4HBOA

Crystal structure of rubella virus capsid protein (residues 127-277)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
96
structure length
79
Chain Sequence
EACVTSWLWSEGEGAVFYRVDLHFTMYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rubella virus capsid protein structure and its role in virus assembly and infection.
pubmed doi rcsb
source organism Rubella virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 8
structure length 79
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.50 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4hboA00
4HBOA 4HBEA 4HARA
chains in the Genus database with same CATH superfamily
1EYMA 3UF8A 4LAYA 2WLYA 5HKGA 1W9UA 3KACA 3ARQA 3PA7A 1KT0A 2ZR6A 4R0XA 2ETNA 3O5DA 4DH0A 1LL7A 2A3BA 4HBEA 4DWSB 5DO2A 4MNMA 4L72B 2DSVA 3O5QA 1SR0A 4Z2HA 3PRAA 3O5PA 1BL4A 3O5IA 4W9OA 2XP4A 2LKNA 3G6MA 3QOKA 3UQAA 3O5MA 4PTMA 1D2KA 3I6CA 1LG2A 2F23A 2PV1A 4N19A 3PRBA 4Z2LA 2MF9A 4TW6A 4LAWA 4S3KA 3WQVA 2FDMA 1EQ3A 1XHGA 2DPEA 2XP3A 5HW8A 1EIBA 2QF8A 5HWCA 3AS2A 4TW7A 4ZPWR 1YW5A 2KGJA 1Q6HA 3AS1A 4P8UA 1NWTA 4QT3A 1GOIA 4Q22A 1FKBA 5HTGA 2D9FA 3AQUA 3OA5A 1HKIA 3CHCA 3WD1A 1QZ2A 1FKFA 2AWGA 3PR9A 1P5QA 4ODKA 2M1IA 1JVWA 3GTYX 5GPRA 3KAHA 5DIUA 4GGQA 4ITZA 1VF8A 4URIA 5DEZA 4JYSA 3BXWA 1PBKA 2PPOA 3O5EA 2DSUA 1HKJA 3FY1A 3IKDA 4DT4A 3ARSA 3B9DA 3AS0A 2DT2A 4C02B 2WLZA 4JFIA 1JNTA 4MTVA 1B6CA 4TYOA 2PPPA 4ML4A 2XP7A 1FKSA 2XP9A 1LG1A 3IKGA 2A3AA 2ITKA 2IF4A 2WM0A 4DWSA 4MNLA 1IX5A 3RM4A 2ZQUA 2KI3A 1UR8A 1O6IA 1J6YA 3ARPA 3JYJA 1NWRA 3ARVA 3FAPA 1EHNA 3AS3A 1NH6A 1FKKA 1U79A 4L3NA 3ARYA 3UI6A 5HUAA 4DRKA 2DSZA 3RM9A 3KAFA 4MAVA 3WL0A 1JNEA 4Z2JA 1N1AA 4MGVA 1E15A 3KAIA 1QPLA 3O5JA 3O5OA 3KABA 4Z2KA 3WD4A 1FKGA 4TW8A 4ODLA 1W1TA 3WH0A 2FKEA 4R5EA 4ZS6A 1W1PA 1ITXA 3UI4A 1SYTA 3B8SA 3TDBA 2DSWA 2KFWA 1HJWA 4JFMA 5HW7A 2OLHA 4HBOA 3KCEA 2PN0A 2F4EA 3ARWA 2VN1A 2K8IA 1QPFA 4JFKA 4DZ2A 1ZBWA 1ZU8A 3PRDA 1FJDA 1X6LA 1ZBKA 1HJXA 4DIPA 1T11A 3GPKA 3UQBA 1WAWA 1W9PA 4MPKA 1HJVA 1XRVA 1FKJA 3BMBA 1ZK6A 2KO7A 3H9RB 4G50A 5HBFA 4IPXA 4IT6A 4DWSC 1W1VA 3CHDA 2A3CA 3ARZA 4IT4A 