4HC8A

Crystal structure of probable enoyl-coa hydratase echa3 (rv0632c, nysgrc-019494) from mycobacterium tuberculosis h37rv
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
236
structure length
236
Chain Sequence
b'DPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGLAENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase family protein
publication title Crystal structure of probable enoyl-CoA hydratase ECHA3 (Rv0632c, NYSGRC-019494) from Mycobacterium Tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 82
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4hc8A00
3HINA 1XNWA 3TVWA 3Q7HA 3LAOA 3RSIA 3H81A 3G64A 2D3TA 3OT6A 2F6QA 1OD4A 5IKLB 1FCFA 2DEOA 1YG6A 4L8KA 4U1AA 3V5EA 3K8XA 4ZDFA 4HC8A 4B3HA 4YLHA 2VSUA 4JWVA 5JBXA 1WDMA 3NJDA 5DZKA 3QKAA 3HE2A 3QXIA 4JYJA 3P85A 2F9YA 3TT6A 4LK5A 5E0SH 5E0NX 3NJBA 3ZWBA 1TYFA 3TVUA 1J7XA 5JBWA 2NP9A 1K32A 5FUSA 3IAVA 1RJMA 3PZKA 3H0JA 3U9TB 2VX2A 4FNDA 3SLLA 4QIJA 3MT6A 5KDRB 3T89A 1VRGA 5MGBA 2J5GD 1XX4A 1SG4A 5INFA 1W2XA 1UYRA 2CBYA 4KPKA 2X58A 4JSBA 1N6DA 3BEZA 5G1QA 1TG6A 4FZWA 1XNYA 1UYVA 2A7SA 1UYSA 3H02A 4JOTA 4Q0GA 1Q52A 3M6MA 4MI2A 5DU6A 1XNVA 4ZDCA 4F47A 4U0GA 4OG1A 3KTKA 3OMEA 2VSUC 1SZOA 5INIA 2J5IA 3KTJA 2J5SA 4HNKA 3R9TA 3ST9A 3FF6A 4G2RA 1FC7A 5KJPA 2C8TA 2PG8A 1JXZA 2VSUF 3R6HA 4I52A 2Q35A 5DZKH 3GF3A 3IB9A 3TT7A 4WZ8B 2WTBA 3R0OA 3IBBA 5CTCA 2X24A 4GHNA 2F9IB 1NZYA 2J5II 5C90A 4GM2A 1HNUA 4JJTA 2ZL2A 4K3WA 1X0UA 4NNQA 3K50A 4I42A 2A7KA 4Z0MA 3H0SA 2A81A 3DORA 4RYFA 2VSSF 1PJHA 3KTGA 2VREA 5DUCA 3Q0GA 4QIIA 1N6FA 1WZ8A 3Q0JA 3TRRA 1DUBA 4B3JA 4K2NA 1RJNA 4FZWC 3T8BA 4JFCA 2CE3A 3QXZA 5DUFA 1HZDA 3QMJA 2GTRA 3ZWCA 3ZWAA 3MYBA 1UYTA 2J5GA 4JCRA 4KD6A 3U9SB 3TV5A 4ELWA 3PEAA 2UZFA 1WDLA 2F9YB 3QWDA 3SWXA 4EMLA 4IZCA 3TDCA 4JCTA 4JCQA 3R9QA 4U18A 3GLMA 5DU4A 4U0GH 4WYOB 3FDUA 3U9RB 3TLFA 1EF8A 2ZQQA 1WDKA 4ASIA 5CTBA 2Q2XA 3QK8A 4IZDA 1FC6A 4OLQA 3LKEA 5DL1A 3RRVA 1FC9A 4JYLA 3T88A 3V5IA 1Q51A 4QFEA 2FW2A 2PBPA 4ZDBA 3L3SA 2BZRA 3QYRA 5KDRA 3GMAA 5DTWA 1N6EA 3KTIA 3BPPA 3KTHA 4NEKA 3H0UA 4I4ZA 4OMRA 4ELSA 4KNPA 2EJ5A 4U19A 2Q34A 3STAA 3T3WA 4FN7A 4EMPA 3JU1A 