4HCFA

Crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
b'AKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cupredoxin 1
publication title Crystal Structure of Uncharacterized Cupredoxin-like Domain Protein Cupredoxin_1 with Copper Bound from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 24
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hcfA00
2HRHA 2J56A 5AZUA 2EINB 1UATA 1GY2A 3TBCA 3FU7A 4E9RA 2YARA 1B3IA 2W88A 3OMIB 4N8UA 3CVDA 1NIDA 1OCZB 3T71A 2IDUA 2DYSB 1MG2C 1YLBB 1J9QA 1NZRA 3NJMA 3WNIA 4G7QB 4YSEA 3PXLA 3PAVA 5FC9A 4W9ZA 1GSKA 2I85A 2DY2A 1JVOA 1RCYA 2QPDB 1A4BA 4M3HA 4BXVA 1XB6A 1E5ZA 2BHFA 3AG3B 1ASOA 2FT6A 1NWOA 4BK5C 4YVUA 3TASA 3D12B 3NJIA 1A65A 2I7SA 4Q89A 5AKRA 2ZWNA 4YSTA 2JKWA 3NSDA 1OCOB 1JVLA 1BYPA 3NJHA 4JHVA 1TKWA 3V9CA 1HFUA 3N55A 1AZUA 2VM4A 3QQXA 1PLCA 4HALA 2WO3B 4A2FA 1ET5A 1PAZA 1AG6A 3PAUA 4M4RB 2DWSA 3NJGA 4AKPA 1ETJA 1BAWA 2HX9A 5I28A 2Q5BA 2A3TA 3DTUB 1HAUA 1KCWA 1FWXA 3V9EA 8PAZA 2XYBA 3S3DB 1WAEA 4L0PB 1NIAA 3SBQA 2TSAA 4A68A 2PPFA 3TU6A 1BQ5A 5D4IA 2UX7A 3ZBMA 5B3SB 5D4JA 4E9VA 1PLBA 2ZONA 1SFHA 2Q9OA 2BZ7A 2VSKB 2XVBA 3FSVA 4GP8B 1E5YA 2EILB 4KNSA 2PPAA 4BWUA 3UGEA 3WKPA 3IEAA 3KW7A 5ANHA 1ASQA 1NINA 1V54B 1MDAA 2FQFA 2UX6A 2Y1AA 2BZCA 4RH4A 1J9RA 2CBPA 4G71B 1JZHA 3ERXA 2IH8A 5TK2A 1L9RA 3HB3B 4GYBA 2CCWA 1ADWA 3FSWA 3UABA 2UXFA 4BWTA 4HAKA 3EH5B 5I6LA 4GY4A 3KW8A 3HEIB 2YAQA 3ABGA 2H3XC 4A66A 2YXWA 1M56B 3CVCA 2DV6A 4A67A 2HLEB 2XV3A 1PY0A 3BQVA 3PLYA 3ASNB 2ZXWB 1NDTA 3JTBA 4E9YA 2YAEA 2JFCA 1ZIBA 1DYZA 1NIFA 4FAAB 1GS7A 1KGYE 2FJSA 4YL4A 3AY2A 1QLEB 3L45A 2YQBA 1NWPA 3IBOA 2Y69B 3H4HA 4DP7X 3ZDWA 2GIMA 3FSAA 2AVFA 3GDCA 1RZPA 1SDDB 1KDJA 1AS7A 2PLTA 4AKOA 2IDTA 4YSSA 3CDZB 3T6XA 3S3CB 2XX1A 3AZUA 5I6PA 1SF5A 2AZUA 1XB8A 2AANA 1URIA 3AG2B 3TBBA 4DP8X 4AX3A 2JXMA 3G5WA 1SHWA 2IDQA 2BO0A 1PCSA 4UANA 2GBAA 1GS6X 2FQGA 2FTAA 5I5JA 3FQ2A 1AZBA 3T6ZA 4G7SB 4KO7A 3DKHA 1AOZA 2XX0A 1KBVA 1XMEB 1ZV2A 3FU8A 5B7FA 4JHUA 2B08A 3QJQB 1N68A 5I6OA 4P5RA 1KCBA 2NRDA 1VLXA 2LLNA 4AKQA 1WA0X 3WNJA 1A4AA 4PAZA 1JZEA 4KNTA 4YSCA 1F56A 4NAJA 1OV8A 2P80A 1E67A 3AG4B 2XUWA 4BWWA 2EIJB 2IDSA 3TA4D 1NICA 4YVNA 1NPJA 3SQRA 1OF0A 3ZIYA 1OOWA 1WS8A 1J5CA 1W6WA 5EHFA 1ET8A 2UXGA 3FYEB 4G7RB 4ZK8A 3GYRA 2GC7C 3S8FB 1PZAA 1HAWA 1BQRA 3FU9A 1E30A 1OCRB 4HHWA 3DIVA 3OD3A 4YSAA 4GXFA 1IC0A 2HX7A 4MFHA 2OJ1A 2BP0B 5IY5B 4A2EA 4E9SA 3NYKA 1GS8A 3WG7B 2EIMB 2AZAA 4KNUA 1RZQA 1W6LA 3CDZA 1CYWA 1GR7A 2BW4A 3IN2A 1E65A 1V55B 2VW4A 2RACA 3JT2A 1JXDA 4YSUA 3PCYA 5D4HA 2GB2A 7PCYA 3U25A 1QNIA 2IWEA 4KOCA 2HZHA 5B7EA 3S8GB 2PPEA 4PCYA 4DP6X 1N70A 4DP4X 1SHXA 3NP3A 1SFDA 2FT7A 1BYOA 4CSPA 3FU7B 2FQEA 1L9QA 1AS8A 1OE1A 1WS7A 3EH3B 4KO5A 5F7BA 5F7AA 4K9JA 3CVBA 1AS6A 4A2DA 2BP8B 1DZ0A 2PCFA 3X1FA 4F2FA 5LDUA 4Q8BA 1FA4A 3X1EA 1IBYA 3FPXA 4HIPA 4DP2X 4E9XA 2X88A 2R7EB 1M57B 1J5DA 2CAKA 5B1JC 4E9WA 1ID2A 4JKNA 4E9QA 1OCCB 1SNRA 2XU9A 3X1GA 3UAAA 3FYIB 1IKOP 4DP5X 3FS9A 3FQYA 5AFAA 3RYMA 2CJ3A 3EF4A 3OMNB 5B7MA 1JOIA 1PZCA 4N4YB 2VW6A 9PCYA 4KOBA 2VW7A 2CALA 2XV0A 2IWFA 4WTQA 5I6MA 1EHKB 1PMYA 3QPKA 1AAJA 1W8EA 2XLLA 1SF3A 1KYAA 1GW0A 1BXVA 2XXFA 4TXVB 2B3IA 1ZDSA 3MX0B 1RKRA 1AR1B 2H47C 1BXAA 3EH4B 1OE2A 3PAZA 5TK4A 4QKTA 1M9WA 1MG3C 2PPCA 2YAPA 2PPDA 4HCFA 2YAHA 2N0MA 2J55A 1KBWA 4NB7A 6PAZA 1T5KA 2IDFA 3NT0A 4DP9X 1ZDQA 1BQKA 1CC3A 4UAHA 5B1BB 4UF7C 3AG1B 2BWDA 4NERA 3GXUB 3ZX1A 2GI0A 2GSMB 3NJFA 4DP0X 2XV2A 2ZOOA 3S3BB 1OE3A 3SBPA 4DPBX 1PLAA 5B1AB 2E86A 1XB3A 4GP5B 3CZUB 1ZIAA 3SBRA 1R1CA 1ZPUA 1L9TA 3ABKB 2FT8A 2BP8A 2WO2B 1PF3A 1AIZA 1J9SA 4W1TA 3H4FA 3PPSA 1KDIA 3IN0A 1AZNA 3QJTB 4G72B 2HXAA 4AI7A 2FQDA 2XXGA 2QDVA 1JZIA 1J9TA 2YAFA 3T6VA 4YSOA 2H5UA 2R7EA 3FT0A 3N2JA 4BDVB 1AANA 1ASPA 5PAZA 2PP7A 3NSFA 3WKQA 4ENZA 1IUZA 3NJJA 3WI9A 2GHZA 4E9TA 3X1BA 1AZRA 1AZCA 1L9SA 4HZ1A 1EZLA 3MBWB 2CUAA 2P80D 2IWKA 4A2HA 3NSYA 4HHGA 3T6WA 5B1KA 1KV7A 1X9RA 2BWIA 2IAAC 1WA2X 4P5SA 4YSRA 1V10A 2EIKB 2XWZA 1SDDA 4BXSV 1NTDA 1MZYA 2UXTA 2YAMA 4HCIA 3UACA 3FQ1A 4KO9A 4G70B 5I6NA 3ABMB 2MRYA 7PAZA 3C75A 2J57A 2PP8A 2HRGA 1ET7A 2I7OA 3CG8A 4YSDA 2OCCB 1A3ZA 1BEXA 2VSMB 1ILSA 4F2EA 3AW5A 1L9OA 5I6KA 3QJVB 3NJNA 3ASOB 4F7KA 1JERA 3OM3B 4AZUA 1PNCA 3NSCA 1PZBA 3BVDB 1AACA 2VN3A 1GYCA 2TSBA 4QLWA 3H56A 1TU2A 4A2GA 5A7EA 1SJMA 2X87A 1WA1X 1MZZA 2OV0A 2QPEB 3X1NA 1JZGA 3X2QB 3ABLB 5I26A 3EHBB 2PP9A 3OMAB 1CURA 3WIAA 4DPCX 5I5IA 2HX8A 1QHQA 2MTAA 1JZJA 3QJRB 1CYXA 1JZFA 1TEGA 3FSZA 4CSZA 2FNWA 2VM3A 1X9UA 2DWTA 4BDVA 1A4CA 4X4KA 3UADA 2VMJA 1IBZA 3UAEA 1PNDA 1FFTB 2WSDA 5E9NA 3NJKA 2FWLB 5I5MA 2YXVA 1BXUA 2IH9A 4HCGA 2PCYA 3OQRA 1NIBA 2DYRB 1L9PA 2J5WA 4YSPA 1JXGA 5PCYA 1AQ8A 4KO6A 4EF3A 3IE9A 1NIEA 2BW5A 4FA7B 5B1JA 3QJSB 1TEFA 3NJLA 4DP1X 1NPNA 2UXVA 2BP0A 1CUOA 4GP4B 3QJUB 4YSQA 1A8ZA 1GY1A 2W8CA 3NP4A 3T9WA 1AG0A 2QDWA 4WKXA 2YAOA 2AFNA 1JXFA 4DPAX 2GC4C 1I53A 6PCYA 3FPYA 2QT6A 1ILUA
chains in the Genus database with same CATH superfamily