4G2PA 3VAWA 2L2SA 1HKMA 4MNJA 1E6RA 2P4VA 3G6LA 2OFNA 1FKRA 2DG9A 1W26A 1NWUA 4WIWA 4QIBA 2A3EA 4ZPTR 4ODNA 2ZR4A 3WD2A 5GPGA 1JNSA 1GUVA 1J4RA 1TCOC 1L1PA 2Y78A 2O9OA 3ARXA 1NSGA 4W5UA 5BXJA 2DT3A 5DIVA 1W9VA 4ODPA 1FD9A 1EDQA 4MSPA 2M2AA 2JZVA 3RM8A 2M08A 4Z2GA 1ZB5A 3MDYB 3O5RA 4IQCA 1D7IA 1OGBA 2PI6A 3ARTA 1FKDA 3CGMA 2ZQSA 1FKTA 4WKFA 4ZPVR 4QT2A 1WB0A 2XP6A 1E6NA 2UZ5A 4DRHA 4ODMA 1NWSA 4ODOA 1W1YA 4MNKA 5DF0A 3IHZA 2Q5AA 2EULA 2F21A 3KADA 1D7JA 1KFWA 2O92A 2KR7A 3TCZA 3NRKA 4IQ2A 1C9HA 2YBUA 3RFWA 1F40A 1HXVA 1ZBCA 2F2DA 3UQIA 1YATA 4DRQA 1OWQA 1D6OA 4DRIA 1X6NA 4HARA 2KE0A 4GIVA 4NZCA 3WD3A 4LAVA 4NNRA 4DZ3A 4P8VA 3NTPA 2RSEA 2LPVA 2IUZA 1CTNA 2LJ4A 3UI5A 1FAPA 2N87A 4KR0B 4WKHA 1Q6UA 4W9PA 1ROUA 4WK9A 5HT1A 4DRJA 4Z2IA 2G41A 4JFJA 4P8XA 1PINA 4S3JA 3WKZA 1ZL1A 3O5GA 2ZQTA 1FKLA 4J4NA 1WNOA 1LL4A 1JNDA 1FFRA 4TX0A 1RD6A 5I98A 4DRMA 2YBTA 4LGXA 4LAXA 2PV3A 3O5FA 4U86A 3B7XA 2RUDA 3AROA 1HKKA 5B8IC 4BF8A 2DG3A 4P8WA 1LJYA 3CHFA 2MNTA 1H0GA 3ARUA 3LUOA 4DROA 3CGNA 2LGOA 3ARRA 2FAPA 5D75A 4ODQA 3FXYA 3OOBA 1E6PA 1J4IA 5DITA 1K9TA 1JCHB 4KQZA 4WKAA 2B5UB 2ZQVA 2PV2A 2AOSA 3ODKA 1ZBVA 4U85A 3WD0A 5J6EA 1GPFA 1ZCNA 3O5LA 4QZVB 4TNSA 3GU0A 1LL6A 3W4RA 3WL1A 1NMVA 3KZ7A 1NMWA 2RURA 4O2TA 4DRPA 4NSBA 2XPAA 2MLXA 2ESCA 4XAKA 2VCDA 4W9QA 1FKIA 1TFVA 2B31A 3B9AA 3RGCA 1GRJA 1M5YA 4FAPA 2ZR5A 1E6ZA 3ALGA 4JFLA 1J4HA 2XP5A 3CHEA 1FKHA 1F8AB 2MPHA 1FFQA 4FN2A 5HW6A 3CH9A 1H0IA 4ODRA 1OGGA 1Q6IA 5JH8A 4DWSD 3ALFA 3EY6A 2MLYA 1A7XA 5GQBA 1BKFA 2DG4A 3IK8A 2MLZA 3RMEA 5HWBA 3TC5A 2G8ZA 3CZ8A 1E44A 3NI6A 3WIJA 3WQWA 3JYMA 4Q7NA 1UR9A 1Q1CA 2WK2A 3B9EA 2DT1A 2XPBA 3O5KA 1E9LA 2RUCA 2XP8A 4DRNA 4UDMA 4WJXA 2PPNA 1R9HA 1D7HA 2RUQA 4AY1A 1Y0OA 2PBCA 3KAGA 3EIPA 4J4OA 4U84A 1ROTA 1LQ0A 2DT0A 3JXVA 2RQSA 1KT1A
chains in the Genus database with same CATH topology
