4HCQA

Crystal structure of glmu from mycobacterium tuberculosis in complex with glucosamine-1-phosphate
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
molecule keywords Bifunctional protein GlmU
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4hcqA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4hcqA01
2OEGA 3N9WA 2RIJA 4IRPA 5DDTA 5FTVA 1VZXA 4D11A 1INIA 1NKHB 2APCA 2WLDA 1LZ0A 3GUEA 3K8EA 4HURA 1EYRA 3POLA 3K8DA 3USRA 1LZ7A 2VS3A 2AESA 1LL2A 3EE5A 5FTSA 4ARWA 1ZCUA 1WSZA 1H5TB 4E1KA 5FU8A 3P47A 3R5BA 3FSBA 3I0LA 2XWMA 1NQIB 2AM4A 3I0DA 2IUAA 1R7YA 2X5SA 1ZJ2A 3OKRA 1TW5A 4M28A 4CJCA 1HJLA 2MZBA 3BXYA 3R5CA 4EQYA 2X60A 4JD0A 1NF5B 2FYBA 3D5NA 5E3RA 4FROA 1JYLA 4E6TA 5C4BA 1HJJA 2I7BA 5BXCA 2VS5A 1G1LA 4FQWA 3I3AA 4FCEA 5CMIA 4EA8A 4EAAA 4HCQA 4KPZA 5CMFX 1OCXA 1G93A 5DDVA 5C1GA 4B5BA 4IHFA 4LW3A 1H5RB 3USQA 4MNDA 4EEGA 2A8UA 1H7EA 2XMHA 4FRMA 3SX3A 1HV9A 1V67A 3CKNA 2XWNA 4MFGA 3O3PA 4HO2A 4Y7UA 4AYJA 2RJ0A 4EEMA 3TIOA 4FRPA 3TQDA 2VXLA 4KXOA 3OTZA 1GQCA 5C4CA 3DJ4A 1GWWA 2PX7A 2OI7A 1JV3A 2WLGA 4R37A 1MP4A 2AECA 1ZCYA 4G3PA 3PKPA 3OAMA 1OQMB 3SX8A 3V0QA 4KNXA 2AQ9A 5C3BA 4HZCA 3CJ8A 3MQHA 3U2XA 3KWCA 2VD4A 1VGUA 1G23A 5F42A 1JV1A 1OMZA 3IGJA 2P72A 4AAWA 4B42A 3KWEA 1H5TA 1G9RA 1FWYA 1V82A 3T57A 2AM3A 1KRUA 2FKOA 1LZIA 1LZJA 4IHHA 4EVWA 1VZUA 3FOQA 5C1LA 1QRLA 2VSIA 1FRWA 4N69A 2AH9A 1R7VA 3U2WA 4Y6NA 1KK6A 3E25A 4CJBA 4J09A 1GA8A 5C4EA 4HO9A 1EZIA 1GX0A 3HJJA 1G0RA 3ZGGA 1V83A 3F1CA 1YP4A 2IU8A 5EJ1A 2I5KA 1VGTA 4D0ZA 5CQMX 1SSQA 4Y7FA 1ZCVA 5C36A 4KC4A 2D7RA 3SXCA 1H5RA 3ZLLA 1MP5A 2GGQA 1YP2A 3FTTA 1S4NA 1QWJA 5C1HA 5DEMA 4B2XA 1SS9A 4HO8A 1XZ6A 4ASJA 5C4FA 3FSXA 1S4OA 2BO7A 5JQQA 2W0VA 1YROB 5C49A 3VBLA 4DECA 5U2KA 2X65A 3CKQA 4Y9XA 4FRAA 2NXVA 3ZF8A 2PGYA 2V0KA 1KRRA 1S4PA 4EGGA 2FYCB 5AJPA 4B3UA 1LL0A 3DK5A 4HO0A 3MQGA 1G2VA 1R82A 3CU0A 3OGZA 3R5AA 2CU2A 3MC4A 2YC5A 3BSYA 3F1XA 3TK8A 5FYEA 4BQHA 1ZCTA 1LL3A 3SXEA 4D0TA 1TDTA 1GX4A 4N27A 1XATA 1G3LA 1KK5A 4E79A 3OUPA 3OH3A 3Q7UA 3V90A 5FU0A 3QVBA 2E8BA 4H7OA 2WEEA 1THJA 1T3DA 2V0HA 2RJ5A 2Y4LA 4EA9A 1VH3A 5C47A 4HO4A 1KWSA 2ZU9A 4KRVA 3I0FA 2DPWA 2RITA 1KGTA 3FWWA 4EEAA 5C38A 3TDTA 2QIVX 1H7TA 3SRTA 2YQSA 2RJ1A 3V0MA 5AFUV 1Z90A 3V91A 1KGQA 4CVHA 1LVWA 5CQPA 4NALA 1S80A 2BO6A 2JF3A 4Y62A 3RMWA 3SXDA 2JCLA 2FYDB 4FRLA 5CQLX 4KC2A 1JVDA 5HS2A 3OW5A 3R2WA 4G3QA 3I3XA 1NWGB 5AFUU 2RJ6A 2P2OA 4HUSA 1ZI5A 1KHRA 1H7QA 4KNRA 3BRKX 2VXMA 3I0KA 4B4MA 3KWDA 2GGOA 1ZJOA 4B4BA 2D0JA 4DE7A 2Z87A 4FRDA 4KT7A 2ZU7A 3Q80A 3HSQA 2JCKA 1XHBA 2V0JA 2BO4A 1O7OA 1HM9A 1ZI1A 2YC3A 1ON8A 3TV0A 4FRHA 1VPAA 1WT3A 3T7OA 2YQJA 3BSWA 1VZTA 5C3AA 2PA4A 5ADXV 2W0WA 3V8YA 2V0LA 3FSCA 1MP3A 4IHGA 2RJ4A 3U0XA 3CKOA 4NAIA 2Z86A 4EA7A 4CJ8A 4KC1A 3PNNA 4M4KA 4IRQA 1FGGA 1ZJ1A 3R3IA 3SPTA 1G8OA 3OH0A 2Y4KA 3IOHA 1QREA 2AM5A 4HO3A 5ADXU 3OH1A 4L41C 2UX8A 2ICXA 3U2VA 3Q1XA 2D7IA 1FXJA 3VNPA 2QKXA 2VS4A 3I0HA 3R0SA 4HO5A 3Q4SA 3D8VA 5C3DA 1GWVA 1QG8A 1H7GA 2XMEA 4G87A 3F1YA 4Y7VA 2XWLA 1W57A 4G3SA 4FRQA 1QGQA 5L6VA 5AJOA 2IU9A 3V0OA 3ST8A 2OEFA 1YP3A 4D11C 4KQLA 4EE4A 1FG5N 4Y64A 3RMVA 3D98A 1ZI4A 2FFUA 1NHEB 3EH0A 4ASYA 4FCUA 2QH5A 2ZU8A 2FY7A 4K6RA 1O0RA 2RJ9A 4Y63A 5C8RA 1PZTA 3NGWA 1ON6A 4ECMA 1NMMB 1VGWA 3T7MA 2O1GA 3VBNA 4DCLA 3SXAA 3ZLKA 5EJZA 2XATA 3R5DA 1QGSA 2I5EA 2YCMA 3U0YA 4HZDA 4E75A 2NPOA 2X5ZA 4D48A 1H4DA 2RIXA 2WVMA 4MYBA 4M9CA 2RIZA 3BSSA 4R7PA 4KPXA 4E6UA 1VGZA 3CGXA 1H5SD 2FYAA 3U2TA 4N6BA 3CKVA 4M2AA 1W55A 2WVKA 3GOSA 1H7LA 4NANA 1KRVA 1SSMA 2QIAA 4M98A 1G97A 1FR8A 3I0IX 1R80A 1VICA 4AA7A 4EEOA 5E3QA 5C4DA 3RSBA 2Y6PA 3I0CA 1J2ZA 2TDTA 1O7QA 1FOAA 5IDTA 1H3MA 5CQNX 3JQYA 2VFZA 1FR9A 2VHEA 4ISXA 3VBJA 1MRLA 3V0LA 1ZJ0A 2QGIA 3OC9A 1R81A 5C48A 3SXBA 1H5SB 2RIYA 4NAKA 4BMAA 1R7TA 3VBPA 1HM8A 2OI5A 4YS8A 3EG4A 1QRGA 1H5SC 4Y7GA 4GBPA 2Q4JA 3LW6A 5CMJA 1H4CA 4P02A 2VSHA 2WLFA 1ZIZA 3V0NA 4Y6UA 1H4EA 1WVCA 1HM0A 2WGZA 1I52A 1MR9A 1MR7A 4B2WA 2WVLA 5IDSA 1JVGA 3ECTA 5J49A 2AGDA 1KQAA 4DDZA 4JISA 1FO8A 4LW6A 3I0GA 2OI6A 4R36A 1MC3A 3IOJA 4HO6A 2A8WA 4ZDQA 2YESA 4C2SA 5I1FA 2IC7A 4N6AA 3VBMA 1TW1A 3I0JA 2E3DA 1QQ0A 2ICYA 2O1FA 5EIYA 1ZDGA 1ZJPA 3NZ2A 1JYKA 1OMXA 1FXOA 1GQ9A 5CQOA 3FS8A 1VH1A 3BCVA 2V0IA 1PZYB 1V84A 1VM8A 1FO9A 4FRBA 1R7XA 3OH4A 1ZHJA 5FV9A 1TZFA 3SXGA 5E3PA 2Y7AA 1K4VA 2BO8A 1QRMA 3OTMA 3VBIA 1ZDFA 3TWDA 2AE7A 4P00A 1IIMA 4UEGA 1SSTA 3JUJA 3SX5A 2WAWA 3BFPA 1V3WA 2FFVA 1H5SA 3P1BA 1R7UA 4J18A 1INJA 5CMGX 1QRFA 1FGXA 3IOIA 1WT0A 4M99A 1ZJ3A 3EEVA 1H7HA 1ZI3A 3U2UA 3V8ZA 3IXCA 2YQHA 1W77A 3HL3A 4EE3A 3OU9A 1FZWA 4B4GA 1WT1A 2P6WA 2WLCA 1WT2A 3DUVA 4M2BA 3OH2A 5DG3A 3T7NA 2Y4MA 2RJ8A 3JTJA 3PKQA 3TZTA 5CMHA 5IFYA 3C8VA 3I0EA 2JCJA 2JF2A 1TVYA 3R1WA 3PMOA 5AJNA 5DEPA 4HOCA 3R3RA 2RJ7A 3JUKA 3SX7A 4EE5A 3E26A 1E5KA 4Y7TA 2O1HA 4HG6A 4FREA 1H7FA 5FUHA 3R8YA 2WE9A 2YQCA 3ZGFA 2Y4JA 1IINA 2JCOA 3KIAA 5L6SA 4XWIA 4MYOA 3CKJA 1LXAA 4AC3A 3DHOA 3V4EA 3GVDA 3V0PA 3FSYA 1O23B 1G95A 2P73A 1XHDA 1KK4A 2WLEA 4MZUA 2PGVA 4EABA 3TISA 4AYLA 3VBKA