2IEXA 4FN8A 4ELXA 5INGA 4FNBA 3GF7A 4RYFH 4Q1IA 1MJ3A 2HW5A 4MOUA 3H0QA 1OD2A 3M6NA 3GKBA 5FIFA 5DKPA 4FJWD 4JVTA 5DU8A 2ZL0A 5E0SA 1Y7OA 2J5IB 3WG5A 4L6WA 1PIXA 2FZSA 1DCIA 5G1SA 1EF9A 1O8UA 2VSSA 4FB8A 3QREA 3DJAA 3BF0A 3MFMA 4MXIA 3P5MA 3KQFA 4EMMA 4KWBA 2VSUE 3PE8A 1ON9A 3HLN1 4ZDEA 1UIYA 3PGQA 2QQ3A 3N6RB 4U0HA 3TZ3A 2DUBA 4RCNA 5G1RA 1EY3A 3MOYA 1NZYB 3ZW9A 2F6IA 3HRXA 4K29A 5DTPA 2ZL3A 4JCSA 1K39A 3I47A 4B3IA 1YG8A 2F9IA 3P2LA 1XO6A 3OC7A 2ZQRA 1HNOA 2PPYA 3R9SA 3ISAA 4DI1A 2ZL4A 2VSSE 3ZW8A 3T8AA 4WCZA 4IZBA 3VIVA 2FBMA 4ZDDA 3RSTA 4ZU2A 5C9GA 2W3PA 3Q1TA 1ON3A 3HP0A
chains in the Genus database with same CATH superfamily
3HINA 1XNWA 3TVWA 3Q7HA 3LAOA 3RSIA 3H81A 3G64A 2D3TA 3OT6A 2F6QA 4NARA 1OD4A 5IKLB 3BPTA 1FCFA 2DEOA 1YG6A 4L8KA 4U1AA 3V5EA 3K8XA 4ZDFA 4HC8A 4B3HA 4YLHA 2VSUA 4JWVA 5JBXA 1WDMA 3NJDA 5DZKA 3QKAA 3HE2A 3QXIA 4JYJA 3P85A 2F9YA 3TT6A 4LK5A 5E0SH 5E0NX 3NJBA 3ZWBA 1TYFA 3TVUA 1J7XA 5JBWA 2NP9A 1K32A 5FUSA 3IAVA 1RJMA 3PZKA 3H0JA 3U9TB 2VX2A 4FNDA 3SLLA 4QIJA 3MT6A 5KDRB 3T89A 1VRGA 5MGBA 2J5GD 1XX4A 1SG4A 5INFA 1W2XA 1UYRA 2CBYA 4KPKA 2X58A 4JSBA 1N6DA 3BEZA 5G1QA 1TG6A 4FZWA 1XNYA 1UYVA 2A7SA 1UYSA 3H02A 4JOTA 4Q0GA 1Q52A 3M6MA 4MI2A 5DU6A 5HUQA 1XNVA 4ZDCA 4F47A 4U0GA 4OG1A 3KTKA 3OMEA 2VSUC 1SZOA 5INIA 2J5IA 3KTJA 2J5SA 4HNKA 3R9TA 3ST9A 3FF6A 4G2RA 1FC7A 5KJPA 2C8TA 2PG8A 1JXZA 2VSUF 3R6HA 4I52A 2Q35A 5DZKH 3GF3A 3IB9A 3TT7A 4WZ8B 2WTBA 3R0OA 3IBBA 5CTCA 2X24A 4GHNA 2F9IB 1NZYA 2J5II 5C90A 4GM2A 1HNUA 4JJTA 2ZL2A 4K3WA 1X0UA 4NNQA 3K50A 4I42A 2A7KA 4Z0MA 3H0SA 2A81A 3DORA 4RYFA 2VSSF 1PJHA 3KTGA 2VREA 5DUCA 3Q0GA 4QIIA 4HDTA 1N6FA 1WZ8A 3Q0JA 3TRRA 1DUBA 4B3JA 4K2NA 1RJNA 4FZWC 3T8BA 4JFCA 2CE3A 3QXZA 5DUFA 1HZDA 3QMJA 2GTRA 3ZWCA 3ZWAA 3MYBA 1UYTA 2J5GA 4JCRA 4KD6A 3U9SB 3TV5A 4ELWA 3PEAA 2UZFA 1WDLA 2F9YB 3QWDA 3SWXA 4EMLA 4IZCA 3TDCA 4JCTA 2YJGA 4JCQA 3R9QA 4U18A 3GLMA 5DU4A 4U0GH 4WYOB 3FDUA 3U9RB 3TLFA 1EF8A 2ZQQA 1WDKA 4ASIA 5CTBA 2Q2XA 3QK8A 4IZDA 1FC6A 4OLQA 3LKEA 5DL1A 3RRVA 1FC9A 4JYLA 3T88A 3V5IA 1Q51A 4QFEA 2FW2A 2PBPA 4ZDBA 3L3SA 2BZRA 3QYRA 5KDRA 3GMAA 5DTWA 1N6EA 3KTIA 3BPPA 3KTHA 4NEKA 