4HCQA

Crystal structure of glmu from mycobacterium tuberculosis in complex with glucosamine-1-phosphate
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4hcqA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4hcqA01
4Y7TA 1VPAA 4G3QA 4J09A 1S4PA 4BMAA 4KT7A 3U2VA 2Z86A 3OH1A 3V0LA 3R5CA 4JD0A 2I5KA 2I7BA 3I0FA 1ON6A 3CKNA 2QKXA 1ZJ3A 1LVWA 4LW6A 5ADXU 1ZJ0A 1K4VA 5ADXV 3V0OA 3C8VA 4Y7FA 3OAMA 1TVYA 2VXLA 1G1LA 1NQIB 1XZ6A 4DCLA 4IHFA 4Y7VA 1NKHB 4FRPA 3V0QA 4CJCA 2ZU8A 2Y4KA 1Z90A 1VGUA 2AM4A 1EZIA 3P1BA 2QH5A 1FOAA 3EE5A 3U2XA 3KWEA 3EH0A 4M2BA 4AYLA 3DK5A 1H5RA 1H7HA 3VBIA 4M9CA 2RJ6A 1ZCUA 1XATA 4G87A 2YCMA 1KRRA 2FYAA 1IINA 1INIA 4CVHA 1GX0A 4E79A 4P02A 2RJ1A 1I52A 2AQ9A 5DEMA 1INJA 3Q7UA 2BO7A 4HO0A 4KC2A 1NF5B 2AECA 3LW6A 2WGZA 2YQCA 4EEOA 2FFVA 5CQOA 1R82A 3I3XA 4KC4A 2AGDA 5C4FA 1GQCA 2XWMA 3R5BA 2WEEA 3V8YA 3IXCA 1JVDA 3TISA 4YS8A 1FGGA 2OI5A 1LZ7A 1MR7A 3BXYA 2A8UA 4HUSA 5C1GA 5E3RA 1HM9A 3K8DA 4C2SA 3U0YA 1KHRA 4DECA 3GUEA 1V67A 2X60A 1FWYA 3SX8A 3Q1XA 3R1WA 1H4DA 3TIOA 2YQJA 1OQMB 4XWIA 1KK4A 2IU9A 2I5EA 3EEVA 3V90A 5EIYA 2O1GA 3ZLKA 1FO8A 2OI7A 1LZJA 1H3MA 2XMHA 1GWVA 1GX4A 1XHBA 5C49A 1QRLA 3OKRA 3Q4SA 2RIZA 5DEPA 4EGGA 1WVCA 2RIYA 4FRQA 2ICXA 4ASYA 5C3DA 4N6AA 4Y6NA 5DG3A 3BFPA 1NHEB 2RJ0A 3Q80A 5IDSA 3OC9A 1MC3A 4LW3A 5C48A 4ZDQA 3P47A 1FRWA 1LL2A 3R5AA 2FYBA 3DUVA 1V83A 1GWWA 4D0ZA 5AJOA 2GGOA 4HO2A 4R37A 5C4CA 2WAWA 1R7XA 4R36A 3PMOA 1JYKA 1JVGA 4EEAA 4BQHA 3K8EA 2ZU9A 1O7QA 5FTSA 4FROA 2V0LA 4HO6A 4IRPA 5C1LA 5AJNA 5U2KA 5C38A 4Y9XA 5L6VA 3FSYA 3FWWA 4UEGA 5C47A 3U2WA 4HZCA 1H7FA 2E8BA 2RJ4A 1H5SC 1PZYB 3F1YA 1TW1A 3JQYA 2WLEA 2P2OA 2Y4MA 2Y6PA 4EEMA 4ASJA 3E25A 1O0RA 1WT2A 1QGSA 3I0DA 3PKQA 4IHGA 1G97A 5CQLX 5FU8A 1ZCTA 5C8RA 4Y64A 2XWLA 3HL3A 1R81A 1H7QA 1V84A 2AE7A 2VS3A 3U0XA 1FXJA 2RJ9A 1G23A 3E26A 1MRLA 4FRHA 3T7MA 3D98A 2YQHA 4MNDA 4M4KA 3SX3A 3FSXA 3JUKA 3OH4A 1G9RA 1KQAA 1SSTA 1JYLA 4HO5A 1KK6A 5IDTA 4Y62A 3USRA 1ZI5A 1VICA 5FUHA 5CQMX 3HJJA 4G3SA 4EE4A 1MP3A 1VH1A 4EE5A 3OTZA 1LZ0A 4KXOA 4FRBA 1OCXA 2YC5A 1SSQA 1G0RA 5FV9A 5C4DA 2V0KA 3DJ4A 1FXOA 2JCLA 3ZGGA 5C3AA 1JV1A 3FTTA 3OH0A 4EE3A 3N9WA 4D48A 3BRKX 3FSBA 2X5SA 2WLFA 2Y7AA 4FQWA 4ISXA 1OMZA 3TQDA 4B4MA 3SXCA 4AYJA 4KNRA 1S4NA 5CMHA 4K6RA 2DPWA 3OH2A 2YC3A 3D5NA 1J2ZA 3IOJA 4KPZA 5C4EA 4E75A 3OTMA 1ZCYA 4FCUA 3NZ2A 3ECTA 1MR9A 1TDTA 1E5KA 1ZIZA 1HJJA 2JCKA 4HO4A 3D8VA 1H7GA 2YQSA 3T7OA 1O7OA 1V3WA 1H5SB 2RIXA 4HZDA 2PGVA 2ZU7A 3FOQA 1VGTA 4P00A 2VSHA 3CJ8A 2FYCB 2O1FA 3BSWA 1S80A 2BO6A 3BSSA 1H7TA 2Q4JA 2FKOA 1WT3A 3R0SA 1ZJPA 3RMWA 3SXEA 1QRGA 5AFUV 2P72A 2X5ZA 4G3PA 5L6SA 4KPXA 1HV9A 4HG6A 4NANA 3T7NA 5C3BA 2WLCA 1YP3A 2OEFA 4B5BA 2VSIA 3OU9A 2AH9A 3OGZA 3TDTA 3ZGFA 1MP5A 4GBPA 1H7LA 3RSBA 2IC7A 2V0JA 4HO8A 4IRQA 3MQGA 4MFGA 1G2VA 1LZIA 1TW5A 2RJ7A 1QWJA 1H4EA 3FS8A 1KRUA 1SS9A 1G3LA 1R7YA 2JF3A 1QQ0A 1EYRA 5C1HA 2FFUA 2QGIA 5F42A 1H5SA 1H7EA 1QG8A 4EEGA 3QVBA 2P6WA 3POLA 5DDTA 2AM3A 4FRAA 4DDZA 5JQQA 2V0IA 3OW5A 4EA7A 2W0WA 3V0MA 1NWGB 3CKJA 3OH3A 2W0VA 1R80A 2VHEA 2OI6A 2OEGA 2P73A 3PKPA 3JUJA 4JISA 1VZXA 4B42A 4EA8A 5FU0A 2D7RA 5EJZA 3T57A 3I0HA 2VXMA 1YP4A 4FREA 4MYBA 4B4GA 1VM8A 3RMVA 3MC4A 1V82A 4FRDA 1R7VA 1ZI3A 1QRMA 1LL3A 1FGXA 4FRMA 4Y6UA 4R7PA 3OUPA 1W55A 2APCA 2NPOA 3VBKA 1R7UA 1ZJ1A 4HO9A 1SSMA 2WVLA 1R7TA 2QIVX 1LL0A 2JCJA 1G95A 2BO8A 1ZI4A 4D11C 4KNXA 1KGQA 2PX7A 3I3AA 4FRLA 3VBNA 5FYEA 3JTJA 4AAWA 4N27A 3VBMA 3VBJA 3U2TA 4NAKA 3SRTA 4B2XA 3R3RA 1G93A 3SPTA 4B4BA 3I0EA 2UX8A 4HCQA 4H7OA 4E6TA 4M99A 3CKQA 4D0TA 1TZFA 2QIAA 1H5TB 1KK5A 3PNNA 3V0PA 3V0NA 1QRFA 1FO9A 1HJLA 5E3QA 3TK8A 2AM5A 3CGXA 4N69A 4KQLA 2JF2A 1ON8A 1G8OA 1WSZA 1VZTA 4IHHA 2RJ5A 2RJ8A 2NXVA 3BSYA 3R3IA 1PZTA 1FZWA 3CU0A 3GOSA 2XMEA 1THJA 1KGTA 5CQPA 5AJPA 5CQNX 5HS2A 3FSCA 3I0KA 4FCEA 2X65A 5CMJA 1H5SD 1VGZA 3U2UA 4B2WA 2A8WA 3KIAA 1ZDFA 1JV3A 2WLGA 2VFZA 2FY7A 1ZJ2A 3SXBA 5CMIA 2MZBA 2VD4A 2Z87A 3GVDA 4HURA 1H4CA 2V0HA 4CJ8A 2TDTA 5AFUU 3BCVA 4HO3A 4KC1A 3TWDA 1YP2A 3R8YA 1H5TA 3ZLLA 5FTVA 1XHDA 1WT0A 3EG4A 2WVKA 1VH3A 3TV0A 2WVMA 4HOCA 1KRVA 1S4OA 1ZJOA 2BO4A 2RITA 4CJBA 3ST8A 1FR9A 3I0CA 5E3PA 1YROB 3I0LA 4NAIA 3V91A 5J49A 2O1HA 3ZF8A 1LXAA 2XATA 1VZUA 2CU2A 3TZTA 1ZHJA 2AESA 4L41C 5BXCA 2PGYA 4EQYA 2RIJA 2Y4LA 1FR8A 5CMFX 1HM0A 3SXGA 3F1XA 2Y4JA 4Y63A 1QREA 4M2AA 4N6BA 5DDVA 2YESA 3IOHA 3MQHA 3R5DA 5EJ1A 3KWDA 4ECMA 3F1CA 4E1KA 1ZCVA 1QGQA 4NALA 4Y7UA 5CMGX 4Y7GA 3VBLA 1GQ9A 1ZDGA 3V4EA 1W57A 3SX5A 4ARWA 1KWSA 1FG5N 3SX7A 2GGQA 3I0IX 5IFYA 4E6UA 2FYDB 2WE9A 2IU8A 4B3UA 3V8ZA 4EVWA 1IIMA 3HSQA 5I1FA 3VBPA 4MZUA 1T3DA 2D0JA 4D11A 3NGWA 3I0JA 2VS5A 2IUAA 2WLDA 3R2WA 3CKVA 3I0GA 1WT1A 1VGWA 2D7IA 4KRVA 1ZI1A 4EABA 3SXAA 1HM8A 1O23B 3CKOA 1W77A 5C36A 5C4BA 3DHOA 4EA9A 3IGJA 4AA7A 4EAAA 2E3DA 3VNPA 4MYOA 1H5RB 1MP4A 1NMMB 3KWCA 1GA8A 2PA4A 3USQA 3IOIA 2VS4A 1OMXA 2JCOA 4DE7A 4J18A 4M98A 4M28A 2ICYA 4AC3A 3O3PA 3SXDA 2XWNA