3F7KA 2VABB 3P69A 5EB9A 4FYRA 5EUOF 4XNUL 3GBEA 2EUWA 2R29A 3PGDB 4LARH 3TBCA 1WDAA 2V2TA 3FQWA 3QAZC 3QIUA 1NEZA 5K1NA 2XTJB 4WO4C 4PR5B 5JHMA 3HUJA 1NJ9B 3IKCA 3MGOA 2VTFA 1HQ4A 1PS3A 3MA7B 4GQPH 1PX4A 5ESAA 5F6HI 1NC2B 2FH8A 4BFBD 3BPNC 3QO0B 3HVDA 3U30B 1UH4A 1P0SE 3BW9A 3FTUA 1YEJL 4QDGA 5I1LA 4N9OB 4JO4H 2R39A 2DY2A 3DC0A 5GIRA 1A4BA 4HSCX 3O4OC 3Q2NA 5ADOH 1W2KT 4G5AA 3MRNB 4RWYL 5J1SC 4I9WD 2ZWSA 3DURB 1RUPL 3GXFA 4KQ4H 4R0LB 4KROC 2P46B 2M1KA 3A24A 3LQZA 3VXUD 2CIIB 2WIIA 3QDJD 4QXVA 4JN1H 3N41B 2IGTA 1ZK5A 3V4PL 2VR7A 4WW2C 2ZX8A 5FYKL 4XP6L 3N40F 4NN5C 3EGSA 1IQDA 4LPVA 2RALA 3DV4A 1MJ7H 3V5DB 1AG6A 1N18A 1OAZL 4P4RA 4TL4A 4AQ1A 2QQQA 2FRGP 2HX9A 1MW2A 4WAFA 3DTUB 3O9WC 5D1XA 2DB8A 2Q76A 3FTZA 2GJZA 4ABVA 4TULL 3SKMB 1EZSA 4XT1C 3BSHA 5CLWA 3BVUA 2O5ZH 1BA9A 2XZAH 4PJAA 4XCFL 4ZOCA 4D2NA 1XD0A 5EBWA 2XJKA 1J0HA 3U6RA 4Z23A 1Q0YH 5BNXD 4XZ4A 3IGKA 3FBKA 4BFJA 4PJHB 2A9ML 2HTKC 4PRBB 3CLFL 3DVNB 3JVFC 1FIGL 3VGAB 4AH2A 3QXAB 3B6SB 3DPDA 5EBLB 2BS71 1XGUB 1S7WA 4IQHA 5E0FA 4J1UA 1MW1A 4K07A 1UVQA 2OSLA 1AGEB 3RFZA 2I27N 1YG9A 3V4VH 1XH0A 2E59A 3IEAA 4LP5A 5KYYA 2QQNL 4R4BB 4QJ5B 3MOAL 3LQAH 2EEBA 1WP6A 1MHCA 2X6UA 3SCMC 2MIZA 4NQUA 3MFGB 2XN9B 3RGVD 3LZPA 3MUHL 3U0TB 4ZMQA 3CLEL 4F58L 5HHMD 4KAQL 5DHYB 2H8PB 1JZHA 2OMZB 4W9GC 4IK6A 5TD4A 3SPCA 4UZSA 4XAWL 1Z9OA 4KI5F 4TQPA 5C0BB 1RIVH 2C9UA 4KITB 3QVAA 3G5YA 3NIGB 4D8PB 4UNVA 2RD0A 2XRAL 4G43A 3TV3H 2ZXDA 9CGTA 2V5MA 2JF1A 2JIXA 3EOTH 1NGQL 4L05A 2FB4H 1K2DB 1MEXH 4OKVA 1YNTB 3MKKA 1LQBC 4MHHI 3UMTA 5FFGA 1D9KB 1IAOB 3ASNB 1FO0L 5FW6A 1PVHA 3IGUA 3TWCL 3VSQA 3VNZA 2LGNA 1FORH 2AMGA 2OL3A 1A4JA 3JQOB 2FEEL 3ENEA 3BP4B 4IYKA 3QEQA 1MI5B 2VB5A 3W0WA 4JJ5B 5IT2H 2VAAB 2Z91A 3UBHA 2DBJA 2Y69B 1NEPA 5D1QA 1AIFA 4HJTA 4M61B 1RZFL 3HZKB 4YLQT 3QXDB 3UBXA 4DVBA 2AVFA 2JQZA 4O5LH 1L3WA 4U2ZA 4RZKA 1CLCA 1XAUA 4P23B 1BBDL 1NH6A 1INEL 3EOAA 1AS7A 1RZKL 1CGTA 2NUTB 3MRJB 3DTXB 5GPRA 1GC1L 1A4KB 3IETB 3E8UL 4X5XA 4YO0A 5DEJA 4F33B 4LOUC 4XAKD 4BSVB 1JPFB 2C34A 3D5OF 3OAZK 2CQVA 1SF5A 4M29A 1PX3A 4B27A 1O7SA 2WLLB 3WLWC 3OX8A 4RIRB 1EXHA 1ZVSB 4TNWK 2XTLA 6FABL 5T1KB 3CH1B 1ED3A 3T6ZA 4JM4H 4CSTA 4IRJD 1PY4A 4IDLA 4X5PA 4S1QH 1AP2B 3IJ9A 2CO1A 1FBIH 1G7JA 1MI5E 3BZFB 1PTZA 4Z7OE 3VD2A 3X3FH 4NQDB 1H15B 3RURA 1JTOA 1LO5A 1XHHA 3GMOA 3NFSH 5K9QG 1T22A 2NRDA 1OAYH 3DJTA 5IW6A 5C3LD 1QFUH 4AW4A 2Q3ZA 3CMOL 4KQ3H 2H6PA 4KFMA 2ZUQB 4GS7C 3VCLA 3RWJB 4UQCA 4XN2A 3D9AL 3D85A 4Z18A 5CCKL 1W8OA 3SE8L 2GUYA 1DJHA 2IDSA 4XXWA 4WO4D 5FFOA 4NM4H 1E2VA 5IVOA 3ZIYA 4UDTB 4JJOA 4Y1AE 3O8XC 2ZOUA 5CEYA 1VKXB 4UNUA 1G7HB 3S2CA 4WUUD 2O5YL 43CAB 2EACA 4KX9A 4NKIH 2OLDA 3BD3A 5HYJB 2Y2TA 4YDJB 5FUCE 3X3GL 3NCJH 1NC4B 1PZAA 2EE6A 2D4FA 2EICA 2VDPB 3MYJA 4JDTH 1Q1JL 4N2NA 5DJDA 2BHZA 1RY7B 5GRUH 3PP3K 3MMEB 4KROD 5I1DA 4JLRB 1L7IL 1ROWA 5I16A 4NQDE 5SWZD 3LKQA 5DD0H 1IEBB 3BZDA 1YUKB 4WFED 1YC8A 4FFTA 2J2ZB 3OAUL 3BPOC 3TLRA 3L16A 5E6RB 1CICC 4ZX6A 4FNLH 2WVUA 4JANA 1I7RB 3QIWC 1N4XL 4LKCB 2LABA 5CJQH 3V52L 1QNIA 2IWEA 5JHLH 4EOWH 1RIUL 2ORBH 1BOYA 4OZFA 4DP6X 1DL7H 1ZGLM 1IGFL 2VXVH 3EFDL 3A4EA 4GKLA 4PBVC 2B4CC 4MCZB 4BM7A 4HGWA 1IKFH 3O9WD 1YMME 1FL5B 1R5VA 4OR1A 2WBWB 2V7NB 4JQXC 5HYJE 2Y72A 2HH0L 5I1GH 4FTDA 5KYXB 4RA0C 4GKNB 4OZGA 4P0DA 5CSGA 3QWRD 3L3KB 3QUKB 3CZSA 4L8SC 5E2TH 3V0FA 1H3GA 2OTWA 3DV6A 1KWGA 3TCTA 2X88A 4G6FB 2R7EB 1OGTA 4XP9L 5INDB 1T1XB 1HILA 3DSNA 3ZHDA 4AGOA 3D2UD 5KSBE 3NPZB 4Y16B 1BQHG 1I8IB 2F7OA 1EAOA 1I8AA 3ULUF 2X4QA 4KOBA 4NO3B 4AEFA 1GHFH 4P57A 1HI6A 4GMSL 2HG0A 3RP1A 4L8CB 1RVFH 3SCMD 1IGIH 2AGJL 2ZUUA 1HJCA 1HWHB 1C7SA 3QE5A 5E7FA 1NBCA 3PWNA 3TVMB 4EEEA 3CFIC 3QIUC 1RH8A 4PRAA 3ETBF 3CSGA 3OKEA 3GRGA 4N2IA 1I1FB 2MQCA 5D2LE 4OZHF 5CMAB 1UM6H 4JFFB 2NY3C 3KGTA 5FK9B 4X5RA 4X8JA 4AL8L 1G7QA 4A7QA 2GK2A 2N0MA 2Z35B 2YGOA 3WTWA 3L8QA 4EXPX 5JOFB 1A14L 3GXUB 2KBGA 3C6LB 1IL1B 2EIEA 3ILPB 1BVOA 1Q8MA 1WZLA 3FRUA 3OG6B 4MA8L 4POZC 5E5MB 5CD3A 1EFXB 3S3BB 3SBPA 1OE3A 4KKQA 1F6AB 3GXNA 4WI0B 2X70A 4WW1B 5HDQH 4XMWA 2PR9A 4YR6B 4JO2L 3S97C 4NWTH 4KH2A 2BP8A 3VXQB 2XKSA 1J9SA 1HE7A 3WTSA 1MFNA 3GB7B 3GM8A 4XMXA 3V79C 1HEJC 2P5EE 5BV7C 5EO9B 4PJBA 1HL4A 1J5OH 1V7NH 1JZIA 2YN5A 5CBEA 4NPYB 3KL5A 2H5UA 4G8GB 1IAKB 5C0FB 3MNVB 3G6AA 3HG1E 4LOUD 4U0RB 5TPWH 4F7MA 2VXTL 3U36B 5D1XC 1YECL 2QTEA 4X9IA 5FCUL 1SRDA 2OTUA 5JYMA 3WLWD 2ILLA 3LIUA 1MCEA 1DVZA 3ZUCA 3DOSA 4LRNL 2DLFL 3UG3A 5AOJA 4AYFB 2AEOA 4H8WC 4IOIA 2VM9A 5AZ2L 5LGJB 5T1LB 3BSZL 1OB1A 4JO1H 3II2A 4N6RB 1A9EA 1UUNA 3BZEA 2DQHL 3SPJA 4JHBA 1BD2D 1T04A 4EN3A 5KVFH 3K71A 3VMPA 2C9VA 1AHWA 5E03A 5KBKA 1MZYA 2JKXA 4ZO8A 4DNLA 3KYMA 3RFZC 3FTGB 1U8QB 3L13A 5AW7B 4YIQB 5K9JH 3K80A 1P2CB 2XPYA 4RFEA 3V5KB 4L4JA 3W2DH 3IE4A 2EADA 1X5KA 4X7SH 5GJTH 5C71A 4EE2A 2CLRA 1MW3A 2VZVA 5ANMB 2FBRA 4H26A 3OKKB 2R0LL 3O8XD 1IJNA 2VCOA 1AKPA 2PMZA 4G8EB 1IC4L 3P3SA 2Q1EA 3CCHA 2YMTA 1H3WM 3KPNA 3FT3A 2ZCZA 1GIGL 2X87A 3FHEA 4YLBA 1AGBA 2ZPKL 3FB8B 1ETB1 2VOTA 3T0DA 3QDJB 1QFOA 1Z0MA 2JB6B 4Z7NB 1UOKA 5A2AA 2WBXA 5ECJE 4JDEA 2Y1YA 3ARFD 4K94C 4UCFA 4CU7A 4IOSA 4FS0A 3RWEB 2AV7B 1R4XA 3M7FB 2IBGA 2G3ZA 1CICD 