3H0UA 4I4ZA 4OMRA 4ELSA 4KNPA 2EJ5A 4U19A 2Q34A 3STAA 3T3WA 4FN7A 4EMPA 3JU1A 2IEXA 4FN8A 4ELXA 5INGA 4FNBA 3GF7A 4RYFH 4Q1IA 1MJ3A 2HW5A 4MOUA 3H0QA 4J2UA 1OD2A 3M6NA 3GKBA 5FIFA 5DKPA 4FJWD 4JVTA 5DU8A 2ZL0A 5E0SA 1Y7OA 2J5IB 3WG5A 4L6WA 1PIXA 2FZSA 1DCIA 5G1SA 1EF9A 1O8UA 2VSSA 4FB8A 3QREA 3DJAA 3BF0A 3MFMA 4MXIA 3P5MA 3KQFA 4EMMA 4KWBA 2VSUE 3PE8A 1ON9A 3HLN1 4ZDEA 1UIYA 3PGQA 2QQ3A 3N6RB 4U0HA 3TZ3A 2DUBA 4RCNA 5G1RA 1EY3A 3MOYA 1NZYB 3ZW9A 2F6IA 3HRXA 4K29A 5DTPA 2ZL3A 4JCSA 1K39A 3I47A 4B3IA 1YG8A 2F9IA 3P2LA 1XO6A 3OC7A 2ZQRA 1HNOA 2PPYA 3R9SA 3ISAA 4DI1A 2ZL4A 2VSSE 3ZW8A 3T8AA 4WCZA 4IZBA 3VIVA 2FBMA 4ZDDA 3RSTA 4ZU2A 5C9GA 2W3PA 3Q1TA 1ON3A 3HP0A
chains in the Genus database with same CATH topology
3HINA 1XNWA 3TVWA 3Q7HA 3LAOA 3RSIA 3H81A 3G64A 2D3TA 3OT6A 2F6QA 4NARA 1OD4A 5IKLB 3BPTA 1FCFA 2DEOA 1YG6A 4L8KA 4U1AA 3V5EA 3K8XA 4ZDFA 4HC8A 4B3HA 4YLHA 2VSUA 4JWVA 5JBXA 1WDMA 3NJDA 5DZKA 3QKAA 3HE2A 3QXIA 4JYJA 3P85A 2F9YA 3TT6A 4LK5A 5E0SH 5E0NX 3NJBA 3ZWBA 1TYFA 3TVUA 1J7XA 5JBWA 2NP9A 1K32A 5FUSA 3IAVA 1RJMA 3PZKA 3H0JA 3U9TB 2VX2A 4FNDA 3SLLA 4QIJA 3MT6A 5KDRB 3T89A 1VRGA 5MGBA 2J5GD 1XX4A 1SG4A 5INFA 1W2XA 1UYRA 2CBYA 4KPKA 2X58A 4JSBA 1N6DA 3BEZA 5G1QA 1TG6A 4FZWA 1XNYA 1UYVA 2A7SA 1UYSA 3H02A 4JOTA 4Q0GA 1Q52A 3M6MA 4MI2A 5DU6A 5HUQA 1XNVA 4ZDCA 4F47A 4U0GA 4OG1A 3KTKA 3OMEA 2VSUC 1SZOA 5INIA 2J5IA 3KTJA 2J5SA 4HNKA 3R9TA 3ST9A 3FF6A 4G2RA 1FC7A 5KJPA 2C8TA 2PG8A 1JXZA 2VSUF 3R6HA 4I52A 2Q35A 5DZKH 3GF3A 3IB9A 3TT7A 4WZ8B 2WTBA 3R0OA 3IBBA 5CTCA 2X24A 4GHNA 2F9IB 1NZYA 2J5II 5C90A 4GM2A 1HNUA 4JJTA 2ZL2A 4K3WA 1X0UA 4NNQA 3K50A 4I42A 2A7KA 4Z0MA 3H0SA 2A81A 3DORA 4RYFA 2VSSF 1PJHA 3KTGA 2VREA 5DUCA 3Q0GA 4QIIA 4HDTA 1N6FA 1WZ8A 3Q0JA 3TRRA 1DUBA 4B3JA 4K2NA 1RJNA 4FZWC 3T8BA 4JFCA 2CE3A 3QXZA 5DUFA 1HZDA 3QMJA 2GTRA 3ZWCA 3ZWAA 3MYBA 1UYTA 2J5GA 4JCRA 4KD6A 3U9SB 3TV5A 4ELWA 3PEAA 2UZFA 1WDLA 2F9YB 3QWDA 3SWXA 4EMLA 4IZCA 3TDCA 4JCTA 2YJGA 4JCQA 3R9QA 4U18A 3GLMA 5DU4A 4U0GH 4WYOB 3FDUA 3U9RB 3TLFA 1EF8A 2ZQQA 1WDKA 4ASIA 5CTBA 2Q2XA 3QK8A 4IZDA 1FC6A 4OLQA 3LKEA 5DL1A 3RRVA 1FC9A 4JYLA 3T88A 3V5IA 1Q51A 4QFEA 