chains in the Genus database with same CATH superfamily
4Y7TA 1VPAA 4G3QA 4J09A 1S4PA 4BMAA 4KT7A 3U2VA 2Z86A 3OH1A 3V0LA 3R5CA 4JD0A 2I5KA 2I7BA 3I0FA 1ON6A 3CKNA 2J0AA 2QKXA 1ZJ3A 1LVWA 4LW6A 5ADXU 1ZJ0A 1K4VA 5ADXV 3V0OA 3C8VA 4Y7FA 3OAMA 1TVYA 2VXLA 1G1LA 1NQIB 1XZ6A 4DCLA 4IHFA 4Y7VA 1NKHB 4FRPA 3V0QA 4O6MA 4CJCA 2ZU8A 2Y4KA 1Z90A 1VGUA 2AM4A 1EZIA 3P1BA 2QH5A 1FOAA 3EE5A 3U2XA 3KWEA 3EH0A 4M2BA 4AYLA 3DK5A 1H5RA 1M8NA 1H7HA 3VBIA 4M9CA 2RJ6A 1ZCUA 1XATA 4G87A 2YCMA 1KRRA 2FYAA 1IINA 1INIA 4CVHA 1GX0A 4E79A 4P02A 2RJ1A 1I52A 2AQ9A 5DEMA 1INJA 3Q7UA 2BO7A 4HO0A 4KC2A 4O6NA 1NF5B 2AECA 3LW6A 2WGZA 2YQCA 4EEOA 2FFVA 5CQOA 1R82A 3I3XA 4KC4A 2AGDA 5C4FA 1GQCA 2XWMA 3R5BA 2WEEA 3V8YA 3IXCA 1JVDA 3TISA 4YS8A 1FGGA 2OI5A 1LZ7A 2J0BA 1MR7A 3BXYA 2A8UA 4HUSA 5C1GA 5E3RA 1HM9A 3K8DA 4C2SA 3U0YA 1KHRA 4DECA 4FIXA 3GUEA 1V67A 2X60A 1FWYA 3SX8A 3Q1XA 3R1WA 1H4DA 3TIOA 2YQJA 1OQMB 4XWIA 1KK4A 2IU9A 2I5EA 3EEVA 3V90A 5EIYA 2O1GA 3ZLKA 1FO8A 2OI7A 1LZJA 1H3MA 2XMHA 1GWVA 1GX4A 1XHBA 5C49A 1QRLA 3OKRA 3Q4SA 2RIZA 5DEPA 1Z2FA 4EGGA 1WVCA 2RIYA 4FRQA 2ICXA 4ASYA 5C3DA 4N6AA 4Y6NA 5DG3A 3BFPA 1NHEB 2RJ0A 3Q80A 5IDSA 3OC9A 1MC3A 4LW3A 5C48A 4ZDQA 3P47A 1FRWA 1LL2A 4FIYA 3R5AA 2FYBA 3DUVA 1V83A 1GWWA 4D0ZA 5AJOA 2GGOA 4HO2A 4R37A 5C4CA 2WAWA 1R7XA 4R36A 3PMOA 1JYKA 1JVGA 4EEAA 4BQHA 3K8EA 2ZU9A 1O7QA 5FTSA 4FROA 2V0LA 4HO6A 4IRPA 5C1LA 5AJNA 5U2KA 5C38A 4Y9XA 5L6VA 3FSYA 3FWWA 4UEGA 5C47A 3U2WA 4HZCA 1H7FA 2E8BA 2RJ4A 1H5SC 1PZYB 3F1YA 1TW1A 3JQYA 2WLEA 2P2OA 2Y4MA 2Y6PA 4EEMA 4ASJA 3E25A 1O0RA 1WT2A 1QGSA 3I0DA 3PKQA 4IHGA 1G97A 5CQLX 5FU8A 1ZCTA 5C8RA 4Y64A 2XWLA 3HL3A 1R81A 1H7QA 1V84A 2AE7A 2VS3A 3U0XA 1FXJA 2RJ9A 1G23A 3E26A 1MRLA 4FRHA 3T7MA 3D98A 2YQHA 4MNDA 4M4KA 3SX3A 3FSXA 3JUKA 3OH4A 1G9RA 1KQAA 1SSTA 1JYLA 4HO5A 1KK6A 5IDTA 4Y62A 3USRA 1ZI5A 1VICA 5FUHA 5CQMX 3HJJA 4G3SA 4EE4A 1MP3A 1VH1A 4EE5A 3OTZA 1LZ0A 4KXOA 4FRBA 1OCXA 2YC5A 1SSQA 1G0RA 5FV9A 5C4DA 2V0KA 3DJ4A 1FXOA 2JCLA 3ZGGA 5C3AA 1JV1A 3FTTA 3OH0A 4EE3A 3N9WA 4D48A 3BRKX 3FSBA 2X5SA 2WLFA 2Y7AA 4FQWA 4ISXA 1OMZA 3TQDA 4B4MA 3SXCA 4AYJA 4KNRA 1S4NA 5CMHA 3OH2A 4K6RA 2C0NA 2DPWA 2YC3A 3D5NA 1J2ZA 3IOJA 4KPZA 5C4EA 4E75A 5D91A 3OTMA 1ZCYA 4FCUA 3NZ2A 3ECTA 5D92A 1MR9A 1TDTA 1E5KA 1ZIZA 1HJJA 2JCKA 4HO4A 3D8VA 1H7GA 2YQSA 3T7OA 1O7OA 1V3WA 1H5SB 2RIXA 4HZDA 2PGVA 2ZU7A 3FOQA 1VGTA 4P00A 2VSHA 3CJ8A 2FYCB 2O1FA 3BSWA 1S80A 2BO6A 3BSSA 1H7TA 2Q4JA 2FKOA 1WT3A 3R0SA 1ZJPA 3RMWA 3SXEA 1QRGA 5AFUV 2P72A 2X5ZA 4G3PA 5L6SA 4KPXA 1HV9A 4HG6A 4NANA 3T7NA 5C3BA 2WLCA 1YP3A 2OEFA 4B5BA 3OGZA 3OU9A 2AH9A 2VSIA 3TDTA 3ZGFA 1MP5A 4GBPA 1H7LA 3RSBA 2IC7A 2V0JA 4HO8A 4IRQA 3MQGA 4MFGA 1G2VA 1LZIA 1TW5A 2RJ7A 1QWJA 1H4EA 3FS8A 1KRUA 1SS9A 1G3LA 1R7YA 2JF3A 1QQ0A 1EYRA 5C1HA 2FFUA 2QGIA 5F42A 1H5SA 1H7EA 1QG8A 4MIXA 4EEGA 3QVBA 2P6WA 3POLA 5DDTA 2AM3A 4FRAA 4DDZA 5JQQA 2V0IA 3GQ9A 3OW5A 4EA7A 2W0WA 3V0MA 1NWGB 3CKJA 3OH3A 2W0VA 1R80A 2VHEA 2OI6A 2OEGA 2P73A 3PKPA 3JUJA 4JISA 1VZXA 4B42A 4EA8A 5FU0A 2D7RA 5EJZA 3T57A 3I0HA 2VXMA 1YP4A 4FREA 4MYBA 4B4GA 3GQ8A 1VM8A 3RMVA 3MC4A 1V82A 4FRDA 1R7VA 1ZI3A 1QRMA 1LL3A 1FGXA 4FRMA 4Y6UA 4R7PA 3OUPA 1W55A 2APCA 2NPOA 3VBKA 2VK9A 1R7UA 1ZJ1A 4HO9A 1SSMA 2WVLA 1R7TA 2QIVX 3GQAA 1LL0A 3SUCA 2JCJA 1G95A 2BO8A 4Q7CA 1ZI4A 4D11C 4KNXA 1KGQA 2PX7A 1L0SA 3I3AA 4FRLA 3VBNA 5FYEA 3JTJA 4AAWA 4N27A 3VBMA 3VBJA 3U2TA 4NAKA 3SRTA 4B2XA 3R3RA 1G93A 3SPTA 4B4BA 3I0EA 2UX8A 4HCQA 4H7OA 4E6TA 4M99A 3CKQA 4D0TA 1TZFA 2QIAA 1H5TB 1KK5A 3PNNA 3V0PA 3V0NA 1QRFA 1FO9A 1HJLA 5E3QA 3TK8A 2AM5A 3CGXA 4N69A 4KQLA 2JF2A 1ON8A 1G8OA 1WSZA 1VZTA 4IHHA 2RJ5A 2RJ8A 2NXVA 3BSYA 3R3IA 1PZTA 1FZWA 3CU0A 3GOSA 2XMEA 1THJA 1KGTA 5CQPA 5AJPA 5CQNX 5HS2A 3FSCA 3I0KA 4FCEA 2X65A 5CMJA 1H5SD 1VGZA 3U2UA 4B2WA 2A8WA 3KIAA 1ZDFA 1JV3A 2WLGA 2VFZA 2FY7A 1ZJ2A 3SXBA 5CMIA 2MZBA 2VD4A 2Z87A 3GVDA 4HURA 1H4CA 2V0HA 4CJ8A 2TDTA 5AFUU 3BCVA 4HO3A 4KC1A 3TWDA 1YP2A 3R8YA 1H5TA 3ZLLA 5FTVA 1XHDA 1WT0A 3EG4A 2WVKA 1VH3A 3TV0A 2WVMA 4HOCA 1KRVA 1S4OA 1ZJOA 2BO4A 2RITA 4CJBA 3ST8A 1FR9A 3I0CA 5E3PA 1YROB 3I0LA 4NAIA 3V91A 5J49A 2O1HA 3ZF8A 1LXAA 