4HBOA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
96
structure length
79
Chain Sequence
EACVTSWLWSEGEGAVFYRVDLHFTMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
total genus 8
structure length 79
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hboA00
4HARA 4HBEA 4HBOA
chains in the Genus database with same CATH superfamily
1FKTA 2M2AA 1FFRA 4TW6A 4ODKA 3WD4A 3RMEA 1NH6A 3ALFA 1ZCNA 2MNTA 3WD0A 3UF8A 1XRVA 2DG3A 2DG9A 4Q22A 5HW7A 2RUDA 1NMWA 1NSGA 1Q6HA 3TCZA 2ETNA 4URIA 2A3BA 3KADA 5HUAA 3OOBA 1FKSA 1HJXA 4LGXA 1QPLA 2MLXA 4ZPWR 4ODQA 4ZPTR 2JZVA 1FKIA 1H0GA 3AS2A 3AS0A 2EULA 2KO7A 4P8XA 4QT3A 4IT6A 1ZBKA 2DSVA 2F2DA 2RURA 1JNTA 3UQIA 4P8VA 4ODNA 4Z2LA 3BMBA 3O5GA 1FKGA 1OGGA 3G6LA 4IT4A 4ODMA 2KGJA 1OGBA 4FN2A 1L1PA 3JXVA 4ZS6A 1FKDA 5DITA 2DPEA 4IPXA 5HKGA 1W1VA 4MSPA 1SYTA 4DRJA 1FKLA 2Q5AA 2IF4A 3O5IA 4QIBA 4JFKA 2KI3A 3NTPA 2DT1A 2PV2A 4WKHA 3WKZA 3G6MA 3KCEA 1PINA 4WK9A 3PR9A 3GPKA 1FJDA 4J4OA 4P8WA 1E6ZA 4UDMA 3O5EA 1EDQA 5I98A 1D2KA 3QOKA 5HW8A 1YATA 1QPFA 1W1TA 3CGNA 3VAWA 4L3NA 3KAGA 3AS3A 1N1AA 1LQ0A 1NWRA 2XP8A 3KACA 1NWTA 5D75A 2F23A 2ITKA 3JYJA 3O5QA 4MNKA 3I6CA 3B9EA 1HKIA 4ODOA 3O5OA 5HWBA 1GOIA 1P5QA 2XP7A 2O92A 1LG1A 4MNMA 1ROTA 4PTMA 1Q6IA 1R9HA 4JYSA 3RM8A 4Z2GA 4ML4A 1ZBVA 1WAWA 2PBCA 2MF9A 2LKNA 5B8IC 1J4RA 4DRNA 2FDMA 4GGQA 4LAWA 4WKAA 2WLZA 1W9PA 1H0IA 4IQCA 1EHNA 1FAPA 1GPFA 1K9TA 3B8SA 3LUOA 1GRJA 3CH9A 4TW8A 1ZB5A 2DSWA 4TW7A 1ZBCA 2M08A 2MPHA 1Q1CA 2WLYA 4R5EA 5GPRA 1FFQA 5HTGA 1XHGA 3ARZA 1YW5A 1FKJA 4ODRA 1SR0A 4ITZA 1F8AB 2MLYA 3TC5A 1VF8A 2PV3A 3RGCA 2XPBA 1NWUA 2IUZA 1QZ2A 1ZU8A 1ROUA 2DT0A 4J4NA 4P8UA 3WQVA 2PPOA 1FKBA 2ZR6A 2DG4A 3BXWA 2PN0A 2FKEA 3ARPA 2XP4A 4QT2A 4Q7NA 4DRKA 4WKFA 3AS1A 3O5MA 4AY1A 1O6IA 1JVWA 4DWSB 3CHEA 4FAPA 3JYMA 1W9UA 3NRKA 2KE0A 1LG2A 1HJVA 1D6OA 3ARQA 2M1IA 4MNJA 1EQ3A 3AROA 1FKFA 3TDBA 2FAPA 2YBTA 1D7JA 4KR0B 3ARTA 5J6EA 3ARVA 4HARA 4C02B 2PPPA 4LAVA 1FKHA 4WJXA 4NSBA 1HKMA 2LGOA 4Z2IA 2OLHA 3O5JA 1NMVA 4DWSC 4Z2KA 2RQSA 5GQBA 1FD9A 3ALGA 1E9LA 4S3JA 4NZCA 3ARSA 4JFIA 3GU0A 4DRMA 