chains in the Genus database with same CATH superfamily
2VK9A 1L0SA 2OEGA 3N9WA 2RIJA 4IRPA 5DDTA 5FTVA 1VZXA 4D11A 1INIA 1NKHB 2APCA 2WLDA 1LZ0A 3GUEA 3K8EA 4HURA 1EYRA 3POLA 3K8DA 3USRA 1LZ7A 2VS3A 2AESA 1LL2A 3EE5A 5FTSA 4ARWA 1ZCUA 1WSZA 1H5TB 4E1KA 5FU8A 3P47A 3R5BA 3FSBA 3I0LA 2XWMA 1NQIB 2AM4A 3I0DA 2IUAA 1R7YA 2X5SA 1ZJ2A 3OKRA 1TW5A 4M28A 4CJCA 1HJLA 2MZBA 3BXYA 3R5CA 4EQYA 2X60A 4JD0A 1NF5B 2FYBA 3D5NA 5E3RA 4FROA 4Q7CA 1JYLA 4E6TA 5C4BA 1HJJA 2I7BA 5BXCA 2VS5A 1G1LA 4FQWA 3I3AA 4FCEA 5CMIA 4EA8A 4EAAA 4HCQA 4KPZA 5CMFX 1OCXA 1G93A 5DDVA 5C1GA 4B5BA 4IHFA 4LW3A 1H5RB 3USQA 4MNDA 4EEGA 2A8UA 1H7EA 2XMHA 4FRMA 3SX3A 1HV9A 1V67A 3CKNA 2XWNA 4MFGA 3O3PA 4HO2A 4Y7UA 4AYJA 2RJ0A 4EEMA 3TIOA 4FRPA 3TQDA 2VXLA 4KXOA 3OTZA 1GQCA 5C4CA 3DJ4A 1GWWA 2PX7A 2OI7A 1JV3A 2WLGA 4R37A 1MP4A 2AECA 1ZCYA 4G3PA 3PKPA 3OAMA 1OQMB 3SX8A 3V0QA 4KNXA 2AQ9A 5C3BA 4HZCA 3CJ8A 3MQHA 3U2XA 3KWCA 2VD4A 1VGUA 1G23A 5F42A 1JV1A 1OMZA 3IGJA 2P72A 4AAWA 4B42A 3KWEA 1H5TA 1G9RA 1FWYA 1V82A 3T57A 2AM3A 1KRUA 2FKOA 1LZIA 1LZJA 4IHHA 4EVWA 1VZUA 3FOQA 5C1LA 1QRLA 2VSIA 1FRWA 4N69A 2AH9A 1R7VA 3U2WA 4Y6NA 1KK6A 3E25A 4CJBA 4J09A 1GA8A 5C4EA 4HO9A 1EZIA 1GX0A 3HJJA 1G0RA 3ZGGA 1V83A 3F1CA 1YP4A 2IU8A 5EJ1A 2I5KA 1VGTA 4D0ZA 5CQMX 1SSQA 4MIXA 4Y7FA 1ZCVA 5C36A 4KC4A 2D7RA 3SXCA 4O6MA 1H5RA 3ZLLA 1MP5A 2GGQA 1YP2A 3FTTA 1S4NA 1QWJA 5C1HA 5DEMA 4B2XA 1SS9A 4HO8A 1N4IA 1XZ6A 4ASJA 5C4FA 3FSXA 1S4OA 2BO7A 5JQQA 2W0VA 1YROB 5C49A 3VBLA 4DECA 5U2KA 2X65A 3CKQA 4Y9XA 4FRAA 2NXVA 3ZF8A 2PGYA 2V0KA 1KRRA 1S4PA 4EGGA 2FYCB 5AJPA 4B3UA 1LL0A 3DK5A 4HO0A 3MQGA 3OGZA 1G2VA 1R82A 3CU0A 3R5AA 2CU2A 3MC4A 2YC5A 1M8NA 3BSYA 3F1XA 3TK8A 5FYEA 4BQHA 1ZCTA 1LL3A 3SXEA 4D0TA 1TDTA 1GX4A 4N27A 1XATA 1G3LA 1KK5A 4E79A 3OUPA 3OH3A 3Q7UA 3V90A 5FU0A 3QVBA 2E8BA 4H7OA 2WEEA 1THJA 1T3DA 2V0HA 2RJ5A 2Y4LA 4EA9A 3SUCA 1VH3A 5C47A 4HO4A 1KWSA 2ZU9A 4KRVA 3I0FA 2DPWA 2RITA 1KGTA 1Z2FA 3FWWA 4EEAA 5C38A 3TDTA 2QIVX 2J0AA 1H7TA 3SRTA 2YQSA 2RJ1A 3V0MA 5AFUV 1Z90A 3V91A 1KGQA 4CVHA 1LVWA 5CQPA 4NALA 1S80A 2BO6A 2JF3A 4Y62A 3RMWA 3SXDA 2JCLA 2FYDB 4FRLA 5CQLX 4KC2A 1JVDA 5HS2A 3OW5A 3R2WA 4G3QA 3I3XA 1NWGB 5AFUU 2RJ6A 2P2OA 4HUSA 4FIYA 1ZI5A 1KHRA 1H7QA 4KNRA 3BRKX 2VXMA 3I0KA 4B4MA 3KWDA 2GGOA 1ZJOA 4FIXA 2D0JA 4B4BA 4DE7A 2Z87A 4FRDA 4KT7A 2ZU7A 3Q80A 3HSQA 2JCKA 1XHBA 2J0BA 2V0JA 2BO4A 1O7OA 1HM9A 1ZI1A 2YC3A 1ON8A 3TV0A 4FRHA 1VPAA 1WT3A 3T7OA 2YQJA 3BSWA 1VZTA 5C3AA 2PA4A 5ADXV 2W0WA 3V8YA 2V0LA 3FSCA 1MP3A 4IHGA 2RJ4A 3U0XA 4O6NA 3CKOA 4NAIA 2Z86A 4EA7A 4CJ8A 4KC1A 3PNNA 4M4KA 4IRQA 1FGGA 1ZJ1A 3R3IA 3OH0A 3SPTA 1G8OA 2Y4KA 3IOHA 1QREA 2AM5A 4HO3A 5ADXU 3OH1A 4L41C 2UX8A 2ICXA 3U2VA 3Q1XA 3GQ8A 1FXJA 2D7IA 3VNPA 2QKXA 2VS4A 3I0HA 3R0SA 4HO5A 3Q4SA 3D8VA 5C3DA 1GWVA 1QG8A 1H7GA 2XMEA 4G87A 3F1YA 4Y7VA 2XWLA 1W57A 4G3SA 4FRQA 1QGQA 5L6VA 5AJOA 2IU9A 3V0OA 3ST8A 2OEFA 1YP3A 4D11C 4KQLA 4EE4A 1FG5N 4Y64A 3RMVA 3D98A 1ZI4A 2FFUA 1NHEB 3EH0A 4ASYA 4FCUA 2QH5A 2ZU8A 2FY7A 4K6RA 1O0RA 2RJ9A 4Y63A 5C8RA 1PZTA 5D92A 3NGWA 1ON6A 4ECMA 1NMMB 1VGWA 3T7MA 2O1GA 3VBNA 4DCLA 3SXAA 3ZLKA 3GQ9A 5EJZA 2XATA 3R5DA 1QGSA 2I5EA 2YCMA 3U0YA 4HZDA 4E75A 2NPOA 2X5ZA 4D48A 1H4DA 2RIXA 2WVMA 4MYBA 4M9CA 2RIZA 5D91A 3BSSA 4R7PA 4KPXA 4E6UA 1VGZA 3CGXA 1H5SD 2FYAA 3U2TA 4N6BA 3CKVA 4M2AA 1W55A 2WVKA 3GOSA 1H7LA 4NANA 1KRVA 1SSMA 2QIAA 4M98A 1G97A 1FR8A 3I0IX 1R80A 1VICA 4AA7A 4EEOA 5E3QA 5C4DA 3RSBA 2Y6PA 3I0CA 1J2ZA 2TDTA 1O7QA 2C0NA 1FOAA 5IDTA 1H3MA 5CQNX 3JQYA 2VFZA 1FR9A 2VHEA 4ISXA 3VBJA 1MRLA 3V0LA 1ZJ0A 2QGIA 3OC9A 1R81A 5C48A 3SXBA 1H5SB 2RIYA 4NAKA 4BMAA 1R7TA 3VBPA 1HM8A 2OI5A 4YS8A 3EG4A 1QRGA 1H5SC 4Y7GA 4GBPA 2Q4JA 3LW6A 5CMJA 1H4CA 4P02A 2VSHA 2WLFA 1ZIZA 3V0NA 4Y6UA 1H4EA 1WVCA 1HM0A 2WGZA 1I52A 1MR9A 1MR7A 4B2WA 2WVLA 5IDSA 1JVGA 3ECTA 5J49A 2AGDA 1KQAA 4DDZA 4JISA 1FO8A 4LW6A 3I0GA 2OI6A 4R36A 1MC3A 3IOJA 4HO6A 2A8WA 4ZDQA 2YESA 4C2SA 5I1FA 2IC7A 4N6AA 3VBMA 1TW1A 3I0JA 2E3DA 1QQ0A 3GQAA 2ICYA 2O1FA 5EIYA 1ZDGA 1ZJPA 3NZ2A 3GQ7A 1JYKA 1OMXA 1FXOA 1GQ9A 5CQOA 3FS8A 