2XATA 1VZUA 2CU2A 3TZTA 1ZHJA 2AESA 4L41C 5BXCA 2PGYA 4EQYA 2RIJA 2Y4LA 1FR8A 5CMFX 1HM0A 3SXGA 3F1XA 2Y4JA 4Y63A 1QREA 4M2AA 4N6BA 5DDVA 2YESA 3IOHA 3MQHA 3R5DA 5EJ1A 3KWDA 4ECMA 3F1CA 4E1KA 1ZCVA 1QGQA 4NALA 4Y7UA 5CMGX 4Y7GA 3VBLA 1GQ9A 1ZDGA 3V4EA 1W57A 3SX5A 4ARWA 1KWSA 1N4IA 1FG5N 3SX7A 2GGQA 3I0IX 1EWWA 5IFYA 4E6UA 2FYDB 2WE9A 2IU8A 4B3UA 3V8ZA 4EVWA 1IIMA 3HSQA 5I1FA 3VBPA 4MZUA 1T3DA 2D0JA 4D11A 3NGWA 3I0JA 2VS5A 2IUAA 2WLDA 3R2WA 3CKVA 3I0GA 1WT1A 1VGWA 2D7IA 4KRVA 1ZI1A 4EABA 3SXAA 1HM8A 1O23B 3CKOA 1W77A 5C36A 5C4BA 3DHOA 4EA9A 3IGJA 4AA7A 4EAAA 2E3DA 3VNPA 4MYOA 1H5RB 1MP4A 1NMMB 3KWCA 1GA8A 3GQ7A 2PA4A 3USQA 3IOIA 2VS4A 1OMXA 2JCOA 4DE7A 4J18A 4M98A 4M28A 2ICYA 4AC3A 3O3PA 3SXDA 2XWNA
chains in the Genus database with same CATH topology
4Y7TA 1VPAA 4G3QA 4J09A 1S4PA 4BMAA 4KT7A 3U2VA 2Z86A 3OH1A 3V0LA 3R5CA 4JD0A 2I5KA 2I7BA 3I0FA 1ON6A 3CKNA 2J0AA 2QKXA 1ZJ3A 1LVWA 4LW6A 5ADXU 1ZJ0A 1K4VA 5ADXV 3V0OA 3C8VA 4Y7FA 3OAMA 1TVYA 2VXLA 1G1LA 1NQIB 1XZ6A 4DCLA 4IHFA 4Y7VA 1NKHB 4FRPA 3V0QA 4O6MA 4CJCA 2ZU8A 2Y4KA 1Z90A 1VGUA 2AM4A 1EZIA 3P1BA 2QH5A 1FOAA 3EE5A 3U2XA 3KWEA 3EH0A 4M2BA 4AYLA 3DK5A 1H5RA 1H7HA 3VBIA 4M9CA 2RJ6A 1ZCUA 1XATA 4G87A 2YCMA 1KRRA 2FYAA 1IINA 1INIA 4CVHA 1GX0A 4E79A 4P02A 2RJ1A 1I52A 2AQ9A 5DEMA 1INJA 3Q7UA 2BO7A 4HO0A 4KC2A 4O6NA 1NF5B 2AECA 3LW6A 2WGZA 2YQCA 4EEOA 2FFVA 5CQOA 1R82A 3I3XA 4KC4A 2AGDA 5C4FA 1GQCA 2XWMA 3R5BA 2WEEA 3V8YA 3IXCA 1JVDA 3TISA 4YS8A 1FGGA 2OI5A 1LZ7A 2J0BA 1MR7A 3BXYA 2A8UA 4HUSA 5C1GA 5E3RA 1HM9A 3K8DA 4C2SA 3U0YA 1KHRA 4DECA 4FIXA 3GUEA 1V67A 2X60A 1FWYA 3SX8A 3Q1XA 3R1WA 1H4DA 3TIOA 2YQJA 1OQMB 4XWIA 1KK4A 2IU9A 2I5EA 3EEVA 3V90A 5EIYA 2O1GA 3ZLKA 1FO8A 2OI7A 1LZJA 1H3MA 2XMHA 1GWVA 1GX4A 1XHBA 5C49A 1QRLA 3OKRA 3Q4SA 2RIZA 5DEPA 4EGGA 1WVCA 2RIYA 4FRQA 2ICXA 4ASYA 5C3DA 4N6AA 4Y6NA 5DG3A 3BFPA 1NHEB 2RJ0A 3Q80A 5IDSA 3OC9A 1MC3A 4LW3A 5C48A 4ZDQA 3P47A 1FRWA 1LL2A 4FIYA 3R5AA 2FYBA 3DUVA 1V83A 1GWWA 4D0ZA 5AJOA 2GGOA 4HO2A 4R37A 5C4CA 2WAWA 1R7XA 4R36A 3PMOA 1JYKA 1JVGA 4EEAA 4BQHA 3K8EA 2ZU9A 1O7QA 5FTSA 4FROA 2V0LA 4HO6A 4IRPA 5C1LA 5AJNA 5U2KA 5C38A 4Y9XA 5L6VA 3FSYA 3FWWA 4UEGA 5C47A 3U2WA 4HZCA 1H7FA 2E8BA 2RJ4A 1H5SC 1PZYB 3F1YA 1TW1A 3JQYA 2WLEA 2P2OA 2Y4MA 2Y6PA 4EEMA 4ASJA 3E25A 1O0RA 1WT2A 1QGSA 3I0DA 3PKQA 4IHGA 1G97A 5CQLX 5FU8A 1ZCTA 5C8RA 4Y64A 2XWLA 3HL3A 1R81A 1H7QA 1V84A 2AE7A 2VS3A 3U0XA 1FXJA 2RJ9A 1G23A 3E26A 1MRLA 4FRHA 3T7MA 3D98A 2YQHA 4MNDA 4M4KA 3SX3A 3FSXA 3JUKA 3OH4A 1G9RA 1KQAA 1SSTA 1JYLA 4HO5A 1KK6A 5IDTA 4Y62A 3USRA 1ZI5A 1VICA 5FUHA 5CQMX 3HJJA 4G3SA 4EE4A 1MP3A 1VH1A 4EE5A 3OTZA 1LZ0A 4KXOA 4FRBA 1OCXA 2YC5A 1SSQA 1G0RA 5FV9A 5C4DA 2V0KA 3DJ4A 1FXOA 2JCLA 3ZGGA 5C3AA 1JV1A 3FTTA 3OH0A 4EE3A 3N9WA 4D48A 3BRKX 3FSBA 2X5SA 2WLFA 2Y7AA 4FQWA 4ISXA 1OMZA 3TQDA 4B4MA 3SXCA 4AYJA 4KNRA 1S4NA 5CMHA 4K6RA 2DPWA 2C0NA 3OH2A 2YC3A 3D5NA 1J2ZA 3IOJA 4KPZA 5C4EA 4E75A 5D91A 3OTMA 1ZCYA 4FCUA 3NZ2A 3ECTA 5D92A 1MR9A 1TDTA 1E5KA 1ZIZA 1HJJA 2JCKA 4HO4A 3D8VA 1H7GA 2YQSA 3T7OA 1O7OA 1V3WA 1H5SB 2RIXA 4HZDA 2PGVA 2ZU7A 3FOQA 1VGTA 4P00A 2VSHA 3CJ8A 2FYCB 2O1FA 3BSWA 1S80A 2BO6A 3BSSA 1H7TA 2Q4JA 2FKOA 1WT3A 3R0SA 1ZJPA 3RMWA 3SXEA 1QRGA 5AFUV 2P72A 2X5ZA 4G3PA 5L6SA 4KPXA 1HV9A 4HG6A 4NANA 3T7NA 5C3BA 2WLCA 1YP3A 2OEFA 4B5BA 2VSIA 3OU9A 2AH9A 3OGZA 3TDTA 3ZGFA 1MP5A 4GBPA 1H7LA 3RSBA 2IC7A 2V0JA 4HO8A 4IRQA 3MQGA 4MFGA 1G2VA 1LZIA 1TW5A 2RJ7A 1QWJA 1H4EA 3FS8A 1KRUA 1SS9A 1G3LA 1R7YA 2JF3A 1QQ0A 1EYRA 5C1HA 2FFUA 2QGIA 5F42A 1H5SA 1H7EA 1QG8A 4MIXA 4EEGA 3QVBA 2P6WA 3POLA 5DDTA 2AM3A 4FRAA 4DDZA 5JQQA 2V0IA 3OW5A 4EA7A 2W0WA 3V0MA 1NWGB 3CKJA 3OH3A 2W0VA 1R80A 2VHEA 2OI6A 2OEGA 2P73A 3PKPA 3JUJA 4JISA 1VZXA 4B42A 4EA8A 5FU0A 2D7RA 5EJZA 3T57A 3I0HA 2VXMA 1YP4A 4FREA 4MYBA 4B4GA 1VM8A 3RMVA 3MC4A 1V82A 4FRDA 1R7VA 1ZI3A 1QRMA 1LL3A 1FGXA 4FRMA 4Y6UA 4R7PA 3OUPA 1W55A 2APCA 2NPOA 3VBKA 2VK9A 1R7UA 1ZJ1A 4HO9A 1SSMA 2WVLA 1R7TA 2QIVX 1LL0A 2JCJA 1G95A 2BO8A 4Q7CA 1ZI4A 4D11C 4KNXA 1KGQA 2PX7A 3I3AA 4FRLA 3VBNA 5FYEA 3JTJA 4AAWA 4N27A 3VBMA 3VBJA 3U2TA 4NAKA 3SRTA 4B2XA 3R3RA 1G93A 3SPTA 4B4BA 3I0EA 2UX8A 4HCQA 4H7OA 4E6TA 4M99A 3CKQA 4D0TA 1TZFA 2QIAA 1H5TB 1KK5A 3PNNA 3V0PA 3V0NA 1QRFA 1FO9A 1HJLA 5E3QA 3TK8A 2AM5A 3CGXA 4N69A 4KQLA 2JF2A 1ON8A 1G8OA 1WSZA 1VZTA 4IHHA 2RJ5A 2RJ8A 2NXVA 3BSYA 3R3IA 1PZTA 1FZWA 3CU0A 3GOSA 2XMEA 1THJA 1KGTA 5CQPA 5AJPA 5CQNX 5HS2A 3FSCA 3I0KA 4FCEA 2X65A 5CMJA 1H5SD 1VGZA 3U2UA 4B2WA 2A8WA 3KIAA 1ZDFA 1JV3A 2WLGA 2VFZA 2FY7A 