2FW2A 2PBPA 4ZDBA 3L3SA 2BZRA 3QYRA 5KDRA 3GMAA 5DTWA 1N6EA 3KTIA 3BPPA 3KTHA 4NEKA 3H0UA 4I4ZA 4OMRA 4ELSA 4KNPA 2EJ5A 4U19A 2Q34A 3STAA 3T3WA 4FN7A 4EMPA 3JU1A 2IEXA 4FN8A 4ELXA 5INGA 4FNBA 3GF7A 4RYFH 4Q1IA 1MJ3A 2HW5A 4MOUA 3H0QA 4J2UA 1OD2A 3M6NA 3GKBA 5FIFA 5DKPA 4FJWD 4JVTA 5DU8A 2ZL0A 5E0SA 1Y7OA 2J5IB 3WG5A 4L6WA 1PIXA 2FZSA 1DCIA 5G1SA 1EF9A 1O8UA 2VSSA 4FB8A 3QREA 3DJAA 3BF0A 3MFMA 4MXIA 3P5MA 3KQFA 4EMMA 4KWBA 2VSUE 3PE8A 1ON9A 3HLN1 4ZDEA 1UIYA 3PGQA 2QQ3A 3N6RB 4U0HA 3TZ3A 2DUBA 4RCNA 5G1RA 1EY3A 3MOYA 1NZYB 3ZW9A 2F6IA 3HRXA 4K29A 5DTPA 2ZL3A 4JCSA 1K39A 3I47A 4B3IA 1YG8A 2F9IA 3P2LA 1XO6A 3OC7A 2ZQRA 1HNOA 2PPYA 3R9SA 3ISAA 4DI1A 2ZL4A 2VSSE 3ZW8A 3T8AA 4WCZA 4IZBA 3VIVA 2FBMA 4ZDDA 3RSTA 4ZU2A 5C9GA 2W3PA 3Q1TA 1ON3A 3HP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIN A;  1XNW A;  3TVW A;  3Q7H A;  3LAO A;  3RSI A;  3H81 A;  3G64 A;  2D3T A;  3OT6 A;  2F6Q A;  1OD4 A;  5IKL B;  1FCF A;  2DEO A;  1YG6 A;  4L8K A;  4U1A A;  3V5E A;  3K8X A;  4ZDF A;  4HC8 A;  4B3H A;  4YLH A;  2VSU A;  4JWV A;  5JBX A;  1WDM A;  3NJD A;  5DZK A;  3QKA A;  3HE2 A;  3QXI A;  4JYJ A;  3P85 A;  2F9Y A;  3TT6 A;  4LK5 A;  5E0S H;  5E0N X;  3NJB A;  3ZWB A;  1TYF A;  3TVU A;  1J7X A;  5JBW A;  2NP9 A;  1K32 A;  5FUS A;  3IAV A;  1RJM A;  3PZK A;  3H0J A;  3U9T B;  2VX2 A;  4FND A;  3SLL A;  4QIJ A;  3MT6 A;  5KDR B;  3T89 A;  1VRG A;  5MGB A;  2J5G D;  1XX4 A;  1SG4 A;  5INF A;  1W2X A;  1UYR A;  2CBY A;  4KPK A;  2X58 A;  4JSB A;  1N6D A;  3BEZ A;  5G1Q A;  1TG6 A;  4FZW A;  1XNY A;  1UYV A;  2A7S A;  1UYS A;  3H02 A;  4JOT A;  4Q0G A;  1Q52 A;  3M6M A;  4MI2 A;  5DU6 A;  1XNV A;  4ZDC A;  4F47 A;  4U0G A;  4OG1 A;  3KTK A;  3OME A;  2VSU C;  1SZO A;  5INI A;  2J5I A;  3KTJ A;  2J5S A;  4HNK A;  3R9T A;  3ST9 A;  3FF6 A;  4G2R A;  1FC7 A;  5KJP A;  2C8T A;  2PG8 A;  1JXZ A;  2VSU F;  3R6H A;  4I52 A;  2Q35 A;  5DZK H;  3GF3 A;  3IB9 A;  3TT7 A;  4WZ8 B;  2WTB A;  3R0O A;  3IBB A;  5CTC A;  2X24 A;  4GHN A;  2F9I B;  1NZY A;  2J5I I;  5C90 A;  4GM2 A;  1HNU A;  4JJT A;  2ZL2 A;  4K3W A;  1X0U A;  4NNQ A;  3K50 A;  4I42 A;  2A7K A;  