1VH1A 3BCVA 2V0IA 1PZYB 1V84A 1VM8A 1EWWA 1FO9A 4FRBA 1R7XA 3OH4A 1ZHJA 5FV9A 1TZFA 3SXGA 5E3PA 2Y7AA 1K4VA 2BO8A 1QRMA 3OTMA 3VBIA 1ZDFA 3TWDA 2AE7A 4P00A 1IIMA 4UEGA 1SSTA 3JUJA 3SX5A 2WAWA 3BFPA 1V3WA 2FFVA 1H5SA 3P1BA 1R7UA 4J18A 1INJA 5CMGX 1QRFA 1FGXA 3IOIA 1WT0A 4M99A 1ZJ3A 3EEVA 1H7HA 1ZI3A 3U2UA 3V8ZA 3IXCA 2YQHA 1W77A 3HL3A 4EE3A 3OU9A 1FZWA 4B4GA 1WT1A 2P6WA 2WLCA 1WT2A 3DUVA 4M2BA 3OH2A 5DG3A 3T7NA 2Y4MA 2RJ8A 3JTJA 3PKQA 3TZTA 5CMHA 5IFYA 3C8VA 3I0EA 2JCJA 2JF2A 1TVYA 3R1WA 3PMOA 5AJNA 5DEPA 4HOCA 3R3RA 2RJ7A 3JUKA 3SX7A 4EE5A 3E26A 1E5KA 4Y7TA 2O1HA 4HG6A 4FREA 1H7FA 5FUHA 3R8YA 2WE9A 2YQCA 3ZGFA 2Y4JA 1IINA 2JCOA 3KIAA 5L6SA 4XWIA 4MYOA 3CKJA 1LXAA 4AC3A 3DHOA 3V4EA 3GVDA 3V0PA 3FSYA 1O23B 1G95A 2P73A 1XHDA 1KK4A 2WLEA 4MZUA 2PGVA 4EABA 3TISA 4AYLA 3VBKA
chains in the Genus database with same CATH topology
2VK9A 2OEGA 3N9WA 2RIJA 4IRPA 5DDTA 5FTVA 1VZXA 4D11A 1INIA 1NKHB 2APCA 2WLDA 1LZ0A 3GUEA 3K8EA 4HURA 1EYRA 3POLA 3K8DA 3USRA 1LZ7A 2VS3A 2AESA 1LL2A 3EE5A 5FTSA 4ARWA 1ZCUA 1WSZA 1H5TB 4E1KA 5FU8A 3P47A 3R5BA 3FSBA 3I0LA 2XWMA 1NQIB 2AM4A 3I0DA 2IUAA 1R7YA 2X5SA 1ZJ2A 3OKRA 1TW5A 4M28A 4CJCA 1HJLA 2MZBA 3BXYA 3R5CA 4EQYA 2X60A 4JD0A 1NF5B 2FYBA 3D5NA 5E3RA 4FROA 4Q7CA 1JYLA 4E6TA 5C4BA 1HJJA 2I7BA 5BXCA 2VS5A 1G1LA 4FQWA 3I3AA 4FCEA 5CMIA 4EA8A 4EAAA 4HCQA 4KPZA 5CMFX 1OCXA 1G93A 5DDVA 5C1GA 4B5BA 4IHFA 4LW3A 1H5RB 3USQA 4MNDA 4EEGA 2A8UA 1H7EA 2XMHA 4FRMA 3SX3A 1HV9A 1V67A 3CKNA 2XWNA 4MFGA 3O3PA 4HO2A 4Y7UA 4AYJA 2RJ0A 4EEMA 3TIOA 4FRPA 3TQDA 2VXLA 4KXOA 3OTZA 1GQCA 5C4CA 3DJ4A 1GWWA 2PX7A 2OI7A 1JV3A 2WLGA 4R37A 1MP4A 2AECA 1ZCYA 4G3PA 3PKPA 3OAMA 1OQMB 3SX8A 3V0QA 4KNXA 2AQ9A 5C3BA 4HZCA 3CJ8A 3MQHA 3U2XA 3KWCA 2VD4A 1VGUA 1G23A 5F42A 1JV1A 1OMZA 3IGJA 2P72A 4AAWA 4B42A 3KWEA 1H5TA 1G9RA 1FWYA 1V82A 3T57A 2AM3A 1KRUA 2FKOA 1LZIA 1LZJA 4IHHA 4EVWA 1VZUA 3FOQA 5C1LA 1QRLA 2VSIA 1FRWA 4N69A 2AH9A 1R7VA 3U2WA 4Y6NA 1KK6A 3E25A 4CJBA 4J09A 1GA8A 5C4EA 4HO9A 1EZIA 1GX0A 3HJJA 1G0RA 3ZGGA 1V83A 3F1CA 1YP4A 2IU8A 5EJ1A 2I5KA 1VGTA 4D0ZA 5CQMX 1SSQA 4MIXA 4Y7FA 1ZCVA 5C36A 4KC4A 2D7RA 3SXCA 4O6MA 1H5RA 3ZLLA 1MP5A 2GGQA 1YP2A 3FTTA 1S4NA 1QWJA 5C1HA 5DEMA 4B2XA 1SS9A 4HO8A 1XZ6A 4ASJA 5C4FA 3FSXA 1S4OA 2BO7A 5JQQA 2W0VA 1YROB 5C49A 3VBLA 4DECA 5U2KA 2X65A 3CKQA 4Y9XA 4FRAA 2NXVA 3ZF8A 2PGYA 2V0KA 1KRRA 1S4PA 4EGGA 2FYCB 5AJPA 4B3UA 1LL0A 3DK5A 4HO0A 3MQGA 1G2VA 1R82A 3CU0A 3OGZA 3R5AA 2CU2A 3MC4A 2YC5A 3BSYA 3F1XA 3TK8A 5FYEA 4BQHA 1ZCTA 1LL3A 3SXEA 4D0TA 1TDTA 1GX4A 4N27A 1XATA 1G3LA 1KK5A 4E79A 3OUPA 3OH3A 3Q7UA 3V90A 5FU0A 3QVBA 2E8BA 4H7OA 2WEEA 1THJA 1T3DA 2V0HA 2RJ5A 2Y4LA 4EA9A 1VH3A 5C47A 4HO4A 1KWSA 2ZU9A 4KRVA 3I0FA 2DPWA 2RITA 1KGTA 3FWWA 4EEAA 5C38A 3TDTA 2QIVX 2J0AA 1H7TA 3SRTA 2YQSA 2RJ1A 3V0MA 5AFUV 1Z90A 3V91A 1KGQA 4CVHA 1LVWA 5CQPA 4NALA 1S80A 2BO6A 2JF3A 4Y62A 3RMWA 3SXDA 2JCLA 2FYDB 4FRLA 5CQLX 4KC2A 1JVDA 5HS2A 3OW5A 3R2WA 4G3QA 3I3XA 1NWGB 5AFUU 2RJ6A 2P2OA 4HUSA 4FIYA 1ZI5A 1KHRA 1H7QA 4KNRA 3BRKX 2VXMA 3I0KA 4B4MA 3KWDA 2GGOA 1ZJOA 4FIXA 2D0JA 4B4BA 4DE7A 2Z87A 4FRDA 4KT7A 2ZU7A 3Q80A 3HSQA 2JCKA 1XHBA 2J0BA 2V0JA 2BO4A 1O7OA 1HM9A 1ZI1A 2YC3A 1ON8A 3TV0A 4FRHA 1VPAA 1WT3A 3T7OA 2YQJA 3BSWA 1VZTA 5C3AA 2PA4A 5ADXV 2W0WA 3V8YA 2V0LA 3FSCA 1MP3A 4IHGA 2RJ4A 3U0XA 4O6NA 3CKOA 4NAIA 2Z86A 4EA7A 4CJ8A 4KC1A 3PNNA 4M4KA 4IRQA 1FGGA 1ZJ1A 3R3IA 3SPTA 1G8OA 3OH0A 2Y4KA 3IOHA 1QREA 2AM5A 4HO3A 5ADXU 3OH1A 4L41C 2UX8A 2ICXA 3U2VA 3Q1XA 2D7IA 1FXJA 3VNPA 2QKXA 2VS4A 3I0HA 3R0SA 4HO5A 3Q4SA 3D8VA 5C3DA 1GWVA 1QG8A 1H7GA 2XMEA 4G87A 3F1YA 4Y7VA 2XWLA 1W57A 4G3SA 4FRQA 1QGQA 5L6VA 5AJOA 2IU9A 3V0OA 3ST8A 2OEFA 1YP3A 4D11C 4KQLA 4EE4A 1FG5N 4Y64A 3RMVA 3D98A 1ZI4A 2FFUA 1NHEB 3EH0A 4ASYA 4FCUA 2QH5A 2ZU8A 2FY7A 4K6RA 1O0RA 2RJ9A 4Y63A 5C8RA 1PZTA 5D92A 3NGWA 1ON6A 4ECMA 1NMMB 1VGWA 3T7MA 2O1GA 3VBNA 4DCLA 3SXAA 3ZLKA 5EJZA 2XATA 3R5DA 1QGSA 2I5EA 2YCMA 3U0YA 4HZDA 4E75A 2NPOA 2X5ZA 4D48A 1H4DA 2RIXA 2WVMA 4MYBA 4M9CA 2RIZA 5D91A 3BSSA 4R7PA 4KPXA 4E6UA 1VGZA 3CGXA 1H5SD 2FYAA 3U2TA 4N6BA 3CKVA 4M2AA 1W55A 2WVKA 3GOSA 1H7LA 4NANA 1KRVA 1SSMA 2QIAA 4M98A 1G97A 1FR8A 3I0IX 1R80A 1VICA 4AA7A 4EEOA 5E3QA 5C4DA 3RSBA 2Y6PA 3I0CA 1J2ZA 2TDTA 1O7QA 2C0NA 1FOAA 5IDTA 1H3MA 5CQNX 3JQYA 2VFZA 1FR9A 2VHEA 4ISXA 3VBJA 1MRLA 3V0LA 1ZJ0A 2QGIA 3OC9A 1R81A 5C48A 3SXBA 1H5SB 2RIYA 4NAKA 4BMAA 1R7TA 3VBPA 1HM8A 2OI5A 4YS8A 3EG4A 1QRGA 1H5SC 4Y7GA 4GBPA 2Q4JA 3LW6A 5CMJA 1H4CA 4P02A 2VSHA 2WLFA 1ZIZA 3V0NA 4Y6UA 1H4EA 1WVCA 1HM0A 2WGZA 1I52A 