1EYMA 3UF8A 4LAYA 2WLYA 5HKGA 1W9UA 3KACA 3ARQA 3PA7A 1KT0A 2ZR6A 4R0XA 3O5DA 4DH0A 1LL7A 2A3BA 4HBEA 4DWSB 5DO2A 4MNMA 4L72B 2DSVA 3O5QA 1SR0A 4Z2HA 3PRAA 3O5PA 1BL4A 3O5IA 4W9OA 2XP4A 2LKNA 3G6MA 3QOKA 3UQAA 3O5MA 4PTMA 1D2KA 3I6CA 1LG2A 2PV1A 4N19A 3PRBA 4Z2LA 2MF9A 4TW6A 4LAWA 4S3KA 3WQVA 2FDMA 1EQ3A 1XHGA 2DPEA 2XP3A 5HW8A 1EIBA 2QF8A 5HWCA 3AS2A 4TW7A 4ZPWR 1YW5A 2KGJA 1Q6HA 3AS1A 4P8UA 1NWTA 4QT3A 1GOIA 4Q22A 1FKBA 5HTGA 2D9FA 3AQUA 3OA5A 1HKIA 3CHCA 3WD1A 1QZ2A 1FKFA 2AWGA 3PR9A 1P5QA 4ODKA 2M1IA 1JVWA 5GPRA 3KAHA 5DIUA 4GGQA 4ITZA 1VF8A 4URIA 5DEZA 4JYSA 3BXWA 1PBKA 2PPOA 3O5EA 2DSUA 1HKJA 3FY1A 3IKDA 4DT4A 3ARSA 3B9DA 3AS0A 2DT2A 4C02B 2WLZA 4JFIA 1JNTA 4MTVA 1B6CA 4TYOA 2PPPA 4ML4A 2XP7A 1FKSA 2XP9A 1LG1A 3IKGA 2A3AA 2ITKA 2IF4A 2WM0A 4DWSA 4MNLA 1IX5A 3RM4A 2ZQUA 2KI3A 1UR8A 1O6IA 1J6YA 3ARPA 3JYJA 1NWRA 3ARVA 3FAPA 1EHNA 3AS3A 1NH6A 1FKKA 1U79A 4L3NA 3ARYA 3UI6A 5HUAA 4DRKA 2DSZA 3RM9A 3KAFA 4MAVA 3WL0A 1JNEA 4Z2JA 1N1AA 4MGVA 1E15A 3KAIA 1QPLA 3O5JA 3O5OA 3KABA 4Z2KA 3WD4A 1FKGA 4TW8A 4ODLA 1W1TA 3WH0A 2FKEA 4R5EA 4ZS6A 1W1PA 1ITXA 3UI4A 1SYTA 3B8SA 3TDBA 2DSWA 2KFWA 1HJWA 4JFMA 5HW7A 2OLHA 4HBOA 3KCEA 2F4EA 3ARWA 2VN1A 2K8IA 1QPFA 4JFKA 4DZ2A 1ZBWA 1ZU8A 3PRDA 1FJDA 1X6LA 1ZBKA 1HJXA 4DIPA 1T11A 3GPKA 3UQBA 1WAWA 1W9PA 4MPKA 1HJVA 1XRVA 1FKJA 1ZK6A 2KO7A 3H9RB 4G50A 5HBFA 4IPXA 4IT6A 4DWSC 1W1VA 3CHDA 2A3CA 3ARZA 4IT4A 4G2PA 3VAWA 2L2SA 1HKMA 4MNJA 1E6RA 3G6LA 2OFNA 1FKRA 2DG9A 1W26A 1NWUA 4WIWA 4QIBA 2A3EA 4ZPTR 4ODNA 2ZR4A 3WD2A 5GPGA 1JNSA 1GUVA 1J4RA 1TCOC 1L1PA 2Y78A 2O9OA 3ARXA 1NSGA 4W5UA 5BXJA 2DT3A 5DIVA 1W9VA 4ODPA 1FD9A 1EDQA 4MSPA 2M2AA 2JZVA 3RM8A 2M08A 4Z2GA 1ZB5A 3MDYB 3O5RA 4IQCA 1D7IA 1OGBA 2PI6A 3ARTA 1FKDA 3CGMA 2ZQSA 1FKTA 4WKFA 4ZPVR 4QT2A 1WB0A 2XP6A 1E6NA 2UZ5A 4DRHA 4ODMA 1NWSA 4ODOA 1W1YA 4MNKA 5DF0A 3IHZA 2Q5AA 2F21A 3KADA 1D7JA 1KFWA 2O92A 2KR7A 3TCZA 3NRKA 4IQ2A 1C9HA 2YBUA 3RFWA 1F40A 1HXVA 1ZBCA 2F2DA 3UQIA 1YATA 4DRQA 1OWQA 1D6OA 4DRIA 1X6NA 4HARA 2KE0A 4GIVA 4NZCA 3WD3A 4LAVA 4NNRA 4DZ3A 4P8VA 3NTPA 2RSEA 2LPVA 2IUZA 1CTNA 2LJ4A 3UI5A 1FAPA 2N87A 4KR0B 4WKHA 1Q6UA 4W9PA 1ROUA 4WK9A 5HT1A 4DRJA 4Z2IA 2G41A 4JFJA 4P8XA 1PINA 4S3JA 3WKZA 1ZL1A 3O5GA 2ZQTA 4J4NA 1FKLA 1WNOA 1LL4A 1JNDA 1FFRA 4TX0A 1RD6A 5I98A 4DRMA 2YBTA 4LGXA 4LAXA 2PV3A 3O5FA 4U86A 3B7XA 2RUDA 3AROA 1HKKA 5B8IC 4BF8A 2DG3A 4P8WA 1LJYA 3CHFA 