2ZF9A 4H20L 3R1GH 4DHLA 3VI3A 5F7FA 4HWBH 3GI8L 4HK0A 4YX2H 2OMYB 4J3OH 3H54A 3B2VH 4PJGB 3PP4L 1LM8V 3F7LA 4L1HA 4A2LA 4NKDB 2FIKA 2K3TA 4LPUA 3G5ZB 5ANME 1MAML 4NWUL 4IRZL 2ZOWA 4PVNA 1S9YA 4EUPB 4NFCA 1PQZA 5JO5A 4BFIB 4I5BA 4NQSA 2CKBB 3A6BL 4LOEA 1NPNA 2CO7B 1W72H 4R5XA 4P9HH 4EDWL 1WZAA 2FX8L 5GGSY 1EAPB 3SKNB 1N9PA 5B39G 2HT3C 2W0KA 3MFFA 1RJZA 5KVDE 4HUNB 4W6YB 1DTUA 2YGNA 2GC4C 2BSDA 1PD1A 1LK3H 4JFYA 3ZRCC 4C4UA 4IJTA 4XNUH 4Z7IA 4K5OA 2KDGA 1IEAB 4KQ0A 2NDGA 3FTSA 1FH5L 4OZ4B 3FC8A 5AVZB 5GZNA 1KY6A 3F6JA 4PRNB 3TBWA 5HHMB 4E0RA 3GJFK 2IDUA 1YLBB 1U36A 5FKAA 4X7CC 4XHJC 2IAND 3DVIA 1OTSC 3FFCB 2AQPA 2R4SH 2FJGB 4K5NA 5FYLL 2BSED 1J1XL 3LNEA 3FAWA 1YEJH 3RHWK 2JK5B 3QIUD 4XXWC 2DL2A 3FF8A 3OXSB 1ICTA 4RWYH 3F7RA 4KDTA 3OJVC 4U1LA 1RUPH 2NY3D 5I8OL 3TPUA 4OFKA 2EYTA 1H19A 1B88A 1MJJB 3L95A 1PG7L 1HOEA 3V0EA 1AMXA 4ORGB 1ODUA 2L7EA 5EEVA 2NY6B 2MSPA 1X5JA 2ATPA 2AXFA 1HFUA 5FYKH 5GGUA 4XOEA 5LG6A 3LZQA 1AZUA 4KY1H 4POZD 3B8SA 1OP5K 3S4SA 2DWDA 3GSQA 4XWGL 3L2MA 1OAZH 2DWSA 1NFAA 2HVJA 4KV5E 4N3UA 3RTQB 4ERSH 4GG6F 4EVNB 3NGBC 4Y9BA 2ADJB 1E4JA 3U6XA 4TULH 3LCYA 2CE6A 1XGRA 3ULVC 4MNQA 1M2VA 3S3DB 3CPLB 4M8RA 4F7TB 5I1JL 5T3ZD 4YGAB 2AJUL 4LLMA 2EDEA 1BJ1H 4XCFH 1I8MA 3F04A 3M45A 4FERA 1ZPLA 2W94A 3BH9B 1DBJH 4WUKL 2A9MH 5D1XD 4ZFGL 3DBXB 1FIGH 1U8OA 4P3CL 3FO0H 4GQ9L 4W9LC 1NDMB 3GMPB 4XPHL 3ULAB 2V33A 4LP8A 1DN0B 3UJJL 2BLFA 5KBMA 3L3JA 1OF2A 3K72A 3O2WH 3GMNA 3MOAH 2VT0A 4I0PB 4M7LL 5E2JA 3NK4A 2OZNA 1VADA 3S35L 1CFQB 2O26U 1Q9KA 3EJQA 1P4IL 3FHQA 5LGHL 1FJ1B 3CLEH 2ZYSA 4W9KC 4KAQH 5AOKA 2HT4C 4IS6B 2IH8A 3DHJA 4JREB 1SVBA 1TJXA 4G6KL 4NZJA 3BRGC 3KYAA 3L3IA 1TTRA 2VLLA 3GTTA 3FTXA 3H8NA 3HAEG 3MRPB 4FQ2H 4XAWH 3L5XL 4M00A 4BWTA 2GY5A 4IHOB 4H1LH 4CGUB 3AS2A 1GZHC 3QNXA 1R9FA 2YAQA 1NGQH 2DDQL 2HLFC 1UXLA 4Y0GA 3SDCC 2UUDH 4BRVA 2WXLA 3A6OA 1SEQL 1EXGA 2GITB 4LLVA 2XV3A 5DVOA 4HJ0C 3TWCH 1A3RL 2AC0A 1ZY9A 2FDBP 3O3EB 4U2YA 5FFLA 1UCTA 1FVCA 2ZWZA 4FAAB 2JIXD 3N44B 5CP7A 3CVIL 5BZWA 4CU8A 5D1ZD 2ENYA 4ZPTB 3I9AA 4MLIA 3L9RA 2FEEI 1NWPA 2BSSA 3V95A 3TO4B 4NQTA 1RZFH 3T2LA 1MNNA 1JK9A 2JKNA 3CFEB 4UM8A 2MCMA 1TF4A 1XQ4A 1INEH 3ZMNA 4DO4A 1KJ2L 1NCDL 2X89A 3QEQD 5F70A 5JR1H 4YSSA 1CFVL 1GC1H 4EI5B 3WTTA 3E8UH 5AAWA 4PSPA 1F90L 3SZ6A 5T1DL 4ZUWA 1W0WA 3GBLA 4Y4FC 2Q7YB 2FBJL 5GISL 1Q9OA 2EUZA 2GJRA 3QEUB 4X83A 3HBQA 3FK3A 4TV3A 4G7YL 5ID0B 1T0MA 3HC4L 5DHVB 2FQGA 4UI2A 1HH6A 1ODAA 3TH3T 4WJ5A 3QZNA 4PTUA 2DI9A 5AVSB 4MA1C 4QT5B 3LRLA 5EBMB 3PDOA 3BUTA 2XX0A 2X09A 3EF7A 1C16B 4GW1B 2HT3D 3HPJA 2Z0BA 5JW4M 3IMSA 5BXFA 4AV0A 1KLGA 1AYOA 1Z9PA 3LHPL 2H6UA 3M46A 4O51A 5DFTA 5HGDA 3INOA 2VIRB 4X6DF 3CMOH 3PS6A 3KGRA 2IGFH 1FVEA 3KLSA 1RZ8A 4KTYA 1AR1C 4PCTA 1JP5A 1UEYA 3D9AH 1NMCB 4EN3C 3TYFA 2P9RA 2XVLA 1AHWC 3RZCB 2ARJQ 1KGCE 3TA4D 1WPCA 2EP6A 4LHUG 4BZ2L 1OK0A 2B9BA 4XHJD 4PRPB 2F54B 1OTSD 2YPLB 1QHOA 2O5YH 2AKRB 2DJUA 1XCTA 2ICES 2NY4B 2Q7AA 2XN0A 3GYRA 4NOBA 1EEUA 4MJ5A 5ETUB 3TONA 1XR8B 1QVOA 4GNKB 4AM0B 1HAWA 3HLAA 4X99A 1A7QH 1Q1JH 5D5MF 4AQZA 3VE0B 1FL3B 4FFZL 3SD2A 1JGEA 1L7IH 4LDEB 5DRWB 1D2PA 2XY1A 1U3HB 2YSSA 3KJ4C 3N1PC 3Q6GL 1CE6A 4G7VL 4HFUH 4XN4A 3VNYA 2XXCB 1H3VA 5IHUL 3GJFB 1FE8H 3OAUH 4F24A 5EEWA 3VB9A 2VDLL 4Z3TA 3V6ZA 1WFTA 1F4YL 1UJ3B 5E1QA 3V52H 2N1TE 4PJ6A 1XBRA 2GB2A 1BVNP 4NN7C 1ZHLA 4X6EA 1RIUH 3FTWA 3SDXF 1R5IB 1SHXA 2FBOJ 5LO7A 1BJMA 2OI9B 2PTTA 3JZ7A 2IOMA 3BPLC 4QGYA 4K7FB 5H4YA 4H8QA 3LPPA 4TF4A 3UDWC 1SYVB 2Y1ZA 5B3NA 2GJ6A 3ULVD 2HH0H 1E27B 2MWCA 4UAOC 1XVSA 4OB5H 3I3EA 4P8QA 5DLLA 1TTBA 1FDLL 3HRZB 1ZT7B 1CGVA 3FPXA 4FHBD 5IBLC 1S7QA 4E9XA 4P2YA 4XP9H 1J5DA 2EDFA 3BISA 3PHOA 4PJXB 4P4KC 3KPRD 5AFAA 1QSVA 1XGTA 3WKML 2E7HA 4M5SA 4OLWL 4JDZA 4M02A 5A43C 4DF9A 1BD2B 1U2HA 4DN3L 4QOKD 1OGAB 3G04A 3GIVA 3KGUA 4BCZA 2DLIA 3D69B 2ED7A 5HGAA 3BXNA 4GMSH 4XBGA 1U91B 1SBSL 4WI5A 1AC6A 1TETH 2AGJH 4ODVL 3DX1A 4GS7B 3RIKA 1N3NB 3ISRA 5BQ7B 1JWMA 4P05A 3SY0B 1MCRA 3IAPA 1E5BA 4MCYB 1VENA 3MBXL 1JBJA 5JZ7D 5BQDA 1EDQA 2C3WA 2WZ6A 4HUWB 1SJEB 5TDOB 1BVLA 5DJ8B 3V0IA 4O2EA 4AL8H 2R9HC 3GIZL 1KXTA 2YAHA 3UYOD 5D7IF 4G6ML 4YS4A 2C5DC 3SDCD 3FB7A 1HDMA 3ARPA 3IU3A 1BGXL 1WZMA 4QXTB 4Z7UF 4UF7C 4PJXE 1A14H 1ZVNA 4QNPF 4AT6B 3GINA 4HJ0D 4KDTC 4OCXL 4DGYH 4DP0X 4MJIB 3RA7H 5EEYA 1RUAL 2VDNL 4MAZA 4MA8H 1FC1A 2AJXH 1OGAE 3MAWA 1HZHL 5KYNA 4L8DB 3GMLA 4BKSC 1RP8A 4JO2H 4ONHA 4AIOA 3QIWB 2FT8A 1D5IL 2UZXB 1CG9B 2EDKA 3GMMB 4L3EA 3LZLA 4N1HB 4O2FB 4ACPA 3VI4B 3CPUA 5J1AB 3HMXH 1A6UL 4FFWC 3PV6A 5M7QA 4YSOA 4QRSA 4LVEA 1VGEH 2EDXA 2HFEA 1OWWA 4Q9CA 1JNHA 4WY7L 1SLVA 2WXKA 1YECH 2M83A 2YMXL 5FCUH 1PBYA 2YOAA 4Y4FD 2NYKA 4AZ8B 3D3VA 2QKIA 5EU7C 4DK3A 1SLXA 1MAJA 3II1A 1AJ7L 4QRQA 4TNGA 1QPPA 1WBZA 1H6EA 2DLFH 4L8SB 5I6XB 5B8CB 2CCVA 3ZT5A 1U58A 4C8XA 4AYBA 3OVUB 4J7RA 4LF3A 5AZ2H 4RMVA 5FUCC 3BSZH 3QBTB 5KVEE 3QIBA 2DQHH 1VFUA 3QJOA 4YSRA 2F8XC 1SDDA 2P44B 2PN5A 3ATAA 1AKJA 3HAEH 3HC0A 4HCIA 4MA3B 3BAJA 3HTLX 1UH3A 2G2NA 3NIDE 1TZHA 1RULH 3VI4E 2OYKA 3ES6B 5CXPA 2PP8A 3FT2B 3QUHA 3ULSA 5LCVA 1L9OA 3ESMA 