4HCQA

Crystal structure of glmu from mycobacterium tuberculosis in complex with glucosamine-1-phosphate
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
b'DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein GlmU
publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4hcqA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4hcqA01
2ZU8A 4HURA 2E8BA 5AFUV 3R8YA 1PZTA 3GVDA 2ICYA 1G1LA 2WVMA 1H7HA 4HOCA 4CJBA 5EIYA 5DG3A 2ICXA 1MP4A 3F1XA 4B42A 2AH9A 1I52A 2WE9A 1HJLA 3ECTA 3CKOA 4EA8A 1ZCVA 3SX5A 1QQ0A 3R5BA 1H4DA 5C4CA 4N27A 3U2TA 5HS2A 1R7XA 4Y7GA 2FYBA 5C1HA 1IINA 2Y4LA 3VBKA 3E26A 3IOJA 2RJ4A 2Z86A 5E3PA 1H5SA 1FOAA 2IU9A 4JISA 2JF2A 2RJ1A 3V8YA 2W0WA 3VBLA 1G93A 1TW1A 3BFPA 3PMOA 1QRGA 3SPTA 2X60A 5FV9A 2A8WA 4AA7A 1LZIA 3TK8A 1GX0A 3U2VA 3TQDA 3ZLKA 1ZDFA 5C4FA 3NGWA 4E75A 2VXLA 1V83A 4D48A 1VGZA 3VBIA 1R82A 3TWDA 2AECA 1QREA 4M9CA 4Y64A 3HSQA 4AYLA 4IHGA 2WLGA 3VBNA 2Q4JA 3VBPA 2RIYA 3I0EA 5DEPA 2OI6A 3GOSA 3IOIA 4M2BA 3OH0A 4M99A 3BCVA 4B2WA 2YESA 1KK6A 1WT1A 1IIMA 1QG8A 1H7TA 4XWIA 2FY7A 1H7EA 3OH2A 4ASYA 1GWWA 1SSTA 3D98A 5C48A 1MR7A 3VBMA 3KWCA 1MP3A 3NZ2A 4K6RA 1G9RA 2AGDA 4P02A 3CU0A 1FR9A 2BO7A 3HL3A 1XZ6A 2QH5A 4KC1A 3FSYA 2A8UA 2I5KA 1H7LA 1LVWA 2BO6A 5CMFX 4MFGA 2YQJA 1KHRA 4E6TA 3T7NA 4KNXA 5AJPA 2Y4KA 5C4DA 4HZDA 2E3DA 1H5SD 3V91A 1ZIZA 3RMVA 1FO8A 1YROB 2D7RA 1KRUA 3FS8A 4G3SA 2QIVX 1H5TB 1ZJ0A 1VGTA 3FOQA 2JCLA 4N69A 1GA8A 5C49A 5C1LA 1FRWA 1R7VA 4FRQA 4KQLA 4FROA 2VSHA 2JCKA 3JQYA 4B4GA 4HO5A 5AJNA 4FRBA 2JF3A 1LL3A 4IHFA 5FU0A 5FTSA 4Y7UA 2AM5A 3SX8A 4EE3A 3U2XA 3R0SA 4IRPA 1MC3A 3FSXA 3BRKX 2IUAA 1SS9A 4LW6A 5C36A 4FRHA 4DCLA 1MR9A 3KWEA 3OAMA 3P47A 5FTVA 5L6VA 4G3PA 2RJ5A 2UX8A 3Q4SA 5F42A 2VS5A 3CKVA 4LW3A 3I0LA 1S4OA 1KGQA 2AE7A 4EQYA 5CMGX 3EE5A 4G3QA 3EH0A 1KK4A 1OMZA 1JYLA 1OMXA 1KK5A 4N6AA 4HO9A 4KRVA 2X5SA 1VH3A 2QIAA 3D5NA 1V67A 4C2SA 4EVWA 1NWGB 4M4KA 1R7UA 4Y63A 1YP4A 1FXJA 3BXYA 3C8VA 4NANA 1JV3A 1LL2A 3IOHA 4GBPA 3U0YA 3OH4A 5E3RA 1R80A 3R3RA 2WLDA 4KC2A 2P72A 2VS3A 4D11C 2O1FA 2OEFA 3O3PA 2ZU7A 3DJ4A 3I0DA 1FO9A 1S80A 4E6UA 4HO3A 4EA9A 1V84A 1QWJA 4BQHA 3FSBA 4DDZA 2VFZA 4DE7A 3OU9A 1OQMB 3T7OA 2WVKA 1G23A 2Y7AA 4NAIA 2I5EA 5C3AA 5CQLX 1VM8A 4Y9XA 2P73A 1EYRA 1FZWA 3F1CA 1WT3A 5I1FA 4FCEA 2X65A 4B5BA 3D8VA 1LZ0A 5JQQA 5FYEA 3V90A 1O23B 3VNPA 3MC4A 3I0JA 1VZTA 4Y62A 1ZI1A 2FFVA 2PGYA 4HO2A 2RIXA 3BSWA 5E3QA 4D0ZA 3PKQA 3V0QA 3I0GA 4N6BA 2XWMA 5ADXU 3I0KA 3RSBA 2RJ8A 2CU2A 1VZUA 2XMHA 3K8EA 3OH3A 2YCMA 1VICA 3PKPA 2APCA 1H7GA 4HO4A 4CJCA 2QKXA 5IFYA 3R5AA 1WVCA 1ZCTA 3SRTA 2RJ6A 1ZJ3A 3CKNA 1JVGA 3KWDA 2PX7A 4FRPA 1QGQA 2RIJA 2YC3A 3I0IX 3ZLLA 5DEMA 1MRLA 4B2XA 2IU8A 1ZJPA 2FYAA 4EEMA 1NKHB 4EAAA 1TDTA 3VBJA 2FKOA 1JV1A 3MQHA 4ISXA 1G0RA 1R7TA 5L6SA 3I0HA 3CKQA 5DDVA 2JCOA 1THJA 4EGGA 3TV0A 4HG6A 1FWYA 4EABA 2V0JA 3OTZA 1QGSA 2Y6PA 4AYJA 3P1BA 3R3IA 4ZDQA 1FGGA 2AESA 1XHDA 4R7PA 4Y7TA 1R81A 3PNNA 4FRMA 1S4PA 1ZCUA 4M98A 5CMHA 3USQA 1KWSA 3SX3A 5AJOA 3BSYA 3OUPA 1G95A 2WLFA 1LL0A 3POLA 3KIAA 1QRFA 1V82A 2WVLA 4J09A 4R37A 1O0RA 5CMIA 4ARWA 3Q7UA 2RITA 1ZJ1A 1INJA 1XATA 1K4VA 2RJ9A 1HJJA 2YQCA 2YQHA 4KC4A 1WT2A 1ZDGA 4M28A 1E5KA 3OH1A 2IC7A 3DUVA 4FQWA 5C47A 1H5TA 1T3DA 1G97A 2V0KA 2AM3A 4KT7A 3V0OA 4MZUA 1TZFA 3CJ8A 2O1GA 4Y7FA 3FTTA 3R5CA 1W77A 1ON8A 1H5SC 1SSMA 2YC5A 1HM8A 5IDSA 3I3XA 1PZYB 3OW5A 5ADXV 3CKJA 4Y7VA 2PGVA 1ON6A 3SXAA 3TISA 3SXDA 3LW6A 1TW5A 5BXCA 2WAWA 2FYDB 2X5ZA 3JUJA 5EJZA 3ZF8A 2P2OA 5C3BA 1H7FA 2RJ0A 4IRQA 3OC9A 3TDTA 3SXBA 2TDTA 4KPZA 1LZ7A 5CQPA 1NF5B 4JD0A 1HM0A 1HM9A 5U2KA 3RMWA 5FUHA 5CQOA 3SXEA 4G87A 5FU8A 1ZJOA 5C38A 4B4BA 4AAWA 2Z87A 3DK5A 2AQ9A 1ZHJA 2ZU9A 5EJ1A 4KXOA 1WSZA 1NHEB 3EG4A 1V3WA 4IHHA 1VGUA 1KQAA 4MYOA 2VD4A 4R36A 2RIZA 1W57A 1KRVA 1ZI5A 1YP3A 1Z90A 3GUEA 1MP5A 5J49A 1GX4A 1WT0A 3I0CA 5CQNX 4AC3A 3SX7A 3SXCA 3V0LA 1NQIB 1LXAA 2MZBA 3E25A 1H5RB 2V0IA 2WLCA 3JTJA 1TVYA 4Y6NA 3V0MA 4D11A 3Q1XA 2FFUA 3R5DA 1JVDA 4BMAA 3HJJA 2W0VA 3IGJA 2P6WA 4P00A 4CJ8A 2XATA 3T7MA 1QRMA 2D7IA 1YP2A 3R1WA 4FCUA 4B4MA 4MNDA 4L41C 2Y4MA 1FR8A 5C4BA 