1ZJ2A 3SXBA 5CMIA 2MZBA 2VD4A 2Z87A 3GVDA 4HURA 1H4CA 2V0HA 4CJ8A 2TDTA 5AFUU 3BCVA 4HO3A 4KC1A 3TWDA 1YP2A 3R8YA 1H5TA 3ZLLA 5FTVA 1XHDA 1WT0A 3EG4A 2WVKA 1VH3A 3TV0A 2WVMA 4HOCA 1KRVA 1S4OA 1ZJOA 2BO4A 2RITA 4CJBA 3ST8A 1FR9A 3I0CA 5E3PA 1YROB 3I0LA 4NAIA 3V91A 5J49A 2O1HA 3ZF8A 1LXAA 2XATA 1VZUA 2CU2A 3TZTA 1ZHJA 2AESA 4L41C 5BXCA 2PGYA 4EQYA 2RIJA 2Y4LA 1FR8A 5CMFX 1HM0A 3SXGA 3F1XA 2Y4JA 4Y63A 1QREA 4M2AA 4N6BA 5DDVA 2YESA 3IOHA 3MQHA 3R5DA 5EJ1A 3KWDA 4ECMA 3F1CA 4E1KA 1ZCVA 1QGQA 4NALA 4Y7UA 5CMGX 4Y7GA 3VBLA 1GQ9A 1ZDGA 3V4EA 1W57A 3SX5A 4ARWA 1KWSA 1FG5N 3SX7A 2GGQA 3I0IX 5IFYA 4E6UA 2FYDB 2WE9A 2IU8A 4B3UA 3V8ZA 4EVWA 1IIMA 3HSQA 5I1FA 3VBPA 4MZUA 1T3DA 2D0JA 4D11A 3NGWA 3I0JA 2VS5A 2IUAA 2WLDA 3R2WA 3CKVA 3I0GA 1WT1A 1VGWA 2D7IA 4KRVA 1ZI1A 4EABA 3SXAA 1HM8A 1O23B 3CKOA 1W77A 5C36A 5C4BA 3DHOA 4EA9A 3IGJA 4AA7A 4EAAA 2E3DA 3VNPA 4MYOA 1H5RB 1MP4A 1NMMB 3KWCA 1GA8A 2PA4A 3USQA 3IOIA 2VS4A 1OMXA 2JCOA 4DE7A 4J18A 4M98A 4M28A 2ICYA 4AC3A 3O3PA 3SXDA 2XWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7T A;  1VPA A;  4G3Q A;  4J09 A;  1S4P A;  4BMA A;  4KT7 A;  3U2V A;  2Z86 A;  3OH1 A;  3V0L A;  3R5C A;  4JD0 A;  2I5K A;  2I7B A;  3I0F A;  1ON6 A;  3CKN A;  2QKX A;  1ZJ3 A;  1LVW A;  4LW6 A;  5ADX U;  1ZJ0 A;  1K4V A;  5ADX V;  3V0O A;  3C8V A;  4Y7F A;  3OAM A;  1TVY A;  2VXL A;  1G1L A;  1NQI B;  1XZ6 A;  4DCL A;  4IHF A;  4Y7V A;  1NKH B;  4FRP A;  3V0Q A;  4CJC A;  2ZU8 A;  2Y4K A;  1Z90 A;  1VGU A;  2AM4 A;  1EZI A;  3P1B A;  2QH5 A;  1FOA A;  3EE5 A;  3U2X A;  3KWE A;  3EH0 A;  4M2B A;  4AYL A;  3DK5 A;  1H5R A;  1H7H A;  3VBI A;  4M9C A;  2RJ6 A;  1ZCU A;  1XAT A;  4G87 A;  2YCM A;  1KRR A;  2FYA A;  1IIN A;  1INI A;  4CVH A;  1GX0 A;  4E79 A;  4P02 A;  2RJ1 A;  1I52 A;  2AQ9 A;  5DEM A;  1INJ A;  3Q7U A;  2BO7 A;  4HO0 A;  4KC2 A;  1NF5 B;  2AEC A;  3LW6 A;  2WGZ A;  2YQC A;  4EEO A;  2FFV A;  5CQO A;  1R82 A;  3I3X A;  4KC4 A;  2AGD A;  5C4F A;  1GQC A;  2XWM A;  3R5B A;  2WEE A;  3V8Y A;  3IXC A;  1JVD A;  3TIS A;  4YS8 A;  1FGG A;  2OI5 A;  1LZ7 A;  1MR7 A;  3BXY A;  2A8U A;  4HUS A;  5C1G A;  5E3R A;  1HM9 A;  3K8D A;  4C2S A;  3U0Y A;  1KHR A;  4DEC A;  3GUE A;  1V67 A;  2X60 A;  1FWY A;  3SX8 A;  3Q1X A;  3R1W A;  1H4D A;  3TIO A;  2YQJ A;  1OQM B;  4XWI A;  1KK4 A;  2IU9 A;  2I5E A;  3EEV A;  3V90 A;  5EIY A;  2O1G A;  3ZLK A;  1FO8 A;  2OI7 A;  1LZJ A;  1H3M A;  2XMH A;  1GWV A;  1GX4 A;  1XHB A;  5C49 A;  1QRL A;  3OKR A;  3Q4S A;  2RIZ A;  5DEP A;  4EGG A;  1WVC A;  2RIY A;  4FRQ A;  2ICX A;  4ASY A;  5C3D A;  4N6A A;  4Y6N A;  5DG3 A;  3BFP A;  1NHE B;  2RJ0 A;  3Q80 A;  5IDS A;  3OC9 A;  1MC3 A;  4LW3 A;  5C48 A;  4ZDQ A;  3P47 A;  1FRW A;  1LL2 A;  3R5A A;  2FYB A;  3DUV A;  1V83 A;  1GWW A;  4D0Z A;  5AJO A;  2GGO A;  4HO2 A;  4R37 A;  5C4C A;  2WAW A;  1R7X A;  4R36 A;  3PMO A;  1JYK A;  1JVG A;  4EEA A;  4BQH A;  3K8E A;  2ZU9 A;  1O7Q A;  5FTS A;  4FRO A;  2V0L A;  4HO6 A;  4IRP A;  5C1L A;  5AJN A;  5U2K A;  5C38 A;  4Y9X A;  5L6V A;  3FSY A;  3FWW A;  4UEG A;  5C47 A;  3U2W A;  4HZC A;  1H7F A;  2E8B A;  2RJ4 A;  1H5S C;  1PZY B;  3F1Y A;  1TW1 A;  3JQY A;  2WLE A;  2P2O A;  2Y4M A;  2Y6P A;  4EEM A;  4ASJ A;  3E25 A;  1O0R A;  1WT2 A;  1QGS A;  3I0D A;  3PKQ A;  4IHG A;  1G97 A;  5CQL X;  5FU8 A;  1ZCT A;  5C8R A;  4Y64 A;  2XWL A;  3HL3 A;  1R81 A;  1H7Q A;  1V84 A;  2AE7 A;  2VS3 A;  3U0X A;  1FXJ A;  2RJ9 A;  1G23 A;  3E26 A;  1MRL A;  4FRH A;  3T7M A;  3D98 A;  2YQH A;  4MND A;  4M4K A;  3SX3 A;  3FSX A;  3JUK A;  3OH4 A;  1G9R A;  1KQA A;  1SST A;  1JYL A;  4HO5 A;  1KK6 A;  5IDT A;  4Y62 A;  3USR A;  1ZI5 A;  1VIC A;  5FUH A;  5CQM X;  3HJJ A;  4G3S A;  4EE4 A;  1MP3 A;  1VH1 A;  4EE5 A;  3OTZ A;  1LZ0 A;  4KXO A;  4FRB A;  1OCX A;  2YC5 A;  1SSQ A;  1G0R A;  5FV9 A;  5C4D A;  2V0K A;  3DJ4 A;  1FXO A;  2JCL A;  3ZGG A;  5C3A A;  1JV1 A;  3FTT A;  3OH0 A;  4EE3 A;  3N9W A;  4D48 A;  3BRK X;  3FSB A;  2X5S A;  2WLF A;  2Y7A A;  4FQW A;  4ISX A;  1OMZ A;  3TQD A;  4B4M A;  3SXC A;  4AYJ A;  4KNR A;  1S4N A;  5CMH A;  4K6R A;  2DPW A;  3OH2 A;  2YC3 A;  3D5N A;  1J2Z A;  3IOJ A;  4KPZ A;  5C4E A;  4E75 A;  3OTM A;  1ZCY A;  4FCU A;  3NZ2 A;  3ECT A;  1MR9 A;  1TDT A;  1E5K A;  1ZIZ A;  1HJJ A;  2JCK A;  4HO4 A;  3D8V A;  1H7G A;  2YQS A;  3T7O A;  1O7O A;  1V3W A;  1H5S B;  2RIX A;  4HZD A;  2PGV A;  2ZU7 A;  3FOQ A;  1VGT A;  4P00 A;  2VSH A;  3CJ8 A;  2FYC B;  2O1F A;  3BSW A;  1S80 A;  