1MR9A 1MR7A 4B2WA 2WVLA 5IDSA 1JVGA 3ECTA 5J49A 2AGDA 1KQAA 4DDZA 4JISA 1FO8A 4LW6A 3I0GA 2OI6A 4R36A 1MC3A 3IOJA 4HO6A 2A8WA 4ZDQA 2YESA 4C2SA 5I1FA 2IC7A 4N6AA 3VBMA 1TW1A 3I0JA 2E3DA 1QQ0A 2ICYA 2O1FA 5EIYA 1ZDGA 1ZJPA 3NZ2A 1JYKA 1OMXA 1FXOA 1GQ9A 5CQOA 3FS8A 1VH1A 3BCVA 2V0IA 1PZYB 1V84A 1VM8A 1FO9A 4FRBA 1R7XA 3OH4A 1ZHJA 5FV9A 1TZFA 3SXGA 5E3PA 2Y7AA 1K4VA 2BO8A 1QRMA 3OTMA 3VBIA 1ZDFA 3TWDA 2AE7A 4P00A 1IIMA 4UEGA 1SSTA 3JUJA 3SX5A 2WAWA 3BFPA 1V3WA 2FFVA 1H5SA 3P1BA 1R7UA 4J18A 1INJA 5CMGX 1QRFA 1FGXA 3IOIA 1WT0A 4M99A 1ZJ3A 3EEVA 1H7HA 1ZI3A 3U2UA 3V8ZA 3IXCA 2YQHA 1W77A 3HL3A 4EE3A 3OU9A 1FZWA 4B4GA 1WT1A 2P6WA 2WLCA 1WT2A 3DUVA 4M2BA 3OH2A 5DG3A 3T7NA 2Y4MA 2RJ8A 3JTJA 3PKQA 3TZTA 5CMHA 5IFYA 3C8VA 3I0EA 2JCJA 2JF2A 1TVYA 3R1WA 3PMOA 5AJNA 5DEPA 4HOCA 3R3RA 2RJ7A 3JUKA 3SX7A 4EE5A 3E26A 1E5KA 4Y7TA 2O1HA 4HG6A 4FREA 1H7FA 5FUHA 3R8YA 2WE9A 2YQCA 3ZGFA 2Y4JA 1IINA 2JCOA 3KIAA 5L6SA 4XWIA 4MYOA 3CKJA 1LXAA 4AC3A 3DHOA 3V4EA 3GVDA 3V0PA 3FSYA 1O23B 1G95A 2P73A 1XHDA 1KK4A 2WLEA 4MZUA 2PGVA 4EABA 3TISA 4AYLA 3VBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEG A;  3N9W A;  2RIJ A;  4IRP A;  5DDT A;  5FTV A;  1VZX A;  4D11 A;  1INI A;  1NKH B;  2APC A;  2WLD A;  1LZ0 A;  3GUE A;  3K8E A;  4HUR A;  1EYR A;  3POL A;  3K8D A;  3USR A;  1LZ7 A;  2VS3 A;  2AES A;  1LL2 A;  3EE5 A;  5FTS A;  4ARW A;  1ZCU A;  1WSZ A;  1H5T B;  4E1K A;  5FU8 A;  3P47 A;  3R5B A;  3FSB A;  3I0L A;  2XWM A;  1NQI B;  2AM4 A;  3I0D A;  2IUA A;  1R7Y A;  2X5S A;  1ZJ2 A;  3OKR A;  1TW5 A;  4M28 A;  4CJC A;  1HJL A;  2MZB A;  3BXY A;  3R5C A;  4EQY A;  2X60 A;  4JD0 A;  1NF5 B;  2FYB A;  3D5N A;  5E3R A;  4FRO A;  1JYL A;  4E6T A;  5C4B A;  1HJJ A;  2I7B A;  5BXC A;  2VS5 A;  1G1L A;  4FQW A;  3I3A A;  4FCE A;  5CMI A;  4EA8 A;  4EAA A;  4HCQ A;  4KPZ A;  5CMF X;  1OCX A;  1G93 A;  5DDV A;  5C1G A;  4B5B A;  4IHF A;  4LW3 A;  1H5R B;  3USQ A;  4MND A;  4EEG A;  2A8U A;  1H7E A;  2XMH A;  4FRM A;  3SX3 A;  1HV9 A;  1V67 A;  3CKN A;  2XWN A;  4MFG A;  3O3P A;  4HO2 A;  4Y7U A;  4AYJ A;  2RJ0 A;  4EEM A;  3TIO A;  4FRP A;  3TQD A;  2VXL A;  4KXO A;  3OTZ A;  1GQC A;  5C4C A;  3DJ4 A;  1GWW A;  2PX7 A;  2OI7 A;  1JV3 A;  2WLG A;  4R37 A;  1MP4 A;  2AEC A;  1ZCY A;  4G3P A;  3PKP A;  3OAM A;  1OQM B;  3SX8 A;  3V0Q A;  4KNX A;  2AQ9 A;  5C3B A;  4HZC A;  3CJ8 A;  3MQH A;  3U2X A;  3KWC A;  2VD4 A;  1VGU A;  1G23 A;  5F42 A;  1JV1 A;  1OMZ A;  3IGJ A;  2P72 A;  4AAW A;  4B42 A;  3KWE A;  1H5T A;  1G9R A;  1FWY A;  1V82 A;  3T57 A;  2AM3 A;  1KRU A;  2FKO A;  1LZI A;  1LZJ A;  4IHH A;  4EVW A;  1VZU A;  3FOQ A;  5C1L A;  1QRL A;  2VSI A;  1FRW A;  4N69 A;  2AH9 A;  1R7V A;  3U2W A;  4Y6N A;  1KK6 A;  3E25 A;  4CJB A;  4J09 A;  1GA8 A;  5C4E A;  4HO9 A;  1EZI A;  1GX0 A;  3HJJ A;  1G0R A;  3ZGG A;  1V83 A;  3F1C A;  1YP4 A;  2IU8 A;  5EJ1 A;  2I5K A;  1VGT A;  4D0Z A;  5CQM X;  1SSQ A;  4Y7F A;  1ZCV A;  5C36 A;  4KC4 A;  2D7R A;  3SXC A;  1H5R A;  3ZLL A;  1MP5 A;  2GGQ A;  1YP2 A;  3FTT A;  1S4N A;  1QWJ A;  5C1H A;  5DEM A;  4B2X A;  1SS9 A;  4HO8 A;  1XZ6 A;  4ASJ A;  5C4F A;  3FSX A;  1S4O A;  2BO7 A;  5JQQ A;  2W0V A;  1YRO B;  5C49 A;  3VBL A;  4DEC A;  5U2K A;  2X65 A;  3CKQ A;  4Y9X A;  4FRA A;  2NXV A;  3ZF8 A;  2PGY A;  2V0K A;  1KRR A;  1S4P A;  4EGG A;  2FYC B;  5AJP A;  4B3U A;  1LL0 A;  3DK5 A;  4HO0 A;  3MQG A;  1G2V A;  1R82 A;  3CU0 A;  3OGZ A;  3R5A A;  2CU2 A;  3MC4 A;  2YC5 A;  3BSY A;  3F1X A;  3TK8 A;  5FYE A;  4BQH A;  1ZCT A;  1LL3 A;  3SXE A;  4D0T A;  1TDT A;  1GX4 A;  4N27 A;  1XAT A;  1G3L A;  1KK5 A;  4E79 A;  3OUP A;  3OH3 A;  3Q7U A;  3V90 A;  5FU0 A;  3QVB A;  2E8B A;  4H7O A;  2WEE A;  1THJ A;  1T3D A;  2V0H A;  2RJ5 A;  2Y4L A;  4EA9 A;  1VH3 A;  5C47 A;  4HO4 A;  1KWS A;  2ZU9 A;  4KRV A;  3I0F A;  2DPW A;  2RIT A;  1KGT A;  3FWW A;  4EEA A;  5C38 A;  3TDT A;  2QIV X;  1H7T A;  3SRT A;  2YQS A;  2RJ1 A;  3V0M A;  5AFU V;  1Z90 A;  3V91 A;  1KGQ A;  4CVH A;  1LVW A;  5CQP A;  4NAL A;  1S80 A;  2BO6 A;  2JF3 A;  4Y62 A;  3RMW A;  3SXD A;  2JCL A;  2FYD B;  4FRL A;  5CQL X;  4KC2 A;  1JVD A;  5HS2 A;  3OW5 A;  3R2W A;  4G3Q A;  3I3X A;  1NWG B;  5AFU U;  2RJ6 A;  2P2O A;  4HUS A;  1ZI5 A;  1KHR A;  1H7Q A;  4KNR A;  3BRK X;  2VXM A;  3I0K A;  4B4M A;  3KWD A;  2GGO A;  1ZJO A;  4B4B A;  2D0J A;  4DE7 A;  2Z87 A;  4FRD A;  4KT7 A;  2ZU7 A;  3Q80 A;  3HSQ A;  2JCK A;  1XHB A;  2V0J A;  2BO4 A;  1O7O A;  1HM9 A;  1ZI1 A;  2YC3 A;  1ON8 