3N9WA 3TIOA 2OEGA 2D0JA 2JCJA 2XMEA 3V0NA 1GWVA 1VPAA 3V4EA 3V8ZA 4Y6UA 3ZGGA 3U2WA 5AFUU 1EZIA 2NPOA 3TZTA 1VH1A 1W55A 3IXCA 1OCXA 3OKRA 1SSQA 1LZJA 1NMMB 2PA4A 3MQGA 1O7OA 4HO6A 3SXGA 2AM4A 4J18A 2OI5A 3I3AA 1H5RA 1J2ZA 4ASJA 1HV9A 4EEAA 4HO0A 4EA7A 2YQSA 3I0FA 3QVBA 3K8DA 5C1GA 2WGZA 4HUSA 1FXOA 2VSIA 2WLEA 1XHBA 3OTMA 4HZCA 2GGQA 4EE5A 4ECMA 3DHOA 1KRRA 1G2VA 4YS8A 2WEEA 1H4EA 4UEGA 4EEGA 4H7OA 4E1KA 2VS4A 4MYBA 4DECA 4FRDA 4KNRA 3U0XA 3FSCA 4FREA 2OI7A 3R2WA 3USRA 1VGWA 3OGZA 2BO8A 1ZI3A 1VZXA 1ZCYA 3U2UA 2RJ7A 2O1HA 4B3UA 4M2AA 5C8RA 2GGOA 1KGTA 2V0HA 3T57A 2VHEA 3CGXA 2Y4JA 2QGIA 2FYCB 1GQCA 2XWNA 3F1YA 1FG5N 3V0PA 4KPXA 4HCQA 5CMJA 2V0LA 3EEVA 2BO4A 2XWLA 1S4NA 1QRLA 1INIA 1JYKA 2DPWA 4FRAA 4NALA 2VXMA 5IDTA 1G8OA 2I7BA 5C3DA 4NAKA 4E79A 2NXVA 1O7QA 3JUKA 5C4EA 4D0TA 1H5SB 5CQMX 4CVHA 1H7QA 1FGXA 5DDTA 1ZJ2A 1G3LA 4EEOA 1ZI4A 3ST8A 1GQ9A 4HO8A 1R7YA 1H4CA 3Q80A 4FRLA 3FWWA 4EE4A 1H3MA 3ZGFA 3BSSA
chains in the Genus database with same CATH superfamily
2ZU8A 4HURA 2E8BA 5AFUV 3R8YA 1PZTA 3GVDA 2ICYA 1G1LA 2WVMA 1H7HA 4HOCA 4CJBA 5EIYA 5DG3A 2ICXA 1MP4A 3F1XA 4B42A 2AH9A 1I52A 2WE9A 1HJLA 3ECTA 3CKOA 4EA8A 1ZCVA 3SX5A 1QQ0A 3R5BA 1H4DA 5C4CA 4N27A 3U2TA 5HS2A 1R7XA 4Y7GA 2FYBA 5C1HA 1IINA 2Y4LA 3VBKA 3E26A 3IOJA 2RJ4A 2Z86A 5E3PA 1H5SA 1FOAA 2IU9A 4JISA 2JF2A 2RJ1A 3V8YA 2W0WA 3VBLA 1G93A 1TW1A 3BFPA 3PMOA 1QRGA 3SPTA 2X60A 5FV9A 2A8WA 4AA7A 1LZIA 3TK8A 1GX0A 3U2VA 3TQDA 3ZLKA 1ZDFA 5C4FA 3NGWA 4E75A 2VXLA 1V83A 4D48A 1VGZA 3VBIA 1R82A 3TWDA 2AECA 1QREA 4M9CA 4O6MA 4Y64A 3HSQA 4AYLA 4IHGA 2WLGA 3VBNA 2Q4JA 3VBPA 2RIYA 3I0EA 5DEPA 2OI6A 3GOSA 3IOIA 4M2BA 3OH0A 4M99A 3BCVA 4B2WA 2YESA 1KK6A 1WT1A 1IIMA 3GQ8A 1QG8A 1H7TA 4XWIA 2FY7A 1H7EA 3OH2A 4ASYA 1GWWA 1SSTA 3D98A 3SUCA 5C48A 1MR7A 3VBMA 3KWCA 1MP3A 3NZ2A 4K6RA 1G9RA 2AGDA 4P02A 3CU0A 1FR9A 2BO7A 3HL3A 1XZ6A 2QH5A 4KC1A 3FSYA 2A8UA 2I5KA 1H7LA 1LVWA 2BO6A 5CMFX 4MFGA 2YQJA 1KHRA 4E6TA 3T7NA 4KNXA 5AJPA 2Y4KA 5C4DA 4HZDA 2E3DA 1H5SD 3V91A 1ZIZA 3RMVA 1FO8A 1YROB 2D7RA 1KRUA 3FS8A 4G3SA 2QIVX 1H5TB 1ZJ0A 1VGTA 3FOQA 2JCLA 4N69A 1GA8A 5C49A 5C1LA 1FRWA 1R7VA 4FRQA 4KQLA 4FROA 2VSHA 2JCKA 3JQYA 4B4GA 4HO5A 5AJNA 4FRBA 2JF3A 4IHFA 1LL3A 5FU0A 5FTSA 4Y7UA 2AM5A 3SX8A 4EE3A 3U2XA 3R0SA 4IRPA 1MC3A 3FSXA 3BRKX 2IUAA 1SS9A 4LW6A 5C36A 4FRHA 4DCLA 1MR9A 3KWEA 3OAMA 3P47A 5FTVA 5L6VA 4G3PA 2RJ5A 2UX8A 3Q4SA 5F42A 2VS5A 3CKVA 4LW3A 3I0LA 1S4OA 1KGQA 2AE7A 4EQYA 5CMGX 3EE5A 4G3QA 3EH0A 1KK4A 1OMZA 1M8NA 1N4IA 3GQAA 1JYLA 1OMXA 1KK5A 4N6AA 4HO9A 4KRVA 2X5SA 1VH3A 2QIAA 3D5NA 1V67A 4C2SA 4EVWA 1NWGB 4M4KA 1R7UA 4Y63A 1YP4A 1FXJA 3BXYA 3C8VA 4FIYA 4NANA 1JV3A 1LL2A 3IOHA 4GBPA 3U0YA 3OH4A 5E3RA 1R80A 3R3RA 2WLDA 4KC2A 2P72A 2VS3A 4D11C 2O1FA 2OEFA 3O3PA 2ZU7A 3DJ4A 3I0DA 1FO9A 1S80A 4E6UA 4HO3A 4EA9A 1V84A 1QWJA 4BQHA 3FSBA 4DDZA 2VFZA 4DE7A 3OU9A 1OQMB 3T7OA 2WVKA 1G23A 2Y7AA 4NAIA 2I5EA 5C3AA 5CQLX 1VM8A 4Y9XA 2P73A 1EYRA 1FZWA 3F1CA 1WT3A 5I1FA 4FCEA 2X65A 4B5BA 3D8VA 1LZ0A 5JQQA 5FYEA 3V90A 1O23B 3VNPA 3MC4A 3I0JA 1VZTA 4Y62A 1ZI1A 2FFVA 2PGYA 4HO2A 2RIXA 3BSWA 5E3QA 4D0ZA 3PKQA 3V0QA 3I0GA 4N6BA 2XWMA 5ADXU 3I0KA 3RSBA 2RJ8A 2CU2A 1VZUA 2XMHA 3K8EA 3OH3A 2YCMA 1VICA 3PKPA 2APCA 1H7GA 4HO4A 4CJCA 2QKXA 5IFYA 3R5AA 1WVCA 1ZCTA 3SRTA 2RJ6A 1ZJ3A 3CKNA 1JVGA 3KWDA 2PX7A 4FRPA 1QGQA 2RIJA 2YC3A 3I0IX 3ZLLA 5DEMA 1MRLA 4B2XA 1EWWA 2IU8A 1ZJPA 2FYAA 4EEMA 1NKHB 4EAAA 1TDTA 3VBJA 2FKOA 1JV1A 3MQHA 4ISXA 1G0RA 1R7TA 5L6SA 3I0HA 3CKQA 5DDVA 2JCOA 1THJA 4EGGA 3TV0A 4HG6A 1FWYA 4EABA 2V0JA 3OTZA 1QGSA 2Y6PA 4AYJA 3P1BA 3R3IA 4ZDQA 1FGGA 2AESA 1XHDA 4R7PA 4Y7TA 1R81A 3PNNA 4FRMA 1S4PA 1ZCUA 4M98A 5CMHA 3USQA 1KWSA 3SX3A 5AJOA 3BSYA 3OUPA 1G95A 2WLFA 1LL0A 3POLA 3KIAA 5D92A 1QRFA 1V82A 2WVLA 4J09A 4R37A 1O0RA 5CMIA 4ARWA 3Q7UA 2RITA 1ZJ1A 1INJA 1XATA 1K4VA 2RJ9A 1HJJA 2YQCA 2YQHA 4KC4A 1WT2A 1ZDGA 3OH1A 3GQ9A 4M28A 2IC7A 1E5KA 3DUVA 4FQWA 1H5TA 5C47A 1T3DA 1G97A 2V0KA 2AM3A 4KT7A 5D91A 3V0OA 4MZUA 1TZFA 3CJ8A 2O1GA 4Y7FA 3FTTA 3R5CA 1W77A 1ON8A 1H5SC 1SSMA 2YC5A 1HM8A 5IDSA 3I3XA 1PZYB 