2BO6 A;  3BSS A;  1H7T A;  2Q4J A;  2FKO A;  1WT3 A;  3R0S A;  1ZJP A;  3RMW A;  3SXE A;  1QRG A;  5AFU V;  2P72 A;  2X5Z A;  4G3P A;  5L6S A;  4KPX A;  1HV9 A;  4HG6 A;  4NAN A;  3T7N A;  5C3B A;  2WLC A;  1YP3 A;  2OEF A;  4B5B A;  2VSI A;  3OU9 A;  2AH9 A;  3OGZ A;  3TDT A;  3ZGF A;  1MP5 A;  4GBP A;  1H7L A;  3RSB A;  2IC7 A;  2V0J A;  4HO8 A;  4IRQ A;  3MQG A;  4MFG A;  1G2V A;  1LZI A;  1TW5 A;  2RJ7 A;  1QWJ A;  1H4E A;  3FS8 A;  1KRU A;  1SS9 A;  1G3L A;  1R7Y A;  2JF3 A;  1QQ0 A;  1EYR A;  5C1H A;  2FFU A;  2QGI A;  5F42 A;  1H5S A;  1H7E A;  1QG8 A;  4EEG A;  3QVB A;  2P6W A;  3POL A;  5DDT A;  2AM3 A;  4FRA A;  4DDZ A;  5JQQ A;  2V0I A;  3OW5 A;  4EA7 A;  2W0W A;  3V0M A;  1NWG B;  3CKJ A;  3OH3 A;  2W0V A;  1R80 A;  2VHE A;  2OI6 A;  2OEG A;  2P73 A;  3PKP A;  3JUJ A;  4JIS A;  1VZX A;  4B42 A;  4EA8 A;  5FU0 A;  2D7R A;  5EJZ A;  3T57 A;  3I0H A;  2VXM A;  1YP4 A;  4FRE A;  4MYB A;  4B4G A;  1VM8 A;  3RMV A;  3MC4 A;  1V82 A;  4FRD A;  1R7V A;  1ZI3 A;  1QRM A;  1LL3 A;  1FGX A;  4FRM A;  4Y6U A;  4R7P A;  3OUP A;  1W55 A;  2APC A;  2NPO A;  3VBK A;  1R7U A;  1ZJ1 A;  4HO9 A;  1SSM A;  2WVL A;  1R7T A;  2QIV X;  1LL0 A;  2JCJ A;  1G95 A;  2BO8 A;  1ZI4 A;  4D11 C;  4KNX A;  1KGQ A;  2PX7 A;  3I3A A;  4FRL A;  3VBN A;  5FYE A;  3JTJ A;  4AAW A;  4N27 A;  3VBM A;  3VBJ A;  3U2T A;  4NAK A;  3SRT A;  4B2X A;  3R3R A;  1G93 A;  3SPT A;  4B4B A;  3I0E A;  2UX8 A;  4HCQ A;  4H7O A;  4E6T A;  4M99 A;  3CKQ A;  4D0T A;  1TZF A;  2QIA A;  1H5T B;  1KK5 A;  3PNN A;  3V0P A;  3V0N A;  1QRF A;  1FO9 A;  1HJL A;  5E3Q A;  3TK8 A;  2AM5 A;  3CGX A;  4N69 A;  4KQL A;  2JF2 A;  1ON8 A;  1G8O A;  1WSZ A;  1VZT A;  4IHH A;  2RJ5 A;  2RJ8 A;  2NXV A;  3BSY A;  3R3I A;  1PZT A;  1FZW A;  3CU0 A;  3GOS A;  2XME A;  1THJ A;  1KGT A;  5CQP A;  5AJP A;  5CQN X;  5HS2 A;  3FSC A;  3I0K A;  4FCE A;  2X65 A;  5CMJ A;  1H5S D;  1VGZ A;  3U2U A;  4B2W A;  2A8W A;  3KIA A;  1ZDF A;  1JV3 A;  2WLG A;  2VFZ A;  2FY7 A;  1ZJ2 A;  3SXB A;  5CMI A;  2MZB A;  2VD4 A;  2Z87 A;  3GVD A;  4HUR A;  1H4C A;  2V0H A;  4CJ8 A;  2TDT A;  5AFU U;  3BCV A;  4HO3 A;  4KC1 A;  3TWD A;  1YP2 A;  3R8Y A;  1H5T A;  3ZLL A;  5FTV A;  1XHD A;  1WT0 A;  3EG4 A;  2WVK A;  1VH3 A;  3TV0 A;  2WVM A;  4HOC A;  1KRV A;  1S4O A;  1ZJO A;  2BO4 A;  2RIT A;  4CJB A;  3ST8 A;  1FR9 A;  3I0C A;  5E3P A;  1YRO B;  3I0L A;  4NAI A;  3V91 A;  5J49 A;  2O1H A;  3ZF8 A;  1LXA A;  2XAT A;  1VZU A;  2CU2 A;  3TZT A;  1ZHJ A;  2AES A;  4L41 C;  5BXC A;  2PGY A;  4EQY A;  2RIJ A;  2Y4L A;  1FR8 A;  5CMF X;  1HM0 A;  3SXG A;  3F1X A;  2Y4J A;  4Y63 A;  1QRE A;  4M2A A;  4N6B A;  5DDV A;  2YES A;  3IOH A;  3MQH A;  3R5D A;  5EJ1 A;  3KWD A;  4ECM A;  3F1C A;  4E1K A;  1ZCV A;  1QGQ A;  4NAL A;  4Y7U A;  5CMG X;  4Y7G A;  3VBL A;  1GQ9 A;  1ZDG A;  3V4E A;  1W57 A;  3SX5 A;  4ARW A;  1KWS A;  1FG5 N;  3SX7 A;  2GGQ A;  3I0I X;  5IFY A;  4E6U A;  2FYD B;  2WE9 A;  2IU8 A;  4B3U A;  3V8Z A;  4EVW A;  1IIM A;  3HSQ A;  5I1F A;  3VBP A;  4MZU A;  1T3D A;  2D0J A;  4D11 A;  3NGW A;  3I0J A;  2VS5 A;  2IUA A;  2WLD A;  3R2W A;  3CKV A;  3I0G A;  1WT1 A;  1VGW A;  2D7I A;  4KRV A;  1ZI1 A;  4EAB A;  3SXA A;  1HM8 A;  1O23 B;  3CKO A;  1W77 A;  5C36 A;  5C4B A;  3DHO A;  4EA9 A;  3IGJ A;  4AA7 A;  4EAA A;  2E3D A;  3VNP A;  4MYO A;  1H5R B;  1MP4 A;  1NMM B;  3KWC A;  1GA8 A;  2PA4 A;  3USQ A;  3IOI A;  2VS4 A;  1OMX A;  2JCO A;  4DE7 A;  4J18 A;  4M98 A;  4M28 A;  2ICY A;  4AC3 A;  3O3P A;  3SXD A;  2XWN A; 
#chains in the Genus database with same CATH topology
 4Y7T A;  1VPA A;  4G3Q A;  4J09 A;  1S4P A;  4BMA A;  4KT7 A;  3U2V A;  2Z86 A;  3OH1 A;  3V0L A;  3R5C A;  4JD0 A;  2I5K A;  2I7B A;  3I0F A;  1ON6 A;  3CKN A;  2J0A A;  2QKX A;  1ZJ3 A;  1LVW A;  4LW6 A;  5ADX U;  1ZJ0 A;  1K4V A;  5ADX V;  3V0O A;  3C8V A;  4Y7F A;  3OAM A;  1TVY A;  2VXL A;  1G1L A;  1NQI B;  1XZ6 A;  4DCL A;  4IHF A;  4Y7V A;  1NKH B;  4FRP A;  3V0Q A;  4O6M A;  4CJC A;  2ZU8 A;  2Y4K A;  1Z90 A;  1VGU A;  2AM4 A;  1EZI A;  3P1B A;  2QH5 A;  1FOA A;  3EE5 A;  3U2X A;  3KWE A;  3EH0 A;  4M2B A;  4AYL A;  3DK5 A;  1H5R A;  1M8N A;  1H7H A;  3VBI A;  4M9C A;  2RJ6 A;  1ZCU A;  1XAT A;  4G87 A;  2YCM A;  1KRR A;  2FYA A;  1IIN A;  1INI A;  4CVH A;  1GX0 A;  4E79 A;  4P02 A;  2RJ1 A;  1I52 A;  2AQ9 A;  5DEM A;  1INJ A;  3Q7U A;  2BO7 A;  4HO0 A;  4KC2 A;  4O6N A;  1NF5 B;  2AEC A;  3LW6 A;  2WGZ A;  2YQC A;  4EEO A;  2FFV