2ZQTA 2QF8A 3O5FA 1OWQA 1J4IA 2VCDA 1ZBWA 4BF8A 1EIBA 1JNDA 3IK8A 1RD6A 2B5UB 2ZR4A 3O5RA 1BL4A 5DIUA 4S3KA 5DIVA 1EYMA 1J6YA 3B9DA 3KAFA 4DZ2A 1E44A 1WB0A 4MGVA 2F4EA 1LL7A 3ARRA 3WH0A 4MTVA 3UI4A 5DF0A 4DRIA 1JNEA 3WD2A 1IX5A 3B7XA 4G50A 4KQZA 1CTNA 3ARXA 2AOSA 2PV1A 1E6PA 3IKGA 4DRPA 1PBKA 1W26A 3RFWA 4DWSD 2A3CA 4HBEA 4W9QA 2XP5A 4DT4A 2RUQA 5HT1A 4U85A 3KAHA 4JFJA 1ZL1A 2LJ4A 1E6NA 1W9VA 1LJYA 4L72B 2DSZA 2A3AA 1HKKA 4DIPA 2D9FA 3RM4A 4DROA 4TX0A 2G41A 2KR7A 5HWCA 3O5KA 4ZPVR 4GIVA 2PI6A 5GPGA 2K8IA 1BKFA 2LPVA 1E6RA 4DRQA 3ARWA 1FKKA 2UZ5A 3O5PA 2DSUA 2XPAA 3ARYA 3AQUA 3WL0A 4LAYA 2WM0A 2XP6A 3KAIA 4LAXA 4ODLA 3UI5A 2DT2A 1W1PA 3RM9A 1A7XA 3KABA 2Y78A 1TCOC 3H9RB 2ZQVA 1HXVA 1GUVA 2DT3A 1C9HA 4O2TA 1B6CA 1KT1A 4MAVA 1T11A 2N87A 1U79A 5DEZA 3CHFA 4WIWA 1NWSA 4IQ2A 3W4RA 5JH8A 2YBUA 2RUCA 3IHZA 3CGMA 4JFLA 1LL4A 4U84A 4MNLA 3PRAA 3UQBA 2ESCA 1Q6UA 2MLZA 2XP9A 2G8ZA 3ODKA 3CHCA 1Y0OA 4ODPA 4MPKA 3PRDA 3KZ7A 4W9OA 3FXYA 4HBOA 3IKDA 3FAPA 3OA5A 2RSEA 2O9OA 3NI6A 1JNSA 3O5DA 2B31A 1ZK6A 3UI6A 1D7HA 2ZQUA 1X6LA 4Z2JA 1WNOA 3PRBA 1E15A 3PA7A 3CZ8A 3WD3A 3FY1A 1KFWA 4XAKA 3EIPA 1M5YA 3WQWA 4Z2HA 3WD1A 4U86A 3EY6A 5DO2A 4DZ3A 4JFMA 1ITXA 3WL1A 4N19A 3MDYB 2OFNA 2PPNA 4W5UA 4DH0A 4NNRA 3CHDA 2AWGA 2XP3A 3GTYX 2F21A 2KFWA 1TFVA 2WK2A 4DWSA 1LL6A 1HKJA 3B9AA 3WIJA 5HW6A 5BXJA 1W1YA 1JCHB 1X6NA 1KT0A 4G2PA 4TNSA 4QZVB 1J4HA 2A3EA 2ZR5A 1HJWA 4R0XA 5HBFA 2ZQSA 4TYOA 4W9PA 4DRHA 1D7IA 2P4VA 3O5LA 3ARUA 2L2SA 1FKRA 3UQAA 1UR9A 1UR8A 2VN1A 1F40A
chains in the Genus database with same CATH topology
1FKTA 2M2AA 1FFRA 4TW6A 4ODKA 3WD4A 3RMEA 1NH6A 3ALFA 1ZCNA 2MNTA 3WD0A 3UF8A 1XRVA 2DG3A 2DG9A 4Q22A 5HW7A 2RUDA 1NMWA 1NSGA 1Q6HA 3TCZA 4URIA 2A3BA 3KADA 5HUAA 3OOBA 1FKSA 1HJXA 4LGXA 1QPLA 2MLXA 4ZPWR 4ODQA 4ZPTR 2JZVA 1FKIA 1H0GA 3AS2A 3AS0A 2KO7A 4P8XA 4QT3A 4IT6A 1ZBKA 2DSVA 2F2DA 2RURA 1JNTA 3UQIA 4P8VA 4ODNA 4Z2LA 3O5GA 1FKGA 1OGGA 3G6LA 4IT4A 4ODMA 2KGJA 1OGBA 4FN2A 1L1PA 3JXVA 4ZS6A 1FKDA 5DITA 2DPEA 4IPXA 5HKGA 1W1VA 4MSPA 1SYTA 4DRJA 1FKLA 2Q5AA 2IF4A 3O5IA 4QIBA 4JFKA 