3OW5A 5ADXV 3CKJA 4Y7VA 2PGVA 1ON6A 3SXAA 3TISA 3SXDA 3LW6A 1TW5A 5BXCA 2WAWA 2FYDB 2X5ZA 3JUJA 5EJZA 3ZF8A 2P2OA 5C3BA 1H7FA 2RJ0A 4IRQA 3OC9A 3TDTA 3SXBA 2TDTA 2C0NA 4KPZA 1LZ7A 5CQPA 1NF5B 4JD0A 1HM0A 4MIXA 1HM9A 5U2KA 3RMWA 5FUHA 5CQOA 3SXEA 4G87A 5FU8A 1ZJOA 5C38A 4B4BA 4AAWA 2Z87A 2J0AA 3DK5A 2AQ9A 1ZHJA 2ZU9A 5EJ1A 4KXOA 1WSZA 1NHEB 3EG4A 1V3WA 4IHHA 1VGUA 1KQAA 4MYOA 2VD4A 4R36A 2RIZA 1W57A 1L0SA 1KRVA 1ZI5A 1YP3A 1Z90A 3GUEA 1MP5A 5J49A 1GX4A 1WT0A 3I0CA 5CQNX 4AC3A 3SX7A 3SXCA 3V0LA 1NQIB 1LXAA 2MZBA 3E25A 1H5RB 2V0IA 2WLCA 3JTJA 2VK9A 1TVYA 4Y6NA 3V0MA 4D11A 3Q1XA 2FFUA 3R5DA 1JVDA 4BMAA 3HJJA 2W0VA 3IGJA 2P6WA 4P00A 4CJ8A 2XATA 3T7MA 1QRMA 2D7IA 1YP2A 3R1WA 4FCUA 4B4MA 4MNDA 4L41C 2Y4MA 1FR8A 5C4BA 3N9WA 3TIOA 2OEGA 2D0JA 2JCJA 2XMEA 3V0NA 1GWVA 1VPAA 4Q7CA 3V4EA 3V8ZA 2J0BA 4Y6UA 3U2WA 5AFUU 3ZGGA 1EZIA 2NPOA 3TZTA 1VH1A 1W55A 3IXCA 1OCXA 3OKRA 1SSQA 1LZJA 1NMMB 2PA4A 3MQGA 1O7OA 4HO6A 3SXGA 2AM4A 4J18A 2OI5A 3I3AA 1H5RA 1J2ZA 4ASJA 1HV9A 4EEAA 4HO0A 4EA7A 2YQSA 3I0FA 3QVBA 3K8DA 5C1GA 2WGZA 4HUSA 1FXOA 2VSIA 2WLEA 1XHBA 3OTMA 4HZCA 2GGQA 4EE5A 4ECMA 3DHOA 1KRRA 1G2VA 4YS8A 2WEEA 1H4EA 4UEGA 4EEGA 4H7OA 4E1KA 1Z2FA 2VS4A 4MYBA 4FRDA 4DECA 4KNRA 3U0XA 3FSCA 4FREA 2OI7A 3R2WA 3USRA 1VGWA 3OGZA 2BO8A 1ZI3A 1VZXA 1ZCYA 3U2UA 2RJ7A 2O1HA 4B3UA 4M2AA 5C8RA 2GGOA 1KGTA 2V0HA 3T57A 2VHEA 3CGXA 2Y4JA 2QGIA 2FYCB 1GQCA 2XWNA 3F1YA 1FG5N 3V0PA 4KPXA 4HCQA 5CMJA 2V0LA 3EEVA 2BO4A 2XWLA 1S4NA 1QRLA 1INIA 1JYKA 2DPWA 4FRAA 4NALA 2VXMA 4O6NA 5IDTA 1G8OA 2I7BA 5C3DA 4NAKA 4E79A 2NXVA 4FIXA 1O7QA 3JUKA 5C4EA 4D0TA 1H5SB 5CQMX 4CVHA 1H7QA 1FGXA 5DDTA 1ZJ2A 1G3LA 4EEOA 1ZI4A 3ST8A 1GQ9A 4HO8A 3GQ7A 1R7YA 1H4CA 3Q80A 4FRLA 3FWWA 4EE4A 1H3MA 3ZGFA 3BSSA
chains in the Genus database with same CATH topology
2ZU8A 4HURA 2E8BA 5AFUV 3R8YA 1PZTA 3GVDA 2ICYA 1G1LA 2WVMA 1H7HA 4HOCA 4CJBA 5EIYA 5DG3A 2ICXA 1MP4A 3F1XA 4B42A 2AH9A 1I52A 2WE9A 1HJLA 3ECTA 3CKOA 4EA8A 1ZCVA 3SX5A 1QQ0A 3R5BA 1H4DA 5C4CA 4N27A 3U2TA 5HS2A 1R7XA 4Y7GA 2FYBA 5C1HA 1IINA 2Y4LA 3VBKA 3E26A 3IOJA 2RJ4A 2Z86A 5E3PA 1H5SA 1FOAA 2IU9A 4JISA 2JF2A 2RJ1A 3V8YA 2W0WA 3VBLA 1G93A 1TW1A 3BFPA 3PMOA 1QRGA 3SPTA 2X60A 5FV9A 2A8WA 4AA7A 1LZIA 3TK8A 1GX0A 3U2VA 3TQDA 3ZLKA 1ZDFA 5C4FA 3NGWA 4E75A 2VXLA 1V83A 4D48A 1VGZA 3VBIA 1R82A 3TWDA 2AECA 1QREA 4M9CA 4O6MA 4Y64A 3HSQA 4AYLA 4IHGA 2WLGA 3VBNA 2Q4JA 3VBPA 2RIYA 3I0EA 5DEPA 2OI6A 3GOSA 3IOIA 4M2BA 3OH0A 4M99A 3BCVA 4B2WA 2YESA 1KK6A 1WT1A 1IIMA 1QG8A 1H7TA 4XWIA 2FY7A 1H7EA 3OH2A 4ASYA 1GWWA 1SSTA 3D98A 5C48A 1MR7A 3VBMA 3KWCA 1MP3A 3NZ2A 4K6RA 1G9RA 2AGDA 4P02A 3CU0A 1FR9A 2BO7A 3HL3A 1XZ6A 2QH5A 4KC1A 3FSYA 2A8UA 2I5KA 1H7LA 1LVWA 2BO6A 5CMFX 4MFGA 2YQJA 1KHRA 4E6TA 3T7NA 4KNXA 5AJPA 2Y4KA 5C4DA 4HZDA 2E3DA 1H5SD 3V91A 1ZIZA 3RMVA 1FO8A 1YROB 2D7RA 1KRUA 3FS8A 4G3SA 2QIVX 1H5TB 1ZJ0A 1VGTA 3FOQA 2JCLA 4N69A 1GA8A 5C49A 5C1LA 1FRWA 1R7VA 4FRQA 4KQLA 4FROA 2VSHA 2JCKA 3JQYA 4B4GA 4HO5A 5AJNA 4FRBA 2JF3A 1LL3A 4IHFA 5FU0A 5FTSA 4Y7UA 2AM5A 3SX8A 4EE3A 3U2XA 3R0SA 4IRPA 1MC3A 3FSXA 3BRKX 2IUAA 1SS9A 4LW6A 5C36A 4FRHA 4DCLA 1MR9A 3KWEA 3OAMA 3P47A 5FTVA 5L6VA 4G3PA 2RJ5A 2UX8A 3Q4SA 5F42A 2VS5A 3CKVA 4LW3A 3I0LA 1S4OA 1KGQA 2AE7A 4EQYA 5CMGX 3EE5A 4G3QA 3EH0A 1KK4A 1OMZA 1JYLA 1OMXA 1KK5A 4N6AA 4HO9A 4KRVA 2X5SA 1VH3A 2QIAA 3D5NA 1V67A 4C2SA 4EVWA 1NWGB 4M4KA 1R7UA 4Y63A 1YP4A 1FXJA 3BXYA 3C8VA 4FIYA 4NANA 1JV3A 1LL2A 3IOHA 4GBPA 3U0YA 3OH4A 5E3RA 1R80A 3R3RA 2WLDA 4KC2A 2P72A 2VS3A 4D11C 2O1FA 2OEFA 3O3PA 2ZU7A 3DJ4A 3I0DA 1FO9A 1S80A 4E6UA 4HO3A 4EA9A 1V84A 1QWJA 4BQHA 3FSBA 4DDZA 2VFZA 4DE7A 3OU9A 1OQMB 3T7OA 2WVKA 1G23A 2Y7AA 4NAIA 2I5EA 5C3AA 5CQLX 1VM8A 4Y9XA 2P73A 1EYRA 1FZWA 3F1CA 1WT3A 5I1FA 4FCEA 2X65A 4B5BA 3D8VA 1LZ0A 5JQQA 5FYEA 3V90A 1O23B 3VNPA 3MC4A 3I0JA 1VZTA 4Y62A 1ZI1A 2FFVA 2PGYA 4HO2A 2RIXA 3BSWA 5E3QA 4D0ZA 3PKQA 3V0QA 3I0GA 4N6BA 2XWMA 5ADXU 3I0KA 3RSBA 2RJ8A 2CU2A 1VZUA 2XMHA 3K8EA 3OH3A 2YCMA 1VICA 3PKPA 2APCA 1H7GA 4HO4A 4CJCA 2QKXA 5IFYA 3R5AA 1WVCA 1ZCTA 3SRTA 2RJ6A 1ZJ3A 3CKNA 1JVGA 3KWDA 