4HCFA

Crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
AKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cupredoxin 1
publication title Crystal Structure of Uncharacterized Cupredoxin-like Domain Protein Cupredoxin_1 with Copper Bound from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 24
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hcfA00
3PAVA 1GY1A 1W6WA 2MTAA 3KW7A 1QNIA 5I6LA 5I6OA 3FQ1A 3NJIA 3OMIB 2UX6A 4RH4A 1QLEB 3KW8A 3IN0A 2P80A 5I28A 3FQYA 3FU8A 2HXAA 1GR7A 1ET5A 1XB6A 4G70B 1JZHA 1WA1X 4YSQA 5I6KA 2UXVA 2QDWA 2GC7C 4PCYA 4NAJA 4YVNA 1HAUA 1JZFA 2XU9A 3NSYA 3S3BB 2BWIA 3NSCA 2EINB 2VSMB 2XX1A 3PLYA 1IUZA 1M9WA 4G71B 3QQXA 2XX0A 1BQ5A 3QJRB 3ABLB 2FQEA 1GS7A 3BVDB 4QKTA 1A3ZA 3AW5A 4KO9A 2PPAA 2NRDA 1J5CA 3CDZA 3V9EA 3HB3B 1PZCA 4M4RB 3NJMA 1T5KA 4M3HA 5B7FA 1J9QA 1KGYE 2BZ7A 2PP7A 2YARA 1PY0A 3ABMB 2BP8A 2YAOA 4AKOA 2PPFA 4YVUA 2PCYA 3DTUB 1W8EA 1KCWA 1TEFA 2FQGA 4F2EA 5B1AB 4WKXA 5B1BB 3X1FA 3OD3A 5D4JA 5AFAA 3T6ZA 1PZBA 3AG2B 4UF7C 1MDAA 3CDZB 1NZRA 2GBAA 1L9QA 4HHGA 3NSDA 1L9RA 4P5RA 2BP8B 4BK5C 4DP4X 2Q5BA 3PPSA 4W9ZA 2UXGA 2VMJA 2XLLA 1AZNA 3QJTB 4A2HA 1V10A 4JHVA 1V55B 3UAAA 2AZUA 9PCYA 4MFHA 4GP8B 1A4AA 2E86A 5TK2A 4BXVA 4A68A 2FJSA 5IY5B 1QHQA 1UATA 3D12B 4GYBA 3T71A 3ASNB 3BQVA 2EIMB 1J5DA 1ILUA 1BXVA 2LLNA 5LDUA 2DYSB 1NPNA 1IC0A 3X1NA 1NIAA 1OCOB 5I5JA 4BDVB 3TBCA 3FS9A 2HRHA 2BW5A 2H3XC 3TBBA 2HLEB 1AANA 1A65A 2BWDA 2AVFA 1GS6X 1IBZA 2IDSA 2GIMA 2Y69B 1WS8A 1NTDA 2J56A 1L9TA 4YSCA 3NJJA 1BAWA 2CAKA 5F7BA 2OCCB 1CC3A 2HX8A 3FSWA 3S3DB 2IDFA 1TEGA 1AZBA 2BP0B 1BXUA 2GC4C 3H4FA 1IBYA 2HZHA 5AKRA 3EH3B 1J9RA 3NJHA 4ENZA 2QT6A 2IH8A 2R7EA 6PCYA 2IWKA 2FT6A 4YL4A 3FT0A 1EHKB 4E9QA 2UXFA 5TK4A 5B1JC 3ZBMA 4N4YB 1IKOP 1OE2A 2DY2A 2CCWA 1BQKA 4F7KA 3QJUB 1JXFA 3GDCA 3NJFA 4CSPA 1SFHA 3SBRA 1E65A 2VW6A 3EF4A 1PZAA 1KCBA 2R7EB 3S8GB 3FSAA 5B7EA 1PLBA 2WO2B 3MX0B 1N68A 4GY4A 4AI7A 3WNIA 4YSRA 2DWTA 4FA7B 3JT2A 2YAMA 4Q89A 3UACA 3AZUA 3OQRA 3ZIYA 1FWXA 2PP8A 1ET8A 2IWFA 1AG6A 2I7OA 3S8FB 2AANA 3AG1B 1PNDA 2UXTA 4W1TA 1ZIBA 4HHWA 1E5YA 3ASOB 1ID2A 6PAZA 3WIAA 5I6NA 2J57A 4A2GA 4JHUA 2Q9OA 1L9OA 2X87A 1FFTB 3CG8A 3TU6A 4L0PB 2FT8A 2ZONA 3UABA 3IN2A 4DP2X 1L9SA 2CJ3A 4GXFA 4KNSA 1PNCA 3NP3A 4G72B 2P80D 2YXVA 4HCGA 1ETJA 1EZLA 4KOBA 2XXFA 1R1CA 1HAWA 5I6PA 2EIJB 4GP5B 1NINA 2VM3A 2AFNA 4CSZA 3DKHA 3QJSB 1AZRA 4DP6X 1KYAA 2H5UA 1NWOA 1KV7A 5F7AA 1ASQA 2FTAA 1GSKA 2A3TA 2JFCA 2PLTA 3FPXA 3IBOA 4AKPA 3CVDA 3ABGA 3FU7A 4BDVA 2YAFA 1OCZB 3AG3B 4BXSV 5A7EA 1JZJA 2IDTA 1DZ0A 2XXGA 8PAZA 3SBQA 4KOCA 3H56A 5PAZA 4BWUA 1GW0A 1JVOA 1ZDQA 4BWWA 2VM4A 3EH4B 2EILB 3N2JA 1W6LA 3X1GA 1NIEA 2XV0A 2XV3A 4G7QB 5PCYA 4YSSA 1PAZA 2I7SA 3U25A 1NICA 1PF3A 4FAAB 1KDIA 2BO0A 4E9YA 2BP0A 2QDVA 3FU7B 1BYOA 2DWSA 5B1JA 1SF3A 4UANA 3G5WA 2IH9A 1GYCA 2TSAA 2Y1AA 3H4HA 1ZIAA 1E5ZA 2HX9A 1AS6A 2CUAA 1VLXA 4NERA 4YSPA 4DPBX 1ZV2A 1JOIA 1RCYA 3FYIB 1AQ8A 1OV8A 2PPCA 1PCSA 3NP4A 5AZUA 3T9WA 3CVCA 1A4CA 1RKRA 1BYPA 1JZIA 3OMNB 3JTBA 4HAKA 5B7MA 2W8CA 4HCIA 4A67A 1FA4A 4HIPA 4N8UA 1BXAA 1JZEA 2OJ1A 2YQBA 1BQRA 2WO3B 2YAEA 4A66A 1MZZA 1M57B 4ZK8A 4E9TA 2GI0A 3FPYA 3T6XA 4HALA 1SFDA 2BZCA 1AIZA 2PCFA 3TA4D 1YLBB 1WA2X 4G7RB 1NPJA 4GP4B 4A2EA 4YSDA 3HEIB 1SHXA 2IAAC 2XYBA 5EHFA 2JXMA 2BW4A 3EH5B 4YSEA 3EHBB 1F56A 4E9WA 3SBPA 5B3SB 2PPEA 1PLAA 3RYMA 1AR1B 1X9RA 2MRYA 1NDTA 1L9PA 1AACA 4UAHA 2XUWA 3NJKA 1CYXA 2B3IA 3T6VA 2BHFA 3UADA 2FQFA 2J5WA 1ILSA 3UGEA 3ERXA 2PPDA 3TASA 4AX3A 4YSOA 1WAEA 2IDQA 1XB3A 3IE9A 2H47C 3NJNA 1GS8A 1GY2A 3QPKA 2WSDA 1AG0A 2FQDA 3MBWB 3OMAB 3OM3B 1JXDA 3WKPA 4E9VA 4YSUA 1KBWA 7PCYA 3AY2A 2J55A 1KBVA 1JZGA 1J9SA 1TKWA 3ZDWA 1M56B 2FNWA 1WS7A 4KO5A 4X4KA 1E30A 1SJMA 1AOZA 1BEXA 1OCRB 3N55A 1CURA 2ZOOA 2TSBA 4DPAX 2XV2A 3NSFA 1URIA 3GYRA 2IWEA 3WG7B 1JERA 2YXWA 2PP9A 2QPDB 5D4HA 2RACA 2CBPA 1RZPA 3QJVB 1OE1A 1MG3C 4DP8X 2HX7A 4G7SB 4NB7A 3WNJA 4BWTA 5I6MA 1SHWA 3PCYA 2VW7A 5D4IA 1ZPUA 1OCCB 1AZUA 4YSAA 4DP5X 1OOWA 1ZDSA 5ANHA 4PAZA 2ZXWB 2DV6A 3X1BA 1B3IA 3NT0A 1SNRA 4AKQA 3NYKA 1MZYA 4P5SA 1JXGA 4TXVB 4HZ1A 3AG4B 2FT7A 4E9XA 1ET7A 2XVBA 1MG2C 2FWLB 3S3CB 1WA0X 1A8ZA 3QJQB 4KNTA 1TU2A 3NJLA 1CYWA 1PMYA 1RZQA 2GSMB 2I85A 1JVLA 3PAUA 2YAHA 1NIBA 1ASPA 4A2DA 1CUOA 3UAEA 1XMEB 2YAQA 1OE3A 3C75A 1ADWA 1AS8A 1SF5A 4DP1X 1ASOA 2YAPA 5FC9A 1SDDA 3ABKB 1AAJA 1J9TA 1XB8A 3FSVA 3X2QB 2DYRB 2VSKB 4DPCX 1A4BA 3PXLA 1AZCA 3L45A 5B1KA 2CALA 3CVBA 1E67A 2W88A 1AS7A 3FYEB 2N0MA 4F2FA 4KO7A 4KNUA 4EF3A 5I5IA 1KDJA 3CZUB 1DYZA 5E9NA 4YSTA 3FU9A 1SDDB 3T6WA 4Q8BA 1V54B 5I26A 2ZWNA 2EIKB 2GHZA 3IEAA 3V9CA 3X1EA 1PLCA 1I53A 3FQ2A 3WI9A 4WTQA 4AZUA 2GB2A 7PAZA 1HFUA 2AZAA 2UX7A 4DP7X 5I5MA 2B08A 2VW4A 3GXUB 2HRGA 3SQRA 3PAZA 3ZX1A 4K9JA 2IDUA 2JKWA 4KO6A 3WKQA 1N70A 1NWPA 3DIVA 3FSZA 2OV0A 4E9SA 4E9RA 4HCFA 1NIFA 2XWZA 1NIDA 3NJGA 2X88A 4A2FA 1OF0A 1X9UA 2QPEB 2VN3A 4DP0X 4DP9X 4QLWA 4JKNA
chains in the Genus database with same CATH superfamily