A;  3TV0 A;  4FRH A;  1VPA A;  1WT3 A;  3T7O A;  2YQJ A;  3BSW A;  1VZT A;  5C3A A;  2PA4 A;  5ADX V;  2W0W A;  3V8Y A;  2V0L A;  3FSC A;  1MP3 A;  4IHG A;  2RJ4 A;  3U0X A;  3CKO A;  4NAI A;  2Z86 A;  4EA7 A;  4CJ8 A;  4KC1 A;  3PNN A;  4M4K A;  4IRQ A;  1FGG A;  1ZJ1 A;  3R3I A;  3SPT A;  1G8O A;  3OH0 A;  2Y4K A;  3IOH A;  1QRE A;  2AM5 A;  4HO3 A;  5ADX U;  3OH1 A;  4L41 C;  2UX8 A;  2ICX A;  3U2V A;  3Q1X A;  2D7I A;  1FXJ A;  3VNP A;  2QKX A;  2VS4 A;  3I0H A;  3R0S A;  4HO5 A;  3Q4S A;  3D8V A;  5C3D A;  1GWV A;  1QG8 A;  1H7G A;  2XME A;  4G87 A;  3F1Y A;  4Y7V A;  2XWL A;  1W57 A;  4G3S A;  4FRQ A;  1QGQ A;  5L6V A;  5AJO A;  2IU9 A;  3V0O A;  3ST8 A;  2OEF A;  1YP3 A;  4D11 C;  4KQL A;  4EE4 A;  1FG5 N;  4Y64 A;  3RMV A;  3D98 A;  1ZI4 A;  2FFU A;  1NHE B;  3EH0 A;  4ASY A;  4FCU A;  2QH5 A;  2ZU8 A;  2FY7 A;  4K6R A;  1O0R A;  2RJ9 A;  4Y63 A;  5C8R A;  1PZT A;  3NGW A;  1ON6 A;  4ECM A;  1NMM B;  1VGW A;  3T7M A;  2O1G A;  3VBN A;  4DCL A;  3SXA A;  3ZLK A;  5EJZ A;  2XAT A;  3R5D A;  1QGS A;  2I5E A;  2YCM A;  3U0Y A;  4HZD A;  4E75 A;  2NPO A;  2X5Z A;  4D48 A;  1H4D A;  2RIX A;  2WVM A;  4MYB A;  4M9C A;  2RIZ A;  3BSS A;  4R7P A;  4KPX A;  4E6U A;  1VGZ A;  3CGX A;  1H5S D;  2FYA A;  3U2T A;  4N6B A;  3CKV A;  4M2A A;  1W55 A;  2WVK A;  3GOS A;  1H7L A;  4NAN A;  1KRV A;  1SSM A;  2QIA A;  4M98 A;  1G97 A;  1FR8 A;  3I0I X;  1R80 A;  1VIC A;  4AA7 A;  4EEO A;  5E3Q A;  5C4D A;  3RSB A;  2Y6P A;  3I0C A;  1J2Z A;  2TDT A;  1O7Q A;  1FOA A;  5IDT A;  1H3M A;  5CQN X;  3JQY A;  2VFZ A;  1FR9 A;  2VHE A;  4ISX A;  3VBJ A;  1MRL A;  3V0L A;  1ZJ0 A;  2QGI A;  3OC9 A;  1R81 A;  5C48 A;  3SXB A;  1H5S B;  2RIY A;  4NAK A;  4BMA A;  1R7T A;  3VBP A;  1HM8 A;  2OI5 A;  4YS8 A;  3EG4 A;  1QRG A;  1H5S C;  4Y7G A;  4GBP A;  2Q4J A;  3LW6 A;  5CMJ A;  1H4C A;  4P02 A;  2VSH A;  2WLF A;  1ZIZ A;  3V0N A;  4Y6U A;  1H4E A;  1WVC A;  1HM0 A;  2WGZ A;  1I52 A;  1MR9 A;  1MR7 A;  4B2W A;  2WVL A;  5IDS A;  1JVG A;  3ECT A;  5J49 A;  2AGD A;  1KQA A;  4DDZ A;  4JIS A;  1FO8 A;  4LW6 A;  3I0G A;  2OI6 A;  4R36 A;  1MC3 A;  3IOJ A;  4HO6 A;  2A8W A;  4ZDQ A;  2YES A;  4C2S A;  5I1F A;  2IC7 A;  4N6A A;  3VBM A;  1TW1 A;  3I0J A;  2E3D A;  1QQ0 A;  2ICY A;  2O1F A;  5EIY A;  1ZDG A;  1ZJP A;  3NZ2 A;  1JYK A;  1OMX A;  1FXO A;  1GQ9 A;  5CQO A;  3FS8 A;  1VH1 A;  3BCV A;  2V0I A;  1PZY B;  1V84 A;  1VM8 A;  1FO9 A;  4FRB A;  1R7X A;  3OH4 A;  1ZHJ A;  5FV9 A;  1TZF A;  3SXG A;  5E3P A;  2Y7A A;  1K4V A;  2BO8 A;  1QRM A;  3OTM A;  3VBI A;  1ZDF A;  3TWD A;  2AE7 A;  4P00 A;  1IIM A;  4UEG A;  1SST A;  3JUJ A;  3SX5 A;  2WAW A;  3BFP A;  1V3W A;  2FFV A;  1H5S A;  3P1B A;  1R7U A;  4J18 A;  1INJ A;  5CMG X;  1QRF A;  1FGX A;  3IOI A;  1WT0 A;  4M99 A;  1ZJ3 A;  3EEV A;  1H7H A;  1ZI3 A;  3U2U A;  3V8Z A;  3IXC A;  2YQH A;  1W77 A;  3HL3 A;  4EE3 A;  3OU9 A;  1FZW A;  4B4G A;  1WT1 A;  2P6W A;  2WLC A;  1WT2 A;  3DUV A;  4M2B A;  3OH2 A;  5DG3 A;  3T7N A;  2Y4M A;  2RJ8 A;  3JTJ A;  3PKQ A;  3TZT A;  5CMH A;  5IFY A;  3C8V A;  3I0E A;  2JCJ A;  2JF2 A;  1TVY A;  3R1W A;  3PMO A;  5AJN A;  5DEP A;  4HOC A;  3R3R A;  2RJ7 A;  3JUK A;  3SX7 A;  4EE5 A;  3E26 A;  1E5K A;  4Y7T A;  2O1H A;  4HG6 A;  4FRE A;  1H7F A;  5FUH A;  3R8Y A;  2WE9 A;  2YQC A;  3ZGF A;  2Y4J A;  1IIN A;  2JCO A;  3KIA A;  5L6S A;  4XWI A;  4MYO A;  3CKJ A;  1LXA A;  4AC3 A;  3DHO A;  3V4E A;  3GVD A;  3V0P A;  3FSY A;  1O23 B;  1G95 A;  2P73 A;  1XHD A;  1KK4 A;  2WLE A;  4MZU A;  2PGV A;  4EAB A;  3TIS A;  4AYL A;  3VBK A; 
#chains in the Genus database with same CATH topology
 2VK9 A;  1L0S A;  2OEG A;  3N9W A;  2RIJ A;  4IRP A;  5DDT A;  5FTV A;  1VZX A;  4D11 A;  1INI A;  1NKH B;  2APC A;  2WLD A;  1LZ0 A;  3GUE A;  3K8E A;  4HUR A;  1EYR A;  3POL A;  3K8D A;  3USR A;  1LZ7 A;  2VS3 A;  2AES A;  1LL2 A;  3EE5 A;  5FTS A;  4ARW A;  1ZCU A;  1WSZ A;  1H5T B;  4E1K A;  5FU8 A;  3P47 A;  3R5B A;  3FSB A;  3I0L A;  2XWM A;  1NQI B;  2AM4 A;  3I0D A;  2IUA A;  1R7Y A;  2X5S A;  1ZJ2 A;  3OKR A;  1TW5 A;  4M28 A;  4CJC A;  1HJL A;  2MZB A;  3BXY A;  3R5C A;  4EQY A;  2X60 A;  4JD0 A;  1NF5 B;  2FYB A;  3D5N A;  5E3R A;  4FRO A;  4Q7C A;  1JYL A;  4E6T A;  5C4B A;  1HJJ A;  2I7B A;  5BXC A;  2VS5 A;  1G1L A;  4FQW A;  3I3A A;  4FCE A;  5CMI A;  4EA8 A;  4EAA A;  4HCQ A;  4KPZ A;  5CMF X;  1OCX A;  1G93 A;  5DDV A;  5C1G A;  4B5B A;  4IHF A;  4LW3 A;  1H5R B;  3USQ A;  4MND A;  4EEG