4Z0M A;  3H0S A;  2A81 A;  3DOR A;  4RYF A;  2VSS F;  1PJH A;  3KTG A;  2VRE A;  5DUC A;  3Q0G A;  4QII A;  1N6F A;  1WZ8 A;  3Q0J A;  3TRR A;  1DUB A;  4B3J A;  4K2N A;  1RJN A;  4FZW C;  3T8B A;  4JFC A;  2CE3 A;  3QXZ A;  5DUF A;  1HZD A;  3QMJ A;  2GTR A;  3ZWC A;  3ZWA A;  3MYB A;  1UYT A;  2J5G A;  4JCR A;  4KD6 A;  3U9S B;  3TV5 A;  4ELW A;  3PEA A;  2UZF A;  1WDL A;  2F9Y B;  3QWD A;  3SWX A;  4EML A;  4IZC A;  3TDC A;  4JCT A;  4JCQ A;  3R9Q A;  4U18 A;  3GLM A;  5DU4 A;  4U0G H;  4WYO B;  3FDU A;  3U9R B;  3TLF A;  1EF8 A;  2ZQQ A;  1WDK A;  4ASI A;  5CTB A;  2Q2X A;  3QK8 A;  4IZD A;  1FC6 A;  4OLQ A;  3LKE A;  5DL1 A;  3RRV A;  1FC9 A;  4JYL A;  3T88 A;  3V5I A;  1Q51 A;  4QFE A;  2FW2 A;  2PBP A;  4ZDB A;  3L3S A;  2BZR A;  3QYR A;  5KDR A;  3GMA A;  5DTW A;  1N6E A;  3KTI A;  3BPP A;  3KTH A;  4NEK A;  3H0U A;  4I4Z A;  4OMR A;  4ELS A;  4KNP A;  2EJ5 A;  4U19 A;  2Q34 A;  3STA A;  3T3W A;  4FN7 A;  4EMP A;  3JU1 A;  2IEX A;  4FN8 A;  4ELX A;  5ING A;  4FNB A;  3GF7 A;  4RYF H;  4Q1I A;  1MJ3 A;  2HW5 A;  4MOU A;  3H0Q A;  1OD2 A;  3M6N A;  3GKB A;  5FIF A;  5DKP A;  4FJW D;  4JVT A;  5DU8 A;  2ZL0 A;  5E0S A;  1Y7O A;  2J5I B;  3WG5 A;  4L6W A;  1PIX A;  2FZS A;  1DCI A;  5G1S A;  1EF9 A;  1O8U A;  2VSS A;  4FB8 A;  3QRE A;  3DJA A;  3BF0 A;  3MFM A;  4MXI A;  3P5M A;  3KQF A;  4EMM A;  4KWB A;  2VSU E;  3PE8 A;  1ON9 A;  3HLN 1;  4ZDE A;  1UIY A;  3PGQ A;  2QQ3 A;  3N6R B;  4U0H A;  3TZ3 A;  2DUB A;  4RCN A;  5G1R A;  1EY3 A;  3MOY A;  1NZY B;  3ZW9 A;  2F6I A;  3HRX A;  4K29 A;  5DTP A;  2ZL3 A;  4JCS A;  1K39 A;  3I47 A;  4B3I A;  1YG8 A;  2F9I A;  3P2L A;  1XO6 A;  3OC7 A;  2ZQR A;  1HNO A;  2PPY A;  3R9S A;  3ISA A;  4DI1 A;  2ZL4 A;  2VSS E;  3ZW8 A;  3T8A A;  4WCZ A;  4IZB A;  3VIV A;  2FBM A;  4ZDD A;  3RST A;  4ZU2 A;  5C9G A;  2W3P A;  3Q1T A;  1ON3 A;  3HP0 A; 
#chains in the Genus database with same CATH topology