1B2WH 3N5AA 3ZSSA 3HI5H 4PS4L 2EE3A 3VXSB 4NAMA 3OMIB 2ZNWA 4FQXB 3ARGC 4ZUUA 4U6VL 4WI2A 3QUMA 2HLFD 4X42A 3RKDD 5I28A 4ZFZB 1MHHA 1RJZA 2NXZB 1P4LB 2HWZH 4LRIA 2BWQA 2O4EA 3V0AC 1W8OA 2AXHA 1S7XA 3MRMB 1DBBL 1ZLDA 3C6SB 3NJXA 4HK0A 3UZQA 3WJJC 1OGTB 5AB1A 2XA8L 4HETA 2BNRE 4OZFG 3CSBA 5IHUH 3DMMC 5MENA 3M1OA 2GT9A 3L3KA 1YQVL 2XX0A 3T8VA 5GGSA 2NNRA 4ETQB 1CFTB 5ERWB 1Z9PA 4W9KC 2EDYA 3N1MC 5EZJA 3IMRA 4L3ED 3BZFA 4GUCA 2R1XA 5KS9E 4QHNA 4ZUWB 1T4KB 5CJXA 4KRMB 4YFDB 4WO4C 3DVNB 2IH1A 5KW9H 4XOCA 1KXVA 2AK4E 1QRNB 5K59E 1KCWA 4OV6F 1B0GB 3RWCA 2WTRB 5E9DB 5BZDA 4J39A 4YHIB 5G4NA 2BDNH 4LBEA 3T0VA 4EPSA 1RZJC 4JG1H 4FFYH 4JUTA 3V6OC 3QJXA 4KRPB 1RK0A 1BQHB 3I6LD 2HPTA 1NDMB 4XB8A 3TIEB 1IGCH 3IJSB 2JKXA 5BCAA 3OAZK 4QRQB 4KJYA 4EMZA 5HGHB 2Q5BA 4ZPVB 1BFSA 4ZUTB 4AIZA 3WTYA 2Y7OA 3W57A 5D7LE 4PS8A 1DQKA 1X4XA 2HN7B 4P0DA 1NFIB 2ILLA 2VL4A 1IEBB 3UBXI 4MCYB 1K5NA 4IBZA 3QJTB 3V6ZA 4EUPH 1A7RH 1G9NL 1TSRA 4UQEA 5F96L 5BQ7A 2WWMC 5D55A 2AJZB 3KPNB 2RCSL 4TSCL 5C0FB 4Y1AB 4R26L 1RUQL 1I3RA 4L0YA 2XA3A 1J5IA 1XH1A 4DVBA 4PY8J 3B9EA 5D6CA 3TP4A 4YWGL 3ECQA 4H20L 4U6XA 3HNSH 1QR1A 4GYBA 1GPOL 3P73A 4AYEC 1Z5HA 1FSKC 1HHJB 2K3TA 4GG8A 3WTTA 2IG2L 1MJ7L 4B0MB 3IU4H 1OCOB 2D7TL 3JQOB 4F7EA 3MRHB 1TTAA 2BLFA 2O30A 3VB9A 5SWZB 3QUZC 2Y7QA 2E6JA 4MJIB 4S1DD 2VCOA 3SE9H 4XXCA 3ME0B 4FTVB 2R1YA 2VLLA 4FX5A 5HPMB 5JXEC 1FE8H 1NTDA 4HF5L 4X98B 1TJIH 1TJHL 2Y06L 4O02B 3KS0J 1QSED 2EUVA 5CEXA 5C0IA 1NMBL 5DR5L 3M1BA 4XO8A 1BDYA 2HB0A 1OWWA 3M17A 4HISA 4K55A 3VFVA 2O93L 2DOCA 5GGTH 1NAML 3DURA 3KNBB 3GZPA 4PB0H 3V5HA 1FHGA 4EI5A 5BVJB 3WOVA 1WDAA 4WI8A 3PAYA 4GEIA 3I3DA 4FQHA 4X4XA 2WC7A 5AB2A 3JV0A 1GA2A 1MNUL 5KYXB 2X89A 1CBJA 4L9LA 3GDCA 1NGPL 1MFDH 2WBKA 3H8NA 3MGOB 1SFHA 1VZIA 2EDNA 4V1DA 5AB0A 3F7QA 4AQEA 4WTZA 1WE5A 1A7OH 3FCGA 1WISA 4KKQA 4IRSC 1X3DA 5TDOA 5H94B 3PP3H 5IB4B 2KUTA 2PW1B 2NW3A 3MNWB 4LQFL 2QADB 2WXOA 3KL5A 4MJ4A 3QSKB 2GJZA 5DD0L 4ELMA 5I1LA 5E6UB 4QR7A 3EHBC 2DI9A 2ZXEB 2FIRT 4IMKC 4MX7A 2PWDA 1BQUA 2BSTA 3WAJA 2CRIA 2MTPA 1D7FA 3CZNA 3WIAA 4LQ1A 3FTWA 2V2WB 4JY6B 5DTFB 3VW3H 1BZDA 4YHML 3ZE0B 2Y0SA 5HHOD 3KPRD 3KZ8A 4G83A 2H1LM 1SLXA 2DQ6A 1EZVX 2EVGA 2I69A 2YPVA 4OBRA 5J6HB 5FGRA 3SN6N 4R7DB 3VRIB 1AQMA 2FVNA 2MPAL 2CJ3A 2GIXA 3IXTA 3C6LC 4K3JL 1YEDB 3DYMA 4I18C 2R2HA 3MBEA 1HINH 3SKUD 1EEQA 2Y2TA 2VM3A 3C09B 3IYLW 3HZKA 3PIQB 4MD0B 1I8KB 4D2NA 1P4IH 3QCTL 4JFFB 3W9EA 3RTLA 5TE6L 1ASQA 4N8PA 3DBSA 5DLLA 2QR0B 3JTSA 4MDJA 1UG9A 5JIIA 4YHPA 4N8VA 2P49B 3MCYA 4PJEA 4XZUA 4YAQA 2Y5TB 2VDNL 4FABL 4E41E 4HHAA 4TMPA 3WKMH 4MD5B 4QY8B 3AG3B 4LSQH 4BXSV 5B3NA 2IPTL 3U1SL 5E8DL 1MFMA 3FOMB 5DA0B 3TEYA 3IFNH 3FH7A 5J1AB 4FFVC 3KCPB 5JTWA 4GAJL 3KJ6H 2CO7B 1A6ZA 2KLRA 3BEWA 1A3RL 3LRSB 1V3JA 4LLQA 1FIGL 2I7SA 4NRYA 2DLEA 3BSGA 3DUUB 3PABB 4PRNB 4HBCL 2C3VA 3SO3C 5JHLA 1CU4H 4WFHD 4NN7C 5C0GA 4FJZA 4UANA 4XRCB 5IB5B 5INCB 4J3WA 1CR9L 4UMGA 3KDPB 3GMOA 3GLEA 4U4IA 1GGUA 2OS7A 3BCDA 2H1XA 2OW7A 1J1XH 3L5WB 5FFGA 4UT9L 2OMXB 1E9OA 1MHEA 2I07A 3OXSB 3A6CH 4B3VA 1PCSA 3IFLL 1MRFL 3SE4A 4X83A 3K2KA 3MBXL 3WIFA 1D5IH 3ELQA 1NKRA 4HPOL 2MHAB 5CCKL 2OTWB 4X5WA 1R5WB 3F12B 1IEHA 3CFEA 1Z32X 3FUJA 3QEQB 3BHBA 4UT7H 5JUEL 4JPVL 1QW8A 2HT3C 5JOFB 1NAKH 4WWNA 2BZCA 3BD3A 2R69H 1FFPB 3MLTA 3S36X 3VI3F 5I66A 4L37B 3DHJA 3LS5L 3EYVB 4ZXBB 1KPVA 2F8VA 3NIFE 4DGUA 2DJ4A 1OAZH 3OLDA 5IV2B 2CLZB 1M7DB 2MH4A 4F7CA 4NUQA 1U41A 5C9JA 2YGOA 3K71B 3B9VA 1Q90A 5E1AA 2V9TA 2YN5A 1Z9LA 2ARWA 3UP1A 4YSEA 4CJ0A 4BINA 5IKCB 3G6JA 3WHXA 4UILL 3VFTA 5HYFA 1GOFA 2C7UB 2UV3A 4LEXH 3VFOB 2B3IA 5D4QA 4IHOB 5CUSH 2HFTA 4ZTOL 3BUYB 3TO4B 3S48A 1U91A 3OPZH 5C0EB 3L4WA 2E4FA 2EEAA 2VISA 4X50A 3VFWB 1TLKA 2OXGA 1EBPA 4HS3A 1AG0A 1JGDA 4Z7WA 3HE6A 4BRJA 4YSUA 5C0AE 4X8GA 3GGWB 3O3BA 3C60A 4HIHB 1KBVA 3I2CH 3MHZA 3VFPB 5E2VL 2CQVA 2WLIB 3HA0A 1J5HA 1G1KA 3TYFB 3X14A 4ZMPA 2A6DA 1A14L 4KO5A 4RMRA 2N7SA 3CNKA 4PGEB 4XXDA 2QTEA 1OCRB 5DLMH 4F9PA 4JBSA 1FZMB 2HKAA 2FCBA 3CLEH 4GQQA 1N26A 3LKNA 1UD4A 2F7OA 5AWNL 5C3LD 5EBGA 3Q9QA 2ARJA 1W16A 4KZDH 4PGBA 2J8UF 3MJ7A 5AOKA 1I8IB 2VUYA 4HDIA 5GRZA 3PREA 3FQUA 1HJBC 1FYTD 2G5BA 2DDQL 1HKFA 4JVUA 3TJHC 2LGNA 3WFHA 4BWTA 4IJ3B 5I6MA 5GRUL 4H1LH 1I1CA 3PCYA 3O41A 4F58H 5E6SB 3K7UA 1JMZA 4LGPB 2D4FA 4FNUA 5F3HB 4QOKD 1H8NA 1KJ2L 5I30H 2YMOA 3MYJA 1BIIA 2Y7LA 5F2FA 3MRFA 9CGTA 4XVJH 4P23B 1RZGB 1ECYA 4JM2F 4IIZA 4IK6A 2VWEC 4AYFA 4JM2C 2NDFA 5DVMA 5B38A 2R0WH 1CS6A 4HLZG 4Q4EA 1G7JB 3K74B 5EZLB 4LZKA 3W81A 4IU3B 4LFHD 1MKFA 4S1QL 3CHOA 4ZYKA 1SM3L 4KHTL 1DQMH 4H8WH 4Y9FA 4AH2B 3T4YB 1KBKA 3CBJB 2C7FA 2H1PH 4XC3H 3NJLA 1A2YB 2P9RA 3O2DH 1RZQA 2I85A 2PO6A 1I9JH 2NR6C 3GLDA 4H7VA 3LPFA 2R2EB 4FMVA 1F4XH 4WV1B 5HY9B 5C70A 5LG1A 4QDGA 4R2GD 2DWDA 1JPFA 1BZQK 3HMXA 1JV5A 1OAYH 1DE4B 3BUBA 3PWPA 3QNXA 4LDEB 1MREL 1Z2KA 5J9PA 1KTCA 1MCSA 2APBA 4KROC 4RFNB 3OQ3B 4RA3A 2YS4A 2DQUH 25C8L 5LN4A 2IMMA 3BWAB 2WXPA 1JNNH 2E7CA 1SDDB 3B56A 4OLUL 1PG7L 2GSGB 1BW8A 5IW3A 4UQCA 5I15L 4JFQA 4GXUN 4A1RA 1IGIL 1I53A 4D3CH 2IBZY 2VXQL 4I0PD 3RGVA 4LPWA 2QQKH 4XP6L 4EXPX 4NRXB 3ZVVA 3UP6A 1OPGH 2QHRL 2R29H 1S5HB 2JKWA 5JHDE 