A;  2A8U A;  1H7E A;  2XMH A;  4FRM A;  3SX3 A;  1HV9 A;  1V67 A;  3CKN A;  2XWN A;  4MFG A;  3O3P A;  4HO2 A;  4Y7U A;  4AYJ A;  2RJ0 A;  4EEM A;  3TIO A;  4FRP A;  3TQD A;  2VXL A;  4KXO A;  3OTZ A;  1GQC A;  5C4C A;  3DJ4 A;  1GWW A;  2PX7 A;  2OI7 A;  1JV3 A;  2WLG A;  4R37 A;  1MP4 A;  2AEC A;  1ZCY A;  4G3P A;  3PKP A;  3OAM A;  1OQM B;  3SX8 A;  3V0Q A;  4KNX A;  2AQ9 A;  5C3B A;  4HZC A;  3CJ8 A;  3MQH A;  3U2X A;  3KWC A;  2VD4 A;  1VGU A;  1G23 A;  5F42 A;  1JV1 A;  1OMZ A;  3IGJ A;  2P72 A;  4AAW A;  4B42 A;  3KWE A;  1H5T A;  1G9R A;  1FWY A;  1V82 A;  3T57 A;  2AM3 A;  1KRU A;  2FKO A;  1LZI A;  1LZJ A;  4IHH A;  4EVW A;  1VZU A;  3FOQ A;  5C1L A;  1QRL A;  2VSI A;  1FRW A;  4N69 A;  2AH9 A;  1R7V A;  3U2W A;  4Y6N A;  1KK6 A;  3E25 A;  4CJB A;  4J09 A;  1GA8 A;  5C4E A;  4HO9 A;  1EZI A;  1GX0 A;  3HJJ A;  1G0R A;  3ZGG A;  1V83 A;  3F1C A;  1YP4 A;  2IU8 A;  5EJ1 A;  2I5K A;  1VGT A;  4D0Z A;  5CQM X;  1SSQ A;  4MIX A;  4Y7F A;  1ZCV A;  5C36 A;  4KC4 A;  2D7R A;  3SXC A;  4O6M A;  1H5R A;  3ZLL A;  1MP5 A;  2GGQ A;  1YP2 A;  3FTT A;  1S4N A;  1QWJ A;  5C1H A;  5DEM A;  4B2X A;  1SS9 A;  4HO8 A;  1N4I A;  1XZ6 A;  4ASJ A;  5C4F A;  3FSX A;  1S4O A;  2BO7 A;  5JQQ A;  2W0V A;  1YRO B;  5C49 A;  3VBL A;  4DEC A;  5U2K A;  2X65 A;  3CKQ A;  4Y9X A;  4FRA A;  2NXV A;  3ZF8 A;  2PGY A;  2V0K A;  1KRR A;  1S4P A;  4EGG A;  2FYC B;  5AJP A;  4B3U A;  1LL0 A;  3DK5 A;  4HO0 A;  3MQG A;  3OGZ A;  1G2V A;  1R82 A;  3CU0 A;  3R5A A;  2CU2 A;  3MC4 A;  2YC5 A;  1M8N A;  3BSY A;  3F1X A;  3TK8 A;  5FYE A;  4BQH A;  1ZCT A;  1LL3 A;  3SXE A;  4D0T A;  1TDT A;  1GX4 A;  4N27 A;  1XAT A;  1G3L A;  1KK5 A;  4E79 A;  3OUP A;  3OH3 A;  3Q7U A;  3V90 A;  5FU0 A;  3QVB A;  2E8B A;  4H7O A;  2WEE A;  1THJ A;  1T3D A;  2V0H A;  2RJ5 A;  2Y4L A;  4EA9 A;  3SUC A;  1VH3 A;  5C47 A;  4HO4 A;  1KWS A;  2ZU9 A;  4KRV A;  3I0F A;  2DPW A;  2RIT A;  1KGT A;  1Z2F A;  3FWW A;  4EEA A;  5C38 A;  3TDT A;  2QIV X;  2J0A A;  1H7T A;  3SRT A;  2YQS A;  2RJ1 A;  3V0M A;  5AFU V;  1Z90 A;  3V91 A;  1KGQ A;  4CVH A;  1LVW A;  5CQP A;  4NAL A;  1S80 A;  2BO6 A;  2JF3 A;  4Y62 A;  3RMW A;  3SXD A;  2JCL A;  2FYD B;  4FRL A;  5CQL X;  4KC2 A;  1JVD A;  5HS2 A;  3OW5 A;  3R2W A;  4G3Q A;  3I3X A;  1NWG B;  5AFU U;  2RJ6 A;  2P2O A;  4HUS A;  4FIY A;  1ZI5 A;  1KHR A;  1H7Q A;  4KNR A;  3BRK X;  2VXM A;  3I0K A;  4B4M A;  3KWD A;  2GGO A;  1ZJO A;  4FIX A;  2D0J A;  4B4B A;  4DE7 A;  2Z87 A;  4FRD A;  4KT7 A;  2ZU7 A;  3Q80 A;  3HSQ A;  2JCK A;  1XHB A;  2J0B A;  2V0J A;  2BO4 A;  1O7O A;  1HM9 A;  1ZI1 A;  2YC3 A;  1ON8 A;  3TV0 A;  4FRH A;  1VPA A;  1WT3 A;  3T7O A;  2YQJ A;  3BSW A;  1VZT A;  5C3A A;  2PA4 A;  5ADX V;  2W0W A;  3V8Y A;  2V0L A;  3FSC A;  1MP3 A;  4IHG A;  2RJ4 A;  3U0X A;  4O6N A;  3CKO A;  4NAI A;  2Z86 A;  4EA7 A;  4CJ8 A;  4KC1 A;  3PNN A;  4M4K A;  4IRQ A;  1FGG A;  1ZJ1 A;  3R3I A;  3OH0 A;  3SPT A;  1G8O A;  2Y4K A;  3IOH A;  1QRE A;  2AM5 A;  4HO3 A;  5ADX U;  3OH1 A;  4L41 C;  2UX8 A;  2ICX A;  3U2V A;  3Q1X A;  3GQ8 A;  1FXJ A;  2D7I A;  3VNP A;  2QKX A;  2VS4 A;  3I0H A;  3R0S A;  4HO5 A;  3Q4S A;  3D8V A;  5C3D A;  1GWV A;  1QG8 A;  1H7G A;  2XME A;  4G87 A;  3F1Y A;  4Y7V A;  2XWL A;  1W57 A;  4G3S A;  4FRQ A;  1QGQ A;  5L6V A;  5AJO A;  2IU9 A;  3V0O A;  3ST8 A;  2OEF A;  1YP3 A;  4D11 C;  4KQL A;  4EE4 A;  1FG5 N;  4Y64 A;  3RMV A;  3D98 A;  1ZI4 A;  2FFU A;  1NHE B;  3EH0 A;  4ASY A;  4FCU A;  2QH5 A;  2ZU8 A;  2FY7 A;  4K6R A;  1O0R A;  2RJ9 A;  4Y63 A;  5C8R A;  1PZT A;  5D92 A;  3NGW A;  1ON6 A;  4ECM A;  1NMM B;  1VGW A;  3T7M A;  2O1G A;  3VBN A;  4DCL A;  3SXA A;  3ZLK A;  3GQ9 A;  5EJZ A;  2XAT A;  3R5D A;  1QGS A;  2I5E A;  2YCM A;  3U0Y A;  4HZD A;  4E75 A;  2NPO A;  2X5Z A;  4D48 A;  1H4D A;  2RIX A;  2WVM A;  4MYB A;  4M9C A;  2RIZ A;  5D91 A;  3BSS A;  4R7P A;  4KPX A;  4E6U A;  1VGZ A;  3CGX A;  1H5S D;  2FYA A;  3U2T A;  4N6B A;  3CKV A;  4M2A A;  1W55 A;  2WVK A;  3GOS A;  1H7L A;  4NAN A;  1KRV A;  1SSM A;  2QIA A;  4M98 A;  1G97 A;  1FR8 A;  3I0I X;  1R80 A;  1VIC A;  4AA7 A;  4EEO A;  5E3Q A;  5C4D A;  3RSB A;  2Y6P A;  3I0C A;  1J2Z A;  2TDT A;  1O7Q A;  2C0N A;  1FOA A;  5IDT A;  1H3M A;  5CQN X;  3JQY A;  2VFZ A;  1FR9 A;  2VHE A;  4ISX A;  3VBJ A;  1MRL A;  3V0L A;  1ZJ0 A;  2QGI A;  3OC9 A;  1R81 A;  5C48 A;  3SXB A;  1H5S B;  2RIY A;  4NAK A;  4BMA A;  1R7T A;  3VBP A;  1HM8 A;  2OI5 A;  4YS8 A;  3EG4 A;  1QRG A;  