A;  5CQO A;  1R82 A;  3I3X A;  4KC4 A;  2AGD A;  5C4F A;  1GQC A;  2XWM A;  3R5B A;  2WEE A;  3V8Y A;  3IXC A;  1JVD A;  3TIS A;  4YS8 A;  1FGG A;  2OI5 A;  1LZ7 A;  2J0B A;  1MR7 A;  3BXY A;  2A8U A;  4HUS A;  5C1G A;  5E3R A;  1HM9 A;  3K8D A;  4C2S A;  3U0Y A;  1KHR A;  4DEC A;  4FIX A;  3GUE A;  1V67 A;  2X60 A;  1FWY A;  3SX8 A;  3Q1X A;  3R1W A;  1H4D A;  3TIO A;  2YQJ A;  1OQM B;  4XWI A;  1KK4 A;  2IU9 A;  2I5E A;  3EEV A;  3V90 A;  5EIY A;  2O1G A;  3ZLK A;  1FO8 A;  2OI7 A;  1LZJ A;  1H3M A;  2XMH A;  1GWV A;  1GX4 A;  1XHB A;  5C49 A;  1QRL A;  3OKR A;  3Q4S A;  2RIZ A;  5DEP A;  1Z2F A;  4EGG A;  1WVC A;  2RIY A;  4FRQ A;  2ICX A;  4ASY A;  5C3D A;  4N6A A;  4Y6N A;  5DG3 A;  3BFP A;  1NHE B;  2RJ0 A;  3Q80 A;  5IDS A;  3OC9 A;  1MC3 A;  4LW3 A;  5C48 A;  4ZDQ A;  3P47 A;  1FRW A;  1LL2 A;  4FIY A;  3R5A A;  2FYB A;  3DUV A;  1V83 A;  1GWW A;  4D0Z A;  5AJO A;  2GGO A;  4HO2 A;  4R37 A;  5C4C A;  2WAW A;  1R7X A;  4R36 A;  3PMO A;  1JYK A;  1JVG A;  4EEA A;  4BQH A;  3K8E A;  2ZU9 A;  1O7Q A;  5FTS A;  4FRO A;  2V0L A;  4HO6 A;  4IRP A;  5C1L A;  5AJN A;  5U2K A;  5C38 A;  4Y9X A;  5L6V A;  3FSY A;  3FWW A;  4UEG A;  5C47 A;  3U2W A;  4HZC A;  1H7F A;  2E8B A;  2RJ4 A;  1H5S C;  1PZY B;  3F1Y A;  1TW1 A;  3JQY A;  2WLE A;  2P2O A;  2Y4M A;  2Y6P A;  4EEM A;  4ASJ A;  3E25 A;  1O0R A;  1WT2 A;  1QGS A;  3I0D A;  3PKQ A;  4IHG A;  1G97 A;  5CQL X;  5FU8 A;  1ZCT A;  5C8R A;  4Y64 A;  2XWL A;  3HL3 A;  1R81 A;  1H7Q A;  1V84 A;  2AE7 A;  2VS3 A;  3U0X A;  1FXJ A;  2RJ9 A;  1G23 A;  3E26 A;  1MRL A;  4FRH A;  3T7M A;  3D98 A;  2YQH A;  4MND A;  4M4K A;  3SX3 A;  3FSX A;  3JUK A;  3OH4 A;  1G9R A;  1KQA A;  1SST A;  1JYL A;  4HO5 A;  1KK6 A;  5IDT A;  4Y62 A;  3USR A;  1ZI5 A;  1VIC A;  5FUH A;  5CQM X;  3HJJ A;  4G3S A;  4EE4 A;  1MP3 A;  1VH1 A;  4EE5 A;  3OTZ A;  1LZ0 A;  4KXO A;  4FRB A;  1OCX A;  2YC5 A;  1SSQ A;  1G0R A;  5FV9 A;  5C4D A;  2V0K A;  3DJ4 A;  1FXO A;  2JCL A;  3ZGG A;  5C3A A;  1JV1 A;  3FTT A;  3OH0 A;  4EE3 A;  3N9W A;  4D48 A;  3BRK X;  3FSB A;  2X5S A;  2WLF A;  2Y7A A;  4FQW A;  4ISX A;  1OMZ A;  3TQD A;  4B4M A;  3SXC A;  4AYJ A;  4KNR A;  1S4N A;  5CMH A;  3OH2 A;  4K6R A;  2C0N A;  2DPW A;  2YC3 A;  3D5N A;  1J2Z A;  3IOJ A;  4KPZ A;  5C4E A;  4E75 A;  5D91 A;  3OTM A;  1ZCY A;  4FCU A;  3NZ2 A;  3ECT A;  5D92 A;  1MR9 A;  1TDT A;  1E5K A;  1ZIZ A;  1HJJ A;  2JCK A;  4HO4 A;  3D8V A;  1H7G A;  2YQS A;  3T7O A;  1O7O A;  1V3W A;  1H5S B;  2RIX A;  4HZD A;  2PGV A;  2ZU7 A;  3FOQ A;  1VGT A;  4P00 A;  2VSH A;  3CJ8 A;  2FYC B;  2O1F A;  3BSW A;  1S80 A;  2BO6 A;  3BSS A;  1H7T A;  2Q4J A;  2FKO A;  1WT3 A;  3R0S A;  1ZJP A;  3RMW A;  3SXE A;  1QRG A;  5AFU V;  2P72 A;  2X5Z A;  4G3P A;  5L6S A;  4KPX A;  1HV9 A;  4HG6 A;  4NAN A;  3T7N A;  5C3B A;  2WLC A;  1YP3 A;  2OEF A;  4B5B A;  3OGZ A;  3OU9 A;  2AH9 A;  2VSI A;  3TDT A;  3ZGF A;  1MP5 A;  4GBP A;  1H7L A;  3RSB A;  2IC7 A;  2V0J A;  4HO8 A;  4IRQ A;  3MQG A;  4MFG A;  1G2V A;  1LZI A;  1TW5 A;  2RJ7 A;  1QWJ A;  1H4E A;  3FS8 A;  1KRU A;  1SS9 A;  1G3L A;  1R7Y A;  2JF3 A;  1QQ0 A;  1EYR A;  5C1H A;  2FFU A;  2QGI A;  5F42 A;  1H5S A;  1H7E A;  1QG8 A;  4MIX A;  4EEG A;  3QVB A;  2P6W A;  3POL A;  5DDT A;  2AM3 A;  4FRA A;  4DDZ A;  5JQQ A;  2V0I A;  3GQ9 A;  3OW5 A;  4EA7 A;  2W0W A;  3V0M A;  1NWG B;  3CKJ A;  3OH3 A;  2W0V A;  1R80 A;  2VHE A;  2OI6 A;  2OEG A;  2P73 A;  3PKP A;  3JUJ A;  4JIS A;  1VZX A;  4B42 A;  4EA8 A;  5FU0 A;  2D7R A;  5EJZ A;  3T57 A;  3I0H A;  2VXM A;  1YP4 A;  4FRE A;  4MYB A;  4B4G A;  3GQ8 A;  1VM8 A;  3RMV A;  3MC4 A;  1V82 A;  4FRD A;  1R7V A;  1ZI3 A;  1QRM A;  1LL3 A;  1FGX A;  4FRM A;  4Y6U A;  4R7P A;  3OUP A;  1W55 A;  2APC A;  2NPO A;  3VBK A;  2VK9 A;  1R7U A;  1ZJ1 A;  4HO9 A;  1SSM A;  2WVL A;  1R7T A;  2QIV X;  3GQA A;  1LL0 A;  3SUC A;  2JCJ A;  1G95 A;  2BO8 A;  4Q7C A;  1ZI4 A;  4D11 C;  4KNX A;  1KGQ A;  2PX7 A;  1L0S A;  3I3A A;  4FRL A;  3VBN A;  5FYE A;  3JTJ A;  4AAW A;  4N27 A;  3VBM A;  3VBJ A;  3U2T A;  4NAK A;  3SRT A;  4B2X A;  3R3R A;  1G93 A;  3SPT A;  4B4B A;  3I0E A;  2UX8 A;  4HCQ A;  4H7O A;  4E6T A;  4M99 A;  3CKQ A;  4D0T A;  1TZF A;  2QIA A;  1H5T B;  1KK5 A;  3PNN A;  3V0P A;  3V0N A;  1QRF A;  1FO9 A;  1HJL A;  5E3Q A;  3TK8 A;  2AM5 A;  3CGX A;  4N69 A;  4KQL A;  2JF2 A;  1ON8 A;  1G8O A;  1WSZ A;  1VZT A;  4IHH A;  2RJ5 A;  2RJ8 A;  2NXV A;  3BSY A;  3R3I A;  1PZT A;  1FZW