2PX7A 4FRPA 1QGQA 2RIJA 2YC3A 3I0IX 3ZLLA 5DEMA 1MRLA 4B2XA 2IU8A 1ZJPA 2FYAA 4EEMA 1NKHB 4EAAA 1TDTA 3VBJA 2FKOA 1JV1A 3MQHA 4ISXA 1G0RA 1R7TA 5L6SA 3I0HA 3CKQA 5DDVA 2JCOA 1THJA 4EGGA 3TV0A 4HG6A 1FWYA 4EABA 2V0JA 3OTZA 1QGSA 2Y6PA 4AYJA 3P1BA 3R3IA 4ZDQA 1FGGA 2AESA 1XHDA 4R7PA 4Y7TA 1R81A 3PNNA 4FRMA 1S4PA 1ZCUA 4M98A 5CMHA 3USQA 1KWSA 3SX3A 5AJOA 3BSYA 3OUPA 1G95A 2WLFA 1LL0A 3POLA 3KIAA 5D92A 1QRFA 1V82A 2WVLA 4J09A 4R37A 1O0RA 5CMIA 4ARWA 3Q7UA 2RITA 1ZJ1A 1INJA 1XATA 1K4VA 2RJ9A 1HJJA 2YQCA 2YQHA 4KC4A 1WT2A 1ZDGA 4M28A 1E5KA 3OH1A 2IC7A 3DUVA 4FQWA 5C47A 1H5TA 1T3DA 1G97A 2V0KA 2AM3A 4KT7A 5D91A 3V0OA 4MZUA 1TZFA 3CJ8A 2O1GA 4Y7FA 3FTTA 3R5CA 1W77A 1ON8A 1H5SC 1SSMA 2YC5A 1HM8A 5IDSA 3I3XA 1PZYB 3OW5A 5ADXV 3CKJA 4Y7VA 2PGVA 1ON6A 3SXAA 3TISA 3SXDA 3LW6A 1TW5A 5BXCA 2WAWA 2FYDB 2X5ZA 3JUJA 5EJZA 3ZF8A 2P2OA 5C3BA 1H7FA 2RJ0A 4IRQA 3OC9A 3TDTA 3SXBA 2TDTA 2C0NA 4KPZA 1LZ7A 5CQPA 1NF5B 4JD0A 1HM0A 4MIXA 1HM9A 5U2KA 3RMWA 5FUHA 5CQOA 3SXEA 4G87A 5FU8A 1ZJOA 5C38A 4B4BA 4AAWA 2Z87A 2J0AA 3DK5A 2AQ9A 1ZHJA 2ZU9A 5EJ1A 4KXOA 1WSZA 1NHEB 3EG4A 1V3WA 4IHHA 1VGUA 1KQAA 4MYOA 2VD4A 4R36A 2RIZA 1W57A 1KRVA 1ZI5A 1YP3A 1Z90A 3GUEA 1MP5A 5J49A 1GX4A 1WT0A 3I0CA 5CQNX 4AC3A 3SX7A 3SXCA 3V0LA 1NQIB 1LXAA 2MZBA 3E25A 1H5RB 2V0IA 2WLCA 3JTJA 2VK9A 1TVYA 4Y6NA 3V0MA 4D11A 3Q1XA 2FFUA 3R5DA 1JVDA 4BMAA 3HJJA 2W0VA 3IGJA 2P6WA 4P00A 4CJ8A 2XATA 3T7MA 1QRMA 2D7IA 1YP2A 3R1WA 4FCUA 4B4MA 4MNDA 4L41C 2Y4MA 1FR8A 5C4BA 3N9WA 3TIOA 2OEGA 2D0JA 2JCJA 2XMEA 3V0NA 1GWVA 1VPAA 4Q7CA 3V4EA 3V8ZA 2J0BA 4Y6UA 3U2WA 5AFUU 3ZGGA 1EZIA 2NPOA 3TZTA 1VH1A 1W55A 3IXCA 1OCXA 3OKRA 1SSQA 1LZJA 1NMMB 2PA4A 3MQGA 1O7OA 4HO6A 3SXGA 2AM4A 4J18A 2OI5A 3I3AA 1H5RA 1J2ZA 4ASJA 1HV9A 4EEAA 4HO0A 4EA7A 2YQSA 3I0FA 3QVBA 3K8DA 5C1GA 2WGZA 4HUSA 1FXOA 2VSIA 2WLEA 1XHBA 3OTMA 4HZCA 2GGQA 4EE5A 4ECMA 3DHOA 1KRRA 1G2VA 4YS8A 2WEEA 1H4EA 4UEGA 4EEGA 4H7OA 4E1KA 2VS4A 4MYBA 4DECA 4FRDA 4KNRA 3U0XA 3FSCA 4FREA 2OI7A 3R2WA 3USRA 1VGWA 3OGZA 2BO8A 1ZI3A 1VZXA 1ZCYA 3U2UA 2RJ7A 2O1HA 4B3UA 4M2AA 5C8RA 2GGOA 1KGTA 2V0HA 3T57A 2VHEA 3CGXA 2Y4JA 2QGIA 2FYCB 1GQCA 2XWNA 3F1YA 1FG5N 3V0PA 4KPXA 4HCQA 5CMJA 2V0LA 3EEVA 2BO4A 2XWLA 1S4NA 1QRLA 1INIA 1JYKA 2DPWA 4FRAA 4NALA 2VXMA 4O6NA 5IDTA 1G8OA 2I7BA 5C3DA 4NAKA 4E79A 2NXVA 4FIXA 1O7QA 3JUKA 5C4EA 4D0TA 1H5SB 5CQMX 4CVHA 1H7QA 1FGXA 5DDTA 1ZJ2A 1G3LA 4EEOA 1ZI4A 3ST8A 1GQ9A 4HO8A 1R7YA 1H4CA 3Q80A 4FRLA 3FWWA 4EE4A 1H3MA 3ZGFA 3BSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZU8 A;  4HUR A;  2E8B A;  5AFU V;  3R8Y A;  1PZT A;  3GVD A;  2ICY A;  1G1L A;  2WVM A;  1H7H A;  4HOC A;  4CJB A;  5EIY A;  5DG3 A;  2ICX A;  1MP4 A;  3F1X A;  4B42 A;  2AH9 A;  1I52 A;  2WE9 A;  1HJL A;  3ECT A;  3CKO A;  4EA8 A;  1ZCV A;  3SX5 A;  1QQ0 A;  3R5B A;  1H4D A;  5C4C A;  4N27 A;  3U2T A;  5HS2 A;  1R7X A;  4Y7G A;  2FYB A;  5C1H A;  1IIN A;  2Y4L A;  3VBK A;  3E26 A;  3IOJ A;  2RJ4 A;  2Z86 A;  5E3P A;  1H5S A;  1FOA A;  2IU9 A;  4JIS A;  2JF2 A;  2RJ1 A;  3V8Y A;  2W0W A;  3VBL A;  1G93 A;  1TW1 A;  3BFP A;  3PMO A;  1QRG A;  3SPT A;  2X60 A;  5FV9 A;  2A8W A;  4AA7 A;  1LZI A;  3TK8 A;  1GX0 A;  3U2V A;  3TQD A;  3ZLK A;  1ZDF A;  5C4F A;  3NGW A;  4E75 A;  2VXL A;  1V83 A;  4D48 A;  1VGZ A;  3VBI A;  1R82 A;  3TWD A;  2AEC A;  1QRE A;  4M9C A;  4Y64 A;  3HSQ A;  4AYL A;  4IHG A;  2WLG A;  3VBN A;  2Q4J A;  3VBP A;  2RIY A;  3I0E A;  5DEP A;  2OI6 A;  3GOS A;  3IOI A;  4M2B A;  3OH0 A;  4M99 A;  3BCV A;  4B2W A;  2YES A;  1KK6 A;  1WT1 A;  1IIM A;  1QG8 A;  1H7T A;  4XWI A;  2FY7 A;  1H7E A;  3OH2 A;  4ASY A;  1GWW A;  1SST A;  3D98 A;  5C48 A;  1MR7 A;  3VBM A;  3KWC A;  1MP3 A;  3NZ2 A;  4K6R A;  1G9R A;  2AGD A;  4P02 A;  3CU0 A;  1FR9 A;  2BO7 A;  3HL3 A;  1XZ6 A;  2QH5 A;  4KC1 A;  3FSY A;  2A8U A;  2I5K A;  1H7L A;  1LVW A;  2BO6 A;  5CMF X;  4MFG A;  2YQJ A;  1KHR A;  4E6T A;  3T7N A;  4KNX A;  5AJP A;  2Y4K A;  5C4D A;  4HZD A;  2E3D A;  1H5S D;  3V91 A;  1ZIZ A;  3RMV A;  1FO8 A;  1YRO B;  2D7R A;  1KRU A;  3FS8 A;  