2KI3A 3NTPA 2DT1A 2PV2A 4WKHA 3WKZA 3G6MA 3KCEA 1PINA 4WK9A 3PR9A 3GPKA 1FJDA 4J4OA 4P8WA 1E6ZA 3O5EA 1EDQA 5I98A 1D2KA 3QOKA 5HW8A 1YATA 1QPFA 1W1TA 3CGNA 3VAWA 4L3NA 3KAGA 3AS3A 1N1AA 1LQ0A 1NWRA 2XP8A 3KACA 1NWTA 5D75A 3JYJA 2ITKA 4MNKA 3O5QA 3I6CA 3B9EA 1HKIA 4ODOA 3O5OA 5HWBA 1GOIA 1P5QA 2XP7A 2O92A 1LG1A 4MNMA 1ROTA 4PTMA 1Q6IA 1R9HA 4JYSA 3RM8A 4Z2GA 4ML4A 1ZBVA 1WAWA 2PBCA 2MF9A 2LKNA 5B8IC 1J4RA 4DRNA 2FDMA 4GGQA 4LAWA 4WKAA 2WLZA 1W9PA 1H0IA 4IQCA 1EHNA 1FAPA 1GPFA 1K9TA 3B8SA 3LUOA 3CH9A 4TW8A 1ZB5A 2DSWA 4TW7A 1ZBCA 2M08A 2MPHA 1Q1CA 2WLYA 4R5EA 5GPRA 1FFQA 5HTGA 1XHGA 3ARZA 1YW5A 1FKJA 4ODRA 1SR0A 4ITZA 1F8AB 2MLYA 3TC5A 1VF8A 2PV3A 3RGCA 2XPBA 1NWUA 2IUZA 1QZ2A 1ZU8A 1ROUA 2DT0A 4J4NA 4P8UA 3WQVA 2PPOA 1FKBA 2ZR6A 2DG4A 3BXWA 2FKEA 3ARPA 2XP4A 4QT2A 4Q7NA 4DRKA 4WKFA 3AS1A 3O5MA 4AY1A 1O6IA 1JVWA 4DWSB 3CHEA 4FAPA 3JYMA 1W9UA 3NRKA 2KE0A 1LG2A 1HJVA 1D6OA 3ARQA 2M1IA 4MNJA 1EQ3A 3AROA 1FKFA 3TDBA 2FAPA 2YBTA 1D7JA 4KR0B 3ARTA 5J6EA 3ARVA 4HARA 4C02B 2PPPA 4LAVA 1FKHA 4WJXA 4NSBA 1HKMA 2LGOA 4Z2IA 2OLHA 3O5JA 1NMVA 4DWSC 4Z2KA 2RQSA 5GQBA 1FD9A 3ALGA 1E9LA 4S3JA 4NZCA 3ARSA 4JFIA 4DRMA 2ZQTA 2QF8A 3O5FA 1OWQA 1J4IA 2VCDA 1ZBWA 4BF8A 1EIBA 1JNDA 3IK8A 1RD6A 2ZR4A 3O5RA 1BL4A 5DIUA 4S3KA 5DIVA 1EYMA 1J6YA 3B9DA 3KAFA 4DZ2A 1WB0A 4MGVA 2F4EA 1LL7A 3ARRA 3WH0A 4MTVA 3UI4A 5DF0A 4DRIA 1JNEA 3WD2A 1IX5A 3B7XA 4G50A 4KQZA 1CTNA 3ARXA 2AOSA 2PV1A 1E6PA 3IKGA 4DRPA 1PBKA 1W26A 3RFWA 4DWSD 2A3CA 4HBEA 4W9QA 2XP5A 4DT4A 2RUQA 5HT1A 4U85A 3KAHA 4JFJA 1ZL1A 2LJ4A 1E6NA 1W9VA 1LJYA 4L72B 2DSZA 2A3AA 1HKKA 4DIPA 2D9FA 3RM4A 4DROA 4TX0A 2G41A 2KR7A 5HWCA 3O5KA 4ZPVR 4GIVA 2PI6A 5GPGA 2K8IA 1BKFA 2LPVA 1E6RA 4DRQA 3ARWA 1FKKA 2UZ5A 3O5PA 2DSUA 2XPAA 3ARYA 3AQUA 3WL0A 4LAYA 2WM0A 2XP6A 3KAIA 4LAXA 4ODLA 3UI5A 2DT2A 1W1PA 3RM9A 1A7XA 3KABA 2Y78A 1TCOC 3H9RB 2ZQVA 1HXVA 1GUVA 2DT3A 1C9HA 4O2TA 1B6CA 1KT1A 4MAVA 1T11A 2N87A 1U79A 5DEZA 3CHFA 4WIWA 1NWSA 4IQ2A 3W4RA 5JH8A 2YBUA 2RUCA 3IHZA 3CGMA 4JFLA 1LL4A 4U84A 4MNLA 3PRAA 3UQBA 2ESCA 1Q6UA 2MLZA 2XP9A 2G8ZA 3ODKA 