4HC8A

Crystal structure of probable enoyl-coa hydratase echa3 (rv0632c, nysgrc-019494) from mycobacterium tuberculosis h37rv
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
236
structure length
236
Chain Sequence
DPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGLAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of probable enoyl-CoA hydratase ECHA3 (Rv0632c, NYSGRC-019494) from Mycobacterium Tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase/isomerase family protein
total genus 82
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4hc8A00
4RYFH 3TLFA 3HE2A 2A7KA 1WDMA 5FUSA 4HC8A 4I4ZA 3PEAA 3OT6A 4QIIA 5IKLB 2F6QA 4JVTA 3FDUA 3RRVA 4U1AA 4JJTA 4G2RA 2FBMA 2PBPA 1Q52A 4JYJA 1WDKA 1HNOA 4KD6A 4JWVA 1JXZA 1HNUA 3R0OA 4K2NA 1X0UA 1TYFA 2FW2A 4ELXA 3ZWCA 4DI1A 3R6HA 3M6NA 3ISAA 4RYFA 4B3JA 4ELSA 3H0QA 3QK8A 3GKBA 2PG8A 3Q0JA 1J7XA 3SLLA 4Q1IA 3TRRA 4K29A 4JFCA 4FZWC 3JU1A 3R9QA 3STAA 1DCIA 3V5EA 4MOUA 4FN7A 3T89A 3MOYA 2VSSE 4OG1A 3QKAA 3GMAA 2VSUA 5E0SH 1O8UA 4FNDA 4KPKA 5DU4A 1PIXA 3TVWA 1YG8A 1N6FA 4ZDBA 2QQ3A 3QWDA 3QREA 2FZSA 4L8KA 5CTCA 3RSTA 4QIJA 1RJNA 3QXZA 3OC7A 1FCFA 4IZBA 3KTGA 5INGA 4U0GH 5FIFA 4ZDCA 3TDCA 5JBXA 3GF7A 4FZWA 3BEZA 5DUCA 3KTJA 4WCZA 5MGBA 1EF9A 2A81A 3Q7HA 2J5IB 3H81A 1FC9A 3HP0A 4IZCA 3U9SB 2F9IA 2F9YB 4LK5A 3PE8A 3R9TA 3TV5A 2VSSF 2DUBA 1NZYB 2DEOA 2X24A 2HW5A 4IZDA 5DU8A 3WG5A 2Q35A 4JYLA 5G1QA 4Q0GA 3BPPA 1WZ8A 1UYSA 4U0GA 1UYTA 2UZFA 3PZKA 3LAOA 5DL1A 2CBYA 3KQFA 5JBWA 1OD4A 3ZW9A 4JCQA 4GM2A 2J5GD 3T8BA 1K39A 1DUBA 2VSSA 3U9RB 2J5IA 4MI2A 2ZL4A 2NP9A 5C90A 3GLMA 3G64A 2X58A 3L3SA 5E0SA 3GF3A 1XNYA 2D3TA 1N6EA 3ZWBA 3KTHA 1SG4A 5DZKA 4JCRA 4JCSA 2GTRA 2EJ5A 4I42A 3PGQA 4MXIA 5DU6A 5DKPA 3R9SA 2ZQRA 1WDLA 2Q2XA 1XX4A 1YG6A 3MT6A 4OLQA 3H0SA 2J5GA 3P2LA 2Q34A 1SZOA 5DZKH 2BZRA 3TT6A 2CE3A 1OD2A 4GHNA 4FJWD 4L6WA 4QFEA 4YLHA 1UYVA 3NJDA 3I47A 3LKEA 4ZDDA 1ON9A 5INFA 4I52A 4KNPA 2ZQQA 2IEXA 3P85A 4EMPA 3MFMA 4WZ8B 4JSBA 1RJMA 1HZDA 5DTWA 4EMMA 3HLN1 2ZL0A 4EMLA 3DJAA 3OMEA 4FB8A 3T88A 1MJ3A 2W3PA 2WTBA 3H0JA 4K3WA 1FC7A 4ZDEA 2VSUC 3TT7A 4ZU2A 4U18A 2ZL3A 3V5IA 1N6DA 4B3IA 