  4P8U A;  4WJX A;  3WIJ A;  4LAV A;  1FKB A;  2OLH A;  4Z2J A;  5HW7 A;  1OGG A;  4DRQ A;  2KR7 A;  4P8V A;  3KCE A;  4IT4 A;  2Y78 A;  4J4N A;  3ARW A;  3ARS A;  1W1T A;  3BXW A;  2PV1 A;  1OWQ A;  1NSG A;  3H9R B;  1D7H A;  1ZK6 A;  1QZ2 A;  1U79 A;  1KFW A;  2XP9 A;  3ALF A;  5BXJ A;  1LL7 A;  1ZB5 A;  4IT6 A;  4QT3 A;  2RUC A;  4Z2K A;  3AS3 A;  4IPX A;  4U86 A;  5GQB A;  2MNT A;  5JH8 A;  1Q1C A;  2DT0 A;  4TW8 A;  4ZPT R;  5HUA A;  2VN1 A;  1E15 A;  1PBK A;  1ZBC A;  4L72 B;  2O9O A;  2G41 A;  1HKK A;  4KQZ A;  3KAI A;  3ARV A;  4W9P A;  1X6N A;  4Z2H A;  1TFV A;  2JZV A;  3ARQ A;  1F40 A;  1CTN A;  3KAC A;  1QPL A;  2RUD A;  1NWR A;  1WAW A;  3CHF A;  3WH0 A;  5HKG A;  3ARU A;  2KI3 A;  2AOS A;  3B7X A;  4DZ3 A;  4JFI A;  1HXV A;  1EQ3 A;  1GPF A;  2ESC A;  2RQS A;  3O5J A;  3TC5 A;  1FFR A;  2FDM A;  4P8X A;  4MNJ A;  1E6Z A;  2PPO A;  3UI4 A;  3O5M A;  4DWS D;  4WKF A;  3CHE A;  2ZQU A;  2KO7 A;  2A3E A;  2DPE A;  2DSV A;  2F21 A;  1C9H A;  2KGJ A;  2XP7 A;  1A7X A;  4QIB A;  1IX5 A;  3O5E A;  1JNT A;  1FKR A;  3TDB A;  4DRK A;  4FAP A;  3PRD A;  3PRA A;  3KAG A;  3WKZ A;  1EHN A;  3TCZ A;  4DRM A;  3EY6 A;  5DEZ A;  1QPF A;  1W9U A;  4LAX A;  4XAK A;  5J6E A;  5HT1 A;  3WQW A;  1FKJ A;  1E6R A;  4Q7N A;  4WK9 A;  1LL6 A;  4DH0 A;  3ALG A;  1FFQ A;  3WD0 A;  2IF4 A;  2MF9 A;  1NMV A;  4ODM A;  3UF8 A;  4MNK A;  4JFJ A;  1N1A A;  4DWS C;  1UR9 A;  4Z2I A;  3JXV A;  5DO2 A;  1ITX A;  1EDQ A;  4DRJ A;  1FKL A;  1PIN A;  1Q6I A;  2IUZ A;  5HWB A;  2ZR5 A;  3CGM A;  3CHC A;  4DRP A;  3ART A;  4ODL A;  1P5Q A;  4URI A;  2RUQ A;  1WNO A;  4MTV A;  1FD9 A;  4WKA A;  1J6Y A;  1HJW A;  4JFK A;  5GPG A;  1JVW A;  2A3A A;  1LQ0 A;  3KAB A;  2O92 A;  5GPR A;  4DRH A;  2FKE A;  2UZ5 A;  4DZ2 A;  4IQ2 A;  4MNL A;  2B31 A;  3AS1 A;  4Z2L A;  2M2A A;  3WL1 A;  3NI6 A;  4DRI A;  1NWU A;  1NWT A;  1HKI A;  2DSU A;  2YBT A;  4BF8 A;  2DSZ A;  2XPA A;  3OA5 A;  2ZQS A;  2ZR4 A;  4TX0 A;  2ZR6 A;  1JND A;  2VCD A;  2KE0 A;  1D6O A;  4P8W A;  2PPP A;  3OOB A;  3PRB A;  1ZCN A;  1TCO C;  1OGB A;  3GPK A;  1NH6 A;  1ZU8 A;  1VF8 A;  4W9O A;  5HTG A;  3RM9 A;  4ODP A;  1ROU A;  4Z2G A;  1FKI A;  4ODK A;  1D2K A;  2DSW A;  2DT1 A;  3O5L A;  2KFW A;  4J4O A;  1YAT A;  3O5F A;  3RGC A;  3AS0 A;  4JYS A;  1E9L A;  4HBO A;  1FKF A;  1J4H A;  