3CHCA 1Y0OA 4ODPA 4MPKA 3PRDA 3KZ7A 4W9OA 3FXYA 4HBOA 3IKDA 3FAPA 3OA5A 2RSEA 2O9OA 3NI6A 1JNSA 3O5DA 2B31A 1ZK6A 3UI6A 1D7HA 2ZQUA 1X6LA 4Z2JA 1WNOA 3PRBA 1E15A 3PA7A 3CZ8A 3WD3A 3FY1A 1KFWA 4XAKA 1M5YA 3WQWA 4Z2HA 3WD1A 4U86A 3EY6A 5DO2A 4DZ3A 4JFMA 1ITXA 3WL1A 4N19A 3MDYB 2OFNA 2PPNA 4W5UA 4DH0A 4NNRA 3CHDA 2AWGA 2XP3A 2F21A 2KFWA 1TFVA 2WK2A 4DWSA 1LL6A 1HKJA 3B9AA 3WIJA 5HW6A 5BXJA 1W1YA 1X6NA 1KT0A 4G2PA 4TNSA 4QZVB 1J4HA 2A3EA 2ZR5A 1HJWA 4R0XA 5HBFA 2ZQSA 4TYOA 4W9PA 4DRHA 1D7IA 3O5LA 3ARUA 2L2SA 1FKRA 3UQAA 1UR9A 1UR8A 2VN1A 1F40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAR A;  4HBE A;  4HBO A; 
#chains in the Genus database with same CATH topology
 1FKT A;  2M2A A;  1FFR A;  4TW6 A;  4ODK A;  3WD4 A;  3RME A;  1NH6 A;  3ALF A;  1ZCN A;  2MNT A;  3WD0 A;  3UF8 A;  1XRV A;  2DG3 A;  2DG9 A;  4Q22 A;  5HW7 A;  2RUD A;  1NMW A;  1NSG A;  1Q6H A;  3TCZ A;  2ETN A;  4URI A;  2A3B A;  3KAD A;  5HUA A;  3OOB A;  1FKS A;  1HJX A;  4LGX A;  1QPL A;  2MLX A;  4ZPW R;  4ODQ A;  4ZPT R;  2JZV A;  1FKI A;  1H0G A;  3AS2 A;  3AS0 A;  2EUL A;  2KO7 A;  4P8X A;  4QT3 A;  4IT6 A;  1ZBK A;  2DSV A;  2F2D A;  2RUR A;  1JNT A;  3UQI A;  4P8V A;  4ODN A;  4Z2L A;  3BMB A;  3O5G A;  1FKG A;  1OGG A;  3G6L A;  4IT4 A;  4ODM A;  2KGJ A;  1OGB A;  4FN2 A;  1L1P A;  3JXV A;  4ZS6 A;  1FKD A;  5DIT A;  2DPE A;  4IPX A;  5HKG A;  1W1V A;  4MSP A;  1SYT A;  4DRJ A;  1FKL A;  2Q5A A;  2IF4 A;  3O5I A;  4QIB A;  4JFK A;  2KI3 A;  3NTP A;  2DT1 A;  2PV2 A;  4WKH A;  3WKZ A;  3G6M A;  3KCE A;  1PIN A;  4WK9 A;  3PR9 A;  3GPK A;  1FJD A;  4J4O A;  4P8W A;  1E6Z A;  4UDM A;  3O5E A;  1EDQ A;  5I98 A;  1D2K A;  3QOK A;  5HW8 A;  1YAT A;  1QPF A;  1W1T A;  3CGN A;  3VAW A;  4L3N A;  3KAG A;  3AS3 A;  1N1A A;  1LQ0 A;  1NWR A;  2XP8 A;  3KAC A;  1NWT A;  5D75 A;  2F23 A;  2ITK A;  3JYJ A;  3O5Q A;  4MNK A;  3I6C A;  3B9E A;  1HKI A;  4ODO A;  3O5O A;  5HWB A;  1GOI A;  1P5Q A;  2XP7 A;  2O92 A;  1LG1 A;  4MNM A;  1ROT A;  4PTM A;  1Q6I A;  1R9H A;  4JYS A;  3RM8 A;  4Z2G A;  4ML4 A;  