2VREA 3IB9A 3Q0GA 4ASIA 1PJHA 4JOTA 3H0UA 1K32A 4JCTA 2C8TA 3KTIA 5INIA 5CTBA 3HINA 5E0NX 3DORA 1FC6A 1EY3A 4HNKA 1XNWA 1XO6A 3MYBA 3H02A 2VSUF 4B3HA 4ZDFA 3U9TB 5DUFA 2F9YA 2J5II 3HRXA 2A7SA 4NNQA 3N6RB 4U19A 3K50A 4FN8A 3IAVA 3VIVA 5G1SA 1UIYA 3FF6A 5C9GA 4U0HA 5KDRB 1VRGA 2ZL2A 3K8XA 2VSUE 3Q1TA 1UYRA 4ELWA 1XNVA 4FNBA 3RSIA 3T3WA 3TVUA 2F9IB 1ON3A 3BF0A 5KJPA 5DTPA 1EF8A 1Q51A 2F6IA 3P5MA 5KDRA 3NJBA 1NZYA 2VX2A 3QYRA 4NEKA 3SWXA 3T8AA 4RCNA 3TZ3A 3ZW8A 4KWBA 4OMRA 3QXIA 3M6MA 3IBBA 1Y7OA 2PPYA 4WYOB 1TG6A 4Z0MA 5G1RA 2J5SA 3KTKA 3ST9A 1W2XA 4F47A 3QMJA 3ZWAA
chains in the Genus database with same CATH superfamily
4RYFH 3TLFA 3HE2A 2A7KA 1WDMA 5FUSA 4HC8A 4I4ZA 3PEAA 3OT6A 4QIIA 5IKLB 2F6QA 4JVTA 3FDUA 3RRVA 4U1AA 4JJTA 4G2RA 2FBMA 2PBPA 1Q52A 4JYJA 1WDKA 1HNOA 4KD6A 4JWVA 1JXZA 1HNUA 3R0OA 4K2NA 1X0UA 1TYFA 2FW2A 4ELXA 3ZWCA 4DI1A 3R6HA 3M6NA 3ISAA 4RYFA 4B3JA 2YJGA 4ELSA 3H0QA 3QK8A 3GKBA 2PG8A 3Q0JA 1J7XA 3SLLA 4Q1IA 3TRRA 4K29A 4JFCA 4FZWC 3JU1A 3R9QA 3STAA 1DCIA 3V5EA 4MOUA 4FN7A 3T89A 3MOYA 2VSSE 4OG1A 3QKAA 3GMAA 2VSUA 5E0SH 1O8UA 4FNDA 4KPKA 5DU4A 1PIXA 3TVWA 1YG8A 1N6FA 4ZDBA 2QQ3A 3QWDA 3QREA 2FZSA 4L8KA 5CTCA 3RSTA 4QIJA 1RJNA 3QXZA 3OC7A 1FCFA 5HUQA 4IZBA 3KTGA 5INGA 4J2UA 4U0GH 5FIFA 4ZDCA 3TDCA 5JBXA 3GF7A 4FZWA 3BEZA 5DUCA 3KTJA 4WCZA 5MGBA 1EF9A 3BPTA 2A81A 3Q7HA 2J5IB 3H81A 1FC9A 3HP0A 4IZCA 3U9SB 2F9IA 2F9YB 4LK5A 3PE8A 3R9TA 3TV5A 2VSSF 2DUBA 1NZYB 2DEOA 2X24A 2HW5A 4IZDA 5DU8A 3WG5A 2Q35A 4JYLA 5G1QA 4Q0GA 3BPPA 1WZ8A 1UYSA 4U0GA 1UYTA 2UZFA 3PZKA 3LAOA 5DL1A 2CBYA 3KQFA 5JBWA 1OD4A 3ZW9A 4JCQA 4GM2A 2J5GD 3T8BA 1K39A 1DUBA 2VSSA 3U9RB 2J5IA 4MI2A 2ZL4A 2NP9A 5C90A 3GLMA 3G64A 2X58A 3L3SA 5E0SA 3GF3A 1XNYA 2D3TA 1N6EA 3ZWBA 3KTHA 1SG4A 5DZKA 4JCRA 4JCSA 2GTRA 2EJ5A 4I42A 3PGQA 4MXIA 5DU6A 5DKPA 3R9SA 2ZQRA 1WDLA 2Q2XA 1XX4A 1YG6A 3MT6A 4OLQA 3H0SA 2J5GA 3P2LA 2Q34A 1SZOA 5DZKH 2BZRA 3TT6A 2CE3A 1OD2A 4GHNA 4FJWD 4L6WA 4QFEA 4YLHA 1UYVA 3NJDA 3I47A 3LKEA 4ZDDA 1ON9A 5INFA 4I52A 4KNPA 2ZQQA 2IEXA 3P85A 4EMPA 3MFMA 4WZ8B 4JSBA 1RJMA 1HZDA 5DTWA 4EMMA 3HLN1 2ZL0A 4EMLA 3DJAA 3OMEA 4FB8A 3T88A 1MJ3A 2W3PA 2WTBA 