2MNTA 1H0GA 3ARUA 3LUOA 4DROA 3CGNA 2LGOA 3ARRA 2FAPA 5D75A 4ODQA 3FXYA 3OOBA 1E6PA 1J4IA 5DITA 1K9TA 4KQZA 4WKAA 2ZQVA 2PV2A 2AOSA 3ODKA 1ZBVA 4U85A 3WD0A 5J6EA 1GPFA 1ZCNA 3O5LA 4QZVB 4TNSA 1LL6A 3W4RA 3WL1A 1NMVA 3KZ7A 1NMWA 2RURA 4O2TA 4DRPA 4NSBA 2XPAA 2MLXA 2ESCA 4XAKA 2VCDA 4W9QA 1FKIA 1TFVA 2B31A 3B9AA 3RGCA 1M5YA 4FAPA 2ZR5A 1E6ZA 3ALGA 4JFLA 1J4HA 2XP5A 3CHEA 1FKHA 1F8AB 2MPHA 1FFQA 4FN2A 5HW6A 3CH9A 1H0IA 4ODRA 1OGGA 1Q6IA 5JH8A 4DWSD 3ALFA 3EY6A 2MLYA 1A7XA 5GQBA 1BKFA 2DG4A 3IK8A 2MLZA 3RMEA 5HWBA 3TC5A 2G8ZA 3CZ8A 3WIJA 3NI6A 3WQWA 3JYMA 4Q7NA 1UR9A 1Q1CA 2WK2A 3B9EA 2DT1A 2XPBA 3O5KA 1E9LA 2RUCA 2XP8A 4DRNA 4WJXA 2PPNA 1R9HA 1D7HA 2RUQA 4AY1A 1Y0OA 2PBCA 3KAGA 4J4OA 4U84A 1ROTA 1LQ0A 2DT0A 3JXVA 2RQSA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBO A;  4HBE A;  4HAR A; 
#chains in the Genus database with same CATH topology
 1EYM A;  3UF8 A;  4LAY A;  2WLY A;  5HKG A;  1W9U A;  3KAC A;  3ARQ A;  3PA7 A;  1KT0 A;  2ZR6 A;  4R0X A;  2ETN A;  3O5D A;  4DH0 A;  1LL7 A;  2A3B A;  4HBE A;  4DWS B;  5DO2 A;  4MNM A;  4L72 B;  2DSV A;  3O5Q A;  1SR0 A;  4Z2H A;  3PRA A;  3O5P A;  1BL4 A;  3O5I A;  4W9O A;  2XP4 A;  2LKN A;  3G6M A;  3QOK A;  3UQA A;  3O5M A;  4PTM A;  1D2K A;  3I6C A;  1LG2 A;  2F23 A;  2PV1 A;  4N19 A;  3PRB A;  4Z2L A;  2MF9 A;  4TW6 A;  4LAW A;  4S3K A;  3WQV A;  2FDM A;  1EQ3 A;  1XHG A;  2DPE A;  2XP3 A;  5HW8 A;  1EIB A;  2QF8 A;  5HWC A;  3AS2 A;  4TW7 A;  4ZPW R;  1YW5 A;  2KGJ A;  1Q6H A;  3AS1 A;  4P8U A;  1NWT A;  4QT3 A;  1GOI A;  4Q22 A;  1FKB A;  5HTG A;  2D9F A;  3AQU A;  3OA5 A;  1HKI A;  3CHC A;  3WD1 A;  1QZ2 A;  1FKF A;  2AWG A;  3PR9 A;  1P5Q A;  4ODK A;  2M1I A;  1JVW A;  3GTY X;  5GPR A;  3KAH A;  5DIU A;  4GGQ A;  4ITZ A;  1VF8 A;  4URI A;  5DEZ A;  4JYS A;  3BXW A;  1PBK A;  2PPO A;  3O5E A;  2DSU A;  1HKJ A;  3FY1 A;  3IKD A;  4DT4 A;  3ARS A;  3B9D A;  3AS0 A;  2DT2 A;  4C02 B;  2WLZ A;  4JFI A;  1JNT A;  4MTV A;  1B6C A;  4TYO A;  2PPP A;  4ML4 A;  2XP7 A;  1FKS A;  2XP9 A;  1LG1 A;  3IKG A;  2A3A A;  2ITK A;  2IF4 A;  2WM0 A;  4DWS A;  