4Z7VA 3ALWA 1C5CL 5DFTA 1EVUA 4JO1H 5DK0A 2P3YA 1LDPL 1OW0A 2DBLH 5AL8A 3WFCH 4H2CA 4YMPA 3M07A 5EO1A 2WUBL 2AITA 3L1GA 5IQ7H 1AJ7L 3I84A 3LPOA 5ECJE 1T1ZB 3MRDA 3ULUL 2WPGA 5E1GA 4H25B 3ULVE 3MRLB 3CXDL 3IT8D 2IOMA 1IAKB 2EYTB 1VACB 5KVGL 4HFUH 3KGRA 3GQFA 1CQYA 1F90H 2V9UA 3HBPA 4LCCA 5D7SL 5JPMB 4O4YL 1HJCA 4LSRH 1E6JL 3T09A 1KNOA 4MAYC 4G6MH 3ARFA 5C9KA 5J6SA 1D9KB 4XCEB 1KENL 3WJLC 1FNLA 1ET5A 3BP7B 3ES6B 1ZSDA 2JTYA 3O6LH 5I6KA 3SE8L 4CSSA 1TDQA 2QDWA 4EIBA 5JHMA 1Z5LA 1FCGA 1KB9J 4PJDB 3BKJH 2APSA 3ISRA 1YEFH 1A1OB 1ZHBB 3FQRB 4BZ2H 5CLWA 4IBVA 1WBYA 2C3XA 4R5XA 2X2IA 2C3HA 2PPAA 2FGWL 4ZAKA 4MBRA 1KLUB 4P2RA 2PABA 2AMGA 4M3HA 1NQBA 5B7FA 3T8XA 2BZ7A 1CDGA 2AJ3A 4N68A 4K71B 1F4AA 4H26B 5HI3C 2FH6A 3WFEH 2MFNA 1DANU 4JW3A 3ARBB 3U36A 4HC1A 3BWZA 2NY1C 1FP5A 3G6AA 2Z4TA 3FFCB 3T6ZA 4CVWA 1JGUH 2BP5M 1HIMH 2N4IA 1EAPB 3UG4A 1WC7A 5AVWB 1BM7A 1P5VB 1G43A 1LYQA 4UF7C 4YHLL 3RX8A 1NZRA 1VEMA 3V0IA 3WS3B 3ZK0A 3NG5A 4K94H 1HNGA 3SQBA 5T1MA 4URKA 3GJFH 2OSLB 3E38A 2BP8B 1CFQA 2A6IB 4DP4X 4JEGB 2J1ZA 2I5YH 1ZS8B 1Q9KB 3QUML 2EYRB 1Q4NX 3QWOB 3IPEA 3JWDC 4Y2LA 4Y4KC 3UTTD 2XZQL 1WFMA 4CMMA 3NPZB 4R90H 3T0ED 1X4ZA 2JJTA 3O2WH 4PLKC 1L3WA 3L3IB 4UZGA 3C2SA 1HYSD 1T03H 1I4FB 1UJ3A 3AT8A 4B9CA 2X7LB 3E6HA 1UATA 3ASNB 2H0PA 3BQVA 5FLVA 1KJ3L 1JI2A 1JZ4A 5D72L 1X5GA 4WLCA 3DWTA 4NGHH 4JY5H 4X6EB 2NYZA 1U58A 2C1OA 3HZVA 2VAAB 5DI8A 3HNTH 1H9DA 2BW5A 2Z34A 2EKSB 4PJ9D 1VEOA 4J6RH 3F01A 5DZ9A 2JJVA 4FOMA 3V0JA 5IHZA 4ES8A 1JRHI 1ML0A 4J8RB 3TA3B 2HX8A 3HE7D 4RAVA 3L4CA 3S37X 3FQWB 3SCMC 4DFIA 3LVTA 3VX0A 2GC4C 3WDIA 3GI9L 4PY7A 3LEYH 1UH3A 2VN7A 4QTFA 2OL3H 1E27A 1S9VA 3FSOA 3HRZB 4RMQA 4AYID 2NSMA 1CTOA 4APXB 3CN1A 2FT6A 3BVNB 3I6KA 4KKCD 1DL7L 1OSZB 4Y4FA 4KKLD 2IADB 5IHBA 3FOLB 2VDRB 4P5TD 3PG2A 4M8VA 3NFSL 3ZBMA 3RWDA 4ZFGH 5I18L 3ZKXB 1X7QB 4DN3L 1EPFA 2PR4L 1F11A 3W0WE 1XIWB 5EIIB 2BNRD 4GIOA 8CGTA 5I73B 4BFFA 2CHNA 2XVGA 1GYAA 3GSVB 5ABDE 5I1GL 3LHPL 3P0VL 1NDGB 4U3CA 3BPOC 3WE1A 5DZPA 2IGFL 5I74B 1OOAA 4GEJA 3BO8A 5EC1A 1BD2A 2FX9L 5ALBL 1PZSA 4NSKB 5ADPH 4J3TA 2AXGA 1R46A 1KUMA 1NCAH 4WCYL 4FA7B 2XCMC 4U7KA 4Q89A 4X99A 4NC0B 3DETD 2AK4D 1I3GL 35C8L 3T3MB 3WY1A 2IWFA 2JIXD 3CDCA 2V2XA 4NC1C 3BPNC 4N1EA 1E6OL 2UXTA 1PYWB 1ZIBA 2L0DA 4JREB 5CJ8A 4QRPE 3MNZB 1TVHB 3EFOA 3LZRA 1DBML 4XPBH 4ODWA 5DD5H 2Z3FA 2WBJB 2WTPA 1DJHA 3UEZA 4J7RA 1WHPA 1ZLSL 1Z3RA 1G7IA 1HI6A 1MW3A 2VIRB 2XIBA 5J12C 3VD4A 4YDKL 1B3JA 2VDQL 2AXFB 4WWKC 4S10A 4HV8A 4XMZA 3MCG1 4MVBC 4HUWB 4F8PA 4RBPH 2HT2C 1IBGH 3A4AA 6FABL 5FM5O 5D7LD 4E0RB 4CKVX 3FO0H 4MHHG 1PQZA 4JFEE 1XGQA 3ARYA 4YPGA 4XP1H 4TNVK 4RZKA 1EERB 1FZJB 4X7EC 3WNMA 4GRMA 4EQ2A 3D6GA 1KJMB 3DV4B 3KM1A 2YMTA 3AMKA 4P59L 5HDBE 4TSAH 2FTAA 2JFCA 2EEFA 3FPXA 2G4EA 3EO1A 1YMMA 5KSAB 1E3ZA 5C07E 1DO6A 2BVPA 2QQLH 4JQVA 4NEHB 3FT3B 2B9AA 4XP9H 4N2GA 2IDTA 3P69A 2LW3A 2HT4C 3OZKA 4IOFD 3SBQA 2AEPH 3EUUA 2WVVA 3HG4A 4LSPL 4QCIA 4QO1B 1A0QH 4WUKH 1OLZA 1XR8A 3NJVA 2HKFH 3VUAA 5CIPH 3FTZA 5HXMA 2XWDA 2Q2EB 2NXYC 3P9MA 2ADFL 3V8CA 4LF3B 4GRLB 5DUPL 2WCSA 5KBPA 4NKDB 1UFUA 2WXLA 1JGLH 3BP4A 3G3LA 4LHQB 5B1JA 5AOMA 2XTJC 3V8OA 3H4HA 3A6OA 3DYPA 3PWVA 1A3LH 4LARH 3UTSB 2B9BA 2YPVL 4U6HA 2R0ZH 4FXGA 3MV7E 1CGWA 3FCSB 3T2PA 4UBDD 1KTRL 4FFYA 1INQB 3REWB 5G5DA 3P4OB 5JW4M 1TTBA 2FZ3B 3FQXA 5DQDH 4DQOL 3A22A 4PJIA 1D5BA 4LCWA 4RMTA 4HUCA 4U1KB 4JRYD 1ZCRA 2EACA 1TQSA 2GEQA 4JX0A 1CFSB 3HZ3A 2YQBA 4GKOA 3WJMB 2VAJA 2G5RA 4POZC 3BGAA 2NCEA 4A66A 1QR4A 5BRPA 2AI0H 2BSDA 4AIXA 1JD9A 4WW2B 2GY5A 3S5YA 5JZ7D 4EUPA 1FCCA 2HG5A 3NK4A 2A9AA 3K0YA 3L95A 3COOA 2VDKB 5IG7B 4YFLF 4XP4H 1EA9C 1ZVSA 4U1IB 4AW7A 3HG1E 1RK1A 3HC4L 1M7XA 4ZMXA 1NC4D 4RESB 3HS0A 1NCOA 3ULUC 1HQRA 1C8PA 3AWGA 1OO2A 1RI8A 5IM7B 1EHAA 1KZYA 1Q72L 2X44D 4XMXA 5IVZB 3F58L 4C4KO 2H3NA 2PETA 4N22A 4NQDD 4E9WA 2H2SC 4OD2A 1SLWA 1CD8A 2E0PA 4W93A 3T2NL 1Y18A 3ZSTA 5B8CA 3F83A 3QZLA 2PXYD 5JHLL 1FL3B 4C56D 1U8LA 2WLKA 4X5QA 5GGQL 2X9XA 3W3BA 5TDPA 3SBWC 1IGML 3D8MA 5D1QD 2L7UA 3U4BL 1JZ7A 3BQUD 1YYML 1TVBA 3IDJB 3KLLA 5I75B 4Z18A 2Z8WC 4HOXA 2JMRA 1M56B 2FBJH 1YYLL 3PUUA 1AI1H 3O3DA 4HUUB 2IAMD 1ZANL 4W6WB 5J3HC 5GGTA 1BECA 3TCLB 2X2HA 4DGVL 1BEXA 3FHEA 2AJUL 4GUPA 1FL5B 1J8HE 4GJTB 4U31A 3QJFA 1G5GA 3N1PC 3IGFA 4BD4A 5CJ5A 5GGVH 5EU6D 3IDXL 5DJDA 3VU2A 3OHXB 1KLGB 1XCXA 2NOYA 1N59B 3CSYB 2RACA 1NUNB 1ONQB 5ABZA 1U42A 2NT0A 3GO1L 3QA3B 3V7MA 1MW0A 2WLLB 2O61A 2OR9L 4NO2A 5DHMC 3C9NB 1DQJB 2JKIS 3WNJA 3IDGA 2B1OA 4IEFA 1EHXA 3L3OC 3DK0A 2EC9U 4Z0BH 4XPFL 5DUML 3LN9A 3OAYK 4NKMB 2LFEA 4PJ8A 5DJ0B 5FFOA 3ZPDA 5KJRL 4CKQA 3RZCD 3E0GA 3SPIA 3QDAA 1XF4A 4PJAF 4PYHA 4KITB 3HAEG 2ZKHL 3B7SA 2Q8BL 1CWVA 1UVQB 1RV6X 1YNKL 5E8EB 3DTXB 3QJOA 4N0FB 2XKNA 1G1CA 4LRIC 4B50A 2ADJA 1E4WL 2E3VA 4XN5A 4KK6D 1J1PL 4XAKD 5J13B 4HK3N 1I1RA 4ZQKA 1VGEH 3GNML 3RIAF 3MUUA 4JUSA 4WY7H 3H7BB 3QJQB 4KNQA 4EN2A 4AVKA 5TQ2H 1CYWA 5CKAA 5LGHL 1DQDL 2QELA 3SJVD 43CAB 3RB7A 2MCMA 3UAJD 3MLRH 3N0PB 4O2FA 1ASPA 1LE9B 2HFEA 1WFIA 3D85D 2JQZA 4UIKL 5CJXC 5DD1L 5E4EC 3IPBA 4Z7UF 2N59A 