3H0JA 4K3WA 1FC7A 4ZDEA 2VSUC 3TT7A 4ZU2A 4U18A 2ZL3A 3V5IA 1N6DA 4B3IA 2VREA 3IB9A 3Q0GA 4ASIA 1PJHA 4JOTA 3H0UA 1K32A 4JCTA 2C8TA 3KTIA 5INIA 5CTBA 3HINA 4NARA 5E0NX 3DORA 1FC6A 1EY3A 4HNKA 1XNWA 1XO6A 3MYBA 3H02A 2VSUF 4B3HA 4ZDFA 3U9TB 4HDTA 5DUFA 2F9YA 2J5II 3HRXA 2A7SA 4NNQA 3N6RB 4U19A 3K50A 4FN8A 3IAVA 3VIVA 5G1SA 1UIYA 3FF6A 5C9GA 4U0HA 5KDRB 1VRGA 2ZL2A 3K8XA 2VSUE 3Q1TA 1UYRA 4ELWA 1XNVA 4FNBA 3RSIA 3T3WA 3TVUA 2F9IB 1ON3A 3BF0A 5KJPA 5DTPA 1EF8A 1Q51A 2F6IA 3P5MA 5KDRA 3NJBA 1NZYA 2VX2A 3QYRA 4NEKA 3SWXA 3T8AA 4RCNA 3TZ3A 3ZW8A 4KWBA 4OMRA 3QXIA 3M6MA 3IBBA 1Y7OA 2PPYA 4WYOB 1TG6A 4Z0MA 5G1RA 2J5SA 3KTKA 3ST9A 1W2XA 4F47A 3QMJA 3ZWAA
chains in the Genus database with same CATH topology
4RYFH 3TLFA 3HE2A 2A7KA 1WDMA 5FUSA 4HC8A 4I4ZA 3PEAA 3OT6A 4QIIA 5IKLB 2F6QA 4JVTA 3FDUA 3RRVA 4U1AA 4JJTA 4G2RA 2FBMA 2PBPA 1Q52A 4JYJA 1WDKA 1HNOA 4KD6A 4JWVA 1JXZA 1HNUA 3R0OA 4K2NA 1X0UA 1TYFA 2FW2A 4ELXA 3ZWCA 4DI1A 3R6HA 3M6NA 3ISAA 4RYFA 4B3JA 2YJGA 4ELSA 3H0QA 3QK8A 3GKBA 2PG8A 3Q0JA 1J7XA 3SLLA 4Q1IA 3TRRA 4K29A 4JFCA 4FZWC 3JU1A 3R9QA 3STAA 1DCIA 3V5EA 4MOUA 4FN7A 3T89A 3MOYA 2VSSE 4OG1A 3QKAA 3GMAA 2VSUA 5E0SH 1O8UA 4FNDA 4KPKA 5DU4A 1PIXA 3TVWA 1YG8A 1N6FA 4ZDBA 2QQ3A 3QWDA 3QREA 2FZSA 4L8KA 5CTCA 3RSTA 4QIJA 1RJNA 3QXZA 3OC7A 1FCFA 5HUQA 4IZBA 3KTGA 5INGA 4J2UA 4U0GH 5FIFA 4ZDCA 3TDCA 5JBXA 3GF7A 4FZWA 3BEZA 5DUCA 3KTJA 4WCZA 5MGBA 1EF9A 3BPTA 2A81A 3Q7HA 2J5IB 3H81A 1FC9A 3HP0A 4IZCA 3U9SB 2F9IA 2F9YB 4LK5A 3PE8A 3R9TA 3TV5A 2VSSF 2DUBA 1NZYB 2DEOA 2X24A 2HW5A 4IZDA 5DU8A 3WG5A 2Q35A 4JYLA 5G1QA 4Q0GA 3BPPA 1WZ8A 1UYSA 4U0GA 1UYTA 2UZFA 3PZKA 3LAOA 5DL1A 2CBYA 3KQFA 5JBWA 1OD4A 3ZW9A 4JCQA 4GM2A 2J5GD 3T8BA 1K39A 1DUBA 2VSSA 3U9RB 2J5IA 4MI2A 2ZL4A 2NP9A 5C90A 3GLMA 3G64A 2X58A 3L3SA 5E0SA 3GF3A 1XNYA 2D3TA 1N6EA 3ZWBA 3KTHA 1SG4A 5DZKA 4JCRA 4JCSA 2GTRA 2EJ5A 4I42A 3PGQA 4MXIA 5DU6A 5DKPA 3R9SA 2ZQRA 1WDLA 2Q2XA 1XX4A 1YG6A 3MT6A 4OLQA 3H0SA 2J5GA 3P2LA 2Q34A 1SZOA 5DZKH 2BZRA 3TT6A 2CE3A 1OD2A 4GHNA 4FJWD 4L6WA 4QFEA 4YLHA 1UYVA 3NJDA 3I47A 3LKEA 4ZDDA 1ON9A 5INFA 4I52A 4KNPA 2ZQQA 2IEXA 3P85A 4EMPA 3MFMA 4WZ8B 4JSBA 