4MNL A;  1IX5 A;  3RM4 A;  2ZQU A;  2KI3 A;  1UR8 A;  1O6I A;  1J6Y A;  3ARP A;  3JYJ A;  1NWR A;  3ARV A;  3FAP A;  1EHN A;  3AS3 A;  1NH6 A;  1FKK A;  1U79 A;  4L3N A;  3ARY A;  3UI6 A;  5HUA A;  4DRK A;  2DSZ A;  3RM9 A;  3KAF A;  4MAV A;  3WL0 A;  1JNE A;  4Z2J A;  1N1A A;  4MGV A;  1E15 A;  3KAI A;  1QPL A;  3O5J A;  3O5O A;  3KAB A;  4Z2K A;  3WD4 A;  1FKG A;  4TW8 A;  4ODL A;  1W1T A;  3WH0 A;  2FKE A;  4R5E A;  4ZS6 A;  1W1P A;  1ITX A;  3UI4 A;  1SYT A;  3B8S A;  3TDB A;  2DSW A;  2KFW A;  1HJW A;  4JFM A;  5HW7 A;  2OLH A;  4HBO A;  3KCE A;  2PN0 A;  2F4E A;  3ARW A;  2VN1 A;  2K8I A;  1QPF A;  4JFK A;  4DZ2 A;  1ZBW A;  1ZU8 A;  3PRD A;  1FJD A;  1X6L A;  1ZBK A;  1HJX A;  4DIP A;  1T11 A;  3GPK A;  3UQB A;  1WAW A;  1W9P A;  4MPK A;  1HJV A;  1XRV A;  1FKJ A;  3BMB A;  1ZK6 A;  2KO7 A;  3H9R B;  4G50 A;  5HBF A;  4IPX A;  4IT6 A;  4DWS C;  1W1V A;  3CHD A;  2A3C A;  3ARZ A;  4IT4 A;  4G2P A;  3VAW A;  2L2S A;  1HKM A;  4MNJ A;  1E6R A;  2P4V A;  3G6L A;  2OFN A;  1FKR A;  2DG9 A;  1W26 A;  1NWU A;  4WIW A;  4QIB A;  2A3E A;  4ZPT R;  4ODN A;  2ZR4 A;  3WD2 A;  5GPG A;  1JNS A;  1GUV A;  1J4R A;  1TCO C;  1L1P A;  2Y78 A;  2O9O A;  3ARX A;  1NSG A;  4W5U A;  5BXJ A;  2DT3 A;  5DIV A;  1W9V A;  4ODP A;  1FD9 A;  1EDQ A;  4MSP A;  2M2A A;  2JZV A;  3RM8 A;  2M08 A;  4Z2G A;  1ZB5 A;  3MDY B;  3O5R A;  4IQC A;  1D7I A;  1OGB A;  2PI6 A;  3ART A;  1FKD A;  3CGM A;  2ZQS A;  1FKT A;  4WKF A;  4ZPV R;  4QT2 A;  1WB0 A;  2XP6 A;  1E6N A;  2UZ5 A;  4DRH A;  4ODM A;  1NWS A;  4ODO A;  1W1Y A;  4MNK A;  5DF0 A;  3IHZ A;  2Q5A A;  2EUL A;  2F21 A;  3KAD A;  1D7J A;  1KFW A;  2O92 A;  2KR7 A;  3TCZ A;  3NRK A;  4IQ2 A;  1C9H A;  2YBU A;  3RFW A;  1F40 A;  1HXV A;  1ZBC A;  2F2D A;  3UQI A;  1YAT A;  4DRQ A;  1OWQ A;  1D6O A;  4DRI A;  1X6N A;  4HAR A;  2KE0 A;  4GIV A;  4NZC A;  3WD3 A;  4LAV A;  4NNR A;  4DZ3 A;  4P8V A;  3NTP A;  2RSE A;  2LPV A;  2IUZ A;  1CTN A;  2LJ4 A;  3UI5 A;  1FAP A;  2N87 A;  4KR0 B;  4WKH A;  1Q6U A;  4W9P A;  1ROU A;  4WK9 A;  5HT1 A;  4DRJ A;  4Z2I A;  2G41 A;  4JFJ A;  