A;  3CU0 A;  3GOS A;  2XME A;  1THJ A;  1KGT A;  5CQP A;  5AJP A;  5CQN X;  5HS2 A;  3FSC A;  3I0K A;  4FCE A;  2X65 A;  5CMJ A;  1H5S D;  1VGZ A;  3U2U A;  4B2W A;  2A8W A;  3KIA A;  1ZDF A;  1JV3 A;  2WLG A;  2VFZ A;  2FY7 A;  1ZJ2 A;  3SXB A;  5CMI A;  2MZB A;  2VD4 A;  2Z87 A;  3GVD A;  4HUR A;  1H4C A;  2V0H A;  4CJ8 A;  2TDT A;  5AFU U;  3BCV A;  4HO3 A;  4KC1 A;  3TWD A;  1YP2 A;  3R8Y A;  1H5T A;  3ZLL A;  5FTV A;  1XHD A;  1WT0 A;  3EG4 A;  2WVK A;  1VH3 A;  3TV0 A;  2WVM A;  4HOC A;  1KRV A;  1S4O A;  1ZJO A;  2BO4 A;  2RIT A;  4CJB A;  3ST8 A;  1FR9 A;  3I0C A;  5E3P A;  1YRO B;  3I0L A;  4NAI A;  3V91 A;  5J49 A;  2O1H A;  3ZF8 A;  1LXA A;  2XAT A;  1VZU A;  2CU2 A;  3TZT A;  1ZHJ A;  2AES A;  4L41 C;  5BXC A;  2PGY A;  4EQY A;  2RIJ A;  2Y4L A;  1FR8 A;  5CMF X;  1HM0 A;  3SXG A;  3F1X A;  2Y4J A;  4Y63 A;  1QRE A;  4M2A A;  4N6B A;  5DDV A;  2YES A;  3IOH A;  3MQH A;  3R5D A;  5EJ1 A;  3KWD A;  4ECM A;  3F1C A;  4E1K A;  1ZCV A;  1QGQ A;  4NAL A;  4Y7U A;  5CMG X;  4Y7G A;  3VBL A;  1GQ9 A;  1ZDG A;  3V4E A;  1W57 A;  3SX5 A;  4ARW A;  1KWS A;  1N4I A;  1FG5 N;  3SX7 A;  2GGQ A;  3I0I X;  1EWW A;  5IFY A;  4E6U A;  2FYD B;  2WE9 A;  2IU8 A;  4B3U A;  3V8Z A;  4EVW A;  1IIM A;  3HSQ A;  5I1F A;  3VBP A;  4MZU A;  1T3D A;  2D0J A;  4D11 A;  3NGW A;  3I0J A;  2VS5 A;  2IUA A;  2WLD A;  3R2W A;  3CKV A;  3I0G A;  1WT1 A;  1VGW A;  2D7I A;  4KRV A;  1ZI1 A;  4EAB A;  3SXA A;  1HM8 A;  1O23 B;  3CKO A;  1W77 A;  5C36 A;  5C4B A;  3DHO A;  4EA9 A;  3IGJ A;  4AA7 A;  4EAA A;  2E3D A;  3VNP A;  4MYO A;  1H5R B;  1MP4 A;  1NMM B;  3KWC A;  1GA8 A;  3GQ7 A;  2PA4 A;  3USQ A;  3IOI A;  2VS4 A;  1OMX A;  2JCO A;  4DE7 A;  4J18 A;  4M98 A;  4M28 A;  2ICY A;  4AC3 A;  3O3P A;  3SXD A;  2XWN A; 
#chains in the Genus database with same CATH homology
 4Y7T A;  1VPA A;  4G3Q A;  4J09 A;  1S4P A;  4BMA A;  4KT7 A;  3U2V A;  2Z86 A;  3OH1 A;  3V0L A;  3R5C A;  4JD0 A;  2I5K A;  2I7B A;  3I0F A;  1ON6 A;  3CKN A;  2J0A A;  2QKX A;  1ZJ3 A;  1LVW A;  4LW6 A;  5ADX U;  1ZJ0 A;  1K4V A;  5ADX V;  3V0O A;  3C8V A;  4Y7F A;  3OAM A;  1TVY A;  2VXL A;  1G1L A;  1NQI B;  1XZ6 A;  4DCL A;  4IHF A;  4Y7V A;  1NKH B;  4FRP A;  3V0Q A;  4O6M A;  4CJC A;  2ZU8 A;  2Y4K A;  1Z90 A;  1VGU A;  2AM4 A;  1EZI A;  3P1B A;  2QH5 A;  1FOA A;  3EE5 A;  3U2X A;  3KWE A;  3EH0 A;  4M2B A;  4AYL A;  3DK5 A;  1H5R A;  1H7H A;  3VBI A;  4M9C A;  2RJ6 A;  1ZCU A;  1XAT A;  4G87 A;  2YCM A;  1KRR A;  2FYA A;  1IIN A;  1INI A;  4CVH A;  1GX0 A;  4E79 A;  4P02 A;  2RJ1 A;  1I52 A;  2AQ9 A;  5DEM A;  1INJ A;  3Q7U A;  2BO7 A;  4HO0 A;  4KC2 A;  4O6N A;  1NF5 B;  2AEC A;  3LW6 A;  2WGZ A;  2YQC A;  4EEO A;  2FFV A;  5CQO A;  1R82 A;  3I3X A;  4KC4 A;  2AGD A;  5C4F A;  1GQC A;  2XWM A;  3R5B A;  2WEE A;  3V8Y A;  3IXC A;  1JVD A;  3TIS A;  4YS8 A;  1FGG A;  2OI5 A;  1LZ7 A;  2J0B A;  1MR7 A;  3BXY A;  2A8U A;  4HUS A;  5C1G A;  5E3R A;  1HM9 A;  3K8D A;  4C2S A;  3U0Y A;  1KHR A;  4DEC A;  4FIX A;  3GUE A;  1V67 A;  2X60 A;  1FWY A;  3SX8 A;  3Q1X A;  3R1W A;  1H4D A;  3TIO A;  2YQJ A;  1OQM B;  4XWI A;  1KK4 A;  2IU9 A;  2I5E A;  3EEV A;  3V90 A;  5EIY A;  2O1G A;  3ZLK A;  1FO8 A;  2OI7 A;  1LZJ A;  1H3M A;  2XMH A;  1GWV A;  1GX4 A;  1XHB A;  5C49 A;  1QRL A;  3OKR A;  3Q4S A;  2RIZ A;  5DEP A;  4EGG A;  1WVC A;  2RIY A;  4FRQ A;  2ICX A;  4ASY A;  5C3D A;  4N6A A;  4Y6N A;  5DG3 A;  3BFP A;  1NHE B;  2RJ0 A;  3Q80 A;  5IDS A;  3OC9 A;  1MC3 A;  4LW3 A;  5C48 A;  4ZDQ A;  3P47 A;  1FRW A;  1LL2 A;  4FIY A;  3R5A A;  2FYB A;  3DUV A;  1V83 A;  1GWW A;  4D0Z A;  5AJO A;  2GGO A;  4HO2 A;  4R37 A;  5C4C A;  2WAW A;  1R7X A;  4R36 A;  3PMO A;  1JYK A;  1JVG A;  4EEA A;  4BQH A;  3K8E A;  2ZU9 A;  1O7Q A;  5FTS A;  4FRO A;  2V0L A;  4HO6 A;  4IRP A;  5C1L A;  5AJN A;  5U2K A;  5C38 A;  4Y9X A;  5L6V A;  3FSY A;  3FWW A;  4UEG A;  5C47 A;  3U2W A;  4HZC A;  1H7F A;  2E8B A;  2RJ4 A;  1H5S C;  1PZY B;  3F1Y A;  1TW1 A;  3JQY A;  2WLE A;  2P2O A;  2Y4M A;  2Y6P A;  4EEM A;  4ASJ A;  3E25 A;  1O0R A;  1WT2 A;  1QGS A;  3I0D A;  3PKQ A;  4IHG A;  1G97 A;  5CQL X;  5FU8 A;  1ZCT A;  5C8R A;  4Y64 A;  2XWL A;  3HL3 A;  1R81 A;  1H7Q A;  1V84 A;  2AE7 A;  2VS3 A;  3U0X A;  1FXJ A;  2RJ9 A;  1G23 A;  3E26 A;  1MRL A;  4FRH A;  3T7M A;  3D98 A;  2YQH A;  4MND A;  4M4K A;  3SX3 A;  3FSX A;  3JUK A;  3OH4 A;  1G9R A;  1KQA A;  1SST A;  1JYL A;  4HO5 A;  1KK6 A;  5IDT A;  4Y62 A;  3USR