2NQCA 3SDYL 4DP1X 5DWPA 4G5ZH 2M2DA 3E8VA 5IJVB 3QDJE 4ODXA 3QH3B 1F5WA 1TF4A 2VN6A 2WZPA 4J3OD 1INEH 4OV5B 1V7ML 4HS8L 3QIWA 2FWOA 3VFUB 4PWHA 3QPXL 1ZWIB 1TU2B 3TURA 2HVKA 3K6OA 4Q6IB 5HSFA 2GI7A 4RX4A 3ZDXF 1JD7A 4DOHE 2NX5D 4FQLL 3SE3C 2VLRB 3BYYA 3MO1B 3CZUB 1XF2B 2NUPA 4KKAC 4HX1A 1N5YL 5FK9A 4G8IB 5JORA 2ICEC 3OKYA 4NQED 5B3JF 3PU7A 4F91B 3II2A 3VQ1C 4YHOL 2ZWNA 4H40A 1BHGA 1Z3GL 2VERA 2DLFH 2CO6B 1T20A 5F0MB 4LLDB 1TZOA 3UGXA 4NP4L 3BE1L 4E5XB 4LSUH 4P3DA 2J3SA 5FUCE 4GW1B 2JQMA 4MQXC 5E6IB 1LK3H 3WKQA 3OLGA 4FERA 3R7QA 1LQBC 2JKJA 2X9ZA 1AMYA 3MRKA 3OKMB 4HUXB 4XN1A 1HHIA 4R97B 5CJBA 3IF1A 1Y6KR 4YHYC 4L3EA 3UDWC 2XICA 4BIKA 3KG5A 3OZ9L 1U0QA 5E9AA 2ESVE 2W5PA 1R0AL 3F6JA 2EH7H 3MLVH 3EXJA 4QMEA 2Q10A 4K3HA 5DD3L 3CFBA 1HESA 3OB8A 2DQGH 4XXCC 3HG3A 3MJ9H 1YECL 1IGTB 2VITB 1J48A 3B1UA 2HXAA 5J11B 3V0WH 1YY8B 4Z7NF 2VUOA 5SWQA 3HFML 2H45A 2V3FA 1F3RB 4RSYA 2L7QA 1FFOB 2C4FT 1A7NL 1J88A 4WJG3 2W65B 4Y5YC 2R69A 2PWFA 1QX1A 2VSMB 3N0AA 4PM1A 2QL1A 2WXFA 3K6IA 3QQXA 3IM1A 4F7MA 1TMCB 1BVZA 3HI1B 1LO3H 4U1NA 4EI5C 4NPYA 3GSUA 1KCSH 3CHSA 4OZGF 3RPBA 3V9EA 3HB3B 5IQ9B 2FHFA 2B8OT 5EG6C 4PIBA 1KYOK 1UB5A 3OX8A 1VFUA 2MEJB 4HIEB 4LKXA 5F1NA 4EI0A 5DVNA 3TWCH 4NCDA 5AFAA 3BP6A 1XGUB 2XXCB 1HWGB 2X6MA 4R7LA 2XN9E 1VPOH 3HC0A 3FU3A 2Y36L 2OMZA 2BS8A 3AG2B 3ARDD 3K2MC 4KTDL 3S35X 3CDZB 3PHOB 1CL7L 2TRYA 5DWUH 3MMEB 3RVXC 1QTPA 2JCCB 4PJBF 3TYGL 3LOWA 4HIXL 5FECB 3O9WB 3SKNB 4X80L 4FG4A 2FH8A 5I1CH 5SX4I 1UWGL 2VXVH 1HU8A 2OSXA 3NZHH 4NQXB 3VE0B 4TLKA 2UXGA 5GGRY 4JANA 3AS0A 4HH9A 4IOSD 1QSEA 1BYNA 3L54A 3QNZA 3ILDA 1G7LA 3A5VA 4KMTL 5GJTH 4KXBA 5DURD 3UAAA 3GXIA 1G7MA 1I7RB 3APMA 5T3XL 3L3JA 4GP8B 4GG6F 4JB9H 1UT9A 5KANI 4H8HA 3ATEA 4GQPH 1V3MA 1NFDA 5IOPA 3VXQA 5EBLB 1MI5B 1PL3A 1ILUA 2WZAA 2BNQE 4N2EA 3FBKA 4Y9CA 2HJKA 4YO0B 5E7FA 1HZHH 3L3DA 4H1LA 2PWGA 5G4OA 5BOZG 1GYWA 1U2CA 4UWQB 3MBEC 5DXWA 3TJEL 2X4SB 2YQ2A 1H3TA 3WIIL 4C4KT 3GZKA 5DGQA 3KS0H 3GS7A 4O00A 1J0JA 1AANA 4LCYA 2Q7YB 1M2OA 1QKZH 5F0LB 5GJSH 3SHSA 3UZEA 1EJOH 5IGXL 3AABA 3NOIA 4HC1L 5FXCH 2EUXA 4PRHB 5F6IC 3Q43A 5DHVH 5HHPB 1HK6A 3LXBA 3GEWB 3H0TB 4V2CB 3RWGA 3S2AA 1KB5B 4LSDA 3ULVD 1KPRA 1P0SE 1G7QB 2Z9TA 2ZXGA 3N1FC 3NIGB 5C3IA 2HLAA 3CXFA 5FO7A 4P5KA 5HYQA 3NJHA 3WEXB 4C55A 3MRRB 2BHZA 3IRZA 2HSIA 1P9MC 4NKOB 3O2DA 3V5KB 4M43L 3ARGB 2EDXA 4UM9B 3OSVA 4OJFH 3R8BB 3GD1C 4M6OH 1SQ2N 1YDPA 4IOIB 5HHOA 3D3VE 3KPRA 4PJHE 5C6WH 3RNQA 3TPUA 2NY2B 5ESVB 4G8FB 1T1WB 3DOIA 3D7PA 4LT7A 3CFDB 5BRZB 1S9KC 4KY2A 4NPJA 4JFOB 4DEUA 3DMMB 3LN4A 5BXFA 3L1EA 4K07A 4PMFA 1P7HL 1L9NA 3MRBA 4G80B 1PLBA 5DVLA 4ZQTA 3BAEL 5DMIH 5AW3B 3CH1A 4X5RA 4J3OH 5LO7A 1OWRM 5DEGA 3FFOA 1EAQA 3O3AA 4HMEA 4S0SD 5DK3A 3TV3H 4OFQA 2UZXB 3QDGE 4L8BA 5DYFA 1ZLEA 3U79A 1FWXA 3GK8H 1E5AA 4PJGF 5KYUB 5HHVH 1JRHH 5E8PB 4M1GL 4YOKA 1K4CA 1UOKA 3DUSA 2OMVA 1LGVA 3FMGH 4U6TA 3MN8A 1IT9L 1BLNA 5BUAA 3KPPA 4NQCD 4F37F 2V9QA 5I6NA 3QEHA 4OB5L 1U2YA 1ZXKA 3BPLC 2EO7A 3JV6B 1XZ0B 2R29A 3TU6A 1DEEA 1QLFB 3EDEA 2V5SA 3VXUE 4BA8A 2VC2H 4Y4HD 3RNKB 3LZFL 1BFOA 1XEDA 3DOSA 3ZTJH 1SMDA 1MDTA 1RJLA 3BKYH 1HT6A 5CMAA 2P80D 1JFQH 4ICXA 1F6AB 1WFNA 5A40E 1PEZA 2N0KA 4P2OD 3QYMA 2EIJB 1MCQA 4DUWA 2UWEF 3IJ9A 4HK3J 2EEBA 1DQLH 2BHYA 1KEGL 4HMCA 1ZHNA 3TT1H 2VDPB 4ONOA 2GTZA 2QSVA 4FCAA 2XBDA 1CVSC 3C60C 3MU3A 2NY7L 1FSKB 3EJUA 3MPCA 4WI6A 5KBNC 2KH2B 2ZOWA 2B4CL 3LQAC 5FKAA 1AGCB 1YJDH 4PJFE 3RJQB 1T22A 2BVQB 4F9PC 5CFAA 1IRAY 4BZ2A 2XPGA 2WYZA 3QUZB 1Y0LA 4IRZL 3T0WA 4BJLA 1G9EA 1NH6A 5IW6B 1JF5A 2C9PA 4EOWH 4EZMA 1G6RB 3QAZC 3HS8A 1ACYH 3PWNB 3QQ3A 2OYPA 1XCWA 2AK1L 4BFNA 2FX8L 4YC2C 4PBVC 4DETA 5EOTB 2DD8L 2VQUA 4PP1C 4IBLT 3C2AL 1TJXA 2FJFA 4MD4B 1KN4L 2JJSA 4I9WD 3EJZD 1ID5I 1AS6A 1ZY9A 4XHQA 3Q48A 1QSFB 3DXAB 2QMKA 2WVSA 4HU2A 4MMYA 5HD8D 3SY6A 1A7QH 3HBZA 4OD3H 3S3JA 2K9UA 3T9WA 3POCA 4EVNB 3V10A 5JA8B 1B2WL 3GJFA 4RFEA 3HI5L 5HBBA 4DJMA 3W0WD 4KMQA 4H8PA 2R27A 1A9VA 1PZ5A 4J5VA 3IMUA 4UQIM 3SOTA 1CBVL 5HGAB 3HAEB 1L5GB 2OYMA 5CHNA 1ZMYA 5IFJA 3UYPB 3W37A 3PWJA 3T6XA 2NPLX 4HMDA 1W0WB 2HWZL 5HHQB 2E7HA 4C83A 3MLUH 2PCXA 4Q97A 3S3PA 3SKMA 3NCCB 3C5ZD 1IGYA 1KLFA 4IRSB 1WA2X 4G7RB 4NCC2 4XN8A 5IHUL 3VSUA 2ODHA 3N44B 3UX9B 4P57B 4PRIB 2ZUUA 1JSYA 3OZLA 3EDFA 1WBZB 1OTSC 3NEOA 3S5LA 3OG6B 1UD5A 3EHBB 15C8H 1JHTB 1QUNA 1QQDA 2V7NB 3GXPA 4QRPD 1VFAB 3BH4A 4UQ9A 1FYTA 1BZOA 3KYNB 3P2DA 3BDYH 5KW9L 2XN9B 1P1ZA 4MNQD 5DVPA 5JIHA 1RIHH 4YGVA 1IAOB 3ERXA 1HCVA 3CZSA 3S5ZA 3IJHB 2WKOA 4RGMC 3ZRCC 5E70A 2H47C 2IGLA 4P4KD 4POYA 1GS8A 2BDNL 4K3EH 2WSDA 5LNGA 1JXDA 4JG1L 4FFYL 4ZUVB 5ICYB 4M5SA 5LVEA 1DQVA 1UASA 1C5DB 3PV6B 4JFED 3C6LB 2Z31B 4GQZA 1O9ZA 4NOBA 3GSRB 1QFUH 3P3RA 1IGCL 1V8HA 3HKFA 3MRPB 4I18B 5CJQH 5EU3A 2E47A 3QE5A 4DCQB 3U46B 2ZXCA 3D18A 4OCMC 1S9YB 4D0CB 4ODVH 2OL3A 2W9EH 4XMVA 3UBXA 5I1IH 3ZKMD 3UG3A 1IFRA 2AQRA 3Q8BA 4TOYH 3ULVH 3WG7B 3CZGA 3VXME 2L7JA 1A7RL 1G0YR 3HR5B 5D4HA 3ZO9A 1GTNA 3H85A 5C07D 1MG3C 1EANA 5FYKD 3FZUC 2DYPB 3GSXB 4ZPTA 1ZT1A 1SHWA 2RALA 2NZ9D 2WSPA 5EO9A 3HNSL 3T1FB 1IMHC 3FO2B 