4P8X A;  1PIN A;  4S3J A;  3WKZ A;  1ZL1 A;  3O5G A;  2ZQT A;  1FKL A;  4J4N A;  1WNO A;  1LL4 A;  1JND A;  1FFR A;  4TX0 A;  1RD6 A;  5I98 A;  4DRM A;  2YBT A;  4LGX A;  4LAX A;  2PV3 A;  3O5F A;  4U86 A;  3B7X A;  2RUD A;  3ARO A;  1HKK A;  5B8I C;  4BF8 A;  2DG3 A;  4P8W A;  1LJY A;  3CHF A;  2MNT A;  1H0G A;  3ARU A;  3LUO A;  4DRO A;  3CGN A;  2LGO A;  3ARR A;  2FAP A;  5D75 A;  4ODQ A;  3FXY A;  3OOB A;  1E6P A;  1J4I A;  5DIT A;  1K9T A;  1JCH B;  4KQZ A;  4WKA A;  2B5U B;  2ZQV A;  2PV2 A;  2AOS A;  3ODK A;  1ZBV A;  4U85 A;  3WD0 A;  5J6E A;  1GPF A;  1ZCN A;  3O5L A;  4QZV B;  4TNS A;  3GU0 A;  1LL6 A;  3W4R A;  3WL1 A;  1NMV A;  3KZ7 A;  1NMW A;  2RUR A;  4O2T A;  4DRP A;  4NSB A;  2XPA A;  2MLX A;  2ESC A;  4XAK A;  2VCD A;  4W9Q A;  1FKI A;  1TFV A;  2B31 A;  3B9A A;  3RGC A;  1GRJ A;  1M5Y A;  4FAP A;  2ZR5 A;  1E6Z A;  3ALG A;  4JFL A;  1J4H A;  2XP5 A;  3CHE A;  1FKH A;  1F8A B;  2MPH A;  1FFQ A;  4FN2 A;  5HW6 A;  3CH9 A;  1H0I A;  4ODR A;  1OGG A;  1Q6I A;  5JH8 A;  4DWS D;  3ALF A;  3EY6 A;  2MLY A;  1A7X A;  5GQB A;  1BKF A;  2DG4 A;  3IK8 A;  2MLZ A;  3RME A;  5HWB A;  3TC5 A;  2G8Z A;  3CZ8 A;  1E44 A;  3NI6 A;  3WIJ A;  3WQW A;  3JYM A;  4Q7N A;  1UR9 A;  1Q1C A;  2WK2 A;  3B9E A;  2DT1 A;  2XPB A;  3O5K A;  1E9L A;  2RUC A;  2XP8 A;  4DRN A;  4UDM A;  4WJX A;  2PPN A;  1R9H A;  1D7H A;  2RUQ A;  4AY1 A;  1Y0O A;  2PBC A;  3KAG A;  3EIP A;  4J4O A;  4U84 A;  1ROT A;  1LQ0 A;  2DT0 A;  3JXV A;  2RQS A;  1KT1 A; 
#chains in the Genus database with same CATH homology
 1EYM A;  3UF8 A;  4LAY A;  2WLY A;  5HKG A;  1W9U A;  3KAC A;  3ARQ A;  3PA7 A;  1KT0 A;  2ZR6 A;  4R0X A;  3O5D A;  4DH0 A;  1LL7 A;  2A3B A;  4HBE A;  4DWS B;  5DO2 A;  4MNM A;  4L72 B;  2DSV A;  3O5Q A;  1SR0 A;  4Z2H A;  3PRA A;  3O5P A;  1BL4 A;  3O5I A;  4W9O A;  2XP4 A;  2LKN A;  3G6M A;  3QOK A;  3UQA A;  3O5M A;  4PTM A;  1D2K A;  3I6C A;  1LG2 A;  2PV1 A;  4N19 A;  3PRB A;  4Z2L A;  2MF9 A;  4TW6 A;  4LAW A;  4S3K A;  3WQV A;  2FDM A;  1EQ3 A;  1XHG A;  2DPE A;  2XP3 A;  5HW8 A;  1EIB A;  2QF8 A;  5HWC