1ZBV A;  1WAW A;  2PBC A;  2MF9 A;  2LKN A;  5B8I C;  1J4R A;  4DRN A;  2FDM A;  4GGQ A;  4LAW A;  4WKA A;  2WLZ A;  1W9P A;  1H0I A;  4IQC A;  1EHN A;  1FAP A;  1GPF A;  1K9T A;  3B8S A;  3LUO A;  1GRJ A;  3CH9 A;  4TW8 A;  1ZB5 A;  2DSW A;  4TW7 A;  1ZBC A;  2M08 A;  2MPH A;  1Q1C A;  2WLY A;  4R5E A;  5GPR A;  1FFQ A;  5HTG A;  1XHG A;  3ARZ A;  1YW5 A;  1FKJ A;  4ODR A;  1SR0 A;  4ITZ A;  1F8A B;  2MLY A;  3TC5 A;  1VF8 A;  2PV3 A;  3RGC A;  2XPB A;  1NWU A;  2IUZ A;  1QZ2 A;  1ZU8 A;  1ROU A;  2DT0 A;  4J4N A;  4P8U A;  3WQV A;  2PPO A;  1FKB A;  2ZR6 A;  2DG4 A;  3BXW A;  2PN0 A;  2FKE A;  3ARP A;  2XP4 A;  4QT2 A;  4Q7N A;  4DRK A;  4WKF A;  3AS1 A;  3O5M A;  4AY1 A;  1O6I A;  1JVW A;  4DWS B;  3CHE A;  4FAP A;  3JYM A;  1W9U A;  3NRK A;  2KE0 A;  1LG2 A;  1HJV A;  1D6O A;  3ARQ A;  2M1I A;  4MNJ A;  1EQ3 A;  3ARO A;  1FKF A;  3TDB A;  2FAP A;  2YBT A;  1D7J A;  4KR0 B;  3ART A;  5J6E A;  3ARV A;  4HAR A;  4C02 B;  2PPP A;  4LAV A;  1FKH A;  4WJX A;  4NSB A;  1HKM A;  2LGO A;  4Z2I A;  2OLH A;  3O5J A;  1NMV A;  4DWS C;  4Z2K A;  2RQS A;  5GQB A;  1FD9 A;  3ALG A;  1E9L A;  4S3J A;  4NZC A;  3ARS A;  4JFI A;  3GU0 A;  4DRM A;  2ZQT A;  2QF8 A;  3O5F A;  1OWQ A;  1J4I A;  2VCD A;  1ZBW A;  4BF8 A;  1EIB A;  1JND A;  3IK8 A;  1RD6 A;  2B5U B;  2ZR4 A;  3O5R A;  1BL4 A;  5DIU A;  4S3K A;  5DIV A;  1EYM A;  1J6Y A;  3B9D A;  3KAF A;  4DZ2 A;  1E44 A;  1WB0 A;  4MGV A;  2F4E A;  1LL7 A;  3ARR A;  3WH0 A;  4MTV A;  3UI4 A;  5DF0 A;  4DRI A;  1JNE A;  3WD2 A;  1IX5 A;  3B7X A;  4G50 A;  4KQZ A;  1CTN A;  3ARX A;  2AOS A;  2PV1 A;  1E6P A;  3IKG A;  4DRP A;  1PBK A;  1W26 A;  3RFW A;  4DWS D;  2A3C A;  4HBE A;  4W9Q A;  2XP5 A;  4DT4 A;  2RUQ A;  5HT1 A;  4U85 A;  3KAH A;  4JFJ A;  1ZL1 A;  2LJ4 A;  1E6N A;  1W9V A;  1LJY A;  4L72 B;  2DSZ A;  2A3A A;  1HKK A;  4DIP A;  2D9F A;  3RM4 A;  4DRO A;  4TX0 A;  2G41 A;  2KR7 A;  5HWC A;  3O5K A;  4ZPV R;  4GIV A;  2PI6 A;  5GPG A;  2K8I A;  1BKF A;  2LPV A;  1E6R A;  4DRQ A;  3ARW A;  1FKK A;  2UZ5 A;  3O5P A;  2DSU