1TT6A 3SDDD 3CZLA 4LCCC 1AZUA 3SGJA 3IU4L 5F1IA 1Z9OA 4DKTA 4MLSA 1YNTF 3NBNA 3VFSB 4OGYH 4PAZA 3ARFC 4GW5A 2HJFB 3H9SE 4P2QD 3SO3B 3RUGE 3FO9A 4NN7B 4OVVA 3SE9L 4YHKH 1SNRA 3VWKD 2K78A 3P9LB 1FE8L 2BNUB 4EI6A 4ILDA 3OKEA 1TJIL 3MV7D 3CDYA 4OCRH 5I17A 2FT7A 5T1KD 2XFGB 2VLJB 4W70A 2A83A 2W80C 3W9DB 2OULB 1T66C 4KNTA 3RWJA 3ZDYF 1AXTH 5GGTL 2KBGA 1KT2B 2C9VA 4ZAKC 2DM3A 1DTUA 4ABVA 3KPQA 2B1AH 4I0PA 3S37H 5I16A 2H2PC 1XGYH 5DZNA 4PB0L 1BCIA 1XD0A 2UZYA 3H42H 1MHCA 3B6SB 1MFAH 3THMH 5LJYH 5LKNA 5K9KA 4MNHB 1J9TA 3QS2A 3VVVA 3VTAA 5DMGD 2AW2A 4CVZB 4ZUSA 3QZWB 1MFDL 3BVTA 4XC1H 3MR9A 5CEYB 3HG1D 2Y4SA 1T0OA 3NQKA 1TQWA 4BFKA 3VRLE 1BF5A 1CFMA 4RAUB 1NGYB 1KGXA 4N1HB 1A7OL 3IU3A 2FWSA 3T6WA 1HSBB 1UD3A 4J3OF 5BJTA 5ESQB 4JGUA 1RUAH 2BY1A 3EJCA 1CXHA 3RWEA 4YDLB 1SXBA 4MWFA 2NQDA 2DH3A 2ERJC 2ZICA 4GINA 3FQ2A 4WTQA 2VZVA 2GB2A 2WXKA 4MZ2A 3ILQD 3T6QC 3FT1A 1MH5B 5CIPA 2V3DA 1LP9B 3AWEA 3F8UB 5AVRB 3WN5C 3ZX1A 1BZ7B 1NCBH 1XL6A 1TQBC 5C0RH 1FNFA 1RP8A 4FYQA 5IW1B 1TZHB 5SX5H 3VW3L 4FL4C 3RL1A 1SUHA 4MS8D 4JPIB 2XWZA 4TV3A 1D3CA 1E7VA 2IXQB 1CXEA 2QPEB 2QKSA 2BY2A 3C6EA 3MGAA 4RWYH 1AVAA 4NNXA 4PJBA 2E56A 1H5BC 2FX7H 2V5RA 2E46A 4OF8A 2P5EE 1T7ZA 3HHSB 1HXKA 3CH8A 1HINL 3T77A 3MRNB 2IFFH 4OFYD 4ZS6C 3VDBA 3VDCA 2X38A 3FRPA 1P4IL 3KL0A 2NSXA 4ESKA 5IB2A 2FE0A 3QPQC 3O6FC 4L1DA 1Q9OB 2DMHA 4JJ5A 4JKWA 4GG6A 1TQTA 1XF1A 5TFSH 3S3BB 5E5UB 2QZQA 4U1JB 3ROOA 5EO0A 2NLJB 1JK9A 1ZT7A 1XGPA 1U6AH 1WCBB 2BP3A 3PFQA 1OP5K 3WKML 1QHPA 4LSQL 4KO9A 3DA0A 1A4JA 4OZIB 3UTTA 4Y4FC 5AOJA 3MRGB 5HI4C 2FK9A 2OZNA 3IFNL 2CO1A 4LSSH 1PZCA 4M4RB 5TPWH 3T0EA 2J6WA 3ZHNA 5DUBA 3KJ6L 3X11B 2RR3A 2W0FB 2WTOA 4W9CC 2YAOA 3NK3A 2PPFA 2PCYA 3PDGA 1S7SA 4GKSA 2Q20A 4F2EA 2P42B 1CD9B 5AALA 5DZLA 1CU4L 5D1ZI 4LL4A 5D4JA 4NLAA 4ANVA 4N5ED 2ITCB 4N2CA 1W72B 4PJ7B 3BDBA 4RRPG 2OTPA 4XVUC 4OKVA 3DIDA 4IM8A 4AQ1A 4JFWA 5CD3B 5F9WC 2BIMA 4KJQC 4PJ9A 4I77H 1TCRA 5TDNB 1DQQA 1E8XA 1VEPA 2YGQA 2HP4A 3A6CL 3H55A 3QDJD 3Q2WA 3SDAC 2PCPA 4AUUA 1VJSA 4RGNE 2ISDA 3D4YA 1VDGA 1D5IL 3MQIA 5AKVA 4ISVA 3HE7A 1T5XA 3Q6GH 1XH2A 4PJ5D 1MCEA 3HHMA 4A7QA 4KROB 3ZE2F 1BEYH 4UT7L 2BVEA 4EDWH 5C8JA 1NAKL 4WQOA 2R69L 1NCWH 3CCHA 3N06B 3C8HA 4E36A 1R3HA 4X7TA 1UB6A 1NAMB 1H6UA 3QUXD 3D2TA 1YEJH 2EIMB 3RGHA 3KPMA 4OR1A 2M1KA 2HTKC 1OAZL 4P5TA 5AEAA 2XFXA 1U8IB 4EJ1C 2F61A 4U1MA 1NIAA 3P3TA 3CD4A 2D7NA 2TAAA 2ZPKH 4BE5A 2HJLA 5FYKH 3WE6B 3FS9A 1RURH 3BZ4A 5HHME 1DLFH 4PJGA 2BNRA 4O9HL 3FU6A 1N19A 4OF6A 4MXQD 5ADOH 5M94B 5JIKA 4LEXL 2GTQA 1FGVH 1GS6X 1II4E 4EE2A 3QYCA 4PJXF 5CUSL 2XBZA 3PGCB 5ENWA 4BH7B 3OPZL 1XF3B 1H15A 2QHLA 1HE8A 2ESVD 4JQVC 4ONGH 5SX4H 5A7BA 1MVYA 2AK4A 2DM2A 4CU8A 1LEIA 2JIXA 2Z7ZA 3I2CL 2V5MA 1O7VA 1M7IB 2CWRA 3OR6A 1G9MC 1LE5A 4P46D 3FT0A 3R0NA 4MAYB 3CX2A 4JN2B 3PPEA 4H0IA 4YDZA 5DLML 3QUYD 1UZ6F 3K6SB 3CLEL 2ITDB 1FN4A 3S4SB 3BN3B 4WI7A 5AD0B 4KZDL 2O26U 2UY6B 1V05A 3ZJAA 3FQNB 4Y16D 1BLIA 1O6SB 1A9EA 3DGCR 4BSVA 3EJJX 2ZUTA 3GSQB 4FXGC 5A2CA 5D1XE 5D7LA 5F7YC 3I9IA 3CSGA 3ATBA 5EUOE 5B7EA 1GL4B 3U1QA 5LB1A 4H44C 5F7HA 3MX0B 3AAZB 3FHAA 4F58L 3HKZA 2VMFA 4CUCA 4N2HA 3FUNA 5IT2H 5I30L 5DHDA 5KSBB 1D5XA 4WEEA 4N26A 4FNQA 2PP8A 4MDIB 3VXSD 4XVJL 4PJCF 3UO1H 2Y2WA 4WSGA 2CR6A 1P1VA 3TH4T 1FNAA 4L2YA 4W1TA 5E5MA 4DZBA 3BXNB 3WUZA 4LNVA 4JFYA 2NY1B 2R0WL 1C9SA 1H6TA 4UINH 4A2GA 4MSWB 2YZ8A 4NHUA 3OKLA 4QXTB 4KZ0A 3T4AA 2E8ZA 1FFTB 4GIAA 2AJYH 1DQML 2ODIA 3FT4A 2Z93A 1AKJB 3HS0C 1AKPA 3VGAC 1ETA1 5DO2D 5M95B 3EYSH 2H1PL 4XC3L 4JRXE 4ZX6A 4TLUA 4J6IA 3O2DL 5C0BD 3NCXA 3NN8A 1I9JL 3ZQ9A 4YIQA 1EZLA 1EEYB 5FDYA 5I2IB 1F4XL 2XXFA 1CG9A 3CDGA 3LS4H 4CGUB 4Y4KB 1PG7X 3FTSA 4GSRA 4PW9A 3P11H 5KAQG 2C1PB 4Y5XC 4XNYH 1U3YA 1OAYL 4ZG1A 1AYRA 1AZRA 3B7RL 3MJ9A 4PG9A 3FUDA 2X9WA 1BMWA 1GZPB 4YDNA 5L2KB 3KBHE 5HYSG 2X4PA 3C5SB 3HUJB 2WKGA 1PKQE 3BP5B 3UBGA 4XP5H 1WBXA 4ATWA 3IWVA 2DQUL 1GOHA 3P30H 4AM0Q 4Z5RA 4JRYA 1R3LB 2NTFA 3ZY7A 1JNNL 2CPUA 2VQTA 4I0KA 3GKZA 3BPCA 3H56A 2WIIA 3HBQA 4R96A 3D50A 3TZVC 3GT6A 3VGGA 2KT6A 2AV7B 3D06A 4O51A 5DQJA 5IESH 3IDYC 2YMXH 4D3CL 1I1FA 1IKFH 1QLEH 2QQKL 4Q2ZA 4XPGH 3IDNB 4JZNA 3VJ6B 4Y1AD 4HA1A 5D6DC 4R7NA 1KB3A 1OP9A 2R29L 1BG9A 3QWQB 1AP2B 4TKWA 3SCMB 1GYCA 2TSAA 3D25A 3D39E 3TOPA 3WEMA 2VR9A 2HX9A 2ZUXA 4JO1L 3WFCL 3DJRA 2DBLL 4PJ8C 4UNUA 4LCUA 2JKLA 1MWAH 1ZHKA 4NQDA 3OB0K 5IQ7L 2WLJA 1XL4A 2CLVB 1RCYA 1WK0A 2PXYA 4OLYH 1I7UA 2RIKA 2IBGA 1A4CA 3GRBA 1WF5A 3QEUA 1XCTA 5JXAH 4C56A 4HFUL 2NY3B 1F90L 1EFXB 1JFHA 4LSRL 4HGWA 3GHBH 5GRJH 4GXVL 4G6ML 5D1QA 1K8DB 2IPUG 1N8OE 1YC7A 2CDFA 2XTSA 3BQUA 4JFTA 4ZK8A 1MXDA 5SV4A 3SDXF 3HR6A 1F6LL 4HKZA 3FN9A 1UXMA 1SFDA 3BPOB 2YC1A 2F53D 3O6LL 1W9XA 1WO2A 5ICZB 2IAMA 4XPHH 1QBAA 1FBIH 4P04A 1H6EA 1ND0B 3BKJL 4PG2C 5EN2A 2A73B 3D5OF 4AMKH 1YEFL 2ZX7A 4YBHA 4BZ2L 4NN6C 5DFWH 3L4XA 5EU6A 1U8MB 2JXMA 5KN5A 3BPNB 4TLTA 4X6DF 1EO5A 1A66A 1TJGH 2W9DH 3J07A 3KAAA 1A6AB 4E41A 2P5WB 1CYXA 3QIWC 2ZWSA 3FB8B 3UADA 1HXYB 4OY9A 1ILSA 1JPEA 2A4EA 3D69A 3VD5A 2F0CA 4L8SC 5J12B 1TPXC 3DX4A 2IDQA 3VXUD 3WFEL 2BPBA 4D7PA 