4G3S A;  2QIV X;  1H5T B;  1ZJ0 A;  1VGT A;  3FOQ A;  2JCL A;  4N69 A;  1GA8 A;  5C49 A;  5C1L A;  1FRW A;  1R7V A;  4FRQ A;  4KQL A;  4FRO A;  2VSH A;  2JCK A;  3JQY A;  4B4G A;  4HO5 A;  5AJN A;  4FRB A;  2JF3 A;  1LL3 A;  4IHF A;  5FU0 A;  5FTS A;  4Y7U A;  2AM5 A;  3SX8 A;  4EE3 A;  3U2X A;  3R0S A;  4IRP A;  1MC3 A;  3FSX A;  3BRK X;  2IUA A;  1SS9 A;  4LW6 A;  5C36 A;  4FRH A;  4DCL A;  1MR9 A;  3KWE A;  3OAM A;  3P47 A;  5FTV A;  5L6V A;  4G3P A;  2RJ5 A;  2UX8 A;  3Q4S A;  5F42 A;  2VS5 A;  3CKV A;  4LW3 A;  3I0L A;  1S4O A;  1KGQ A;  2AE7 A;  4EQY A;  5CMG X;  3EE5 A;  4G3Q A;  3EH0 A;  1KK4 A;  1OMZ A;  1JYL A;  1OMX A;  1KK5 A;  4N6A A;  4HO9 A;  4KRV A;  2X5S A;  1VH3 A;  2QIA A;  3D5N A;  1V67 A;  4C2S A;  4EVW A;  1NWG B;  4M4K A;  1R7U A;  4Y63 A;  1YP4 A;  1FXJ A;  3BXY A;  3C8V A;  4NAN A;  1JV3 A;  1LL2 A;  3IOH A;  4GBP A;  3U0Y A;  3OH4 A;  5E3R A;  1R80 A;  3R3R A;  2WLD A;  4KC2 A;  2P72 A;  2VS3 A;  4D11 C;  2O1F A;  2OEF A;  3O3P A;  2ZU7 A;  3DJ4 A;  3I0D A;  1FO9 A;  1S80 A;  4E6U A;  4HO3 A;  4EA9 A;  1V84 A;  1QWJ A;  4BQH A;  3FSB A;  4DDZ A;  2VFZ A;  4DE7 A;  3OU9 A;  1OQM B;  3T7O A;  2WVK A;  1G23 A;  2Y7A A;  4NAI A;  2I5E A;  5C3A A;  5CQL X;  1VM8 A;  4Y9X A;  2P73 A;  1EYR A;  1FZW A;  3F1C A;  1WT3 A;  5I1F A;  4FCE A;  2X65 A;  4B5B A;  3D8V A;  1LZ0 A;  5JQQ A;  5FYE A;  3V90 A;  1O23 B;  3VNP A;  3MC4 A;  3I0J A;  1VZT A;  4Y62 A;  1ZI1 A;  2FFV A;  2PGY A;  4HO2 A;  2RIX A;  3BSW A;  5E3Q A;  4D0Z A;  3PKQ A;  3V0Q A;  3I0G A;  4N6B A;  2XWM A;  5ADX U;  3I0K A;  3RSB A;  2RJ8 A;  2CU2 A;  1VZU A;  2XMH A;  3K8E A;  3OH3 A;  2YCM A;  1VIC A;  3PKP A;  2APC A;  1H7G A;  4HO4 A;  4CJC A;  2QKX A;  5IFY A;  3R5A A;  1WVC A;  1ZCT A;  3SRT A;  2RJ6 A;  1ZJ3 A;  3CKN A;  1JVG A;  3KWD A;  2PX7 A;  4FRP A;  1QGQ A;  2RIJ A;  2YC3 A;  3I0I X;  3ZLL A;  5DEM A;  1MRL A;  4B2X A;  2IU8 A;  1ZJP A;  2FYA A;  4EEM A;  1NKH B;  4EAA A;  1TDT A;  3VBJ A;  2FKO A;  1JV1 A;  3MQH A;  4ISX A;  1G0R A;  1R7T A;  5L6S A;  3I0H A;  3CKQ A;  5DDV A;  2JCO A;  1THJ A;  4EGG A;  3TV0 A;  4HG6 A;  1FWY A;  4EAB A;  2V0J A;  3OTZ A;  1QGS A;  2Y6P A;  4AYJ A;  3P1B A;  3R3I A;  4ZDQ A;  1FGG A;  2AES A;  1XHD A;  4R7P A;  4Y7T A;  1R81 A;  3PNN A;  4FRM A;  1S4P A;  1ZCU A;  4M98 A;  5CMH A;  3USQ A;  1KWS A;  3SX3 A;  5AJO A;  3BSY A;  3OUP A;  1G95 A;  2WLF A;  1LL0 A;  3POL A;  3KIA A;  1QRF A;  1V82 A;  2WVL A;  4J09 A;  4R37 A;  1O0R A;  5CMI A;  4ARW A;  3Q7U A;  2RIT A;  1ZJ1 A;  1INJ A;  1XAT A;  1K4V A;  2RJ9 A;  1HJJ A;  2YQC A;  2YQH A;  4KC4 A;  1WT2 A;  1ZDG A;  4M28 A;  1E5K A;  3OH1 A;  2IC7 A;  3DUV A;  4FQW A;  5C47 A;  1H5T A;  1T3D A;  1G97 A;  2V0K A;  2AM3 A;  4KT7 A;  3V0O A;  4MZU A;  1TZF A;  3CJ8 A;  2O1G A;  4Y7F A;  3FTT A;  3R5C A;  1W77 A;  1ON8 A;  1H5S C;  1SSM A;  2YC5 A;  1HM8 A;  5IDS A;  3I3X A;  1PZY B;  3OW5 A;  5ADX V;  3CKJ A;  4Y7V A;  2PGV A;  1ON6 A;  3SXA A;  3TIS A;  3SXD A;  3LW6 A;  1TW5 A;  5BXC A;  2WAW A;  2FYD B;  2X5Z A;  3JUJ A;  5EJZ A;  3ZF8 A;  2P2O A;  5C3B A;  1H7F A;  2RJ0 A;  4IRQ A;  3OC9 A;  3TDT A;  3SXB A;  2TDT A;  4KPZ A;  1LZ7 A;  5CQP A;  1NF5 B;  4JD0 A;  1HM0 A;  1HM9 A;  5U2K A;  3RMW A;  5FUH A;  5CQO A;  3SXE A;  4G87 A;  5FU8 A;  1ZJO A;  5C38 A;  4B4B A;  4AAW A;  2Z87 A;  3DK5 A;  2AQ9 A;  1ZHJ A;  2ZU9 A;  5EJ1 A;  4KXO A;  1WSZ A;  1NHE B;  3EG4 A;  1V3W A;  4IHH A;  1VGU A;  1KQA A;  4MYO A;  2VD4 A;  4R36 A;  2RIZ A;  1W57 A;  1KRV A;  1ZI5 A;  1YP3 A;  1Z90 A;  3GUE A;  1MP5 A;  5J49 A;  1GX4 A;  1WT0 A;  3I0C A;  5CQN X;  4AC3 A;  3SX7 A;  3SXC A;  3V0L A;  1NQI B;  1LXA A;  2MZB A;  3E25 A;  1H5R B;  2V0I A;  2WLC A;  3JTJ A;  1TVY A;  4Y6N A;  3V0M A;  4D11 A;  3Q1X A;  2FFU A;  3R5D A;  1JVD A;  4BMA A;  3HJJ A;  2W0V A;  3IGJ A;  2P6W A;  4P00 A;  4CJ8 A;  2XAT A;  3T7M A;  1QRM A;  2D7I A;  1YP2 A;  3R1W A;  4FCU A;  4B4M A;  4MND A;  4L41 C;  2Y4M A;  1FR8 A;  5C4B A;  3N9W A;  3TIO A;  2OEG A;  2D0J A;  2JCJ A;  