4FD0A 5E8PA 1QOKA 2X6VA 2VZ1A 2R0LH 3ESOA 4JFUA 4Q6YA 4QAMB 1AACA 5AD0A 3P02A 4OJCA 3RNKB 1IC4H 2R2HA 2ADGA 5ESAB 2OXHA 1U8PA 1GIGH 4WI3A 3CFDA 4GSDL 1E4KA 2EDQA 3TOPA 3ZXAC 2ZPKH 2NQCA 1DVUA 3BW9B 4ZQKA 5I1LB 4Y2LA 5GIRB 3WIAA 1SVZA 3SHSA 3VFWB 4ZD3L 2JJWA 3FQXB 2PTUA 2X28A 1H5BC 3QDMB 1GA2A 5CO1A 5HHOE 4EDXA 3QJRB 4LSPL 4Q0XL 2VUOA 3CXDH 4A55A 3BHBA 1KUMA 4M8VA 2DWTA 1I4FB 3LQZB 1IBZA 4GAAA 2WIIB 4CJ0A 2OJEA 2R0ZH 5T33L 2WCPA 3GI8H 4RESB 5H37G 4TM9A 1VB9A 4WEMB 3PP4H 2PCYA 1DVXA 4FXKA 3DX2A 2NNFA 1MAMH 1GGTA 3MNZA 1IQDB 2ZXGA 1CDYA 4IIZA 4KO6A 4NWUH 1OP3K 3N1MC 3OF6D 3WD5H 3FSOA 1PYWA 3GBDA 4POUB 5CNHA 3UZQA 4AQ1B 2IJ0C 1GJWA 1M53A 3VFMB 2NCMA 1GYVA 3WN5A 3A6BH 3CTTA 4BCXA 1FIEA 1CUOA 1U8IA 4EDWH 3ROLA 2GKIA 3ZRFC 3QEHA 2FX8H 2NYZA 4OIIH 4GUCA 3LZNA 3Q2WA 5IBLD 5GS2H 1O6VA 4PJAB 1TZIA 4DFIA 1KTRL 3WO4B 3QFJA 5EBWB 3AGVA 3QDME 1V8HA 3T2NL 3OGOE 5F3BA 1EDHA 4P4KD 4NKOA 3AADB 1TQSA 3NPSC 2ZKYA 1NKOA 2TRHA 4AH2B 1N0XL 4B0MM 5IGXL 4YFLI 3FU7A 3GZKA 2BVEA 1FH5H 4P59L 3SE3A 3E6HA 2W88A 4FMFA 1GMEA 4J1UB 2NXZB 3RFZB 2BNQA 2A74C 2ZKHL 3EJJX 5KYYB 2FVNA 4N2OA 1AGDA 2BDNL 5BRPA 1J1XH 4U6YA 3ZT7A 1MHCB 2WNXA 1WC7A 3WTUA 1U6AL 4NS0A 4PP1C 2NDFA 5TGBA 3HG5A 2HVBA 3HE6A 5CIPH 1TVHA 5AVRB 2R9HD 4K7PL 5I8OH 5KBPA 2WWOA 3UBGA 3U6XS 4GUPB 4G43B 3IFPA 2BFVL 3NSDA 3MV8A 5FKPB 4OGZA 2O6DA 4HXBL 1R3LA 2B59A 3IAQA 3HE7A 3QJFA 5FM8A 5CINL 2WKGA 5CWSA 3NJXA 4MB4A 4XWGH 4FNQA 4G9FA 2D73A 3LRMA 3UYRH 3MJ8A 5J56B 3DVFA 3W0WB 4QXGL 2OYLA 2Z91B 1QZ1A 2EAEA 3V9EA 3CU1A 1S7UA 5D1QB 2UWEE 1AIFB 4N86A 3TT1L 5IVXE 4GRWB 4DVBB 4FFWD 2EYRA 2Y07L 5BVJA 5I1JH 3BGFB 4M1GL 2XBDA 2AJUH 3JWNE 2ENQA 2HN7A 2HUHA 4F7CB 3MNDA 3EOAB 5D72L 5I75C 5FDYA 4UOQA 4WUKH 4ZFGH 1I9IL 3EGDA 2LLLA 3BAKA 4J23A 3WDIA 4RMUA 4X5XB 2KPWA 4YO0B 4B9FA 5B3SB 4P3CH 2XIBA 4K2UL 1RPKA 5IQNA 4MNQD 4GQ9H 3VMNA 4Y1AD 3V55A 4E9VA 1NUGA 1BPLB 2X6MA 4YHPA 1OSZB 2Q9OA 2BZ7A 5J06A 4BELD 3OX8B 2EILB 4WEUD 4OFIA 4CU6A 4LSSL 4YZFF 2EDJA 3LRSA 1OZTG 1SJHA 1ED3B 3KW7A 3IXTA 1NINA 5HVHB 4M7LH 3KVQA 4UTAA 3S35H 1FNSL 2BZCA 1AMYA 4LASH 4BHUA 1P4IH 4R3SA 5DU7A 5IEKA 1G7JB 4WV1A 4KKCC 2IBZX 1BMZA 1KY7A 1LO5B 1T20A 2F8OA 3GMOB 4G6KH 2X5PA 1T22B 1J9CT 2UZPA 1IGYA 1BVKA 4JR9L 3UG4A 4AIZA 4WNQA 4XMKL 1MCFA 2H6PB 4GY4A 3PWVB 5E8DL 3DARA 5HDBF 5T5NF 4V11A 2BRRL 3D85B 3L1OL 4A66A 1EXUA 5A6MA 5LNDA 1SEQH 2FYVA 3HS9A 2DD8H 1PY0A 3TX4A 2YPVL 2P4AB 1A3RH 5D93B 1YMMD 4Y4HA 3L3HB 4R7LA 4WWOA 5I9QB 1D7CA 4B96A 3LY6A 1QLEB 3LZOA 5CLZA 4LCCA 1CL7I 2G3XA 3I6SA 1PZ2A 2ZWKA 3MYJB 4JKPL 2P7TA 5DJDB 3RL1A 3S98A 4MHHG 1IE5A 1PCXA 3NFNB 4GAJL 5I1DB 3F7VA 1CTMA 5I16B 2BX5A 3LKQB 4UUJA 5AW5B 1CFVH 1F0LA 1ML0A 4ZOBA 4GRMA 4OY9A 3UC0L 1MVFA 2XX1A 1F90H 4JANB 2ICEB 1KB3A 5T1DH 4DH2A 4CJ1A 2FBJH 3OKOA 5GISH 3KYOA 5K39A 5ACLA 1C12B 1OGPA 3GWJA 5CR8A 3A6CH 4GBXA 1VCBC 4NUGH 2X89D 1RUQL 2AEPL 4G7YH 5C7XH 3HC4H 2NY2C 2FTAA 3QXVA 5DI8A 2Z1KA 3T1FA 4HGWB 4CGTA 4OM1L 4QAWA 3MCKB 1R5VB 1CD9B 3BKYL 5T3XE 2QKIC 1UA3A 4F57L 3WNOA 2VDOB 1MW0A 3TNNA 5CZKA 3ZHKA 4PJIE 1HKLL 4XZUA 4BQCA 2OTWB 4YHLL 2I5YL 5IBTL 2Z4QB 2YFNA 3A4AA 4P07A 2WZ5A 1OGTB 2VWEC 5G5DA 5AEAA 3DSNB 3QIBC 5LBSL 1IBDA 2X4TA 5C0CA 3EJPA 3T3MB 1Q90A 3NCYP 5IJCC 2EIJB 2ALWA 4JFOA 4YVNA 5E6UB 2L7UA 1DLHA 2ARJA 2FL5A 5HHXL 1INQA 4P57B 1HI6B 1F2XK 4LCYA 1EEYA 2BXZA 2HWZH 3QCTH 1ZA3A 4TSAL 2P5ED 4P2RA 1NMAL 1WBXA 5DWUL 1OCRB 3GLAA 4HHWA 4PP1D 4PRAB 5FGRA 4PJ8A 4GSUA 3HG1D 4G7VH 3Q6GH 1WE5A 4PY8I 3TYGH 2AZAA 5F8RC 4X8JB 1G7QB 4FTVB 4QO1B 2WLYA 4KRMB 4NI6A 2EXSA 4OTXL 2E7DA 5KBNC 4Z5RA 1F4YH 1RHFA 4RQQA 3LJ3A 4U6HA 4ZW6A 2NY5L 3FU3A 5H94B 3U25A 2UY7A 2JELL 3CE1A 4NO2B 5J0BA 3PXHA 3JWDC 4OZHA 2AABL 2E3VA 2F53A 3FRUB 2OQJA 5I19L 2FT7A 5CD3B 2E27L 3C5JB 1E0OB 2X70B 4YL9A 5DQ9A 1YPZE 5F7AA 3IAGC 1UD2A 2BP8B 2FH6A 4N90D 3Q9PA 5SV4A 3V0JA 2DOCA 4PJBB 1KPVB 3VYOA 4ETQA 1FDLH 5LNEA 1FA4A 3AT8A 1MWOA 2ATAA 5CBEB 1T5XB 4LMQI 3AQDA 1AD9A 2CAKA 2XIDA 3POCA 1ID2A 3OBAA 5J13C 5E56A 4ZODA 4F7MB 2OZ4L 5MI0C 1FH2A 5EZPA 3ZDXF 1XD1A 4FTVE 4JHWH 2OTUB 3WKMH 2F5AH 1XF5A 2J8UA 4OLWH 4FCAA 5FF6B 2W60B 3I9GL 4DN3H 3CZFA 4NM8L 1QRNA 5AG8A 1J12A 1DVFA 4TVPD 1NCTA 5KJ4A 1RXLA 2AQNA 4IOIB 3V7AE 3PE9A 2EDWA 4TRPH 1SBSH 1AAJA 3TEWA 1Y6KR 1M7IA 3V0WL 1OB1B 1KBKA 3NSXA 4ODVH 1ZDSA 1NMBL 2CXKA 1W80A 4RA3A 1AR1B 3BZEB 1UKTA 1OAUL 4KKCD 4EN3B 3K71B 3SYQA 2EVFA 4Z3EA 3MBXH 1X5FA 3KYMB 4GIOA 1R5WA 2OP4L 3QRBA 1N6VA 3VRJA 1Q4NX 3J27A 2KT6A 4FMKA 2CGYA 3GIZH 1S7TA 5JLZA 1MFDL 1ONQB 4G6MH 2YKKA 2A5UA 25C8H 1EUTA 4Q2ZB 3D50A 4IBSA 2CLRB 2J5LC 4XNZC 4H26B 3KPSA 4Z0XA 4RNRA 1FV1A 3HE6C 1RUAH 1N2RA 2MFNA 3K6FA 1PGRB 1WTLA 3HN5A 4LSQL 1KYDA 3CCHB 1HZHH 1OAQL 4HMDA 3B9KC 4OJFL 4L8BB 4CMMB 4N2LA 4LSVL 5JUEH 1FVDA 1E8ZA 1QLFA 3GK8L 3H7BA 5CILL 5KZCB 3F64A 5F2FA 3HE7C 1PZDA 3IMVA 4EAEA 1A6UH 1UEMA 2XXGA 1ESOA 1Z66A 3G6JE 1DLFL 2VLMD 3WS6C 3N2JA 4I0KA 1IGTA 1AD0A 3TP4A 5FS5A 3CZGA 4WY7H 4L3ED 4U4IA 1GYAA 2GTZA 1W91A 4UM9A 4PRIA 4BCYA 2FR4A 2VDPL 3FOLB 3DIDA 5FA3A 4JPWH 2H2SD 2FIKB 4NZRL 5D1ZI 2NNRA 2NY2D 4HIQA 4OCMC 1N0LA 4M1CD 