A;  2XPA A;  3ARY A;  3AQU A;  3WL0 A;  4LAY A;  2WM0 A;  2XP6 A;  3KAI A;  4LAX A;  4ODL A;  3UI5 A;  2DT2 A;  1W1P A;  3RM9 A;  1A7X A;  3KAB A;  2Y78 A;  1TCO C;  3H9R B;  2ZQV A;  1HXV A;  1GUV A;  2DT3 A;  1C9H A;  4O2T A;  1B6C A;  1KT1 A;  4MAV A;  1T11 A;  2N87 A;  1U79 A;  5DEZ A;  3CHF A;  4WIW A;  1NWS A;  4IQ2 A;  3W4R A;  5JH8 A;  2YBU A;  2RUC A;  3IHZ A;  3CGM A;  4JFL A;  1LL4 A;  4U84 A;  4MNL A;  3PRA A;  3UQB A;  2ESC A;  1Q6U A;  2MLZ A;  2XP9 A;  2G8Z A;  3ODK A;  3CHC A;  1Y0O A;  4ODP A;  4MPK A;  3PRD A;  3KZ7 A;  4W9O A;  3FXY A;  4HBO A;  3IKD A;  3FAP A;  3OA5 A;  2RSE A;  2O9O A;  3NI6 A;  1JNS A;  3O5D A;  2B31 A;  1ZK6 A;  3UI6 A;  1D7H A;  2ZQU A;  1X6L A;  4Z2J A;  1WNO A;  3PRB A;  1E15 A;  3PA7 A;  3CZ8 A;  3WD3 A;  3FY1 A;  1KFW A;  4XAK A;  3EIP A;  1M5Y A;  3WQW A;  4Z2H A;  3WD1 A;  4U86 A;  3EY6 A;  5DO2 A;  4DZ3 A;  4JFM A;  1ITX A;  3WL1 A;  4N19 A;  3MDY B;  2OFN A;  2PPN A;  4W5U A;  4DH0 A;  4NNR A;  3CHD A;  2AWG A;  2XP3 A;  3GTY X;  2F21 A;  2KFW A;  1TFV A;  2WK2 A;  4DWS A;  1LL6 A;  1HKJ A;  3B9A A;  3WIJ A;  5HW6 A;  5BXJ A;  1W1Y A;  1JCH B;  1X6N A;  1KT0 A;  4G2P A;  4TNS A;  4QZV B;  1J4H A;  2A3E A;  2ZR5 A;  1HJW A;  4R0X A;  5HBF A;  2ZQS A;  4TYO A;  4W9P A;  4DRH A;  1D7I A;  2P4V A;  3O5L A;  3ARU A;  2L2S A;  1FKR A;  3UQA A;  1UR9 A;  1UR8 A;  2VN1 A;  1F40 A; 
#chains in the Genus database with same CATH homology
 1FKT A;  2M2A A;  1FFR A;  4TW6 A;  4ODK A;  3WD4 A;  3RME A;  1NH6 A;  3ALF A;  1ZCN A;  2MNT A;  3WD0 A;  3UF8 A;  1XRV A;  2DG3 A;  2DG9 A;  4Q22 A;  5HW7 A;  2RUD A;  1NMW A;  1NSG A;  1Q6H A;  3TCZ A;  4URI A;  2A3B A;  3KAD A;  5HUA A;  3OOB A;  1FKS A;  1HJX A;  4LGX A;  1QPL A;  2MLX A;  4ZPW R;  4ODQ A;  4ZPT R;  2JZV A;  1FKI A;  1H0G A;  3AS2 A;  3AS0 A;  2KO7 A;  4P8X A;  4QT3 A;  4IT6 A;  1ZBK A;  2DSV A;  2F2D A;  2RUR A;  1JNT A;  3UQI A;  4P8V A;  4ODN A;  4Z2L A;  3O5G A;  1FKG A;  1OGG A;  3G6L A;  4IT4 A;  4ODM A;  2KGJ A;  1OGB A;  4FN2 A;  1L1P A;  3JXV A;  4ZS6 A;  