2XME A;  3V0N A;  1GWV A;  1VPA A;  3V4E A;  3V8Z A;  4Y6U A;  3ZGG A;  3U2W A;  5AFU U;  1EZI A;  2NPO A;  3TZT A;  1VH1 A;  1W55 A;  3IXC A;  1OCX A;  3OKR A;  1SSQ A;  1LZJ A;  1NMM B;  2PA4 A;  3MQG A;  1O7O A;  4HO6 A;  3SXG A;  2AM4 A;  4J18 A;  2OI5 A;  3I3A A;  1H5R A;  1J2Z A;  4ASJ A;  1HV9 A;  4EEA A;  4HO0 A;  4EA7 A;  2YQS A;  3I0F A;  3QVB A;  3K8D A;  5C1G A;  2WGZ A;  4HUS A;  1FXO A;  2VSI A;  2WLE A;  1XHB A;  3OTM A;  4HZC A;  2GGQ A;  4EE5 A;  4ECM A;  3DHO A;  1KRR A;  1G2V A;  4YS8 A;  2WEE A;  1H4E A;  4UEG A;  4EEG A;  4H7O A;  4E1K A;  2VS4 A;  4MYB A;  4DEC A;  4FRD A;  4KNR A;  3U0X A;  3FSC A;  4FRE A;  2OI7 A;  3R2W A;  3USR A;  1VGW A;  3OGZ A;  2BO8 A;  1ZI3 A;  1VZX A;  1ZCY A;  3U2U A;  2RJ7 A;  2O1H A;  4B3U A;  4M2A A;  5C8R A;  2GGO A;  1KGT A;  2V0H A;  3T57 A;  2VHE A;  3CGX A;  2Y4J A;  2QGI A;  2FYC B;  1GQC A;  2XWN A;  3F1Y A;  1FG5 N;  3V0P A;  4KPX A;  4HCQ A;  5CMJ A;  2V0L A;  3EEV A;  2BO4 A;  2XWL A;  1S4N A;  1QRL A;  1INI A;  1JYK A;  2DPW A;  4FRA A;  4NAL A;  2VXM A;  5IDT A;  1G8O A;  2I7B A;  5C3D A;  4NAK A;  4E79 A;  2NXV A;  1O7Q A;  3JUK A;  5C4E A;  4D0T A;  1H5S B;  5CQM X;  4CVH A;  1H7Q A;  1FGX A;  5DDT A;  1ZJ2 A;  1G3L A;  4EEO A;  1ZI4 A;  3ST8 A;  1GQ9 A;  4HO8 A;  1R7Y A;  1H4C A;  3Q80 A;  4FRL A;  3FWW A;  4EE4 A;  1H3M A;  3ZGF A;  3BSS A; 
#chains in the Genus database with same CATH topology
 2ZU8 A;  4HUR A;  2E8B A;  5AFU V;  3R8Y A;  1PZT A;  3GVD A;  2ICY A;  1G1L A;  2WVM A;  1H7H A;  4HOC A;  4CJB A;  5EIY A;  5DG3 A;  2ICX A;  1MP4 A;  3F1X A;  4B42 A;  2AH9 A;  1I52 A;  2WE9 A;  1HJL A;  3ECT A;  3CKO A;  4EA8 A;  1ZCV A;  3SX5 A;  1QQ0 A;  3R5B A;  1H4D A;  5C4C A;  4N27 A;  3U2T A;  5HS2 A;  1R7X A;  4Y7G A;  2FYB A;  5C1H A;  1IIN A;  2Y4L A;  3VBK A;  3E26 A;  3IOJ A;  2RJ4 A;  2Z86 A;  5E3P A;  1H5S A;  1FOA A;  2IU9 A;  4JIS A;  2JF2 A;  2RJ1 A;  3V8Y A;  2W0W A;  3VBL A;  1G93 A;  1TW1 A;  3BFP A;  3PMO A;  1QRG A;  3SPT A;  2X60 A;  5FV9 A;  2A8W A;  4AA7 A;  1LZI A;  3TK8 A;  1GX0 A;  3U2V A;  3TQD A;  3ZLK A;  1ZDF A;  5C4F A;  3NGW A;  4E75 A;  2VXL A;  1V83 A;  4D48 A;  1VGZ A;  3VBI A;  1R82 A;  3TWD A;  2AEC A;  1QRE A;  4M9C A;  4O6M A;  4Y64 A;  3HSQ A;  4AYL A;  4IHG A;  2WLG A;  3VBN A;  2Q4J A;  3VBP A;  2RIY A;  3I0E A;  5DEP A;  2OI6 A;  3GOS A;  3IOI A;  4M2B A;  3OH0 A;  4M99 A;  3BCV A;  4B2W A;  2YES A;  1KK6 A;  1WT1 A;  1IIM A;  3GQ8 A;  1QG8 A;  1H7T A;  4XWI A;  2FY7 A;  1H7E A;  3OH2 A;  4ASY A;  1GWW A;  1SST A;  3D98 A;  3SUC A;  5C48 A;  1MR7 A;  3VBM A;  3KWC A;  1MP3 A;  3NZ2 A;  4K6R A;  1G9R A;  2AGD A;  4P02 A;  3CU0 A;  1FR9 A;  2BO7 A;  3HL3 A;  1XZ6 A;  2QH5 A;  4KC1 A;  3FSY A;  2A8U A;  2I5K A;  1H7L A;  1LVW A;  2BO6 A;  5CMF X;  4MFG A;  2YQJ A;  1KHR A;  4E6T A;  3T7N A;  4KNX A;  5AJP A;  2Y4K A;  5C4D A;  4HZD A;  2E3D A;  1H5S D;  3V91 A;  1ZIZ A;  3RMV A;  1FO8 A;  1YRO B;  2D7R A;  1KRU A;  3FS8 A;  4G3S A;  2QIV X;  1H5T B;  1ZJ0 A;  1VGT A;  3FOQ A;  2JCL A;  4N69 A;  1GA8 A;  5C49 A;  5C1L A;  1FRW A;  1R7V A;  4FRQ A;  4KQL A;  4FRO A;  2VSH A;  2JCK A;  3JQY A;  4B4G A;  4HO5 A;  5AJN A;  4FRB A;  2JF3 A;  4IHF A;  1LL3 A;  5FU0 A;  5FTS A;  4Y7U A;  2AM5 A;  3SX8 A;  4EE3 A;  3U2X A;  3R0S A;  4IRP A;  1MC3 A;  3FSX A;  3BRK X;  2IUA A;  1SS9 A;  4LW6 A;  5C36 A;  4FRH A;  4DCL A;  1MR9 A;  3KWE A;  3OAM A;  3P47 A;  5FTV A;  5L6V A;  4G3P A;  2RJ5 A;  2UX8 A;  3Q4S A;  5F42 A;  2VS5 A;  3CKV A;  4LW3 A;  3I0L A;  1S4O A;  1KGQ A;  2AE7 A;  4EQY A;  5CMG X;  3EE5 A;  4G3Q A;  3EH0 A;  1KK4 A;  1OMZ A;  1M8N A;  1N4I A;  3GQA A;  1JYL A;  1OMX A;  1KK5 A;  4N6A A;  4HO9 A;  4KRV A;  2X5S A;  1VH3 A;  2QIA A;  3D5N A;  1V67 A;  4C2S A;  4EVW A;  1NWG B;  4M4K A;  1R7U A;  4Y63 A;  1YP4 A;  1FXJ A;  3BXY A;  3C8V A;  4FIY A;  4NAN A;  1JV3 A;  1LL2 A;  3IOH A;  4GBP A;  3U0Y A;  3OH4 A;  5E3R A;  1R80 A;  3R3R A;  2WLD A;  4KC2 A;  2P72 A;  2VS3 A;  4D11 C;  2O1F A;  2OEF A;  3O3P