1RJMA 1HZDA 5DTWA 4EMMA 3HLN1 2ZL0A 4EMLA 3DJAA 3OMEA 4FB8A 3T88A 1MJ3A 2W3PA 2WTBA 3H0JA 4K3WA 1FC7A 4ZDEA 2VSUC 3TT7A 4ZU2A 4U18A 2ZL3A 3V5IA 1N6DA 4B3IA 2VREA 3IB9A 3Q0GA 4ASIA 1PJHA 4JOTA 3H0UA 1K32A 4JCTA 2C8TA 3KTIA 5INIA 5CTBA 3HINA 4NARA 5E0NX 3DORA 1FC6A 1EY3A 4HNKA 1XNWA 1XO6A 3MYBA 3H02A 2VSUF 4B3HA 4ZDFA 3U9TB 4HDTA 5DUFA 2F9YA 2J5II 3HRXA 2A7SA 4NNQA 3N6RB 4U19A 3K50A 4FN8A 3IAVA 3VIVA 5G1SA 1UIYA 3FF6A 5C9GA 4U0HA 5KDRB 1VRGA 2ZL2A 3K8XA 2VSUE 3Q1TA 1UYRA 4ELWA 1XNVA 4FNBA 3RSIA 3T3WA 3TVUA 2F9IB 1ON3A 3BF0A 5KJPA 5DTPA 1EF8A 1Q51A 2F6IA 3P5MA 5KDRA 3NJBA 1NZYA 2VX2A 3QYRA 4NEKA 3SWXA 3T8AA 4RCNA 3TZ3A 3ZW8A 4KWBA 4OMRA 3QXIA 3M6MA 3IBBA 1Y7OA 2PPYA 4WYOB 1TG6A 4Z0MA 5G1RA 2J5SA 3KTKA 3ST9A 1W2XA 4F47A 3QMJA 3ZWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYF H;  3TLF A;  3HE2 A;  2A7K A;  1WDM A;  5FUS A;  4HC8 A;  4I4Z A;  3PEA A;  3OT6 A;  4QII A;  5IKL B;  2F6Q A;  4JVT A;  3FDU A;  3RRV A;  4U1A A;  4JJT A;  4G2R A;  2FBM A;  2PBP A;  1Q52 A;  4JYJ A;  1WDK A;  1HNO A;  4KD6 A;  4JWV A;  1JXZ A;  1HNU A;  3R0O A;  4K2N A;  1X0U A;  1TYF A;  2FW2 A;  4ELX A;  3ZWC A;  4DI1 A;  3R6H A;  3M6N A;  3ISA A;  4RYF A;  4B3J A;  4ELS A;  3H0Q A;  3QK8 A;  3GKB A;  2PG8 A;  3Q0J A;  1J7X A;  3SLL A;  4Q1I A;  3TRR A;  4K29 A;  4JFC A;  4FZW C;  3JU1 A;  3R9Q A;  3STA A;  1DCI A;  3V5E A;  4MOU A;  4FN7 A;  3T89 A;  3MOY A;  2VSS E;  4OG1 A;  3QKA A;  3GMA A;  2VSU A;  5E0S H;  1O8U A;  4FND A;  4KPK A;  5DU4 A;  1PIX A;  3TVW A;  1YG8 A;  1N6F A;  4ZDB A;  2QQ3 A;  3QWD A;  3QRE A;  2FZS A;  4L8K A;  5CTC A;  3RST A;  4QIJ A;  1RJN A;  3QXZ A;  3OC7 A;  1FCF A;  4IZB A;  3KTG A;  5ING A;  4U0G H;  5FIF A;  4ZDC A;  3TDC A;  5JBX A;  3GF7 A;  4FZW A;  3BEZ A;  5DUC A;  3KTJ A;  4WCZ A;  5MGB A;  1EF9 A;  2A81 A;  3Q7H A;  2J5I B;  3H81 A;  1FC9 A;  3HP0 A;  4IZC A;  3U9S B;  2F9I A;  2F9Y B;  4LK5 A;  3PE8 A;  3R9T A;  3TV5 A;  2VSS F;  2DUB A;  1NZY B;  2DEO A;  2X24 A;  2HW5 A;  4IZD A;  5DU8 A;  3WG5 A;  2Q35 A;  4JYL A;  5G1Q A;  4Q0G A;  3BPP A;  1WZ8 A;  1UYS A;  4U0G A;  1UYT A;  2UZF A;  3PZK A;  3LAO A;  