1FKD A;  5DIT A;  2DPE A;  4IPX A;  5HKG A;  1W1V A;  4MSP A;  1SYT A;  4DRJ A;  1FKL A;  2Q5A A;  2IF4 A;  3O5I A;  4QIB A;  4JFK A;  2KI3 A;  3NTP A;  2DT1 A;  2PV2 A;  4WKH A;  3WKZ A;  3G6M A;  3KCE A;  1PIN A;  4WK9 A;  3PR9 A;  3GPK A;  1FJD A;  4J4O A;  4P8W A;  1E6Z A;  3O5E A;  1EDQ A;  5I98 A;  1D2K A;  3QOK A;  5HW8 A;  1YAT A;  1QPF A;  1W1T A;  3CGN A;  3VAW A;  4L3N A;  3KAG A;  3AS3 A;  1N1A A;  1LQ0 A;  1NWR A;  2XP8 A;  3KAC A;  1NWT A;  5D75 A;  3JYJ A;  2ITK A;  4MNK A;  3O5Q A;  3I6C A;  3B9E A;  1HKI A;  4ODO A;  3O5O A;  5HWB A;  1GOI A;  1P5Q A;  2XP7 A;  2O92 A;  1LG1 A;  4MNM A;  1ROT A;  4PTM A;  1Q6I A;  1R9H A;  4JYS A;  3RM8 A;  4Z2G A;  4ML4 A;  1ZBV A;  1WAW A;  2PBC A;  2MF9 A;  2LKN A;  5B8I C;  1J4R A;  4DRN A;  2FDM A;  4GGQ A;  4LAW A;  4WKA A;  2WLZ A;  1W9P A;  1H0I A;  4IQC A;  1EHN A;  1FAP A;  1GPF A;  1K9T A;  3B8S A;  3LUO A;  3CH9 A;  4TW8 A;  1ZB5 A;  2DSW A;  4TW7 A;  1ZBC A;  2M08 A;  2MPH A;  1Q1C A;  2WLY A;  4R5E A;  5GPR A;  1FFQ A;  5HTG A;  1XHG A;  3ARZ A;  1YW5 A;  1FKJ A;  4ODR A;  1SR0 A;  4ITZ A;  1F8A B;  2MLY A;  3TC5 A;  1VF8 A;  2PV3 A;  3RGC A;  2XPB A;  1NWU A;  2IUZ A;  1QZ2 A;  1ZU8 A;  1ROU A;  2DT0 A;  4J4N A;  4P8U A;  3WQV A;  2PPO A;  1FKB A;  2ZR6 A;  2DG4 A;  3BXW A;  2FKE A;  3ARP A;  2XP4 A;  4QT2 A;  4Q7N A;  4DRK A;  4WKF A;  3AS1 A;  3O5M A;  4AY1 A;  1O6I A;  1JVW A;  4DWS B;  3CHE A;  4FAP A;  3JYM A;  1W9U A;  3NRK A;  2KE0 A;  1LG2 A;  1HJV A;  1D6O A;  3ARQ A;  2M1I A;  4MNJ A;  1EQ3 A;  3ARO A;  1FKF A;  3TDB A;  2FAP A;  2YBT A;  1D7J A;  4KR0 B;  3ART A;  5J6E A;  3ARV A;  4HAR A;  4C02 B;  2PPP A;  4LAV A;  1FKH A;  4WJX A;  4NSB A;  1HKM A;  2LGO A;  4Z2I A;  2OLH A;  3O5J A;  1NMV A;  4DWS C;  4Z2K A;  2RQS A;  5GQB A;  1FD9 A;  3ALG A;  1E9L A;  4S3J A;  4NZC A;  3ARS A;  4JFI A;  4DRM A;  2ZQT A;  2QF8 A;  3O5F A;  1OWQ A;  1J4I A;  2VCD A;  1ZBW A;  4BF8 A;  1EIB A;  1JND A;  3IK8 A;  1RD6 A;  2ZR4 A;  3O5R A;  1BL4 A;  5DIU A;  4S3K A;  5DIV A;  1EYM A;  1J6Y A;  3B9D A;  