1H5S C;  4Y7G A;  4GBP A;  2Q4J A;  3LW6 A;  5CMJ A;  1H4C A;  4P02 A;  2VSH A;  2WLF A;  1ZIZ A;  3V0N A;  4Y6U A;  1H4E A;  1WVC A;  1HM0 A;  2WGZ A;  1I52 A;  1MR9 A;  1MR7 A;  4B2W A;  2WVL A;  5IDS A;  1JVG A;  3ECT A;  5J49 A;  2AGD A;  1KQA A;  4DDZ A;  4JIS A;  1FO8 A;  4LW6 A;  3I0G A;  2OI6 A;  4R36 A;  1MC3 A;  3IOJ A;  4HO6 A;  2A8W A;  4ZDQ A;  2YES A;  4C2S A;  5I1F A;  2IC7 A;  4N6A A;  3VBM A;  1TW1 A;  3I0J A;  2E3D A;  1QQ0 A;  3GQA A;  2ICY A;  2O1F A;  5EIY A;  1ZDG A;  1ZJP A;  3NZ2 A;  3GQ7 A;  1JYK A;  1OMX A;  1FXO A;  1GQ9 A;  5CQO A;  3FS8 A;  1VH1 A;  3BCV A;  2V0I A;  1PZY B;  1V84 A;  1VM8 A;  1EWW A;  1FO9 A;  4FRB A;  1R7X A;  3OH4 A;  1ZHJ A;  5FV9 A;  1TZF A;  3SXG A;  5E3P A;  2Y7A A;  1K4V A;  2BO8 A;  1QRM A;  3OTM A;  3VBI A;  1ZDF A;  3TWD A;  2AE7 A;  4P00 A;  1IIM A;  4UEG A;  1SST A;  3JUJ A;  3SX5 A;  2WAW A;  3BFP A;  1V3W A;  2FFV A;  1H5S A;  3P1B A;  1R7U A;  4J18 A;  1INJ A;  5CMG X;  1QRF A;  1FGX A;  3IOI A;  1WT0 A;  4M99 A;  1ZJ3 A;  3EEV A;  1H7H A;  1ZI3 A;  3U2U A;  3V8Z A;  3IXC A;  2YQH A;  1W77 A;  3HL3 A;  4EE3 A;  3OU9 A;  1FZW A;  4B4G A;  1WT1 A;  2P6W A;  2WLC A;  1WT2 A;  3DUV A;  4M2B A;  3OH2 A;  5DG3 A;  3T7N A;  2Y4M A;  2RJ8 A;  3JTJ A;  3PKQ A;  3TZT A;  5CMH A;  5IFY A;  3C8V A;  3I0E A;  2JCJ A;  2JF2 A;  1TVY A;  3R1W A;  3PMO A;  5AJN A;  5DEP A;  4HOC A;  3R3R A;  2RJ7 A;  3JUK A;  3SX7 A;  4EE5 A;  3E26 A;  1E5K A;  4Y7T A;  2O1H A;  4HG6 A;  4FRE A;  1H7F A;  5FUH A;  3R8Y A;  2WE9 A;  2YQC A;  3ZGF A;  2Y4J A;  1IIN A;  2JCO A;  3KIA A;  5L6S A;  4XWI A;  4MYO A;  3CKJ A;  1LXA A;  4AC3 A;  3DHO A;  3V4E A;  3GVD A;  3V0P A;  3FSY A;  1O23 B;  1G95 A;  2P73 A;  1XHD A;  1KK4 A;  2WLE A;  4MZU A;  2PGV A;  4EAB A;  3TIS A;  4AYL A;  3VBK A; 
#chains in the Genus database with same CATH homology
 2VK9 A;  2OEG A;  3N9W A;  2RIJ A;  4IRP A;  5DDT A;  5FTV A;  1VZX A;  4D11 A;  1INI A;  1NKH B;  2APC A;  2WLD A;  1LZ0 A;  3GUE A;  3K8E A;  4HUR A;  1EYR A;  3POL A;  3K8D A;  3USR A;  1LZ7 A;  2VS3 A;  2AES A;  1LL2 A;  3EE5 A;  5FTS A;  4ARW A;  1ZCU A;  1WSZ A;  1H5T B;  4E1K A;  5FU8 A;  3P47 A;  3R5B A;  3FSB A;  3I0L A;  2XWM A;  1NQI B;  2AM4 A;  3I0D A;  2IUA A;  1R7Y A;  2X5S A;  1ZJ2 A;  3OKR A;  1TW5 A;  4M28 A;  4CJC A;  1HJL A;  2MZB A;  3BXY A;  3R5C A;  4EQY A;  2X60 A;  4JD0 A;  1NF5 B;  2FYB A;  3D5N A;  5E3R A;  4FRO A;  4Q7C A;  1JYL A;  4E6T A;  5C4B A;  1HJJ A;  2I7B A;  5BXC A;  2VS5 A;  1G1L A;  4FQW A;  3I3A A;  4FCE A;  5CMI A;  4EA8 A;  4EAA A;  4HCQ A;  4KPZ A;  5CMF X;  1OCX A;  1G93 A;  5DDV A;  5C1G A;  4B5B A;  4IHF A;  4LW3 A;  1H5R B;  3USQ A;  4MND A;  4EEG A;  2A8U A;  1H7E A;  2XMH A;  4FRM A;  3SX3 A;  1HV9 A;  1V67 A;  3CKN A;  2XWN A;  4MFG A;  3O3P A;  4HO2 A;  4Y7U A;  4AYJ A;  2RJ0 A;  4EEM A;  3TIO A;  4FRP A;  3TQD A;  2VXL A;  4KXO A;  3OTZ A;  1GQC A;  5C4C A;  3DJ4 A;  1GWW A;  2PX7 A;  2OI7 A;  1JV3 A;  2WLG A;  4R37 A;  1MP4 A;  2AEC A;  1ZCY A;  4G3P A;  3PKP A;  3OAM A;  1OQM B;  3SX8 A;  3V0Q A;  4KNX A;  2AQ9 A;  5C3B A;  4HZC A;  3CJ8 A;  3MQH A;  3U2X A;  3KWC A;  2VD4 A;  1VGU A;  1G23 A;  5F42 A;  1JV1 A;  1OMZ A;  3IGJ A;  2P72 A;  4AAW A;  4B42 A;  3KWE A;  1H5T A;  1G9R A;  1FWY A;  1V82 A;  3T57 A;  2AM3 A;  1KRU A;  2FKO A;  1LZI A;  1LZJ A;  4IHH A;  4EVW A;  1VZU A;  3FOQ A;  5C1L A;  1QRL A;  2VSI A;  1FRW A;  4N69 A;  2AH9 A;  1R7V A;  3U2W A;  4Y6N A;  1KK6 A;  3E25 A;  4CJB A;  4J09 A;  1GA8 A;  5C4E A;  4HO9 A;  1EZI A;  1GX0 A;  3HJJ A;  1G0R A;  3ZGG A;  1V83 A;  3F1C A;  1YP4 A;  2IU8 A;  5EJ1 A;  2I5K A;  1VGT A;  4D0Z A;  5CQM X;  1SSQ A;  4MIX A;  4Y7F A;  1ZCV A;  5C36 A;  4KC4 A;  2D7R A;  3SXC A;  4O6M A;  1H5R A;  3ZLL A;  1MP5 A;  2GGQ A;  1YP2 A;  3FTT A;  1S4N A;  1QWJ A;  5C1H A;  5DEM A;  4B2X A;  1SS9 A;  4HO8 A;  1XZ6 A;  4ASJ A;  5C4F A;  3FSX A;  1S4O A;  2BO7 A;  5JQQ A;  2W0V A;  1YRO B;  5C49 A;  3VBL A;  4DEC A;  5U2K A;  2X65 A;  3CKQ A;  4Y9X A;  4FRA A;  2NXV A;  3ZF8 A;  2PGY A;  2V0K A;  1KRR A;  1S4P A;  4EGG A;  2FYC B;  5AJP A;  4B3U A;  1LL0 A;  3DK5 A;  4HO0 A;  3MQG A;  1G2V A;  1R82 A;  3CU0 A;  3OGZ A;  3R5A A;  2CU2 A;  3MC4 A;  2YC5 A;  3BSY A;  3F1X A;  3TK8 A;  5FYE A;  4BQH A;  1ZCT A;  1LL3 A;  3SXE A;  4D0T A;  1TDT A;  1GX4 A;  4N27 A;  1XAT A;  1G3L A;  1KK5 A;  4E79 A;  3OUP A;  3OH3 A;  3Q7U A;  3V90 A;  5FU0 A;  3QVB A;  2E8B A;  4H7O A;  2WEE A;  1THJ A;  