2M08 A;  3JYM A;  3B9E A;  1K9T A;  1YW5 A;  1JNE A;  3O5I A;  1NMW A;  2A3C A;  4LGX A;  2XP8 A;  4ZS6 A;  1GOI A;  3ARP A;  2DG3 A;  3KAH A;  3FY1 A;  4DT4 A;  2LKN A;  4LAW A;  2M1I A;  4MNM A;  1HJV A;  3FAP A;  2XP6 A;  4S3K A;  5DIU A;  2MLZ A;  1HJX A;  1NWS A;  2LPV A;  1ZL1 A;  4GGQ A;  4ZPV R;  2K8I A;  4ODN A;  4DRO A;  5DIV A;  1SYT A;  1W26 A;  2D9F A;  2WLY A;  2WLZ A;  3RM8 A;  2YBU A;  4G2P A;  1D7J A;  1Q6U A;  4LAY A;  2MLY A;  3ARX A;  3KZ7 A;  4O2T A;  3IKD A;  3CHD A;  2OFN A;  1B6C A;  3WD4 A;  3NRK A;  4W5U A;  1FKS A;  1W9V A;  1FKH A;  5HBF A;  5I98 A;  4U84 A;  3B9D A;  4ML4 A;  3NTP A;  2RSE A;  3O5R A;  3CGN A;  1J4R A;  1W1Y A;  2MLX A;  1FAP A;  3WD2 A;  3I6C A;  4NSB A;  4TW7 A;  3MDY B;  4R5E A;  3ARO A;  3UQA A;  3B9A A;  2DT2 A;  3VAW A;  2PPN A;  1XHG A;  3O5K A;  2AWG A;  2FAP A;  4C02 B;  4U85 A;  1ZBK A;  2XP3 A;  5HW8 A;  1HKM A;  3QOK A;  4KR0 B;  5DIT A;  3UI6 A;  2PV2 A;  1Q6H A;  3PR9 A;  4MPK A;  4QZV B;  4QT2 A;  1FJD A;  2MPH A;  1J4I A;  4DWS B;  2PI6 A;  3O5O A;  1WB0 A;  4DWS A;  1Y0O A;  2ZQV A;  4PTM A;  1W9P A;  1BKF A;  2XP5 A;  4TW6 A;  1LG2 A;  1R9H A;  3G6M A;  1XRV A;  3W4R A;  3B8S A;  3O5G A;  3JYJ A;  3KAF A;  3KAD A;  3RFW A;  4W9Q A;  4HBE A;  1GUV A;  4JFL A;  2LGO A;  4WKH A;  2ITK A;  4TNS A;  4TYO A;  2F2D A;  3ARY A;  1FKD A;  2WM0 A;  2DT3 A;  4NNR A;  4WIW A;  1H0G A;  3IHZ A;  4AY1 A;  2PBC A;  5D75 A;  3WL0 A;  3CH9 A;  1LG1 A;  4S3J A;  1BL4 A;  3IK8 A;  1H0I A;  3LUO A;  1HKJ A;  3CZ8 A;  2LJ4 A;  1O6I A;  4FN2 A;  1F8A B;  3G6L A;  3ARZ A;  2QF8 A;  5DF0 A;  1FKK A;  2WK2 A;  4DRN A;  3WD3 A;  5HW6 A;  3UQB A;  3AS2 A;  4GIV A;  1JNS A;  1FKG A;  3IKG A;  4MGV A;  3UI5 A;  3AQU A;  4MAV A;  1E6N A;  2F4E A;  4ODR A;  3UQI A;  2DG4 A;  3ARR A;  4ITZ A;  5B8I C;  1M5Y A;  3O5D A;  4DIP A;  4Q22 A;  3O5P A;  2RUR A;  1LJY A;  3RME A;  1E6P A;  2XP4 A;  4N19 A;  2XPB A;  5HWC A;  3WD1 A;  1ROT A;  1RD6 A;  4MSP A;  4ODO A;  3O5Q A;  1T11 A;  1KT1 A;  1L1P A;  3RM4 A;  3WQV A;  4NZC A;  3ODK A;  2G8Z A;  4G50 A;  1EIB A;  4ZPW R;  2PV3 A;  4JFM A;  1UR8 A;  2DG9 A;  2L2S A;  4HAR A;  3PA7 A;  1W1P A;  4ODQ A;  1FKT A;  4IQC A;  1KT0 A;  4R0X A;  1ZBW A;  1LL4 A;  2Q5A A;  1W1V A;  1D7I A;  1EYM A;  1ZBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...