5DL1 A;  2CBY A;  3KQF A;  5JBW A;  1OD4 A;  3ZW9 A;  4JCQ A;  4GM2 A;  2J5G D;  3T8B A;  1K39 A;  1DUB A;  2VSS A;  3U9R B;  2J5I A;  4MI2 A;  2ZL4 A;  2NP9 A;  5C90 A;  3GLM A;  3G64 A;  2X58 A;  3L3S A;  5E0S A;  3GF3 A;  1XNY A;  2D3T A;  1N6E A;  3ZWB A;  3KTH A;  1SG4 A;  5DZK A;  4JCR A;  4JCS A;  2GTR A;  2EJ5 A;  4I42 A;  3PGQ A;  4MXI A;  5DU6 A;  5DKP A;  3R9S A;  2ZQR A;  1WDL A;  2Q2X A;  1XX4 A;  1YG6 A;  3MT6 A;  4OLQ A;  3H0S A;  2J5G A;  3P2L A;  2Q34 A;  1SZO A;  5DZK H;  2BZR A;  3TT6 A;  2CE3 A;  1OD2 A;  4GHN A;  4FJW D;  4L6W A;  4QFE A;  4YLH A;  1UYV A;  3NJD A;  3I47 A;  3LKE A;  4ZDD A;  1ON9 A;  5INF A;  4I52 A;  4KNP A;  2ZQQ A;  2IEX A;  3P85 A;  4EMP A;  3MFM A;  4WZ8 B;  4JSB A;  1RJM A;  1HZD A;  5DTW A;  4EMM A;  3HLN 1;  2ZL0 A;  4EML A;  3DJA A;  3OME A;  4FB8 A;  3T88 A;  1MJ3 A;  2W3P A;  2WTB A;  3H0J A;  4K3W A;  1FC7 A;  4ZDE A;  2VSU C;  3TT7 A;  4ZU2 A;  4U18 A;  2ZL3 A;  3V5I A;  1N6D A;  4B3I A;  2VRE A;  3IB9 A;  3Q0G A;  4ASI A;  1PJH A;  4JOT A;  3H0U A;  1K32 A;  4JCT A;  2C8T A;  3KTI A;  5INI A;  5CTB A;  3HIN A;  5E0N X;  3DOR A;  1FC6 A;  1EY3 A;  4HNK A;  1XNW A;  1XO6 A;  3MYB A;  3H02 A;  2VSU F;  4B3H A;  4ZDF A;  3U9T B;  5DUF A;  2F9Y A;  2J5I I;  3HRX A;  2A7S A;  4NNQ A;  3N6R B;  4U19 A;  3K50 A;  4FN8 A;  3IAV A;  3VIV A;  5G1S A;  1UIY A;  3FF6 A;  5C9G A;  4U0H A;  5KDR B;  1VRG A;  2ZL2 A;  3K8X A;  2VSU E;  3Q1T A;  1UYR A;  4ELW A;  1XNV A;  4FNB A;  3RSI A;  3T3W A;  3TVU A;  2F9I B;  1ON3 A;  3BF0 A;  5KJP A;  5DTP A;  1EF8 A;  1Q51 A;  2F6I A;  3P5M A;  5KDR A;  3NJB A;  1NZY A;  2VX2 A;  3QYR A;  4NEK A;  3SWX A;  3T8A A;  4RCN A;  3TZ3 A;  3ZW8 A;  4KWB A;  4OMR A;  3QXI A;  3M6M A;  3IBB A;  1Y7O A;  2PPY A;  4WYO B;  1TG6 A;  4Z0M A;  5G1R A;  2J5S A;  3KTK A;  3ST9 A;  1W2X A;  4F47 A;  3QMJ A;  3ZWA A; 
#chains in the Genus database with same CATH topology