4EZMA 3L3DA 4N2CA 1PQZB 5KWYC 5EN3A 5JO5B 4AYGA 4I5BB 3IM1A 3BAWA 3KPOA 4NQSB 3D3VD 2ZSWA 4G8IA 4K23H 2WP3T 2DI7A 4YK4B 4JFVA 1K5NA 4HEME 3UACA 3FQ1A 4G70B 1E6OL 1O5PA 3KXFD 3FH5A 3MFFB 3O4LA 2G3NA 1FFNA 3EJUA 4YBLC 3TIEB 2HRGA 3H3PL 4JFYB 3QIBD 5I0ZA 3TS8A 1GGBL 3RY6A 3EYQC 1AKJD 2ENPA 4TN9A 3GJEA 3LSOA 4EPSA 4WV1C 4ZRGA 5ITFA 1QSFA 1G7IA 5E2UL 1X4YA 2DBLL 1XR9A 2ITCA 2VN3A 3TBWB 4CC4A 4E0RB 3H56A 5F9WC 3ZTEA 4R5TA 5A7EA 3A22A 1V05A 2Z7ZA 2CG9X 4OBSA 3N5AA 1GPOL 4LQFL 4OIAA 1R3KA 3U1SL 2X4SA 1IX2A 5EZIL 2VERA 3TTYA 2DQEL 1M05A 2HX8A 2XC8A 3D48R 2WWMC 4ZD3H 5IESH 2MTAA 4LSPH 4U1LB 1FFOB 4Q0XH 1O5DT 3QI9B 4Y4HC 4YDVA 5FHAL 3TPUB 2VR5A 4PS4L 2VMJA 5IWLC 4ZXBC 2EYTB 2H1XA 4NNPL 5T33H 1BQUA 3L95B 3K6IA 3BAYA 4LCCC 4UINL 1MQKL 2FWLB 3W37A 3MRHB 4Z77A 3MOQA 2AXFB 2ATPB 1O9VA 4R90H 1NBQA 4URTB 5GGUB 4Y4KA 3S4SB 1AQ8A 3IS1X 1UB6A 1B4LA 2DWDB 3GSQB 4TQEL 1BECA 4L1SA 4NN6C 1HXMA 1YEEH 3PQYA 5JORA 3IFOA 3NJLA 4UZGA 5T5FH 4IIQB 1CE1L 3AACA 4UT7H 1XGRB 4G83A 2UZIL 1M2VB 1XWVA 1AO7E 2C9PA 4AYMC 3QDHA 2R69L 1I8MB 1JXFA 5DD3L 3OB0H 3T2NH 1BREA 3BUYB 4ZMXA 4ZMTA 1QPXA 5E94A 4TQIA 1B90A 4HD5A 4NHUB 4WVRA 2DH2A 1UATA 4PIBA 3RX9A 1U8OB 3AREA 5IGXH 4TTGA 1G5GA 1ZRUA 1OQOA 3MRRB 4P59H 4HS3A 4BEIA 4I1NB 4N6QA 2CHNA 2AQ1A 2DYSB 2CJTA 5IZ7A 4RGNB 3IJEA 3QNZA 2ZKHH 5KS9F 3C5ZA 1JGVL 2L3BA 2WVTA 2WZAA 2Z0UA 3L3JB 1OF2B 2BDNH 3K72B 3GMNB 3OG4B 4PVMA 4PWEA 1KBBA 2VXUH 3VFGL 2QHRH 5FC9A 4HIIA 4EQ2A 1VADB 5EU5A 1JDCA 5C0AE 3VRLE 1Q9KB 1WFMA 3FNKA 3KYNB 2BMKA 4HUCA 5E9DE 4NT6A 3ZN6A 1VFMA 4MMZA 3ZMRA 5F1OB 1Y6NR 3L3IB 2FLMA 3N41F 4K7PH 1X4XA 2JQMA 2XG4A 4RDBA 1QEWA 5GS1A 1OB0A 4IBWA 2WC7A 4YPJA 2F08A 3BJLA 5J11B 3QNXB 3UJIL 4UWQB 1NCGA 3V6OA 3T4YA 1ACZA 5IB5A 1ZOXA 5DYOA 1DFBL 1K9TA 3HE6D 4PJ8C 2J21A 1FGVL 3DX8A 4LLVB 5B39A 4DK5A 5CINH 3G5VB 3K4ZA 1XL6A 5DJXA 5IQ7L 2BC4A 3B9KD 5C07E 1FVCB 5DO2C 1T2QL 3MV8D 5BZWB 1WWCA 2Q5BA 3TEUA 5CGBA 3ZKQD 2DQGL 4N2KA 4QXGH 3L9RB 1HAUA 5JIDA 1TSHA 3D4ZA 3HE7D 1IQWH 3TT1H 1JZ4A 3B2XA 4Q14A 2Y07H 1JK9B 5IROA 1NIAA 4UM8B 3RKPA 3SODB 4G9FD 3AITA 4FFVC 1UHVA 4TLTA 1BYNA 1A7NH 2K3HA 1MFUA 1I9IH 4PJ5A 2DYPD 1TTUA 4MZ3A 2BM3A 4AXWA 4X9HA 5AG9A 2RB8A 4K2UH 4ZUWB 4WFFD 1W0WB 3HNTL 5IKCA 1Q9OB 2UY6A 5KVDL 3EDJA 2D31B 3E2HB 1S9WB 5IG7B 2GSIB 2G0LA 4LSSH 1T0MB 1HK6A 4FEMA 4UT6L 1HH6B 3VWKD 4D0CA 1SXAA 1XIWA 4WJ5B 5EULV 3W3BA 2OMNA 4PTUB 3BAXA 2EVGA 1G6RB 3L1FA 4TSBL 2WCSA 2DTML 1FNSH 1OAXL 3I50H 3PDOB 4MMXA 4PV1C 3C09B 3CBJB 3APNA 4IGBB 4XH2A 5BXFB 3B37A 1B6UA 2VQUA 5E08L 1KLGB 1L9RA 3ATEA 4QF1A 3UX9B 2K6YA 4NQCA 4O51B 3G9AB 1HJBC 1P6FA 1YNTF 4XMKH 3S7GA 3EYQD 4KXDA 3P54A 1FVEB 2CR6A 1RZ8B 2CKBL 5E8DH 5JMOC 4A04A 3K8KA 1XAKA 2BRRH 3L1OH 1IFGA 3TYFB 3CVCA 1UZGA 1SEBA 1J05A 3BPCA 3O6KH 5AVXB 4JGNA 2YPVH 2YEZA 1J1OH 4ISVA 1N64H 1PAMA 5E6IA 1YQVL 4X6DA 4RCAA 4LVOB 1UGNA 1XCTB 5KSAA 1DYZA 2JVUA 2J6WA 1MCLA 4AMXA 1QVOB 4B53A 5GGSA 3HLAB 1J7VR 2WWMD 4X99B 1X3DA 5EPMA 5HDLA 3B2MA 3CU7A 4GAJH 4Y4HD 1JGEB 2YSSB 1KDJA 2YPKB 1CE6B 5JYLA 2IDTA 4ONGL 4ZXBD 4V1DA 4LLYB 3UC0H 2IQ9L 3PL6A 3V6ZB 3SPHA 1H8OA 3MXWL 4NQEA 1ZHLB 4X6EB 5B22A 1KIQA 3EO1A 3QFDA 3BCFA 1RUQH 2AEPH 3I3DA 1F3DJ 1NANH 4MAYA 2QL1A 1U9KA 3K8LA 5I5JA 1U3ZA 2PTTB 1T1WB 5AQ0A 1W0VB 4NNXA 3BGAA 1DVSA 3QS2A 4KNQA 4OM1H 1BMWA 3J8F7 2Q3AA 3BKYH 2WZPD 3PHQA 2GJ6B 3B5HA 3SDXA 3IJSA 4Z78A 4QKXB 4U49A 1DSFL 3RTLA 4PW4A 1HKLH 1ZLEA 4ZMNA 1KCBA 2VLJB 4U1HA 1F3DH 5E8NB 5ICZB 2L04A 3BO8A 4NCDA 2WIMA 5IBTH 3TWYA 2VR4A 1G4RA 2Y7NA 3COOA 4L2LA 3PHOB 1RJYA 3O2DL 2VSCA 4LO9A 5LBSH 3MLUL 2FNBA 3ECQA 4IEFA 2XZZA 2OMWA 4XI5C 4HYTB 2X0UA 5GGTA 4EIBA 4JDZB 4P3DB 5GGQL 4UQ2A 1KEGL 1BX2B 5B21A 1OL0A 3G04B 3GIVB 5HHXH 5ABAA 5HGAB 1E6JL 4KZEL 3BXNB 3DOHA 1E5CA 1Q94A 4XBGB 2G9HA 4JMNA 1IM9D 5FGCB 3TXAA 5ISZB 2MEJB 3ZE2F 3GNML 3MV9A 4TSAH 4ELMF 4QI3A 4ZZFA 1NMAH 4O02H 5DHXB 3CGTA 5C0RH 5DMYA 1ZT4A 4WFHE 5FYJU 4W9IC 3BD4A 5EBGA 3FCSA 3JWNC 3HN3A 4ONFL 2PWEA 3VG9B 3FN0L 3WG7B 1BVLB 3ZE0B 3MYZA 1ZMYA 4O2EB 2BWQA 1KXTB 1W6LA 2VLJE 2XWXA 1IC5L 1F1GA 2G30A 1FZJA 3TFBA 4J3WA 2RACA 1HDMB 3FB7B 1JXDA 4S1DC 5K5YA 2NY5H 4PJ8D 4TUUA 2WPGA 2IAMB 3EJTA 3GO1H 2CRZA 4ZSOA 4HBCL 4JFDD 3SE4A 2AABH 3EUDA 4EIZC 2QGDA 5GZOA 1CT8A 2VLRA 1TG8A 3BMWA 5D7IA 2WTPA 2LFEA 1U8HA 1U41A 3JV6A 2MQ3A 4V2CB 4Z7UA 5HYFA 3WXWL 1MY7A 3GMLB 4L5FE 4FE9A 5FGCE 4X4YB 5ISZE 4MXWL 4L3EB 1NCWH 3H42L 4Q9BA 5FXCH 4R7DB 3ECBB 5IM7B 4NXSA 3X1FA 4FFVD 1CTNA 1KYFA 2NLJA 4J4PA 2ZOTA 4R8WL 4AC2A 3NA9H 4L4VA 5AB2A 4PJCF 1UENA 2HFEB 3LMJL 4JFQA 1OCCB 2ALAA 1OGSA 2BXYA 3WY3A 1SXCA 5DGQA 1MFVA 2CZNA 3Q3GB 2WYZA 4DP5X 3SPGA 3QZWG 4QXWA 2CJ3A 4ZO6A 1OLLA 3VXME 3EJRA 4KRLB 3E9TA 4NDMA 5MEQB 1PZCA 3FT4A 1FNLA 4KUZL 4NM8H 3S48A 4FFYL 4QRQB 4EKJA 9PCYA 4P2OA 1JXJA 1WBZB 2DI8A 4W9EC 4MJJA 4WTQA 2Q10A 5J5EA 1U58B 2O5XL 4LF3B 1MFMA 4JY4B 3HI6L 4Z9KB 4ZJ9A 3V0WH 4PLKD 1JF5A 1NMBH 3AREC 1OAUH 5HHOD 3OWRA 2ZCLH 3HC0B 2LAAA 4C4KT 2NX5E 1JMXA 1NLDL 1TZHB 1L6ZA 3EFFA 4FYSA 4OT1L 1OTTC 4HJJL 4WK0B 3ULSB 2Z9TA 1MFDH 1M2OA 3C5SA 5C2BL 4NB7A 1J8HA 3B1UA 5E8PB 4MAUH 3FUNA 4EUPG 