 3HIN A;  1XNW A;  3TVW A;  3Q7H A;  3LAO A;  3RSI A;  3H81 A;  3G64 A;  2D3T A;  3OT6 A;  2F6Q A;  4NAR A;  1OD4 A;  5IKL B;  3BPT A;  1FCF A;  2DEO A;  1YG6 A;  4L8K A;  4U1A A;  3V5E A;  3K8X A;  4ZDF A;  4HC8 A;  4B3H A;  4YLH A;  2VSU A;  4JWV A;  5JBX A;  1WDM A;  3NJD A;  5DZK A;  3QKA A;  3HE2 A;  3QXI A;  4JYJ A;  3P85 A;  2F9Y A;  3TT6 A;  4LK5 A;  5E0S H;  5E0N X;  3NJB A;  3ZWB A;  1TYF A;  3TVU A;  1J7X A;  5JBW A;  2NP9 A;  1K32 A;  5FUS A;  3IAV A;  1RJM A;  3PZK A;  3H0J A;  3U9T B;  2VX2 A;  4FND A;  3SLL A;  4QIJ A;  3MT6 A;  5KDR B;  3T89 A;  1VRG A;  5MGB A;  2J5G D;  1XX4 A;  1SG4 A;  5INF A;  1W2X A;  1UYR A;  2CBY A;  4KPK A;  2X58 A;  4JSB A;  1N6D A;  3BEZ A;  5G1Q A;  1TG6 A;  4FZW A;  1XNY A;  1UYV A;  2A7S A;  1UYS A;  3H02 A;  4JOT A;  4Q0G A;  1Q52 A;  3M6M A;  4MI2 A;  5DU6 A;  5HUQ A;  1XNV A;  4ZDC A;  4F47 A;  4U0G A;  4OG1 A;  3KTK A;  3OME A;  2VSU C;  1SZO A;  5INI A;  2J5I A;  3KTJ A;  2J5S A;  4HNK A;  3R9T A;  3ST9 A;  3FF6 A;  4G2R A;  1FC7 A;  5KJP A;  2C8T A;  2PG8 A;  1JXZ A;  2VSU F;  3R6H A;  4I52 A;  2Q35 A;  5DZK H;  3GF3 A;  3IB9 A;  3TT7 A;  4WZ8 B;  2WTB A;  3R0O A;  3IBB A;  5CTC A;  2X24 A;  4GHN A;  2F9I B;  1NZY A;  2J5I I;  5C90 A;  4GM2 A;  1HNU A;  4JJT A;  2ZL2 A;  4K3W A;  1X0U A;  4NNQ A;  3K50 A;  4I42 A;  2A7K A;  4Z0M A;  3H0S A;  2A81 A;  3DOR A;  4RYF A;  2VSS F;  1PJH A;  3KTG A;  2VRE A;  5DUC A;  3Q0G A;  4QII A;  4HDT A;  1N6F A;  1WZ8 A;  3Q0J A;  3TRR A;  1DUB A;  4B3J A;  4K2N A;  1RJN A;  4FZW C;  3T8B A;  4JFC A;  2CE3 A;  3QXZ A;  5DUF A;  1HZD A;  3QMJ A;  2GTR A;  3ZWC A;  3ZWA A;  3MYB A;  1UYT A;  2J5G A;  4JCR A;  4KD6 A;  3U9S B;  3TV5 A;  4ELW A;  3PEA A;  2UZF A;  1WDL A;  2F9Y B;  3QWD A;  3SWX A;  4EML A;  4IZC A;  3TDC A;  4JCT A;  2YJG A;  4JCQ A;  3R9Q A;  4U18 A;  3GLM A;  5DU4 A;  4U0G H;  4WYO B;  3FDU A;  3U9R B;  3TLF A;  1EF8 A;  2ZQQ A;  1WDK A;  4ASI A;  5CTB A;  2Q2X A;  3QK8 A;  4IZD A;  1FC6 A;  4OLQ A;  3LKE A;  5DL1 A;  3RRV A;  1FC9 A;  4JYL A;  3T88 A;  3V5I A;  1Q51 A;  4QFE A;  2FW2 A;  2PBP A;  4ZDB A;  3L3S A;  2BZR A;  3QYR A;  5KDR A;  3GMA A;  5DTW A;  1N6E A;  3KTI A;  3BPP A;  3KTH A;  4NEK A;  3H0U A;  4I4Z A;  4OMR A;  4ELS A;  4KNP A;  2EJ5 A;  4U19 A;  2Q34 A;  3STA A;  3T3W A;  4FN7 A;  4EMP A;  3JU1 