A;  2ZU7 A;  3DJ4 A;  3I0D A;  1FO9 A;  1S80 A;  4E6U A;  4HO3 A;  4EA9 A;  1V84 A;  1QWJ A;  4BQH A;  3FSB A;  4DDZ A;  2VFZ A;  4DE7 A;  3OU9 A;  1OQM B;  3T7O A;  2WVK A;  1G23 A;  2Y7A A;  4NAI A;  2I5E A;  5C3A A;  5CQL X;  1VM8 A;  4Y9X A;  2P73 A;  1EYR A;  1FZW A;  3F1C A;  1WT3 A;  5I1F A;  4FCE A;  2X65 A;  4B5B A;  3D8V A;  1LZ0 A;  5JQQ A;  5FYE A;  3V90 A;  1O23 B;  3VNP A;  3MC4 A;  3I0J A;  1VZT A;  4Y62 A;  1ZI1 A;  2FFV A;  2PGY A;  4HO2 A;  2RIX A;  3BSW A;  5E3Q A;  4D0Z A;  3PKQ A;  3V0Q A;  3I0G A;  4N6B A;  2XWM A;  5ADX U;  3I0K A;  3RSB A;  2RJ8 A;  2CU2 A;  1VZU A;  2XMH A;  3K8E A;  3OH3 A;  2YCM A;  1VIC A;  3PKP A;  2APC A;  1H7G A;  4HO4 A;  4CJC A;  2QKX A;  5IFY A;  3R5A A;  1WVC A;  1ZCT A;  3SRT A;  2RJ6 A;  1ZJ3 A;  3CKN A;  1JVG A;  3KWD A;  2PX7 A;  4FRP A;  1QGQ A;  2RIJ A;  2YC3 A;  3I0I X;  3ZLL A;  5DEM A;  1MRL A;  4B2X A;  1EWW A;  2IU8 A;  1ZJP A;  2FYA A;  4EEM A;  1NKH B;  4EAA A;  1TDT A;  3VBJ A;  2FKO A;  1JV1 A;  3MQH A;  4ISX A;  1G0R A;  1R7T A;  5L6S A;  3I0H A;  3CKQ A;  5DDV A;  2JCO A;  1THJ A;  4EGG A;  3TV0 A;  4HG6 A;  1FWY A;  4EAB A;  2V0J A;  3OTZ A;  1QGS A;  2Y6P A;  4AYJ A;  3P1B A;  3R3I A;  4ZDQ A;  1FGG A;  2AES A;  1XHD A;  4R7P A;  4Y7T A;  1R81 A;  3PNN A;  4FRM A;  1S4P A;  1ZCU A;  4M98 A;  5CMH A;  3USQ A;  1KWS A;  3SX3 A;  5AJO A;  3BSY A;  3OUP A;  1G95 A;  2WLF A;  1LL0 A;  3POL A;  3KIA A;  5D92 A;  1QRF A;  1V82 A;  2WVL A;  4J09 A;  4R37 A;  1O0R A;  5CMI A;  4ARW A;  3Q7U A;  2RIT A;  1ZJ1 A;  1INJ A;  1XAT A;  1K4V A;  2RJ9 A;  1HJJ A;  2YQC A;  2YQH A;  4KC4 A;  1WT2 A;  1ZDG A;  3OH1 A;  3GQ9 A;  4M28 A;  2IC7 A;  1E5K A;  3DUV A;  4FQW A;  1H5T A;  5C47 A;  1T3D A;  1G97 A;  2V0K A;  2AM3 A;  4KT7 A;  5D91 A;  3V0O A;  4MZU A;  1TZF A;  3CJ8 A;  2O1G A;  4Y7F A;  3FTT A;  3R5C A;  1W77 A;  1ON8 A;  1H5S C;  1SSM A;  2YC5 A;  1HM8 A;  5IDS A;  3I3X A;  1PZY B;  3OW5 A;  5ADX V;  3CKJ A;  4Y7V A;  2PGV A;  1ON6 A;  3SXA A;  3TIS A;  3SXD A;  3LW6 A;  1TW5 A;  5BXC A;  2WAW A;  2FYD B;  2X5Z A;  3JUJ A;  5EJZ A;  3ZF8 A;  2P2O A;  5C3B A;  1H7F A;  2RJ0 A;  4IRQ A;  3OC9 A;  3TDT A;  3SXB A;  2TDT A;  2C0N A;  4KPZ A;  1LZ7 A;  5CQP A;  1NF5 B;  4JD0 A;  1HM0 A;  4MIX A;  1HM9 A;  5U2K A;  3RMW A;  5FUH A;  5CQO A;  3SXE A;  4G87 A;  5FU8 A;  1ZJO A;  5C38 A;  4B4B A;  4AAW A;  2Z87 A;  2J0A A;  3DK5 A;  2AQ9 A;  1ZHJ A;  2ZU9 A;  5EJ1 A;  4KXO A;  1WSZ A;  1NHE B;  3EG4 A;  1V3W A;  4IHH A;  1VGU A;  1KQA A;  4MYO A;  2VD4 A;  4R36 A;  2RIZ A;  1W57 A;  1L0S A;  1KRV A;  1ZI5 A;  1YP3 A;  1Z90 A;  3GUE A;  1MP5 A;  5J49 A;  1GX4 A;  1WT0 A;  3I0C A;  5CQN X;  4AC3 A;  3SX7 A;  3SXC A;  3V0L A;  1NQI B;  1LXA A;  2MZB A;  3E25 A;  1H5R B;  2V0I A;  2WLC A;  3JTJ A;  2VK9 A;  1TVY A;  4Y6N A;  3V0M A;  4D11 A;  3Q1X A;  2FFU A;  3R5D A;  1JVD A;  4BMA A;  3HJJ A;  2W0V A;  3IGJ A;  2P6W A;  4P00 A;  4CJ8 A;  2XAT A;  3T7M A;  1QRM A;  2D7I A;  1YP2 A;  3R1W A;  4FCU A;  4B4M A;  4MND A;  4L41 C;  2Y4M A;  1FR8 A;  5C4B A;  3N9W A;  3TIO A;  2OEG A;  2D0J A;  2JCJ A;  2XME A;  3V0N A;  1GWV A;  1VPA A;  4Q7C A;  3V4E A;  3V8Z A;  2J0B A;  4Y6U A;  3U2W A;  5AFU U;  3ZGG A;  1EZI A;  2NPO A;  3TZT A;  1VH1 A;  1W55 A;  3IXC A;  1OCX A;  3OKR A;  1SSQ A;  1LZJ A;  1NMM B;  2PA4 A;  3MQG A;  1O7O A;  4HO6 A;  3SXG A;  2AM4 A;  4J18 A;  2OI5 A;  3I3A A;  1H5R A;  1J2Z A;  4ASJ A;  1HV9 A;  4EEA A;  4HO0 A;  4EA7 A;  2YQS A;  3I0F A;  3QVB A;  3K8D A;  5C1G A;  2WGZ A;  4HUS A;  1FXO A;  2VSI A;  2WLE A;  1XHB A;  3OTM A;  4HZC A;  2GGQ A;  4EE5 A;  4ECM A;  3DHO A;  1KRR A;  1G2V A;  4YS8 A;  2WEE A;  1H4E A;  4UEG A;  4EEG A;  4H7O A;  4E1K A;  1Z2F A;  2VS4 A;  4MYB A;  4FRD A;  4DEC A;  4KNR A;  3U0X A;  3FSC A;  4FRE A;  2OI7 A;  3R2W A;  3USR A;  1VGW A;  3OGZ A;  2BO8 A;  1ZI3 A;  1VZX A;  1ZCY A;  3U2U A;  2RJ7 A;  2O1H A;  4B3U A;  4M2A A;  5C8R A;  2GGO A;  1KGT A;  2V0H A;  3T57 A;  2VHE A;  3CGX A;  2Y4J A;  2QGI A;  2FYC B;  1GQC A;  2XWN A;  3F1Y A;  1FG5 N;  3V0P A;  4KPX A;  4HCQ A;  5CMJ A;  2V0L A;  3EEV A;  2BO4 A;  2XWL A;  1S4N A;  1QRL A;  1INI A;  1JYK A;  2DPW A;  4FRA A;  4NAL A;  2VXM A;  4O6N A;  5IDT A;  1G8O A;  2I7B A;  5C3D A;  4NAK A;  4E79 A;  2NXV A;  4FIX A;  1O7Q A;  3JUK A;  5C4E A;  4D0T A;  1H5S B;  5CQM X;  4CVH A;  1H7Q A;  1FGX A;  5DDT A;  1ZJ2 A;  1G3L A;  4EEO A;  1ZI4 A;  3ST8 A;  1GQ9 A;  4HO8 A;  3GQ7 A;  1R7Y A;  1H4C A;  3Q80 A;  4FRL A;  3FWW A;  4EE4 A;  1H3M A;  3ZGF A;  3BSS A; 