5INCA 3OXRB 4FXGA 5AD0B 5HYSA 2W9LA 5IF0A 4MMZC 2GSMB 3L7FA 3POHA 2OK0L 4BGDA 2GAZA 2R2HB 3CC1A 4LSQH 3T2QA 5B1AB 4OJFH 2FO8A 4ZQKB 3V6OC 4LSVH 4HG4K 2WQXA 3GK8H 2DJ4A 3KPSD 5CILH 1PFCA 5ESVA 2DJSA 4J8RA 3WHE1 3ZYZA 3RPKA 4EDXB 3ARRA 5MP6L 3BHBB 3NIFE 1ASPA 2R83A 3K0WA 2OSYA 1UWGL 1WRFA 1SDAB 1P1ZA 3F85A 3Q2CA 1X5MA 1X4ZA 2VDPH 3C60A 4FXKB 4TUJA 1HOCA 1MFCL 5F7EL 1EZLA 3KCPA 5KVMC 2FZ3A 4A7TA 4UQ3A 3ZGHA 3MNZB 4JHZA 1XZ0A 1IARB 3ZE1F 1PYWB 3FQ4A 5B38G 5B3JE 1UOWA 3UZQB 3LZFL 5J13B 1R19A 4X4ME 3G9VA 4P5SA 4PRID 1U8IB 5EUOE 4M48L 2SEBA 3QEHB 3QCVL 3PPEA 4QEGA 3S34H 1Y6MR 2Y24A 3NZHL 5FM4A 1BJ8A 1E6OH 5I6NA 3ABMB 5F1IA 4X4ZA 3LX9A 1TZIB 4J28A 3SDAC 1RZIA 3QFJB 1DSWA 2H2PC 1DQKA 1ET7A 2EDOA 3FRPA 5F3BB 1HL8A 2ZOKA 4JFEE 4NKOB 2P43B 1JYNA 3F58L 1DQTA 1GGBH 4XI5D 1KPRA 4HIJA 3NJNA 3X12A 2Q2LA 3Q2LA 4P2QB 4F7KA 1HC1A 4QRPB 1WZ1L 4ODTL 4IBQA 5JPMC 2Y25A 3E6HB 2DBLH 3H0TB 4ZW3A 1CBJA 1PIFA 2BNQB 2PO6D 4IDJL 3TNMA 4HUKB 3REVB 5JW4Q 1U92A 5AL0A 1FHNA 3B34A 1UA7A 1AGDB 1I1RA 1GPOH 4U31A 4U6YB 3U1SH 2C8NA 4YC2B 2QV4A 5EZIH 1CURA 4XNZB 4A38A 2DQEH 1J8RA 3GZPA 3J2PA 3SE9L 1EHNA 5EC1A 1QHQA 1AQKL 5TGBB 5GS0L 3HE6B 1CD8A 4H0IA 5E6IC 3HS0C 1TVHB 3GRBA 4NX0A 2ZP9A 5FHAH 2P47B 1OQXA 3RU8L 1PG7X 2EJ1A 4YHKL 1BIHA 4NNPH 1A7BA 3LQMA 4U4BA 4S1DD 1VFBA 3IFPB 5A16B 3VD4A 1MQKH 2RH0A 1UJTA 1OSEA 1OZUA 3NUKA 1TEYA 1R3LB 1TQUA 2B59B 4P2QE 4DO5A 3HE7B 3QJFB 3IVKA 4QRPE 5JOPE 1MNUH 2VL5A 5CWSB 4A2MA 3PWPA 5BS0A 4TQEH 4WDIA 5I1EL 2WSKA 4P46D 3MJ8B 2DWXA 4HJEA 2ZUXA 3QUYC 2BP0A 3PL6C 2Y22A 1MRCL 5K59F 4ZFQA 2ATKA 1S7UB 4OD3H 4LP4A 3VDCA 3PJLA 2H1LM 2OS7A 2UZIH 1I8LC 4WHDA 1XGYH 4S0SD 1EV2E 4N0UA 3NRFA 4PV9A 5BVJB 4J8QA 4M7ZC 1GVIA 3G3LA 3KDMA 2R69H 3JZYA 2HN7B 5DD3H 3RB7A 4DPAX 1FI8C 2PCXA 4XN5A 3RIFF 1GOHA 3EGDB 1ZE3C 3LPFA 5KANI 1P69B 1IV8A 2XZQH 2FCBA 1GAFL 5J1TC 1LGVA 4BZ1A 4WFGD 3H2PA 2DJMA 1PDKA 1PZ5B 5DYFA 4YMPA 3BWUC 2D3LA 2R51A 2ZP8A 3P0YL 3LRSB 4YFEA 3NJMA 1JGVH 5F7YC 3BP6B 2I9TA 4KI5E 3EYVA 3ARED 4XPAL 4TS6A 3VFGH 4HUUA 3U1PA 5H37A 4ZNCD 2I85A 2JNZA 3Q43A 2HKHL 4R3SB 1E7VA 2W80C 4YUEL 5IEKB 4HV8B 4CW1B 2D7TH 4LPTA 5DRXA 1T20B 5DJ6B 1OTTD 1DUZA 4ZMOA 1SMAA 3AS3A 2R2EA 4WNQB 4YSTA 3ATDA 3EJCA 2JCCA 4F9PA 5GQBA 3B43A 3MV11 1DFBH 1EXUB 1OT4A 1A1OA 2VDMB 4N0YL 3EYFA 4U3HA 1FGVH 3U7YL 3OAZH 4OJYA 1PLCA 2FWOA 3CUPA 1PAZA 1QRKA 1JCVA 1MXGA 3FO9A 2FWSA 5IQ7H 1UB5A 2Q7NA 3V4LA 4XMTA 1T2QH 3DRQA 5E5UB 5I28A 4TPRL 2DQGH 4QJ3B 1TVBA 1W0YT 3KPMB 4D3CH 1CFSB 3LRKA 3SE4C 3H9SE 3O41A 2P7TB 3MV7E 3RL1B 1UT1A 4ANWA 5DVKA 4NIYE 3LXBA 3SBQA 3DPBA 2JJSC 4FN0A 4UUJB 5JXAH 1TYJA 2H3NA 5DUBB 1BQ5A 1MCOL 3FCUB 5D4IA 5DHMC 12E8L 4GRMB 5KTEH 5D4JA 1IGJA 4LT7A 3UFIA 1Z5LA 2UUDK 1Q9LA 1MFAL 1R3HB 1WWAX 2VSKB 1X6NA 2LVEA 3KYOB 3HFFA 3OR7A 1E5YA 4OAWA 2PXYA 5GRYA 4GBXB 2EC9U 5KUKA 2HMIC 3QUXA 4J4PC 3F7PC 2YN3A 4PJ5D 2H9GA 3T1FB 3CD4A 3HHSA 4JM2C 1Z9MA 5ICXA 3U9UB 3RFRA 1USZA 4X6CA 1A1MB 4OJAA 1P4BH 2DTMH 1OAXH 2YUVA 4QGTA 1RI8A 2ZF8A 5IMKA 5E51A 3RJQB 3WMSA 2XBZA 2IXQA 2Z31A 3SDAD 4XZUB 4GRLA 2H2PD 3GS7A 4HJIA 1Z3RA 5EFIA 3PP3H 3VU2A 4EUPH 2D8KA 2CKBH 3GF8A 1NUDA 1R6VA 3JYCA 5C0CB 2HFGL 3RPIA 3U9WA 4IRSA 2WQ8A 4RWHA 1OOAA 5SWSB 4ZOEA 4A67A 4JFOB 3BP7A 3UTSE 3BQVA 4OLXL 5CJ8A 2ARJB 2FL5B 4XVTL 5T1MA 1INQB 4F3FA 1YQVH 4B5ZA 3MGTA 1EEYB 4K9EL 4LCYB 3VSUA 4CL7A 1GL4B 3HJEA 4W81A 1GH7A 1GS7A 5KVFE 1ZA3B 4WW2F 3AY2A 1VFOA 2ICWI 3JUYA 4P2RB 1F02I 1WBXB 2OR8A 4I85A 4MD4A 3HOGA 4RBPK 3WIFA 1E90A 1KFAH 2P5WA 3FSAA 2C4XA 5E6ID 3GDCA 1KCSL 4I77L 4OCNC 4QHKJ 2CO6A 4PHXA 5EH1A 2C4FT 4XTRC 1VZHA 1Z9LA 5CJ5A 2FHCA 3QH3B 3MUJA 2IQ9H 2YC1A 3H1ZA 4Z5RB 4U6HB 2DTSA 4ZTEA 5K9KB 4EJ1C 3RE0A 3A67L 2UY7B 5C0CE 5C9JA 2K78A 4OZHB 1LL1A 1QTSA 1EX0A 2F53B 5SWSE 4PS7A 2K1MA 1RPUA 1OY3B 5C0IA 4G9DA 2WD0A 3QUYD 4G7SB 5DQ9B 1J0IA 5FWQA 3ARBA 4PTTA 1T5WA 2QFRA 2CRYA 4WU7A 5B7FA 1DSFH 1WHOA 5JXEC 2BP5M 4ETQB 4YZWA 3ULUE 1JGUH 1TQBC 4Z3FA 5ENWA 5I1HL 1IBHA 1AD9B 1AZVA 1KULA 2F68X 3O2DH 3OHXA 2VR3A 4JKWA 3KEHA 1AXSA 1XF5B 2J8UB 5GGQH 1ZTXL 1KEGH 4R97C 3ZTJG 4RZCA 3WE6A 4LBEA 3TESA 2CHWA 4MQ7B 2R8SL 2XWDA 1QRNB 1W6WA 1DVFB 2IH1A 1E6JH 4KZEH 2XKUA 4XCEA 3UCQA 1I9EA 2BIMA 1M7IB 1EZVY 3QSKB 4OM0L 2HG5A 2V9QA 3GNMH 3BOVA 4HU8A 5F7NC 4F1ZA 2I32A 5DRNA 5H35A 1JHTB 2O6CA 3BAEL 3DIVA 2EDHA 3SGJA 4EIUA 5D7EA 1R5WB 4ONFH 3VRJB 5IY5B 3FN0H 1GS8A 5DC9B 2EIMB 5JPNC 1RZQA 4JDVA 1S7TB 3NSJA 4MXQC 5JLZB 1BCIA 1CYWA 3FONA 1FYHB 4I2XB 4PPTA 1O9WA 4Y2NA 1V55B 4XXDA 4YH6A 1DSYA 4OQTA 4ZOAA 4F92B 3N42B 1ND0A 4KOCA 1IFRA 2XDHA 4IW4C 1EJFA 3EFOA 1FV1B 4LQ1A 4HXAL 4WLCA 1N2RB 2C1OA 1SY6A 2DLHA 3D18A 1ZSHA 2VZOA 4IBYA 4P5TA 3US9A 1QRNE 3NRPA 1LEKA 3WXWH 2A83A 1FVDB 4MXWH 1KIPB 3H42H 1QLFB 3H7BB 4HZAA 2FHBA 4K3EH 4ZTPH 3ZDYF 1BQHB 2XWRA 2VLRD 4C47A 1SM3H 2APWA 3FXIC 5CJXA 2K0RA 1NEZG 4Y19A 3LMJH 1IGTB 5T3XL 1AD0B 2COQA 4XP4L 5AUMA 5FYKE 3CHOA 1QLEL 3UAAA 2Y7SA 4XPBH 2GTZB 2W0LA 2F5BL 2WYTA 4PP2A 2WMPA 3ZO9A 4PJ7A 4I2XE 2WGNB 4UM9B 2FR4B 4HPYL 1PZUB 2CUIA 2WN2A 4HH9A 4KUZH 5EO0A 4FFYH 2HMID 4J4PD 4MS8C 5T1JA 4L4VD 4D0DA 1MPAH 