A;  3AS2 A;  4TW7 A;  4ZPW R;  1YW5 A;  2KGJ A;  1Q6H A;  3AS1 A;  4P8U A;  1NWT A;  4QT3 A;  1GOI A;  4Q22 A;  1FKB A;  5HTG A;  2D9F A;  3AQU A;  3OA5 A;  1HKI A;  3CHC A;  3WD1 A;  1QZ2 A;  1FKF A;  2AWG A;  3PR9 A;  1P5Q A;  4ODK A;  2M1I A;  1JVW A;  5GPR A;  3KAH A;  5DIU A;  4GGQ A;  4ITZ A;  1VF8 A;  4URI A;  5DEZ A;  4JYS A;  3BXW A;  1PBK A;  2PPO A;  3O5E A;  2DSU A;  1HKJ A;  3FY1 A;  3IKD A;  4DT4 A;  3ARS A;  3B9D A;  3AS0 A;  2DT2 A;  4C02 B;  2WLZ A;  4JFI A;  1JNT A;  4MTV A;  1B6C A;  4TYO A;  2PPP A;  4ML4 A;  2XP7 A;  1FKS A;  2XP9 A;  1LG1 A;  3IKG A;  2A3A A;  2ITK A;  2IF4 A;  2WM0 A;  4DWS A;  4MNL A;  1IX5 A;  3RM4 A;  2ZQU A;  2KI3 A;  1UR8 A;  1O6I A;  1J6Y A;  3ARP A;  3JYJ A;  1NWR A;  3ARV A;  3FAP A;  1EHN A;  3AS3 A;  1NH6 A;  1FKK A;  1U79 A;  4L3N A;  3ARY A;  3UI6 A;  5HUA A;  4DRK A;  2DSZ A;  3RM9 A;  3KAF A;  4MAV A;  3WL0 A;  1JNE A;  4Z2J A;  1N1A A;  4MGV A;  1E15 A;  3KAI A;  1QPL A;  3O5J A;  3O5O A;  3KAB A;  4Z2K A;  3WD4 A;  1FKG A;  4TW8 A;  4ODL A;  1W1T A;  3WH0 A;  2FKE A;  4R5E A;  4ZS6 A;  1W1P A;  1ITX A;  3UI4 A;  1SYT A;  3B8S A;  3TDB A;  2DSW A;  2KFW A;  1HJW A;  4JFM A;  5HW7 A;  2OLH A;  4HBO A;  3KCE A;  2F4E A;  3ARW A;  2VN1 A;  2K8I A;  1QPF A;  4JFK A;  4DZ2 A;  1ZBW A;  1ZU8 A;  3PRD A;  1FJD A;  1X6L A;  1ZBK A;  1HJX A;  4DIP A;  1T11 A;  3GPK A;  3UQB A;  1WAW A;  1W9P A;  4MPK A;  1HJV A;  1XRV A;  1FKJ A;  1ZK6 A;  2KO7 A;  3H9R B;  4G50 A;  5HBF A;  4IPX A;  4IT6 A;  4DWS C;  1W1V A;  3CHD A;  2A3C A;  3ARZ A;  4IT4 A;  4G2P A;  3VAW A;  2L2S A;  1HKM A;  4MNJ A;  1E6R A;  3G6L A;  2OFN A;  1FKR A;  2DG9 A;  1W26 A;  1NWU A;  4WIW A;  4QIB A;  2A3E A;  4ZPT R;  4ODN A;  2ZR4 A;  3WD2 A;  5GPG A;  1JNS A;  1GUV A;  1J4R A;  1TCO C;  1L1P A;  2Y78 A;  2O9O A;  3ARX A;  1NSG A;  4W5U A;  5BXJ A;  2DT3 A;  5DIV A;  1W9V A;  4ODP A;  1FD9 A;  1EDQ A;  4MSP A;  2M2A A;  2JZV A;  3RM8 A;  2M08 A;  4Z2G A;  1ZB5 A;  3MDY B;  3O5R A;  4IQC A;  1D7I A;  1OGB A;  2PI6 A;  3ART A;  1FKD A;  3CGM A;  2ZQS A;  1FKT A;  4WKF A;  4ZPV R;  