A;  1ZI5 A;  1VIC A;  5FUH A;  5CQM X;  3HJJ A;  4G3S A;  4EE4 A;  1MP3 A;  1VH1 A;  4EE5 A;  3OTZ A;  1LZ0 A;  4KXO A;  4FRB A;  1OCX A;  2YC5 A;  1SSQ A;  1G0R A;  5FV9 A;  5C4D A;  2V0K A;  3DJ4 A;  1FXO A;  2JCL A;  3ZGG A;  5C3A A;  1JV1 A;  3FTT A;  3OH0 A;  4EE3 A;  3N9W A;  4D48 A;  3BRK X;  3FSB A;  2X5S A;  2WLF A;  2Y7A A;  4FQW A;  4ISX A;  1OMZ A;  3TQD A;  4B4M A;  3SXC A;  4AYJ A;  4KNR A;  1S4N A;  5CMH A;  4K6R A;  2DPW A;  2C0N A;  3OH2 A;  2YC3 A;  3D5N A;  1J2Z A;  3IOJ A;  4KPZ A;  5C4E A;  4E75 A;  5D91 A;  3OTM A;  1ZCY A;  4FCU A;  3NZ2 A;  3ECT A;  5D92 A;  1MR9 A;  1TDT A;  1E5K A;  1ZIZ A;  1HJJ A;  2JCK A;  4HO4 A;  3D8V A;  1H7G A;  2YQS A;  3T7O A;  1O7O A;  1V3W A;  1H5S B;  2RIX A;  4HZD A;  2PGV A;  2ZU7 A;  3FOQ A;  1VGT A;  4P00 A;  2VSH A;  3CJ8 A;  2FYC B;  2O1F A;  3BSW A;  1S80 A;  2BO6 A;  3BSS A;  1H7T A;  2Q4J A;  2FKO A;  1WT3 A;  3R0S A;  1ZJP A;  3RMW A;  3SXE A;  1QRG A;  5AFU V;  2P72 A;  2X5Z A;  4G3P A;  5L6S A;  4KPX A;  1HV9 A;  4HG6 A;  4NAN A;  3T7N A;  5C3B A;  2WLC A;  1YP3 A;  2OEF A;  4B5B A;  2VSI A;  3OU9 A;  2AH9 A;  3OGZ A;  3TDT A;  3ZGF A;  1MP5 A;  4GBP A;  1H7L A;  3RSB A;  2IC7 A;  2V0J A;  4HO8 A;  4IRQ A;  3MQG A;  4MFG A;  1G2V A;  1LZI A;  1TW5 A;  2RJ7 A;  1QWJ A;  1H4E A;  3FS8 A;  1KRU A;  1SS9 A;  1G3L A;  1R7Y A;  2JF3 A;  1QQ0 A;  1EYR A;  5C1H A;  2FFU A;  2QGI A;  5F42 A;  1H5S A;  1H7E A;  1QG8 A;  4MIX A;  4EEG A;  3QVB A;  2P6W A;  3POL A;  5DDT A;  2AM3 A;  4FRA A;  4DDZ A;  5JQQ A;  2V0I A;  3OW5 A;  4EA7 A;  2W0W A;  3V0M A;  1NWG B;  3CKJ A;  3OH3 A;  2W0V A;  1R80 A;  2VHE A;  2OI6 A;  2OEG A;  2P73 A;  3PKP A;  3JUJ A;  4JIS A;  1VZX A;  4B42 A;  4EA8 A;  5FU0 A;  2D7R A;  5EJZ A;  3T57 A;  3I0H A;  2VXM A;  1YP4 A;  4FRE A;  4MYB A;  4B4G A;  1VM8 A;  3RMV A;  3MC4 A;  1V82 A;  4FRD A;  1R7V A;  1ZI3 A;  1QRM A;  1LL3 A;  1FGX A;  4FRM A;  4Y6U A;  4R7P A;  3OUP A;  1W55 A;  2APC A;  2NPO A;  3VBK A;  2VK9 A;  1R7U A;  1ZJ1 A;  4HO9 A;  1SSM A;  2WVL A;  1R7T A;  2QIV X;  1LL0 A;  2JCJ A;  1G95 A;  2BO8 A;  4Q7C A;  1ZI4 A;  4D11 C;  4KNX A;  1KGQ A;  2PX7 A;  3I3A A;  4FRL A;  3VBN A;  5FYE A;  3JTJ A;  4AAW A;  4N27 A;  3VBM A;  3VBJ A;  3U2T A;  4NAK A;  3SRT A;  4B2X A;  3R3R A;  1G93 A;  3SPT A;  4B4B A;  3I0E A;  2UX8 A;  4HCQ A;  4H7O A;  4E6T A;  4M99 A;  3CKQ A;  4D0T A;  1TZF A;  2QIA A;  1H5T B;  1KK5 A;  3PNN A;  3V0P A;  3V0N A;  1QRF A;  1FO9 A;  1HJL A;  5E3Q A;  3TK8 A;  2AM5 A;  3CGX A;  4N69 A;  4KQL A;  2JF2 A;  1ON8 A;  1G8O A;  1WSZ A;  1VZT A;  4IHH A;  2RJ5 A;  2RJ8 A;  2NXV A;  3BSY A;  3R3I A;  1PZT A;  1FZW A;  3CU0 A;  3GOS A;  2XME A;  1THJ A;  1KGT A;  5CQP A;  5AJP A;  5CQN X;  5HS2 A;  3FSC A;  3I0K A;  4FCE A;  2X65 A;  5CMJ A;  1H5S D;  1VGZ A;  3U2U A;  4B2W A;  2A8W A;  3KIA A;  1ZDF A;  1JV3 A;  2WLG A;  2VFZ A;  2FY7 A;  1ZJ2 A;  3SXB A;  5CMI A;  2MZB A;  2VD4 A;  2Z87 A;  3GVD A;  4HUR A;  1H4C A;  2V0H A;  4CJ8 A;  2TDT A;  5AFU U;  3BCV A;  4HO3 A;  4KC1 A;  3TWD A;  1YP2 A;  3R8Y A;  1H5T A;  3ZLL A;  5FTV A;  1XHD A;  1WT0 A;  3EG4 A;  2WVK A;  1VH3 A;  3TV0 A;  2WVM A;  4HOC A;  1KRV A;  1S4O A;  1ZJO A;  2BO4 A;  2RIT A;  4CJB A;  3ST8 A;  1FR9 A;  3I0C A;  5E3P A;  1YRO B;  3I0L A;  4NAI A;  3V91 A;  5J49 A;  2O1H A;  3ZF8 A;  1LXA A;  2XAT A;  1VZU A;  2CU2 A;  3TZT A;  1ZHJ A;  2AES A;  4L41 C;  5BXC A;  2PGY A;  4EQY A;  2RIJ A;  2Y4L A;  1FR8 A;  5CMF X;  1HM0 A;  3SXG A;  3F1X A;  2Y4J A;  4Y63 A;  1QRE A;  4M2A A;  4N6B A;  5DDV A;  2YES A;  3IOH A;  3MQH A;  3R5D A;  5EJ1 A;  3KWD A;  4ECM A;  3F1C A;  4E1K A;  1ZCV A;  1QGQ A;  4NAL A;  4Y7U A;  5CMG X;  4Y7G A;  3VBL A;  1GQ9 A;  1ZDG A;  3V4E A;  1W57 A;  3SX5 A;  4ARW A;  1KWS A;  1FG5 N;  3SX7 A;  2GGQ A;  3I0I X;  5IFY A;  4E6U A;  2FYD B;  2WE9 A;  2IU8 A;  4B3U A;  3V8Z A;  4EVW A;  1IIM A;  3HSQ A;  5I1F A;  3VBP A;  4MZU A;  1T3D A;  2D0J A;  4D11 A;  3NGW A;  3I0J A;  2VS5 A;  2IUA A;  2WLD A;  3R2W A;  3CKV A;  3I0G A;  1WT1 A;  1VGW A;  2D7I A;  4KRV A;  1ZI1 A;  4EAB A;  3SXA A;  1HM8 A;  1O23 B;  3CKO A;  1W77 A;  5C36 A;  5C4B A;  3DHO A;  4EA9 A;  3IGJ A;  4AA7 A;  4EAA A;  2E3D A;  3VNP A;  4MYO A;  1H5R B;  1MP4 A;  1NMM B;  3KWC A;  1GA8 A;  2PA4 A;  3USQ A;  3IOI A;  2VS4 A;  1OMX A;  2JCO A;  4DE7 A;  4J18 A;  4M98 A;  4M28 A;  2ICY A;  4AC3 A;  3O3P A;  3SXD A;  2XWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...