3LS5L 4ODXA 1N0LB 5HGBA 4AQ8A 4JM2D 3QPKA 3FQTA 3L3DB 3VFRA 1INDH 3S37X 2P8PA 3HI6H 3E1F1 4QD2E 1KN2L 3GBMH 3KPOB 4TXVB 2ZSWB 4G8IB 4ZAKA 5JHDA 1K5NB 5ECGA 1BXAA 2RA1A 3QNYA 3APCA 5F9JA 1ZHKB 2F8IA 3CDCA 3O4LB 4OCWL 3DXAE 4OT1H 1FFNB 2V2XA 4I0CC 5DSCA 4U0QB 3WDJA 2P24A 1X7SA 3HNSL 4HJJH 5DHVH 3A47A 4DKEL 4L9LB 2QQLL 3SJVA 1SMOA 3L6FA 2MKLC 5C2BH 4X9FA 1YYCA 1S8DB 3Q5YA 3J07A 5AW9B 1CIDA 2DW5A 2QR0A 3GJEB 3LSOB 3AG1B 5ITFB 1KC5L 2OW6A 1RQ5A 2VDOL 1QSFB 4K71C 4TOYL 2EXWC 5ITBL 2OK0H 1KTJA 5J12C 1XR9B 2ITCB 2XG5A 4GQQA 5L2KA 2C9RA 4C54A 2GVYA 3S2AA 4GP5B 3FO2A 4F9PC 4G5ZL 1R3KB 2QVTA 1AO7D 1PPIA 3TT3H 2WO2B 4YLCA 4JO3L 5AW1B 1AIZA 3KDPB 1NUNB 1M05B 4G72B 3QJXA 1G43A 1WISA 5AWNL 2IG2L 4XTRD 4YDVB 2D7PA 1G9NC 3LEYL 4R96A 5F44A 1TO5A 3O4LE 2DM7A 1OCWL 2YRLA 1G1KA 4NQXB 4R2GB 5PAZA 4WSGA 1UWGH 5JQIB 3B7YA 4YHYB 1SPDA 3KPLA 5DS8B 4Z77B 2EKSA 3BI9X 1A6AA 1AZCA 1MFCH 3KG5A 1IAIL 5AKSA 5F7EH 4AK2A 2MCPL 4BUHA 4Y4KB 5FW8A 2CGZA 2M2DA 2NY7L 3JV0A 1UB6B 2CK2A 2ZXEB 4HHGA 4PWHA 4C56E 3GJFH 2O6FA 3PQYB 1YYML 2CLVA 2IAAC 3DTDA 3IFOB 4HPHA 3TBTA 4M48H 4MBRA 4TLKA 4YHZL 3UYPB 1NTDA 1A6ZA 5JXED 2YAMA 4APXB 3NZHH 4U1GC 2IQAA 3VD0A 4N2DA 5CFAA 2EC8A 5MEND 3CDGB 1UD5A 3IDNB 3K3QA 3BDYL 5IUSA 4GG6B 1IO4C 5EU6E 5DTFA 1CQYA 2A9BA 1UD3A 5TE7L 1LDSA 1SQMA 3IJHA 4FQPA 3AW5A 1P5UA 3F58H 4Q74A 3QJVB 4JS7A 1NFDA 2YR3A 3HUJF 1FYTD 1GZPA 3NSCA 4HS3B 4LESA 3ARYA 4FZ8L 4G6AC 5C07D 2ZG2A 1GYCA 2NPLX 3EGXA 4IDJH 1GOFA 3MVSA 4JRXA 4OSUH 3IJEB 3QNZB 3S6CA 3TA3A 3C5ZB 4NIKB 1SJMA 3UBXG 1OPGH 1OP5H 3ZKSD 1LP9F 4DVRL 2ZKMX 3KNBA 4HIIB 5EU5B 3TN0B 3CHXA 1DQDL 1WWWX 2YLKA 5BO1L 4KUCD 2FX7L 4ZFOB 3SE9H 2BMKB 4A6YA 1MVYA 1EK3A 3BWAA 4NT6B 5JA9A 1AQKH 3CSTA 3PUCA 1ACCA 4MMZB 3VQ2C 1XZWA 5KS9A 3VFNA 2CMRL 4OW6A 2CHDA 1S7VB 3JSSA 4FHJA 4JFHD 4RAHA 3RU8H 4WI6A 2XG4B 1J1PL 1QEWB 5GS1B 4GG6E 3IKKA 1NGXA 4R4NC 4LOFA 3WNPA 2WSDA 4PRHE 4IMKA 1DANU 5J4MA 3B9EA 3T4YB 5A2JH 5IB5B 1BXUA 1RL1A 4UILL 5DYOB 5C0NC 3Q8EA 1RZJL 4NC2B 4YSPA 4CC1A 2LVCA 2FLRT 4K7PY 1AHMA 5B39B 4H4NA 4MKMA 2Z7WA 3K0YA 2B0SL 4B9KC 2WLZA 1NCCL 4ODSL 2G5UA 1WT5A 1XL4A 5I1EH 2BC4B 4XBEL 1UFGA 2XZCL 3D4CA 3MZGB 3LS4L 4LL4A 3R7QA 5FDWB 5DC4B 1MRCH 4GP4B 4RX4D 4ABQA 5AAPA 3QULA 1QTPA 2MTPA 2W8CA 3U2JA 3TBYA 3MPCA 1QTYT 1P5VA 1AG0A 2VYRE 3PWPD 2YAOA 5BS0D 2IVFC 1XCQA 4JZJA 4J3BA 3QUGA 1CQKA 3FKUS 3BCDA 4ZMVA 1WAPA 3VGGA 5C3TA 1D5MB 3ZTJH 4FNUA 4AXWB 3ARBC 2R23A 3W9DA 1ZJBA 1GAFH 2EEAA 3LKRA 3QDGD 1LLAA 1G1YA 4MS8D 4AV5A 5HHQB 5IKCB 1BFOA 4Z0BL 5C3IA 1E4XH 1NGZB 3LQAC 4J39A 3ARTA 1AI1L 3N0AA 3P0YH 5LGYA 1NZRA 1CPUA 1EGJL 4D0CB 5KYWA 2YK1L 1P6WA 1RD6A 3GLZA 1XIWB 3VXSB 2VISA 1FNHA 1QLRA 1XF3B 3OHXC 4FG2A 4XPAH 5HDRA 1X6LA 1EZUA 3X11A 2HKHH 1JI2A 4MMXB 2PYEE 1SJXA 1YAZA 4TSCL 4XH2B 4HPOL 1JPEA 1BEYH 4UOW1 5D7JC 4QF1B 4NQCB 1MFBL 3EUUA 3AT0A 5HI3C 4OZFG 4GIPD 4U1KA 3NK3A 2QVMA 3HZMA 3R4RA 4OV6F 2ZX5A 4Z95L 3MXVL 4PV8A 5F0JB 2JLPA 4N0YH 5KW9L 1FSKB 3SGJC 5BZDA 2EXWD 1SEBB 1J05B 3BPCB 5DEGA 3U7YH 2WQWA 4YJZL 2VM4A 3US1A 2YEZB 4OKDA 3NABH 4ISVB 1R0AH 2WO3B 3MCG1 5E6IB 3NN8A 4X6DB 4Q4EA 4L4TE 1EVTC 5A2CA 5DHDA 5KSAB 3KBFA 4LK4A 3RUGE 1N5YL 4GRWF 4LAJH 4TPRH 4U33A 3MREA 4BK5A 3VXSE 2Y7OA 3LNDA 5GGSB 4CBPA 2R29H 4OI8A 1TVDA 4YQXL 4FQ1L 2W9EL 3KVPA 1W16A 1MF2L 3U4KA 3LB6C 2ADFL 3WN6A 1GZQA 1ROCA 3FUEA 35C8L 5MHSE 4P5TC 4PIRF 2NZ1A 4BSWA 4V1DB 1GOGA 1MCOH 5MEOA 2EO7A 2K7PA 4KVCL 5DS2A 3ZBMA 1AXIB 4OVVA 1E9QA 1NPUA 3PL6B 4I88A 3ALPA 2ZONA 5DEFA 4NQEB 3WTXA 4L29A 4BUGA 4KRPC 4KHTH 3S5YA 4MNGE 4K3DH 4RFNC 1XH1A 1IKNA 4QRBA 1KIQB 4ZMWA 3QFDB 3F5WA 3RWCA 5AW0B 4FF9A 4MAYB 3HAEB 4L3AA 1CDHA 1JAEA 1ASQA 4NNXB 1RIHL 4UOZA 1Z7JA 3GPSA 3PHQB 3SDXB 2XFGB 5FUZH 3IJSB 1BZDA 1RP9A 4HLZG 4Z78B 4S0TD 2E7LC 5BV7H 2YA0A 3U82B 5TK2A 5EZJA 4U1HB 3BO8B 5D2NB 3MBED 4POYA 4ZUSB 1GKEA 1QWUA 3UBFA 1YY8A 4CC0A 1SXSA 4I18C 4IEFB 2OMWB 2BOBA 3KLQA 4G6AD 4UQ2B 4Y88A 2G9KA 1IM3A 2EE9A 1K6QL 3QQ9C 3PLYA 4OLXH 1HQRA 2ZXWB 4L48A 5D5ME 4XVTH 2YAEA 3V4PA 1Q94B 4K9EH 2G9HB 1ZIBA 4XBPA 3THML 1MHEA 2AI0L 1RHHB 1YMHA 4KX8A 3MV9B 4CMHC 4QHUA 3IBOA 3K1KC 1ZT4B 1QYGL 3KBEA 3WELA 2DQCL 2YSTA 4PUBH 5I15L 1KCSH 2YMOA 4I77H 5F72S 3EH2A 2WKLA 4CILA 3CFKA 3F6IA 3WHE0 4KDVA 3C9NA 3P3RA 4DOHB 4R4ND 4ELMA 2VLKB 3ULVF 4U7KA 3VXMD 3QJZA 5D2NE 5C0ND 5HYQA 3RI5F 2CDFA 3F12A 2AJSL 2O6EA 2E4FA 1EERB 4ZSOB 1NLBL 4NZFA 1NCNA 2D7NA 1U33A 1CZ8L 1CT8B 5D7IB 1BZOA 1U8HB 3IMRA 3JV6B 4V33A 4F8LA 1AFVL 4Z7UB 4OZGF 1DEEA 3WEMA 2AQRA 3OR6B 4G1EA 2NX5D 1JFHA 5D70L 3QYMA 3QR0A 4EZLA 3F00A 2DIBA 5AW4B 3SO3B 4OJEH 3DK2A 2NLJB 5I18L 2LLNA 4K94H 3I02B 2OL3H 3ETTA 4GLRI 4OFDA 3QEGH 3QWOB 5F71A 4AKQA 4L4VB 4DKFH 3E0GA 5I1HH 3NCWA 5TF1L 2WGXA 3ARBD 5D71L 2Y7QA 4JFQB 2ESVA 3MRCA 5DK3A 3GSNL 3K6SA 2VLKE 1ZTXH 3N06B 2X05A 2Z3FA 1NA8A 4GQZA 3FT4B 2C3VA 4GRWH 3SQRA 1OOWA 2R8SH 3L3OA 4P2OB 4PJCA 2X2JA 5CSBA 2DMKA 3CFJB 2V5SA 4AUYA 3P0VL 5KSVA 1CDUA 1CTOA 1A0QH 3SYCA 5ID1B 2P26A 5IQLA 1E9PA 4OM0H 1P5UC 3JBG7 5D7IE 3DI2B 3GHBL 1FO0A 3PREA 3MUZ1 3W1ZA 2J88L 3BAEH 3S5LA 4YHOL 4QNPE 1AQDA 2X9YA 5D7JD 