3UZVA 4WWKB 5DRXB 1FAIH 2KZ1B 3MBWB 3OMAB 1B0RB 4G43B 1KGCE 4R4BB 1JGUL 5CLTA 1HIML 5DHVA 3WKPA 4E9VA 1OP3H 3AY2A 3RZCA 1KJ2B 4NT6A 1P5UA 3E3QE 5C0JA 4K94L 2HLFC 3QO0A 4WGKA 3RKDC 3WN6A 2QSTA 1RPQA 5DC2A 3U4EB 1GCFA 3TVMA 3KYOA 3S35H 1IGJB 2QLVB 2H9GB 4UYPA 3K6NA 4QXGL 2BXYA 2I5YL 4FULA 5CBEA 3DECA 4ALAC 5A16A 1LD9B 2FRGP 3QIBC 4FNRA 4ZX5A 1UUNA 5D2LE 2YO3A 4Y19B 4Y9GA 1G7HB 1U8NA 3L2MA 4R90L 2OQJA 6CGTA 3O2WL 1CLYH 3RWIB 4AE1A 3RIKA 3SJVA 3L5IA 1T03L 2YZ1A 4YDIH 3UAJA 4FNLH 5D1ZD 4DQAA 3D85A 4ZMYA 5A6LA 2PUQT 4LIQH 3VQ2C 4D9RE 1ZLUH 1HEHC 1PTZA 2B2XH 4NGHL 4XCYB 4JY5L 3WLBB 1IEAB 2D3JA 1XD1A 4HJ0D 4UIMA 2XWJB 5ISZB 2D9CA 2NXYB 4RIRB 3VXTA 4A2LA 1K3ZA 4J6RL 1YPZF 5F9DC 4FP8H 1I3UA 1PZUB 2P8MA 2HYMA 4K8RD 2NX5A 2XTJB 4JFFD 1GOGA 4Z7QB 4FD0A 3NYKA 1HSAB 3UPRB 3FCTA 1R4XA 3NCEB 4B9JA 4ETYA 3OPUA 4E9LA 4E9XA 1WA0X 4NQEA 3APFA 2KHAA 4F8OA 5A6IA 2B7DT 3KXFB 2GHWB 3L16A 3LEYL 3QXAB 4LPCA 2OL3L 3CQPA 2APFA 2BS71 4RQQB 5C08E 4XBMA 3C75A 2FO4B 2K6WA 2W81C 5IIEA 4ZO9A 1HC1A 3BMVA 5L4FA 3BJ91 5C0AA 5HVHC 3T0BA 4ELME 4ZFGL 7FABH 4Q6KA 2DYRB 4X5XB 2HFFB 4O58H 2DI8A 1A4BA 1JZ2A 4I5BB 4KI5E 4ZNCD 4OZHB 2JI1A 5K39A 5F9JB 5I5IA 1EV2E 3BJLA 5E2JA 5EDSA 5E94A 4RAHA 4YBLB 4S1DC 1DYZA 2X05A 1MFEH 3MRQB 2OCJA 4JK0D 5ADPL 3RP1A 4I89A 1FH5H 2F8OA 2X12A 3K4ZA 4DKAA 1EHNA 1NCAL 1V54B 4PRBB 5I26A 2ZUSA 3B7YA 3CPLB 1XCQA 3X1EA 5I23A 1PLCA 1VKXB 1NGXB 4LHUG 4QJ5B 3OR7B 3QEQD 3ZTDC 5GSRA 1BM3H 1XWVA 4NQSA 1Q9LB 4JRXB 1EK3A 2ZSVA 3IDMA 4WHYG 4XPBL 4AGNA 5DD5L 5IUCA 1JYNA 4DK6A 5FF6A 3BUDA 4HCFA 4YHZH 2X1OA 3P4LA 1Q38A 4G1EB 3EOBB 3P40A 3TEXA 4BQ8A 3F7LA 4MRCA 3L08A 2VN3A 3WLWD 4NZTH 4PWJA 1IBGL 4AEEA 1OD9A 1GMEA 4NXKA 3DX6A 3FO0L 4TVUA 5AZ2H 1QNIA 1C16B 5I6OA 3VXMD 1YNLH 3NJIA 4X6BA 2YWZA 3NIDE 4J3VA 3FO1B 4XP1L 1X6NA 2CD0A 1A25A 3FK3A 3Q8FA 3VA6A 3FQYA 4QGTA 1L0XA 2Y6SD 4JGMA 1CK0H 3ARDA 4B96A 1XBRA 2PYEE 1LDSA 5C2UB 5CR8A 1GZHC 2V17H 3FRUA 3L3OB 4TSAL 3QXDA 4FG6D 2ATAA 4F33B 1JZFA 4H8WC 2L04A 2OMWB 2O72A 3QG7H 4G42A 2QQLL 2DWEB 1AHKA 4P4RA 3ZL2A 2XV6B 4XP9L 4PWFA 3RTQD 3WXVH 1A3ZA 3LQZA 3I75A 1J5CA 3H9SD 1S8DA 4LCVA 2AEPL 2X1WL 3QUMB 5EU5B 4ZUUB 4IOSA 4WUKL 1A0QL 1IE4A 3UTOA 1RJZB 3CFMA 4OFIA 1QG3A 4X6CF 2V6HA 2HKFL 3QQNA 3UZQB 1M3IA 2WXIA 4HK0B 4WGWB 4UM8A 3MLWH 3P54A 1VB9A 3QDMB 4UI2A 3BLBA 5MENB 5EEZA 4TUKH 2GT9B 3L3KB 1JGLL 4X7FC 3HNVH 4WU5A 4YDVA 1J12A 3C5XA 5GGSB 1KYOJ 4N0YH 1DBJL 1A3LL 4LARL 5D2NE 2Z92A 3BZFB 2R0ZL 2LTQC 2HA1A 5JPNA 1CDIA 5KBDA 1KIQA 1CT8A 2YGVA 3X3FH 3QHZL 4UNIA 3OAZH 1ECZA 2WYHA 4P5RA 5F7FA 5DQDL 3GSOA 3I74A 3DV6A 4MS6A 2YK1H 1Q0YH 2AJSH 3RWCB 3VD3A 4QXUH 5BZDB 3ESOA 4QGYA 3SGKA 3U9UA 4L3CA 4LBEB 5H4YA 4BFBD 4KHXH 2H6OA 4JHVA 1MELA 1X5MA 2E6QA 2AAVA 1B6DA 2AI0L 3RAJH 3WENA 4HS6A 3VGDA 3IFPA 1Z6JT 3MFFB 1VF5C 5GHWH 3JYCA 1OGSA 2X1QA 1QABA 3EOAA 3AB0C 4BQ9A 3T71A 3GZOA 4KJYB 1XTLA 2GK2A 2ICEB 4XP4L 5HHNA 4AIZB 4K0OA 5EU4B 5EBMB 4OBSA 1HWWA 3K81A 4AC2A 5FW8A 1NPNA 1QSVA 1LWHA 4D8PA 1K5NB 3EDKA 4WIQA 3V6ZB 1U21A 5EC2A 2QVIA 3TNNA 2G4GA 3A4DA 3BD4A 5DMKA 1Q1JH 3SEPA 2AVFA 1OQXA 4DVBB 2J56A 4DIXA 3CJJA 5D6CB 4H0HB 1QR1B 1TNNA 3NJJA 4U6XB 3BIBX 3P73B 5DJ6A 4YHYB 3NSJA 4GAYA 4GH7B 1A6VH 4GG8B 3VXNA 1SYVA 3WEOA 5GSVA 1AZBA 1DBAH 1U3NA 2BP0B 5MEOB 4F7EB 1CPUA 3FW6A 1MFUA 2P5ED 2FBJL 4K8RH 2Y7QB 1AI1L 1UD2A 2Z0BA 3V95A 1UYWH 4K5PA 2R1YB 2VLLB 2NT1A 4NQCA 4E9QA 1N2RA 3SB3A 1T4WA 4WU7A 3IAQA 5CWSA 1PZDA 5GGVL 3RE0A 3OGCA 5C0IB 1UZ8A 1T21A 2B16A 2EO9A 4Y4HA 3VFVB 4Y5YB 2DQFA 2O5ZH 2VDQB 4W4OA 3LCYA 3DURB 1MW1A 1ORQA 4K23H 5CN3A 5D5MF 1JYVA 4F3FA 4PIRF 1DSFH 3V5HB 3RDTD 3RU8H 4P2OA 4EI5B 4Z0BL 2AJXH 4K94C 4YSRA 3OGOE 4WEBH 1R3KA 2ROXA 3SODB 2ED9A 4AG4H 4FQHB 4X4XB 4YLQT 4ODUA 2W0KA 1EUUA 2VOTA 4OFKA 1ES0B 4FA6A 1SJXA 1Y6NR 3P1VA 1ZT4A 4YE0A 3KPSE 1RUPH 4ZSOE 3F85A 1D9KD 1GZQB 4OLVH 4V1DB 4QLRA 1MLBA 3ASOB 5E5RB 5DK2B 3FUHA 1DUYA 4AQEB 3WKNA 2Q9OA 3P77A 1NANI 1KCUH 1VGEL 5TDOB 3IMWA 3CFIC 1TTUA 1PFOA 4WY7L 3EGXA 3EYFA 1DZBA 1KYDA 1AYOA 3WY3A 4Z23A 1V3KA 2GJZB 3O2VH 5TQ2L 5I1LB 4KNSA 4LOVA 4TQEH 5T1DH 4J1UA 4MX7B 5CEZH 3MLRL 2EVJA 4M5ZH 2BSTB 2YRLA 3TBYA 1SXZA 3RVUD 2NXZC 3A4EA 1U2HA 5LGJA 4GPVA 1GC1H 4G5ZL 1SBSH 2CNYA 5GXBB 1INEL 1CDUA 1N5AA 2H6UA 1AZVA 1QZNA 1CJYA 1ZE3H 3LRHA 3EGDA 3UYRH 5L88H 3BVXA 1MJUH 3O3EA 3LB6D 5C71A 3IXTB 4YXLH 3TFKC 2L3BA 2R2HB 3L5JA 3VM7A 5A2JH 3MBEB 5K9JH 3D4CA 5KTEH 3W0WA 3LNHA 2ZE0A 3KLDA 5HHMD 2XRAH 3HZKB 2G0KA 4IDLA 2EIEA 2DF3A 4TLSA 4BWWA 3EJRA 1SJEA 2ID5A 2VM4A 4X8XA 3W9EB 3K1DA 4PP2B 1M9SA 3UGUA 1YEEH 2DLFL 3MNMA 1E4HA 1JAEA 3O0LA 5F6IB 3JTSB 4MDJB 1FH2A 4XNQA 4AQ8A 1E43A 1NPUA 3C5ZA 4MKMA 4YAQB 4XZUB 2MPAH 4PJEB 4FAAB 4LSUL 4KRPC 3C8KA 4HHAB 3GPEA 4U3SA 1A9BA 1LK3L 3HG0A 4F1SA 2VJ0A 5DEZA 2WGNB 1KSRA 5BV7H 1EGJH 1DN2A 5T3XE 5H37G 1AO7D 2CCLA 4R2GC 1A6ZB 3BEWB 4GO6B 4QRPA 2EZ0D 1T89A 1T5WB 2W0LA 4L1HA 4LLQB 4PBWD 1A8JH 2R23A 3QQ9C 4AYDC 2W60A 4MNQA 3BUIA 2EH7L 3MLVL 4NRYB 2F7QA 2ZNXA 4KH9A 3V4VH 2ED8A 4PEEA 2DQGL 4Z6AT 5C0GB 1D7CA 3BN9C 3MJ9L 4OH2A 4P4KA 1FVDA 2OZ4L 4G7YH 1M57B 5D1XD 3V0WL 4RDBA 