3KAF A;  4DZ2 A;  1WB0 A;  4MGV A;  2F4E A;  1LL7 A;  3ARR A;  3WH0 A;  4MTV A;  3UI4 A;  5DF0 A;  4DRI A;  1JNE A;  3WD2 A;  1IX5 A;  3B7X A;  4G50 A;  4KQZ A;  1CTN A;  3ARX A;  2AOS A;  2PV1 A;  1E6P A;  3IKG A;  4DRP A;  1PBK A;  1W26 A;  3RFW A;  4DWS D;  2A3C A;  4HBE A;  4W9Q A;  2XP5 A;  4DT4 A;  2RUQ A;  5HT1 A;  4U85 A;  3KAH A;  4JFJ A;  1ZL1 A;  2LJ4 A;  1E6N A;  1W9V A;  1LJY A;  4L72 B;  2DSZ A;  2A3A A;  1HKK A;  4DIP A;  2D9F A;  3RM4 A;  4DRO A;  4TX0 A;  2G41 A;  2KR7 A;  5HWC A;  3O5K A;  4ZPV R;  4GIV A;  2PI6 A;  5GPG A;  2K8I A;  1BKF A;  2LPV A;  1E6R A;  4DRQ A;  3ARW A;  1FKK A;  2UZ5 A;  3O5P A;  2DSU A;  2XPA A;  3ARY A;  3AQU A;  3WL0 A;  4LAY A;  2WM0 A;  2XP6 A;  3KAI A;  4LAX A;  4ODL A;  3UI5 A;  2DT2 A;  1W1P A;  3RM9 A;  1A7X A;  3KAB A;  2Y78 A;  1TCO C;  3H9R B;  2ZQV A;  1HXV A;  1GUV A;  2DT3 A;  1C9H A;  4O2T A;  1B6C A;  1KT1 A;  4MAV A;  1T11 A;  2N87 A;  1U79 A;  5DEZ A;  3CHF A;  4WIW A;  1NWS A;  4IQ2 A;  3W4R A;  5JH8 A;  2YBU A;  2RUC A;  3IHZ A;  3CGM A;  4JFL A;  1LL4 A;  4U84 A;  4MNL A;  3PRA A;  3UQB A;  2ESC A;  1Q6U A;  2MLZ A;  2XP9 A;  2G8Z A;  3ODK A;  3CHC A;  1Y0O A;  4ODP A;  4MPK A;  3PRD A;  3KZ7 A;  4W9O A;  3FXY A;  4HBO A;  3IKD A;  3FAP A;  3OA5 A;  2RSE A;  2O9O A;  3NI6 A;  1JNS A;  3O5D A;  2B31 A;  1ZK6 A;  3UI6 A;  1D7H A;  2ZQU A;  1X6L A;  4Z2J A;  1WNO A;  3PRB A;  1E15 A;  3PA7 A;  3CZ8 A;  3WD3 A;  3FY1 A;  1KFW A;  4XAK A;  1M5Y A;  3WQW A;  4Z2H A;  3WD1 A;  4U86 A;  3EY6 A;  5DO2 A;  4DZ3 A;  4JFM A;  1ITX A;  3WL1 A;  4N19 A;  3MDY B;  2OFN A;  2PPN A;  4W5U A;  4DH0 A;  4NNR A;  3CHD A;  2AWG A;  2XP3 A;  2F21 A;  2KFW A;  1TFV A;  2WK2 A;  4DWS A;  1LL6 A;  1HKJ A;  3B9A A;  3WIJ A;  5HW6 A;  5BXJ A;  1W1Y A;  1X6N A;  1KT0 A;  4G2P A;  4TNS A;  4QZV B;  1J4H A;  2A3E A;  2ZR5 A;  1HJW A;  4R0X A;  5HBF A;  2ZQS A;  4TYO A;  4W9P A;  4DRH A;  1D7I A;  3O5L A;  3ARU A;  2L2S A;  1FKR A;  3UQA A;  1UR9 A;  1UR8 A;  2VN1 A;  1F40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...