3BLPX 3PJNA 3EFFB 1I8UA 5IIEB 3V0DA 3SSGA 2K45A 4WWID 2AJ3B 1J8HB 1G6RL 3BFQG 1CU4L 4N0FA 1YVLA 5C70A 3GXMA 5INCB 1XGQB 4RFOL 4FXGB 3HR6A 3F3HA 1F4AA 5HYSB 2BPBA 4HXAH 1F6FB 1WEJL 1XTMA 2GAZB 1GYUA 5F1NB 4HJGA 4YXKL 5CCHE 1DEDA 1R46A 2GFBA 4UNTA 5E4IA 4PJBF 4H7VA 4F37K 4UV7L 1FNAA 3KVDD 1SBBA 4A2DA 1JD9A 2LHAA 1KJVB 1FG9C 3LB6D 3WN5C 2Y7LA 5DMKA 4J8RB 5ACZA 2OR9L 4Q8BA 4OZIA 4JFED 2R15A 4P5TD 4F5CA 5BMFH 4PJDA 1WT5C 4H2CA 4FQLL 2WLMA 1I1AB 2F1EA 1QLEH 1O9ZA 1P1ZB 4KRPD 2J6EA 2ZX9A 5I5RA 1A6PA 3C60B 4HPYH 3OMNB 1HOCB 4TUJB 1S7XB 3KCPB 4M4RA 2VW6A 4UQ3B 3VD7A 3L08A 1B0WA 1F11B 4BFNA 1XZ0B 3REWB 2BFGA 2FO4A 4K8RC 5CU5A 3TCLB 4WWKC 5C08A 4B50A 3CN1A 1CDGA 4TQHA 1KN2H 1BXVA 3N9GH 2X1PA 3UIZA 3KMDA 3QT2A 3BT0A 5L0QC 3IYLW 3ULVH 1HHKA 5IB2A 4X4XA 4OZFH 2D0GA 5F1IB 2A0LC 2PPCA 3BZ4A 4G8FB 2YAPA 4R83A 2NSXA 1RZIB 3HNSH 3QPQD 4DKEH 3FRPB 3T8MA 2K8MA 5BRZE 5F9DC 2QQLH 3NTCL 4RGMC 4XO9A 2C9SA 3L4VA 4PS3A 3BKJL 3GRWA 1T5KA 1AZZC 1KPRB 4HIJB 3X12B 1SLUA 2VO8A 4AEIL 1UQSB 2Q8BL 3QQ9D 4OLYL 3SEPA 2YQ3A 3VFPA 2X4OB 1KC5H 1VPOL 2VDOH 4TOYH 3BP5A 1F3RB 1TFHA 5DC0A 3RL2A 3BRFA 3TNMB 1C8QA 3QORC 4JFSA 3SJVD 1PKQE 2XV2A 3KEDA 4XO3A 5EA0L 4DPBX 3RNQB 4KMTL 3STZA 2JCWA 2A6KA 1OP3H 2CHZA 4G5ZH 5CEZL 2VDRB 5J6HA 3ABKB 2V3DA 4XNAA 1PF3A 4JO3H 4KK5C 3A0OA 3GD1C 1NCOA 4URKA 4P5MA 1FRGH 1G7PA 5EC1B 3VXUA 2KYIA 4W9DC 4YFDB 3VFUB 3VI3F 5DDHA 3W9EA 2WM0A 4J3OC 2Z7UA 3R7RA 3SGKC 5IB3A 4GFTB 4L5FL 1AANA 5ESQA 1ZANL 3DJ9A 1NAKH 2I9LA 2R2CA 4XP5H 1TO4A 4JO5A 2DQ6A 2QJDA 1OD7A 3NACH 5DD6A 4F2MA 1HEHC 2OX5A 3ARDA 3UO1L 5LXGH 3IVKB 1ZSDA 4KI5D 2VL5B 2P80D 2NY7H 3CFQA 4P9HC 5BS0B 3SGDH 4WDIB 1IAII 2ZG1A 5ELIA 3T4AB 2XQYA 4HLZH 2Q6WA 1YYMH 1TJMA 4X42A 4UYQA 2ATKB 1P7HL 3VG0L 3PJSA 2BS9A 4H8HA 4FKKA 4AJYV 1IKNC 4N0UB 3QB7C 2YFOA 2F9BT 3KDMB 1KNOA 3F62A 4TVSa 2J57A 1JRHI 3OKDA 3CXHJ 1G1OA 4M5YL 2XZAL 2GTWA 5DMIL 3JVGA 5CGTA 3WFCL 3KPQA 2EIBA 3BJ91 3EO0B 3PWLB 4EO5A 1E2ZA 1F41A 2GBUA 2P28B 1PDKB 2R1WB 4H0HB 4FZ8H 5GRJH 4DERA 2EDRA 4LHQB 1WIUA 4CNIB 1TU2A 4Z1PA 3MNMA 4LSRL 1FAKT 1DVTA 3RGVA 1WA1X 1XGPA 4GKZA 2BIIA 4DVRH 3EYVB 3S9DB 2QPEB 4HUUB 1LWRA 3EHBB 1U3YA 3LDBB 2RIKA 5BO1H 2FX7H 3H6AA 2OMTA 4HSAC 5DVLA 5FHBH 2B7DT 4LEOA 2CMRH 4A7GA 3VD5A 1WHPA 2FNWA 3UTTE 1DUZB 4Z7VE 4GI6A 1HZLA 3ZZLA 5IUCA 4AYDC 3OB0K 4Z7OF 2YD7A 5B38A 1J1PH 4X4KA 2DQMA 4IKJA 4MMYA 3MUGA 2CXGA 3GT6A 3R06A 2H45A 2AK4B 3GUTA 1GTFA 3E6FA 2VC2B 4UILH 2D3JA 1RZJH 1A1OB 3QUMA 5EF0A 1FN4A 3EYFB 5HHVL 4OD2A 1JXKA 1R3IL 3KPPA 4W4OA 2B0SH 4I8DA 2FWOB 2BVQA 1T3FA 1NCCH 2P8MA 3CUPB 2OMUA 1EQWA 1LDPH 3D4GA 4FCHA 1UB5B 2LV4A 4XBEH 2BW5A 5I0DA 4TMPA 1U4FA 2GT9A 3LS4H 4FQHB 5HDBB 2CDEA 1F58L 2I25N 3RBGA 1FORL 1PG7W 2WWKO 4Y8DC 3U9PL 4BA8A 4AQEB 3O41B 3PNWA 2AQ3A 3DPBB 1UT2A 2R0WL 4F15C 4YZFE 4NJ9L 3WNLA 1MRDL 3QXWA 4X6BA 3WBDA 1URZA 1N59A 4ETYA 3W5NA 3UTSD 1IGJB 1BZ9A 1Z5LB 2AK4E 2AQSA 4TUOB 2VMEA 4Z0BH 2ZJSL 3ZQXA 4OAWB 3JWDL 2PXYB 4IRJA 5CSZA 4K8RD 1T0NA 3QUXB 4WWKD 2DH3A 2H9GB 2YK1H 1Y7VA 4G7QB 5ICXB 5EIIA 4ZT1A 1KXQE 2IWGA 1G0YR 2YOCA 3CZLA 4YHIB 4KPHL 3SO5A 5HDBE 3UTPE 1WWBX 4M3HA 1ACXA 4PGBB 2J1XA 1XB6A 2QLYA 5IMKB 1VAHA 4TSCH 1KG0A 2A0LD 5DJCA 3TZVB 1BOGA 2FT6A 2IXQB 2Z31B 4HPOH 1WGOA 3F83A 4GRLB 1FBIL 5D7LB 5JMRA 3X3FL 2Y0SA 4WO4A 3NFSL 2LU3A 3BH8A 1G7MB 3D09A 3KLAA 3B3BA 3VXOA 2M26A 3MXVH 5A2FA 1TKWA 4HWUA 3UZVA 5KW9H 4IRSB 4XOBA 3V4UL 3OKLA 4WUUA 1SOXA 3UH8A 3BP7B 1R24A 2CO4A 2BOCA 3QORD 4GMTL 5T1MB 5KSBF 1CGYA 4F3FB 3MGTB 2XT1B 2EDYA 3VA2C 1ETJA 1A66A 3LVTA 1N5YH 1NAMA 2ZSVA 1YEKL 3OJMB 4IRZA 2P42B 4KK5D 4LZKA 4MD4B 1RZKC 4FQ1H 3IB4A 2W9EH 4D9RE 1G9ML 1GC1C 1MF2H 2P5WB 3OZKA 4J3OD 2ADFH 4ELKB 4CA4A 5FA4A 3SYPA 1L5GB 5EU3A 4HX1A 2AJZA 2AXWA 4OBRA 1F45A 2HKAA 2HT2C 4KVCH 5D7LE 5IQOA 4FG0A 1QP1A 4UMSA 4Y2DA 4O9HL 4FNRA 4MTMA 2DIJA 2WAQA 2XSKA 1QACA 1M71A 5C9JB 3FL7A 4JW3A 3GSWA 4MD0A 3R18A 4WTXA 3VQLA 5C0IB 2ORBL 3KBHE 4G9DB 4EOWL 1V54B 1BZEA 1RIHH 2OYPA 1DL7L 2QSQA 1UA6H 2B8OT 1TXKA 3IRPX 3QWRA 4P9ML 3VVWA 4HUVA 2VXVL 1RMFL 4JGMA 3DVGA 5DT1H 1IKFL 1MHHA 2CBPA 3VGFA 2NXYB 3FO1A 2YXFA 4FNTA 1OTUC 4JRYB 3APDA 2J1ZA 5ACMA 2OCJA 4MLSA 2EDTA 3ZJAA 2BNRE 4HAKA 1KWKA 1CDJA 1M7UA 2E76C 3HEIB 3OHXB 1SUHA 4M9OA 5E00A 5B4MC 1AXSB 1J88A 1QR4A 3MRBA 1K6QH 2EEFA 3WE6B 8FABA 4LBEB 4Q9RH 5CM1A 2XFXA 4PREB 4HJSA 4LVNC 1CDCA 1T0PB 3VSVA 4PJEA 1TJIL 1YCSA 2H26B 2KI6A 4XCEB 1KTLA 1F97A 3C08L 3C8DA 1NIFA 5GJSL 3THMH 3ZDXB 2AI0H 1GHFL 5LQBH 4WGWB 5DRNB 5H35B 5CR1A 1QYGH 3KPTA 2XCMC 3NG5A 3ZDWA 3OMZA 4ZMZA 1JL8A 2Z64C 1RZPA 1O6SB 1ETA1 3WEBA 3VW3H 5FYKD 5EDSA 1CB4A 2ZX7A 3ZKMC 4JRYE 2VZ3A 4XOCA 4JDVB 4ESKA 5C0EA 3FONB 4DTGL 4XXDB 4MDJA 2AJSH 4N2EA 1ND0B 2GY7B 4JG1H 3TBSB 4AMKL 3EFOB 1CZ8H 3Q1SH 1JF1A 2C1OB 4FL4B 5FOBA 4E36A 3D18B 4NI3A 4TTDC 4HKJA 3LIZA 1AFVH 1H8LA 2JE8A 1PFOA 3Q2VA 2A83B 4X6FB 2VMFA 4H40A 5D70H 2QMJA 5K69A 4JPQA 1UWEL 2VDML 3CDYA 3DXAD 3PG2A 3MLSL 5HDQL 3ARDC 1TLMA 4J6IA 4P5RA 5I18H 4KTEH 2BSRA 5L6YL 3SKJL 3WNJA 2AXGA 1XXFC 4RGOL 4Y19B 5TF1H 4WRLA 5D71H 3VRIA 1TTFA 5IK3A 5AUMB 4YSCA 3IWUA 4JKMA 3H9HA