 4RYF H;  3TLF A;  3HE2 A;  2A7K A;  1WDM A;  5FUS A;  4HC8 A;  4I4Z A;  3PEA A;  3OT6 A;  4QII A;  5IKL B;  2F6Q A;  4JVT A;  3FDU A;  3RRV A;  4U1A A;  4JJT A;  4G2R A;  2FBM A;  2PBP A;  1Q52 A;  4JYJ A;  1WDK A;  1HNO A;  4KD6 A;  4JWV A;  1JXZ A;  1HNU A;  3R0O A;  4K2N A;  1X0U A;  1TYF A;  2FW2 A;  4ELX A;  3ZWC A;  4DI1 A;  3R6H A;  3M6N A;  3ISA A;  4RYF A;  4B3J A;  2YJG A;  4ELS A;  3H0Q A;  3QK8 A;  3GKB A;  2PG8 A;  3Q0J A;  1J7X A;  3SLL A;  4Q1I A;  3TRR A;  4K29 A;  4JFC A;  4FZW C;  3JU1 A;  3R9Q A;  3STA A;  1DCI A;  3V5E A;  4MOU A;  4FN7 A;  3T89 A;  3MOY A;  2VSS E;  4OG1 A;  3QKA A;  3GMA A;  2VSU A;  5E0S H;  1O8U A;  4FND A;  4KPK A;  5DU4 A;  1PIX A;  3TVW A;  1YG8 A;  1N6F A;  4ZDB A;  2QQ3 A;  3QWD A;  3QRE A;  2FZS A;  4L8K A;  5CTC A;  3RST A;  4QIJ A;  1RJN A;  3QXZ A;  3OC7 A;  1FCF A;  5HUQ A;  4IZB A;  3KTG A;  5ING A;  4J2U A;  4U0G H;  5FIF A;  4ZDC A;  3TDC A;  5JBX A;  3GF7 A;  4FZW A;  3BEZ A;  5DUC A;  3KTJ A;  4WCZ A;  5MGB A;  1EF9 A;  3BPT A;  2A81 A;  3Q7H A;  2J5I B;  3H81 A;  1FC9 A;  3HP0 A;  4IZC A;  3U9S B;  2F9I A;  2F9Y B;  4LK5 A;  3PE8 A;  3R9T A;  3TV5 A;  2VSS F;  2DUB A;  1NZY B;  2DEO A;  2X24 A;  2HW5 A;  4IZD A;  5DU8 A;  3WG5 A;  2Q35 A;  4JYL A;  5G1Q A;  4Q0G A;  3BPP A;  1WZ8 A;  1UYS A;  4U0G A;  1UYT A;  2UZF A;  3PZK A;  3LAO A;  5DL1 A;  2CBY A;  3KQF A;  5JBW A;  1OD4 A;  3ZW9 A;  4JCQ A;  4GM2 A;  2J5G D;  3T8B A;  1K39 A;  1DUB A;  2VSS A;  3U9R B;  2J5I A;  4MI2 A;  2ZL4 A;  2NP9 A;  5C90 A;  3GLM A;  3G64 A;  2X58 A;  3L3S A;  5E0S A;  3GF3 A;  1XNY A;  2D3T A;  1N6E A;  3ZWB A;  3KTH A;  1SG4 A;  5DZK A;  4JCR A;  4JCS A;  2GTR A;  2EJ5 A;  4I42 A;  3PGQ A;  4MXI A;  5DU6 A;  5DKP A;  3R9S A;  2ZQR A;  1WDL A;  2Q2X A;  1XX4 A;  1YG6 A;  3MT6 A;  4OLQ A;  3H0S A;  2J5G A;  3P2L A;  2Q34 A;  1SZO A;  5DZK H;  2BZR A;  3TT6 A;  2CE3 A;  1OD2 A;  4GHN A;  4FJW D;  4L6W A;  4QFE A;  4YLH A;  1UYV A;  3NJD A;  3I47 A;  3LKE A;  4ZDD A;  1ON9 A;  5INF A;  4I52 A;  4KNP A;  2ZQQ A;  2IEX A;  3P85 A;  4EMP A;  3MFM A;  4WZ8 B;  4JSB A;  1RJM A;  1HZD A;  5DTW A;  4EMM A;  3HLN 1;  2ZL0 A;  4EML A;  3DJA A;  3OME A;  4FB8 A;  3T88 A;  1MJ3 A;  2W3P A;  2WTB A;  3H0J A;  4K3W A;  1FC7 A;  4ZDE A;  2VSU C;  3TT7 A;  4ZU2 A;  4U18 A;  2ZL3 A;  3V5I A;  1N6D A;  