1WPCA 1ZSHA 4IU2A 1X5FA 4JFEA 1RZ7H 1FI8C 3RA7H 2BFGA 1D6EA 1E9OB 1MHEB 2I07B 2ZYHA 1YLBB 5TTRA 1TO4A 3MTXA 4KVPA 1ZK9A 1WAAA 5F88A 4R9HA 2I32A 1S6NA 4QHPA 4OJDH 3WIFB 4I0PC 4HJEA 1I3VA 2NY6C 3JZYA 2IAAC 1LO3L 3LTVA 2AEOA 3CFEB 1KCSL 5MEOA 4WWPA 2FO8A 3BHBB 3LEXA 4ZMZA 1X9RA 2BCMA 3MFGB 1BQSA 4DW2H 5C07A 3GS0A 1F86A 4XCCH 3ZMEA 3MLTB 3GC3A 5I66B 5J8OA 4X4YA 3BPLB 1ED3A 4OZFH 2AXWA 1XIWD 4TNWK 1KPVB 3JZ7A 3OKDA 2CR3A 4BH8A 5DGRA 4P9MH 1R9FA 2CMRH 1DJGA 4FS0A 3FUIA 3TWCL 2L7EA 5E4OA 3SDDA 3N04A 1AR1D 1N3NA 4KDTA 4F7CB 5C9JB 5I1AA 1F3DH 1VPOL 2W94A 5E1AB 4CDHA 3T3PE 4RMUA 1YN7A 2EDBA 1JZGA 5AVVB 5DWUL 3G6JB 2UY7A 3WHXB 1C08A 3MJWA 1KBBA 3VFTB 3J8F7 4P2QA 3ZZQA 1O6TA 4A38A 5GS0H 1UCBH 2I9LB 3VWKA 5I1CL 1E9QA 4JE0A 1M1XA 3L6FA 2VXVL 1D5RA 1U91B 2G75A 4DPAX 1KEMH 2VISB 2NY5C 2XV2A 3EUDA 3MV7A 2FLRT 3NZHL 3JUYA 5CJOH 5LNEA 5T1KA 1ZHLA 4YDMA 1JGDB 4BZYA 3HE6B 3CLWA 4Z7WB 5AVSB 3O3BB 3LNIA 3C60B 2GAZA 3QG6A 1A47A 4OIIH 5GJTL 4AK2A 4F8TA 3S88H 3NACH 2PYFA 2VL5A 4NB7A 3X14B 4I2XE 1N67A 2A6DB 3OVUB 4JB9L 4OM1H 1O0VA 4HD5A 5LBGA 4E42A 3GBNH 2ZOKA 4XXDB 5IQOA 1CO1A 3HJ0A 3LKNB 2J7LA 1H0DA 1ZTMA 1HZHL 2G9KA 2ARJB 1L7IL 4B9FA 2XWCA 3QAZB 4PGBB 2W9LA 3MJ7B 4HDIB 3VD2A 1I8MA 1EDYA 3DUHA 1FJ1B 3QJZA 4OQ1A 3FQUB 5T33L 1XQ4A 1T6BX 3DROA 4WEMB 2G5BB 3ZE0F 1VGKA 4F1ZA 4XHJD 4YC2B 3HG1A 1QKZL 5GJSL 3D39D 2DEXX 1EJOL 2XC8A 1SOQA 4Q6YA 3WFHB 1C1EH 3FB7A 1J1OH 1RZFH 3QORD 4HVBA 5J4MA 3O41B 2ITFA 2JJUA 2VDLB 2OAAA 1A8ZA 4DO5A 1BIIB 1X5YA 3MRFB 4B3EA 3HG2A 2XWBA 3CBRA 3QI9D 3QQDA 4UQ2B 3ZIMA 4IRJD 4HD9A 1WT5A 1LL1A 3R8QA 1TCMA 5FHAH 4AYFB 1KTDA 5B38B 4JL1A 1D5MA 3GRWH 4A2DA 4QRRE 3MRIA 1HYSC 2YAPA 4OJFL 4ZYKB 3WU1A 2VTFA 4G6KH 4M6OL 4PTUA 3X2QB 4PVLA 4GUQA 4DPCX 2MCPH 4JCWA 1AZCA 1M05A 4QHKI 4PW3A 5CCGE 1L6PA 1OKEA 2R4RH 2P1YA 4WI5A 1KDJA 4PJ9C 2G9HA 2VE6A 1RVFH 5DMIL 4DUXA 2AEIT 1MCWW 4HFWA 1U8QA 2DWDB 2EE6A 1JPFB 4MHHI 2DH2A 1JV5B 3TV3L 1R33A 4OFYA 3PWPB 3B3IA 3DPDA 1U8OA 4B97A 4PCSA 2EUZA 3GK8L 1X5ZA 5HHVL 1DJSA 1JRHL 3WI9A 5J9PB 1EIBA 3RB5A 3ARQA 3M6DA 4RGMB 3FMGL 2B08A 3GXUB 3TGXA 4K5LA 3WIHH 1KGCD 1UENA 3ZZSA 2FR4A 4GB9A 3LKQA 3LPPA 1NWPA 3WFZA 3PNWB 1AZZC 2E76C 4KKCC 4E9SA 2MKWA 1J86A 3ASWA 1T80A 1RJCA 1NIDA 4P5TC 3V0VA 1TYEB 1BP3B 3H9HA 3D0LA 4X9FA 4GKZA 4BKLA 1MWAA 4NJAH 1ZD6A 2NDGA 1ZEAH 4M8RA 3BKYL 2A9NH 3B37A 1LILA 2P47B 1UM5H 3AGWA 1HOCA 3Q6FA 3LRKA 4PFEA 4Z7VB 3QXVA 3VXPB 2XNAA 3OJVC 2VABA 5I0ZA 5DK0B 1DQLL 1EEZA 2BSSA 5GZNC 1AGBA 3TT1L 4AIOA 2ICWI 5EO1B 1ODUA 4D9RD 2H8PA 2FNBA 3MRDB 2ZOTA 3DETC 4L29A 2EINB 5DJ2B 3QDJA 1A1MA 1IUZA 1UKQA 1EJ6A 3AU0A 4G71B 3PGDA 4LCCB 3BVDB 1YJDL 2ADGA 4KDVA 2UVFA 1KNOB 3ARFB 3Q2VA 2QQQA 3BIAX 4NM4H 4PJ5A 4Y9BA 3NJMA 4PJIE 2NY4D 2FEEI 4LCWE 3TO4C 1J9QA 1E50A 1XZWA 2YA0A 4EOWL 2ZAIA 1ZSDB 1PD0A 1Z5LB 3W2DH 2WHVA 1ACYL 3CFQA 4D8OA 4PU2A 2Y22A 1DCLA 3X1FA 3QUXA 1Z66A 2J8UE 3ZW3A 4CGTA 2BOBA 1WWAX 2GITA 1LLAA 2Z35B 1CL7I 3AITA 4GNKB 2VDRH 1C12A 1L0PA 4ZAKB 3MOQA 5TF1H 4P2RB 5C08D 4TUUA 4G2AA 3T8XB 2WQUA 2FL5A 1WTGT 1L9RA 1A7QL 4OD3L 2AJ3B 3UROR 2X3CA 1H9VA 3EOTH 5DA4A 2BINA 1OP4A 1I7TA 4S0TD 3K46A 3U36B 2MQ3A 3KDMB 2XLLA 3G6AB 3WBDA 4LDCA 1JF1B 5DDHA 2ESVA 5E24E 1WC7B 1V55B 2OW6A 2ZG1A 2GJJA 3ECBA 4KI5D 4K5NA 5FV2A 5I5RA 4IOFC 2B1HH 4QI3A 3BAYA 1BMZA 1A4AA 4IBQA 2W07A 1HL9A 3MAWA 2L8AA 3MLUL 4HIQA 5EBWA 3SQBB 3SPVA 3DRTA 1CFQB 3B2UD 4P46A 1KGJA 5E5LA 3MOBH 4NI3A 4QXWA 4N28A 1JL8A 3QUYA 1OZUA 2LU3A 4WJKB 1IC0A 1UWFA 4XNXH 2ERJB 2NZ1A 3QYNA 4CMMB 5KSUA 3ZYZA 3H9ZA 15C8L 5KYNA 2X53A 2FYYB 4Y16A 1A65A 3BDYL 1H8OA 1UJ3B 4OAWA 1BAGA 4F2ME 4J4PD 1JDDA 3BSHA 3T3PB 4HEMA 4CU6A 3E6HB 4UBDC 3WO3B 4NNPH 5IFHH 4FL4B 1B0WA 1OAXH 2OCCB 2G2PA 3CUPA 2VDMB 2R9HD 3FH8A 3DSFH 4GQ9H 4K3EL 2XY1A 4LMQE 1U58B 4CILA 2C1OB 1I9EA 4WV1C 1A6PA 2PWEA 5DI8B 3MKGA 1GH7A 5CP3H 2HRLA 3N3EA 3VXSA 5EEVA 1F1DA 4ZODA 3WMSA 2IH8A 1QFUL 4XWGH 5CJQL 4NENB 4P06A 5JZ7C 4ODVL 2W9EL 1VFBA 3D51A 3KPTA 2ZCZA 5I1IL 2O6EA 5IHZB 2PYED 3AJ7A 5F7NC 2PR9A 3ULVL 1Z1WA 1R19A 4RAVB 3TBSA 3O6FB 2VXTH 2X4NA 3CBKB 3ARZA 3D4ZA 5EIVA 4CSPA 1R5IA 4AENA 3AT0A 1E27B 4ETQA 1OZTG 5C0BA 4CN4A 5GS2H 4GT7A 4ZOEA 5JQHC 3I6KB 4FKEA 4Y4FB 3NMEA 2X40A 3EAKA 2PXYC 2HH0H 4LK4A 3MRJA 3RWDB 3OTTA 4GT0A 4YXHH 5E6YA 1J18A 1ET8A 3S8FB 1PNDA 1K85A 1N10A 5K33A 4OGYL 3OSKA 4DTGH 3BQUC 3BZEB 4YHKL 4JKPH 1DVSA 3ZR5A 3BO8B 5EC1B 1BD2B 2K6YA 4R4FH 2IAMC 2Z7YA 3UBFA 4XOBA 4OCRL 2DQTH 3A24A 3IJSA 5GGUA 1OK8A 3P3YA 4L0PB 2AXGB 5F9WB 4X99B 2AERT 4QHUA 4ZUTA 5E08H 2MIZA 5KOMC 5DFVD 2V2XB 1YHPA 1AXTL 3IGAA 1NCJA 4HT1H 3NP3A 3SDAB 4MCYA 4UUJA 3TN0D 2YXVA 5FR3A 1GMIA 1QFWH 3KWWB 1UT2A 2B1AL 4HLZH 1SJHA 3S37L 1R1CA 1XGYL 5T8IA 2AJZA 3H42L 2DJMA 4ODWB 2VR5A 2DS4A 2VDKH 4Y1AA 4CSZA 1MFAL 3THML 4PGZA 5BO1H 4PJDF 1RL1A 3SPGA 1G7IB 1S46A 1HI6B 2V2TA 4MRBA 3QJSB 3HVDA 4GMSH 4Y8AA 4B6ZA 1NWOA 5FWQA 2G3XA 5DHYA 4HV8B 2LOEA 5E2WH 2PLTA 4NO3B 1QBBA 4XC1L 3D87B 4N3TA 3RZCC 1SLUA 3MXWH 4WNSA 1FYHB 1PQZB 1P5UC 2GCYA 5I1KH 4JG0H 4MZ3A 4YPGB 4Y2DD 3CFJA 3D3VA 3EADA 1RZKC 4EAEA 3L4VA 3TVMC 5MEQB 3ME0A 5ACZA 