1T3D A;  2V0H A;  2RJ5 A;  2Y4L A;  4EA9 A;  1VH3 A;  5C47 A;  4HO4 A;  1KWS A;  2ZU9 A;  4KRV A;  3I0F A;  2DPW A;  2RIT A;  1KGT A;  3FWW A;  4EEA A;  5C38 A;  3TDT A;  2QIV X;  2J0A A;  1H7T A;  3SRT A;  2YQS A;  2RJ1 A;  3V0M A;  5AFU V;  1Z90 A;  3V91 A;  1KGQ A;  4CVH A;  1LVW A;  5CQP A;  4NAL A;  1S80 A;  2BO6 A;  2JF3 A;  4Y62 A;  3RMW A;  3SXD A;  2JCL A;  2FYD B;  4FRL A;  5CQL X;  4KC2 A;  1JVD A;  5HS2 A;  3OW5 A;  3R2W A;  4G3Q A;  3I3X A;  1NWG B;  5AFU U;  2RJ6 A;  2P2O A;  4HUS A;  4FIY A;  1ZI5 A;  1KHR A;  1H7Q A;  4KNR A;  3BRK X;  2VXM A;  3I0K A;  4B4M A;  3KWD A;  2GGO A;  1ZJO A;  4FIX A;  2D0J A;  4B4B A;  4DE7 A;  2Z87 A;  4FRD A;  4KT7 A;  2ZU7 A;  3Q80 A;  3HSQ A;  2JCK A;  1XHB A;  2J0B A;  2V0J A;  2BO4 A;  1O7O A;  1HM9 A;  1ZI1 A;  2YC3 A;  1ON8 A;  3TV0 A;  4FRH A;  1VPA A;  1WT3 A;  3T7O A;  2YQJ A;  3BSW A;  1VZT A;  5C3A A;  2PA4 A;  5ADX V;  2W0W A;  3V8Y A;  2V0L A;  3FSC A;  1MP3 A;  4IHG A;  2RJ4 A;  3U0X A;  4O6N A;  3CKO A;  4NAI A;  2Z86 A;  4EA7 A;  4CJ8 A;  4KC1 A;  3PNN A;  4M4K A;  4IRQ A;  1FGG A;  1ZJ1 A;  3R3I A;  3SPT A;  1G8O A;  3OH0 A;  2Y4K A;  3IOH A;  1QRE A;  2AM5 A;  4HO3 A;  5ADX U;  3OH1 A;  4L41 C;  2UX8 A;  2ICX A;  3U2V A;  3Q1X A;  2D7I A;  1FXJ A;  3VNP A;  2QKX A;  2VS4 A;  3I0H A;  3R0S A;  4HO5 A;  3Q4S A;  3D8V A;  5C3D A;  1GWV A;  1QG8 A;  1H7G A;  2XME A;  4G87 A;  3F1Y A;  4Y7V A;  2XWL A;  1W57 A;  4G3S A;  4FRQ A;  1QGQ A;  5L6V A;  5AJO A;  2IU9 A;  3V0O A;  3ST8 A;  2OEF A;  1YP3 A;  4D11 C;  4KQL A;  4EE4 A;  1FG5 N;  4Y64 A;  3RMV A;  3D98 A;  1ZI4 A;  2FFU A;  1NHE B;  3EH0 A;  4ASY A;  4FCU A;  2QH5 A;  2ZU8 A;  2FY7 A;  4K6R A;  1O0R A;  2RJ9 A;  4Y63 A;  5C8R A;  1PZT A;  5D92 A;  3NGW A;  1ON6 A;  4ECM A;  1NMM B;  1VGW A;  3T7M A;  2O1G A;  3VBN A;  4DCL A;  3SXA A;  3ZLK A;  5EJZ A;  2XAT A;  3R5D A;  1QGS A;  2I5E A;  2YCM A;  3U0Y A;  4HZD A;  4E75 A;  2NPO A;  2X5Z A;  4D48 A;  1H4D A;  2RIX A;  2WVM A;  4MYB A;  4M9C A;  2RIZ A;  5D91 A;  3BSS A;  4R7P A;  4KPX A;  4E6U A;  1VGZ A;  3CGX A;  1H5S D;  2FYA A;  3U2T A;  4N6B A;  3CKV A;  4M2A A;  1W55 A;  2WVK A;  3GOS A;  1H7L A;  4NAN A;  1KRV A;  1SSM A;  2QIA A;  4M98 A;  1G97 A;  1FR8 A;  3I0I X;  1R80 A;  1VIC A;  4AA7 A;  4EEO A;  5E3Q A;  5C4D A;  3RSB A;  2Y6P A;  3I0C A;  1J2Z A;  2TDT A;  1O7Q A;  2C0N A;  1FOA A;  5IDT A;  1H3M A;  5CQN X;  3JQY A;  2VFZ A;  1FR9 A;  2VHE A;  4ISX A;  3VBJ A;  1MRL A;  3V0L A;  1ZJ0 A;  2QGI A;  3OC9 A;  1R81 A;  5C48 A;  3SXB A;  1H5S B;  2RIY A;  4NAK A;  4BMA A;  1R7T A;  3VBP A;  1HM8 A;  2OI5 A;  4YS8 A;  3EG4 A;  1QRG A;  1H5S C;  4Y7G A;  4GBP A;  2Q4J A;  3LW6 A;  5CMJ A;  1H4C A;  4P02 A;  2VSH A;  2WLF A;  1ZIZ A;  3V0N A;  4Y6U A;  1H4E A;  1WVC A;  1HM0 A;  2WGZ A;  1I52 A;  1MR9 A;  1MR7 A;  4B2W A;  2WVL A;  5IDS A;  1JVG A;  3ECT A;  5J49 A;  2AGD A;  1KQA A;  4DDZ A;  4JIS A;  1FO8 A;  4LW6 A;  3I0G A;  2OI6 A;  4R36 A;  1MC3 A;  3IOJ A;  4HO6 A;  2A8W A;  4ZDQ A;  2YES A;  4C2S A;  5I1F A;  2IC7 A;  4N6A A;  3VBM A;  1TW1 A;  3I0J A;  2E3D A;  1QQ0 A;  2ICY A;  2O1F A;  5EIY A;  1ZDG A;  1ZJP A;  3NZ2 A;  1JYK A;  1OMX A;  1FXO A;  1GQ9 A;  5CQO A;  3FS8 A;  1VH1 A;  3BCV A;  2V0I A;  1PZY B;  1V84 A;  1VM8 A;  1FO9 A;  4FRB A;  1R7X A;  3OH4 A;  1ZHJ A;  5FV9 A;  1TZF A;  3SXG A;  5E3P A;  2Y7A A;  1K4V A;  2BO8 A;  1QRM A;  3OTM A;  3VBI A;  1ZDF A;  3TWD A;  2AE7 A;  4P00 A;  1IIM A;  4UEG A;  1SST A;  3JUJ A;  3SX5 A;  2WAW A;  3BFP A;  1V3W A;  2FFV A;  1H5S A;  3P1B A;  1R7U A;  4J18 A;  1INJ A;  5CMG X;  1QRF A;  1FGX A;  3IOI A;  1WT0 A;  4M99 A;  1ZJ3 A;  3EEV A;  1H7H A;  1ZI3 A;  3U2U A;  3V8Z A;  3IXC A;  2YQH A;  1W77 A;  3HL3 A;  4EE3 A;  3OU9 A;  1FZW A;  4B4G A;  1WT1 A;  2P6W A;  2WLC A;  1WT2 A;  3DUV A;  4M2B A;  3OH2 A;  5DG3 A;  3T7N A;  2Y4M A;  2RJ8 A;  3JTJ A;  3PKQ A;  3TZT A;  5CMH A;  5IFY A;  3C8V A;  3I0E A;  2JCJ A;  2JF2 A;  1TVY A;  3R1W A;  3PMO A;  5AJN A;  5DEP A;  4HOC A;  3R3R A;  2RJ7 A;  3JUK A;  3SX7 A;  4EE5 A;  3E26 A;  1E5K A;  4Y7T A;  2O1H A;  4HG6 A;  4FRE A;  1H7F A;  5FUH A;  3R8Y A;  2WE9 A;  2YQC A;  3ZGF A;  2Y4J A;  1IIN A;  2JCO A;  3KIA A;  5L6S A;  4XWI A;  4MYO A;  3CKJ A;  1LXA A;  4AC3 A;  3DHO A;  3V4E A;  3GVD A;  3V0P A;  3FSY A;  1O23 B;  1G95 A;  2P73 A;  1XHD A;  1KK4 A;  2WLE A;  4MZU A;  2PGV A;  4EAB A;  3TIS A;  4AYL A;  3VBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...