4B3I A;  2VRE A;  3IB9 A;  3Q0G A;  4ASI A;  1PJH A;  4JOT A;  3H0U A;  1K32 A;  4JCT A;  2C8T A;  3KTI A;  5INI A;  5CTB A;  3HIN A;  4NAR A;  5E0N X;  3DOR A;  1FC6 A;  1EY3 A;  4HNK A;  1XNW A;  1XO6 A;  3MYB A;  3H02 A;  2VSU F;  4B3H A;  4ZDF A;  3U9T B;  4HDT A;  5DUF A;  2F9Y A;  2J5I I;  3HRX A;  2A7S A;  4NNQ A;  3N6R B;  4U19 A;  3K50 A;  4FN8 A;  3IAV A;  3VIV A;  5G1S A;  1UIY A;  3FF6 A;  5C9G A;  4U0H A;  5KDR B;  1VRG A;  2ZL2 A;  3K8X A;  2VSU E;  3Q1T A;  1UYR A;  4ELW A;  1XNV A;  4FNB A;  3RSI A;  3T3W A;  3TVU A;  2F9I B;  1ON3 A;  3BF0 A;  5KJP A;  5DTP A;  1EF8 A;  1Q51 A;  2F6I A;  3P5M A;  5KDR A;  3NJB A;  1NZY A;  2VX2 A;  3QYR A;  4NEK A;  3SWX A;  3T8A A;  4RCN A;  3TZ3 A;  3ZW8 A;  4KWB A;  4OMR A;  3QXI A;  3M6M A;  3IBB A;  1Y7O A;  2PPY A;  4WYO B;  1TG6 A;  4Z0M A;  5G1R A;  2J5S A;  3KTK A;  3ST9 A;  1W2X A;  4F47 A;  3QMJ A;  3ZWA A; 
#chains in the Genus database with same CATH homology
 4RYF H;  3TLF A;  3HE2 A;  2A7K A;  1WDM A;  5FUS A;  4HC8 A;  4I4Z A;  3PEA A;  3OT6 A;  4QII A;  5IKL B;  2F6Q A;  4JVT A;  3FDU A;  3RRV A;  4U1A A;  4JJT A;  4G2R A;  2FBM A;  2PBP A;  1Q52 A;  4JYJ A;  1WDK A;  1HNO A;  4KD6 A;  4JWV A;  1JXZ A;  1HNU A;  3R0O A;  4K2N A;  1X0U A;  1TYF A;  2FW2 A;  4ELX A;  3ZWC A;  4DI1 A;  3R6H A;  3M6N A;  3ISA A;  4RYF A;  4B3J A;  2YJG A;  4ELS A;  3H0Q A;  3QK8 A;  3GKB A;  2PG8 A;  3Q0J A;  1J7X A;  3SLL A;  4Q1I A;  3TRR A;  4K29 A;  4JFC A;  4FZW C;  3JU1 A;  3R9Q A;  3STA A;  1DCI A;  3V5E A;  4MOU A;  4FN7 A;  3T89 A;  3MOY A;  2VSS E;  4OG1 A;  3QKA A;  3GMA A;  2VSU A;  5E0S H;  1O8U A;  4FND A;  4KPK A;  5DU4 A;  1PIX A;  3TVW A;  1YG8 A;  1N6F A;  4ZDB A;  2QQ3 A;  3QWD A;  3QRE A;  2FZS A;  4L8K A;  5CTC A;  3RST A;  4QIJ A;  1RJN A;  3QXZ A;  3OC7 A;  1FCF A;  5HUQ A;  4IZB A;  3KTG A;  5ING A;  4J2U A;  4U0G H;  5FIF A;  4ZDC A;  3TDC A;  5JBX A;  3GF7 A;  4FZW A;  3BEZ A;  5DUC A;  3KTJ A;  4WCZ A;  5MGB A;  1EF9 A;  3BPT A;  2A81 A;  3Q7H A;  2J5I B;  3H81 A;  1FC9 A;  3HP0 A;  4IZC A;  3U9S B;  2F9I A;  2F9Y B;  4LK5 A;  3PE8 A;  3R9T A;  3TV5 A;  2VSS