1T0MB 4GRMB 4KK6C 4A2MA 2LLGA 2BK8A 1RUAL 4X98A 3EH4B 3GLAA 3N2JA 2F53A 4R8WH 3U25A 1NANH 3U1PA 2BO0A 1YMMB 4JY4A 1TZ8A 2BVPB 5DJZA 3ZT5A 5JQIB 4TTDD 1BJMA 2FAUA 1NCBL 5C0RL 3PUCA 2G2RA 3I6LE 1M42A 2J12B 3FN3A 4CNIA 2WVVB 5E1IA 4AYSA 4QCIB 3BC9A 3RWHA 2DJSA 1FO0B 3E9TA 2R56H 3Q3GA 1XR8B 1KPUB 1A6WH 1R3IH 3CZFA 5AZUA 2E7LA 5LUMA 4HH8A 4RWYL 5LNDA 3P9MB 1F0LA 4KKBC 5CGTA 4HAKA 2FX7L 3TNMA 2W8CA 1X5XA 5L2KE 3BP4B 3VXUA 1JZEA 3QO1A 2IFFL 1KY7A 2I24N 3PWVB 2CG9X 2HTLD 2COVD 4NHCH 4U6HB 4PRHD 4FXGB 4HALA 4Z77A 1WIOA 2CM6A 4KUZH 1G0XA 1UGNA 3CN0A 5H94A 5G5DB 5LN8A 1AHWC 4LSVH 3FQXB 5TFSL 1SDAB 5IROD 3SKOA 3E1F1 3MNWA 3EW3B 4PJIB 3O8XD 5CLXA 1CDYA 1D5BB 4H2AA 4JO5A 4ICWA 4JMXA 5GS3A 1U6AL 4ABWA 3K4AA 5JNYA 5GS1A 3BKCH 5EHFA 3BWUF 3KPSD 1RZIB 3ARGD 4G9DA 1JTOA 4LSSL 5TPWL 3KBEA 3CZKA 4ZFOB 4EUPB 2V2WA 3NJKA 4JY6A 5DTFA 4XPTH 4QRAA 2CGYA 2JLLA 3L4ZA 1BMGA 4PJFA 1QTYT 5D1ZA 4N3UA 3K80A 1ZVSB 3BZ5A 4QJ3B 4JVWA 1IKNC 1RK1B 2D0FA 3DMMD 3HS0B 3NJNA 5JHBA 3CIQA 4FHBD 3VGAB 1HQRB 2Y9RT 4GSQA 1KBWA 1YEDA 3FU5A 2H3NB 1E7UA 1GHFH 2X09A 4X9BA 1UH2A 3ECVA 4OD2B 1QI4A 2Q1EA 1YJDC 4MD0A 5B8CB 2YGPA 3WEBA 1LWRA 4WO4D 4I77L 4JGNA 1TYJA 2E75C 2X4OA 4X4ME 1U8LB 5LQBH 4JFFA 4D9QE 3GMPA 4Y5XB 5JW4N 5IBUG 2CK2A 1S7UA 4NC1E 1G1OA 3WTVA 1JPSH 5TDPB 4L4VE 2N56A 2LU5A 4OIFA 5CLYA 3Q6GL 1GJUA 2CBPA 4ZMVA 3QGVA 4HIIA 2VJ8A 4QY8A 2BFVH 1BEYL 4EDWL 1NCWL 5J1AA 2ENPA 3KCPA 3T3MF 2KS0A 4WI3A 1HCYA 3BIKB 1YEJL 4GUPB 3O4LE 4OUOA 3LRSA 3QJFB 3RX9A 4CW1A 3VB8A 3PABA 4PRNA 5DJDB 2ZPKL 1HTYA 3STBA 3IDYB 1R6VA 1YA5A 5FYKL 4ENED 1RURL 3G5XB 1DLFL 1ZJBA 2WWMD 2E8YA 4BFRA 3X1BA 1Y1DA 3NCBB 5ADOL 4X9GA 1FGVL 3IDGB 1VCAA 2JV6A 4IEFB 5C09E 1EAOA 3LIUA 4G9FE 4TXVB 2GFBA 4HWZA 1UM4H 2R15A 3AG4B 4HZ1A 4PJ8B 3UPAA 5BPPA 3MVSA 3S3SA 1PGRB 1WV7T 3OXSA 4O2EA 5KUKA 5FGCB 4LO9A 4DGYH 2K6ZA 2OTWA 3CC5A 1R5WA 3QWRD 3QEQA 3RX5A 1GYVA 2XKNB 1IBFA 3LNEA 2AQSA 3K2UH 3WUWG 1SF5A 5AOIA 4O2CA 5B39G 5JXED 2VRQA 4ZQKB 2IPKA 3JWNG 1DDHA 4XBGA 5IVXB 5IP4A 2YD1A 3HN3A 4L37A 2KL6A 4LMQI 1VA9A 2VSKB 3LZLA 3W56A 3AU1A 3U6RA 2CALA 1CXFA 2Q3XA 2EKJA 5F7UA 3K71A 2JI2A 2BSCA 4Q14A 3CIAA 4O2FB 5ALCH 5JPNC 3PL6D 2HFEB 4NN6B 4PLJD 3AC0A 1L9MA 1DVUA 3DXAD 2F08A 3VXMA 3FQ4A 2YUXA 1J0YA 3GWJA 4ODXB 3V7AE 5T1LD 3PNRB 5IT2L 5C2BH 3QIWB 4MQ7A 4GRLC 4Q9CA 2FWOB 2XI9A 3D1MC 3ETSA 4JFDE 3SGKC 2BOCA 3UO1L 1YN6A 2HVKB 2X4QB 4L8SB 4P49A 1E90A 1TPXB 3ULVC 1E5UI 2H0EA 1DQDH 5A2IH 1HOEA 4K9JA 4HIHA 3PQYD 1E9PA 2NUPB 4UINL 5AENA 1S78C 3RTQA 3FUKA 1V3LA 2B59B 4E9RA 1WUZA 5FK9B 5JORB 5JW5B 1NIFA 3H9SA 4PGEA 2AJYL 4LFHG 2FLMA 3RUGA 4Q7DA 4N0UE 1X9UA 1HL5A 1EGJA 3EYSL 4EZKA 1T20B 4DGIH 1XX9C 2FJGA 2QPUA 3LIZH 1OTUD 2P7TA 5I9QC 4LLMA 3EHBD 4F8QA 5CSBA 1NFKA 1I8IA 4WW2F 3PV7A 4P3DB 2WINA 3LS4L 3TH2T 3ILPB 3LKSB 1BQHG 2FGZA 2IVFC 4TNVF 5T5FH 4H5SA 3P11L 4LP8A 3V4VA 2KZKA 3MRKB 1M3JA 1A4KB 1HHIB 3Q1EA 3A3YB 1K3IA 3IF1B 4XNYL 3DRQA 4XXWA 4JPWH 2R4SH 4L3EB 5F7EH 1WA1X 1YAZA 4BE6A 1OSPH 5F3HA 5HI5C 2EDFA 3ATFA 3D33A 3QARA 1T3FA 3OV6A 5ILTH 3NSCA 4APQD 2JVUA 3JVFC 4PHZA 4XP5L 5LGKA 4TUOA 3CFBB 3P30L 1N6UA 2KQNA 3GMMB 3UOAB 1D7BA 4B7IA 5AAPA 4ZTPH 4ODBD 3QULA 4B53A 3IS1X 1T5KA 4LPTA 1WCQA 5SWQB 5KJ7E 5LXGH 3QUGA 2K7PA 5IESL 2YMXL 4KAQH 3GBMH 3T4YA 4WFGE 1IKFL 1QLEL 4NFBA 2CE6A 3CFKA 5B1AB 4XPGL 4W4OC 1A2YA 4PV8A 4OZFA 5I1EH 2FBOJ 4UT9A 4UYQA 5EZPA 4OFVA 4F7MB 4U1NB 3MV9E 3GSUB 5DJ8A 5JW3H 1WTLA 2GBAA 1L9QA 1KIPA 4HHGA 1MWAL 4QRRD 4FFVD 3AM8A 1S7RA 3MKKA 5E51A 5KYWA 4AJWA 5CBAA 4OKDA 3CU7A 2YPLE 1TQCC 1UB5B 1GGYA 1TZIA 3OX8B 5HDOA 1QP1A 4OLYL 3JWOC 5HVHB 1CLVA 1L7TH 3H54A 3PPSA 5JXAL 4LKXB 4TVPE 1ZTXH 3GIVA 4FJ6A 3OG4B 2PTTA 4PJAE 2Z8RA 4GS7B 4IDJH 4LKCA 1FYTE 4M7KH 1FVEA 3GHBL 5GRJL 3Q7JA 1KTLB 1L0YA 2I60H 3HC0B 4LVOC 2YFOA 2OMZB 3NH7H 2Y1YA 2VLJD 2P5EA 1QHQA 4JM0A 4QOKE 3VX1A 5D7IB 2GSGA 1MCIA 4XPHL 4OW6A 1FBIL 2GABA 1J5DA 4TQIA 1Y6MR 3LZQA 4AMKL 1Q1PA 1MQKH 4JANB 4X8CA 3AMLA 1RZJH 1J11A 4HH9B 3B9KD 1QSEB 3IE4A 4HWNA 1IIKA 3NRPA 3BAJA 5EULV 1TJGL 2W9DL 1JNLH 4Z7UE 1G7MB 5J13C 1KGIA 3L3JB 3CDFA 4I3SH 1MCDA 1Q9WA 2IDSA 1CL7H 3EJZC 1L9TA 1CI5A 1NFDB 4FLOA 3RDTA 5HD8C 2HJKB 3L3DB 2AQQA 4H1LB 1FAIL 3UERA 5K93A 1VACA 3ZDXE 2EEXA 2RQEA 4LEBA 5BUGA 1XGTA 3DDFA 2MQ0A 2QT6A 1F3JA 4LCYB 4XMPH 4WF7A 1BA9A 4CADA 1D9KA 2B5IB 2LQRA 4XCEA 1M53A 1NM9A 3S35L 3PRZA 3ZHDA 5B3JE 2XG4B 1UURA 4HAFA 3GRWA 4G1MA 2DY2A 4AQ8C 3C5ZC 2D0HA 1MIEH 3J2PA 3QISA 2GTWA 3VXOB 1A1NA 3IMSA 3RWGB 2M8XA 3EF7A 4G8EA 4FKKA 3QR2A 3FQRA 4OQTH 2HLAB 4EN3D 4P5KB 4WHTB 5C7XH 5HYQB 4QXVA 3BH8B 1ZOXA 1L6XA 4YDIL 4ZMTA 2FIKA 4FNLL 2OX5A 5T3ZE 3G9VA 4CU7A 1T89C 4GY4A 4LIQL 4OCNC 4DAGH 3FUFA 2BJMH 4XX1G 2B2XL 1JWSB 1MJ8H 1XDTT 2HVJA 3BFQG 1YDPB 3TJPA 5HHOB 4XO4A 3KPRB 2HMID 4WI4A 3RNQB 3TPUB 1E5BA 1FNGA 4M9PA 1OGAE 2AANA 4P4KC 5E6ZA 4HIJA 5GGRB 3N41B 4FP8L 3TJHD 5BXFB 2HFGH 2QGDA 1WITA 2X0WA 2VO5A 2GPZA 3MRBB 1T1YA 4Z7OB 2Y07H 2LHAA 3CH1B 3WIHA 3RJDA 4Z7NE 2LTQB 1IC5H 5DEGB 5E8NA 2C26A 3O3AB 3ZKMC 3DVIA 4H0GA 5CR1A 5DHXB 4L8BB 3T0DA 2EJ1A 2ZP8A 3HAEH 1ZS8A 1R17A 2QKIA 3AQXA 1AXSA