A;  2IEX A;  4FN8 A;  4ELX A;  5ING A;  4FNB A;  3GF7 A;  4RYF H;  4Q1I A;  1MJ3 A;  2HW5 A;  4MOU A;  3H0Q A;  4J2U A;  1OD2 A;  3M6N A;  3GKB A;  5FIF A;  5DKP A;  4FJW D;  4JVT A;  5DU8 A;  2ZL0 A;  5E0S A;  1Y7O A;  2J5I B;  3WG5 A;  4L6W A;  1PIX A;  2FZS A;  1DCI A;  5G1S A;  1EF9 A;  1O8U A;  2VSS A;  4FB8 A;  3QRE A;  3DJA A;  3BF0 A;  3MFM A;  4MXI A;  3P5M A;  3KQF A;  4EMM A;  4KWB A;  2VSU E;  3PE8 A;  1ON9 A;  3HLN 1;  4ZDE A;  1UIY A;  3PGQ A;  2QQ3 A;  3N6R B;  4U0H A;  3TZ3 A;  2DUB A;  4RCN A;  5G1R A;  1EY3 A;  3MOY A;  1NZY B;  3ZW9 A;  2F6I A;  3HRX A;  4K29 A;  5DTP A;  2ZL3 A;  4JCS A;  1K39 A;  3I47 A;  4B3I A;  1YG8 A;  2F9I A;  3P2L A;  1XO6 A;  3OC7 A;  2ZQR A;  1HNO A;  2PPY A;  3R9S A;  3ISA A;  4DI1 A;  2ZL4 A;  2VSS E;  3ZW8 A;  3T8A A;  4WCZ A;  4IZB A;  3VIV A;  2FBM A;  4ZDD A;  3RST A;  4ZU2 A;  5C9G A;  2W3P A;  3Q1T A;  1ON3 A;  3HP0 A; 
#chains in the Genus database with same CATH homology
 3HIN A;  1XNW A;  3TVW A;  3Q7H A;  3LAO A;  3RSI A;  3H81 A;  3G64 A;  2D3T A;  3OT6 A;  2F6Q A;  4NAR A;  1OD4 A;  5IKL B;  3BPT A;  1FCF A;  2DEO A;  1YG6 A;  4L8K A;  4U1A A;  3V5E A;  3K8X A;  4ZDF A;  4HC8 A;  4B3H A;  4YLH A;  2VSU A;  4JWV A;  5JBX A;  1WDM A;  3NJD A;  5DZK A;  3QKA A;  3HE2 A;  3QXI A;  4JYJ A;  3P85 A;  2F9Y A;  3TT6 A;  4LK5 A;  5E0S H;  5E0N X;  3NJB A;  3ZWB A;  1TYF A;  3TVU A;  1J7X A;  5JBW A;  2NP9 A;  1K32 A;  5FUS A;  3IAV A;  1RJM A;  3PZK A;  3H0J A;  3U9T B;  2VX2 A;  4FND A;  3SLL A;  4QIJ A;  3MT6 A;  5KDR B;  3T89 A;  1VRG A;  5MGB A;  2J5G D;  1XX4 A;  1SG4 A;  5INF A;  1W2X A;  1UYR A;  2CBY A;  4KPK A;  2X58 A;  4JSB A;  1N6D A;  3BEZ A;  5G1Q A;  1TG6 A;  4FZW A;  1XNY A;  1UYV A;  2A7S A;  1UYS A;  3H02 A;  4JOT A;  4Q0G A;  1Q52 A;  3M6M A;  4MI2 A;  5DU6 A;  5HUQ A;  1XNV A;  4ZDC A;  4F47 A;  4U0G A;  4OG1 A;  3KTK A;  3OME A;  2VSU C;  1SZO A;  5INI A;  2J5I A;  3KTJ A;  2J5S A;  4HNK A;  3R9T A;  3ST9 A;  3FF6 A;  4G2R A;  1FC7 A;  5KJP A;  2C8T A;  2PG8 A;  1JXZ A;  2VSU F;  3R6H A;  4I52 A;  2Q35 A;  5DZK H;  3GF3 A;  3IB9 A;  3TT7 A;  4WZ8 B;  2WTB A;  