F;  2DUB A;  1NZY B;  2DEO A;  2X24 A;  2HW5 A;  4IZD A;  5DU8 A;  3WG5 A;  2Q35 A;  4JYL A;  5G1Q A;  4Q0G A;  3BPP A;  1WZ8 A;  1UYS A;  4U0G A;  1UYT A;  2UZF A;  3PZK A;  3LAO A;  5DL1 A;  2CBY A;  3KQF A;  5JBW A;  1OD4 A;  3ZW9 A;  4JCQ A;  4GM2 A;  2J5G D;  3T8B A;  1K39 A;  1DUB A;  2VSS A;  3U9R B;  2J5I A;  4MI2 A;  2ZL4 A;  2NP9 A;  5C90 A;  3GLM A;  3G64 A;  2X58 A;  3L3S A;  5E0S A;  3GF3 A;  1XNY A;  2D3T A;  1N6E A;  3ZWB A;  3KTH A;  1SG4 A;  5DZK A;  4JCR A;  4JCS A;  2GTR A;  2EJ5 A;  4I42 A;  3PGQ A;  4MXI A;  5DU6 A;  5DKP A;  3R9S A;  2ZQR A;  1WDL A;  2Q2X A;  1XX4 A;  1YG6 A;  3MT6 A;  4OLQ A;  3H0S A;  2J5G A;  3P2L A;  2Q34 A;  1SZO A;  5DZK H;  2BZR A;  3TT6 A;  2CE3 A;  1OD2 A;  4GHN A;  4FJW D;  4L6W A;  4QFE A;  4YLH A;  1UYV A;  3NJD A;  3I47 A;  3LKE A;  4ZDD A;  1ON9 A;  5INF A;  4I52 A;  4KNP A;  2ZQQ A;  2IEX A;  3P85 A;  4EMP A;  3MFM A;  4WZ8 B;  4JSB A;  1RJM A;  1HZD A;  5DTW A;  4EMM A;  3HLN 1;  2ZL0 A;  4EML A;  3DJA A;  3OME A;  4FB8 A;  3T88 A;  1MJ3 A;  2W3P A;  2WTB A;  3H0J A;  4K3W A;  1FC7 A;  4ZDE A;  2VSU C;  3TT7 A;  4ZU2 A;  4U18 A;  2ZL3 A;  3V5I A;  1N6D A;  4B3I A;  2VRE A;  3IB9 A;  3Q0G A;  4ASI A;  1PJH A;  4JOT A;  3H0U A;  1K32 A;  4JCT A;  2C8T A;  3KTI A;  5INI A;  5CTB A;  3HIN A;  4NAR A;  5E0N X;  3DOR A;  1FC6 A;  1EY3 A;  4HNK A;  1XNW A;  1XO6 A;  3MYB A;  3H02 A;  2VSU F;  4B3H A;  4ZDF A;  3U9T B;  4HDT A;  5DUF A;  2F9Y A;  2J5I I;  3HRX A;  2A7S A;  4NNQ A;  3N6R B;  4U19 A;  3K50 A;  4FN8 A;  3IAV A;  3VIV A;  5G1S A;  1UIY A;  3FF6 A;  5C9G A;  4U0H A;  5KDR B;  1VRG A;  2ZL2 A;  3K8X A;  2VSU E;  3Q1T A;  1UYR A;  4ELW A;  1XNV A;  4FNB A;  3RSI A;  3T3W A;  3TVU A;  2F9I B;  1ON3 A;  3BF0 A;  5KJP A;  5DTP A;  1EF8 A;  1Q51 A;  2F6I A;  3P5M A;  5KDR A;  3NJB A;  1NZY A;  2VX2 A;  3QYR A;  4NEK A;  3SWX A;  3T8A A;  4RCN A;  3TZ3 A;  3ZW8 A;  4KWB A;  4OMR A;  3QXI A;  3M6M A;  3IBB A;  1Y7O A;  2PPY A;  4WYO B;  1TG6 A;  4Z0M A;  5G1R A;  2J5S A;  3KTK A;  3ST9 A;  1W2X A;  4F47 A;  3QMJ A;  3ZWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...