4QT2 A;  1WB0 A;  2XP6 A;  1E6N A;  2UZ5 A;  4DRH A;  4ODM A;  1NWS A;  4ODO A;  1W1Y A;  4MNK A;  5DF0 A;  3IHZ A;  2Q5A A;  2F21 A;  3KAD A;  1D7J A;  1KFW A;  2O92 A;  2KR7 A;  3TCZ A;  3NRK A;  4IQ2 A;  1C9H A;  2YBU A;  3RFW A;  1F40 A;  1HXV A;  1ZBC A;  2F2D A;  3UQI A;  1YAT A;  4DRQ A;  1OWQ A;  1D6O A;  4DRI A;  1X6N A;  4HAR A;  2KE0 A;  4GIV A;  4NZC A;  3WD3 A;  4LAV A;  4NNR A;  4DZ3 A;  4P8V A;  3NTP A;  2RSE A;  2LPV A;  2IUZ A;  1CTN A;  2LJ4 A;  3UI5 A;  1FAP A;  2N87 A;  4KR0 B;  4WKH A;  1Q6U A;  4W9P A;  1ROU A;  4WK9 A;  5HT1 A;  4DRJ A;  4Z2I A;  2G41 A;  4JFJ A;  4P8X A;  1PIN A;  4S3J A;  3WKZ A;  1ZL1 A;  3O5G A;  2ZQT A;  4J4N A;  1FKL A;  1WNO A;  1LL4 A;  1JND A;  1FFR A;  4TX0 A;  1RD6 A;  5I98 A;  4DRM A;  2YBT A;  4LGX A;  4LAX A;  2PV3 A;  3O5F A;  4U86 A;  3B7X A;  2RUD A;  3ARO A;  1HKK A;  5B8I C;  4BF8 A;  2DG3 A;  4P8W A;  1LJY A;  3CHF A;  2MNT A;  1H0G A;  3ARU A;  3LUO A;  4DRO A;  3CGN A;  2LGO A;  3ARR A;  2FAP A;  5D75 A;  4ODQ A;  3FXY A;  3OOB A;  1E6P A;  1J4I A;  5DIT A;  1K9T A;  4KQZ A;  4WKA A;  2ZQV A;  2PV2 A;  2AOS A;  3ODK A;  1ZBV A;  4U85 A;  3WD0 A;  5J6E A;  1GPF A;  1ZCN A;  3O5L A;  4QZV B;  4TNS A;  1LL6 A;  3W4R A;  3WL1 A;  1NMV A;  3KZ7 A;  1NMW A;  2RUR A;  4O2T A;  4DRP A;  4NSB A;  2XPA A;  2MLX A;  2ESC A;  4XAK A;  2VCD A;  4W9Q A;  1FKI A;  1TFV A;  2B31 A;  3B9A A;  3RGC A;  1M5Y A;  4FAP A;  2ZR5 A;  1E6Z A;  3ALG A;  4JFL A;  1J4H A;  2XP5 A;  3CHE A;  1FKH A;  1F8A B;  2MPH A;  1FFQ A;  4FN2 A;  5HW6 A;  3CH9 A;  1H0I A;  4ODR A;  1OGG A;  1Q6I A;  5JH8 A;  4DWS D;  3ALF A;  3EY6 A;  2MLY A;  1A7X A;  5GQB A;  1BKF A;  2DG4 A;  3IK8 A;  2MLZ A;  3RME A;  5HWB A;  3TC5 A;  2G8Z A;  3CZ8 A;  3WIJ A;  3NI6 A;  3WQW A;  3JYM A;  4Q7N A;  1UR9 A;  1Q1C A;  2WK2 A;  3B9E A;  2DT1 A;  2XPB A;  3O5K A;  1E9L A;  2RUC A;  2XP8 A;  4DRN A;  4WJX A;  2PPN A;  1R9H A;  1D7H A;  2RUQ A;  4AY1 A;  1Y0O A;  2PBC A;  3KAG A;  4J4O A;  4U84 A;  1ROT A;  1LQ0 A;  2DT0 A;  3JXV A;  2RQS A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...