3R0O A;  3IBB A;  5CTC A;  2X24 A;  4GHN A;  2F9I B;  1NZY A;  2J5I I;  5C90 A;  4GM2 A;  1HNU A;  4JJT A;  2ZL2 A;  4K3W A;  1X0U A;  4NNQ A;  3K50 A;  4I42 A;  2A7K A;  4Z0M A;  3H0S A;  2A81 A;  3DOR A;  4RYF A;  2VSS F;  1PJH A;  3KTG A;  2VRE A;  5DUC A;  3Q0G A;  4QII A;  4HDT A;  1N6F A;  1WZ8 A;  3Q0J A;  3TRR A;  1DUB A;  4B3J A;  4K2N A;  1RJN A;  4FZW C;  3T8B A;  4JFC A;  2CE3 A;  3QXZ A;  5DUF A;  1HZD A;  3QMJ A;  2GTR A;  3ZWC A;  3ZWA A;  3MYB A;  1UYT A;  2J5G A;  4JCR A;  4KD6 A;  3U9S B;  3TV5 A;  4ELW A;  3PEA A;  2UZF A;  1WDL A;  2F9Y B;  3QWD A;  3SWX A;  4EML A;  4IZC A;  3TDC A;  4JCT A;  2YJG A;  4JCQ A;  3R9Q A;  4U18 A;  3GLM A;  5DU4 A;  4U0G H;  4WYO B;  3FDU A;  3U9R B;  3TLF A;  1EF8 A;  2ZQQ A;  1WDK A;  4ASI A;  5CTB A;  2Q2X A;  3QK8 A;  4IZD A;  1FC6 A;  4OLQ A;  3LKE A;  5DL1 A;  3RRV A;  1FC9 A;  4JYL A;  3T88 A;  3V5I A;  1Q51 A;  4QFE A;  2FW2 A;  2PBP A;  4ZDB A;  3L3S A;  2BZR A;  3QYR A;  5KDR A;  3GMA A;  5DTW A;  1N6E A;  3KTI A;  3BPP A;  3KTH A;  4NEK A;  3H0U A;  4I4Z A;  4OMR A;  4ELS A;  4KNP A;  2EJ5 A;  4U19 A;  2Q34 A;  3STA A;  3T3W A;  4FN7 A;  4EMP A;  3JU1 A;  2IEX A;  4FN8 A;  4ELX A;  5ING A;  4FNB A;  3GF7 A;  4RYF H;  4Q1I A;  1MJ3 A;  2HW5 A;  4MOU A;  3H0Q A;  4J2U A;  1OD2 A;  3M6N A;  3GKB A;  5FIF A;  5DKP A;  4FJW D;  4JVT A;  5DU8 A;  2ZL0 A;  5E0S A;  1Y7O A;  2J5I B;  3WG5 A;  4L6W A;  1PIX A;  2FZS A;  1DCI A;  5G1S A;  1EF9 A;  1O8U A;  2VSS A;  4FB8 A;  3QRE A;  3DJA A;  3BF0 A;  3MFM A;  4MXI A;  3P5M A;  3KQF A;  4EMM A;  4KWB A;  2VSU E;  3PE8 A;  1ON9 A;  3HLN 1;  4ZDE A;  1UIY A;  3PGQ A;  2QQ3 A;  3N6R B;  4U0H A;  3TZ3 A;  2DUB A;  4RCN A;  5G1R A;  1EY3 A;  3MOY A;  1NZY B;  3ZW9 A;  2F6I A;  3HRX A;  4K29 A;  5DTP A;  2ZL3 A;  4JCS A;  1K39 A;  3I47 A;  4B3I A;  1YG8 A;  2F9I A;  3P2L A;  1XO6 A;  3OC7 A;  2ZQR A;  1HNO A;  2PPY A;  3R9S A;  3ISA A;  4DI1 A;  2ZL4 A;  2VSS E;  3ZW8 A;  3T8A A;  4WCZ A;  4IZB A;  3VIV A;  2FBM A;  4ZDD A;  3RST A;  4ZU2 A;  5C9G A;  2W3P A;  3Q1T A;  1ON3 A;  3HP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...