#chains in the Genus database with same CATH homology
 2ZU8 A;  4HUR A;  2E8B A;  5AFU V;  3R8Y A;  1PZT A;  3GVD A;  2ICY A;  1G1L A;  2WVM A;  1H7H A;  4HOC A;  4CJB A;  5EIY A;  5DG3 A;  2ICX A;  1MP4 A;  3F1X A;  4B42 A;  2AH9 A;  1I52 A;  2WE9 A;  1HJL A;  3ECT A;  3CKO A;  4EA8 A;  1ZCV A;  3SX5 A;  1QQ0 A;  3R5B A;  1H4D A;  5C4C A;  4N27 A;  3U2T A;  5HS2 A;  1R7X A;  4Y7G A;  2FYB A;  5C1H A;  1IIN A;  2Y4L A;  3VBK A;  3E26 A;  3IOJ A;  2RJ4 A;  2Z86 A;  5E3P A;  1H5S A;  1FOA A;  2IU9 A;  4JIS A;  2JF2 A;  2RJ1 A;  3V8Y A;  2W0W A;  3VBL A;  1G93 A;  1TW1 A;  3BFP A;  3PMO A;  1QRG A;  3SPT A;  2X60 A;  5FV9 A;  2A8W A;  4AA7 A;  1LZI A;  3TK8 A;  1GX0 A;  3U2V A;  3TQD A;  3ZLK A;  1ZDF A;  5C4F A;  3NGW A;  4E75 A;  2VXL A;  1V83 A;  4D48 A;  1VGZ A;  3VBI A;  1R82 A;  3TWD A;  2AEC A;  1QRE A;  4M9C A;  4O6M A;  4Y64 A;  3HSQ A;  4AYL A;  4IHG A;  2WLG A;  3VBN A;  2Q4J A;  3VBP A;  2RIY A;  3I0E A;  5DEP A;  2OI6 A;  3GOS A;  3IOI A;  4M2B A;  3OH0 A;  4M99 A;  3BCV A;  4B2W A;  2YES A;  1KK6 A;  1WT1 A;  1IIM A;  1QG8 A;  1H7T A;  4XWI A;  2FY7 A;  1H7E A;  3OH2 A;  4ASY A;  1GWW A;  1SST A;  3D98 A;  5C48 A;  1MR7 A;  3VBM A;  3KWC A;  1MP3 A;  3NZ2 A;  4K6R A;  1G9R A;  2AGD A;  4P02 A;  3CU0 A;  1FR9 A;  2BO7 A;  3HL3 A;  1XZ6 A;  2QH5 A;  4KC1 A;  3FSY A;  2A8U A;  2I5K A;  1H7L A;  1LVW A;  2BO6 A;  5CMF X;  4MFG A;  2YQJ A;  1KHR A;  4E6T A;  3T7N A;  4KNX A;  5AJP A;  2Y4K A;  5C4D A;  4HZD A;  2E3D A;  1H5S D;  3V91 A;  1ZIZ A;  3RMV A;  1FO8 A;  1YRO B;  2D7R A;  1KRU A;  3FS8 A;  4G3S A;  2QIV X;  1H5T B;  1ZJ0 A;  1VGT A;  3FOQ A;  2JCL A;  4N69 A;  1GA8 A;  5C49 A;  5C1L A;  1FRW A;  1R7V A;  4FRQ A;  4KQL A;  4FRO A;  2VSH A;  2JCK A;  3JQY A;  4B4G A;  4HO5 A;  5AJN A;  4FRB A;  2JF3 A;  1LL3 A;  4IHF A;  5FU0 A;  5FTS A;  4Y7U A;  2AM5 A;  3SX8 A;  4EE3 A;  3U2X A;  3R0S A;  4IRP A;  1MC3 A;  3FSX A;  3BRK X;  2IUA A;  1SS9 A;  4LW6 A;  5C36 A;  4FRH A;  4DCL A;  1MR9 A;  3KWE A;  3OAM A;  3P47 A;  5FTV A;  5L6V A;  4G3P A;  2RJ5 A;  2UX8 A;  3Q4S A;  5F42 A;  2VS5 A;  3CKV A;  4LW3 A;  3I0L A;  1S4O A;  1KGQ A;  2AE7 A;  4EQY A;  5CMG X;  3EE5 A;  4G3Q A;  3EH0 A;  1KK4 A;  1OMZ A;  1JYL A;  1OMX A;  1KK5 A;  4N6A A;  4HO9 A;  4KRV A;  2X5S A;  1VH3 A;  2QIA A;  3D5N A;  1V67 A;  4C2S A;  4EVW A;  1NWG B;  4M4K A;  1R7U A;  4Y63 A;  1YP4 A;  1FXJ A;  3BXY A;  3C8V A;  4FIY A;  4NAN A;  1JV3 A;  1LL2 A;  3IOH A;  4GBP A;  3U0Y A;  3OH4 A;  5E3R A;  1R80 A;  3R3R A;  2WLD A;  4KC2 A;  2P72 A;  2VS3 A;  4D11 C;  2O1F A;  2OEF A;  3O3P A;  2ZU7 A;  3DJ4 A;  3I0D A;  1FO9 A;  1S80 A;  4E6U A;  4HO3 A;  4EA9 A;  1V84 A;  1QWJ A;  4BQH A;  3FSB A;  4DDZ A;  2VFZ A;  4DE7 A;  3OU9 A;  1OQM B;  3T7O A;  2WVK A;  1G23 A;  2Y7A A;  4NAI A;  2I5E A;  5C3A A;  5CQL X;  1VM8 A;  4Y9X A;  2P73 A;  1EYR A;  1FZW A;  3F1C A;  1WT3 A;  5I1F A;  4FCE A;  2X65 A;  4B5B A;  3D8V A;  1LZ0 A;  5JQQ A;  5FYE A;  3V90 A;  1O23 B;  3VNP A;  3MC4 A;  3I0J A;  1VZT A;  4Y62 A;  1ZI1 A;  2FFV A;  2PGY A;  4HO2 A;  2RIX A;  3BSW A;  5E3Q A;  4D0Z A;  3PKQ A;  3V0Q A;  3I0G A;  4N6B A;  2XWM A;  5ADX U;  3I0K A;  3RSB A;  2RJ8 A;  2CU2 A;  1VZU A;  2XMH A;  3K8E A;  3OH3 A;  2YCM A;  1VIC A;  3PKP A;  2APC A;  1H7G A;  4HO4 A;  4CJC A;  2QKX A;  5IFY A;  3R5A A;  1WVC A;  1ZCT A;  3SRT A;  2RJ6 A;  1ZJ3 A;  3CKN A;  1JVG A;  3KWD A;  2PX7 A;  4FRP A;  1QGQ A;  2RIJ A;  2YC3 A;  3I0I X;  3ZLL A;  5DEM A;  1MRL A;  4B2X A;  2IU8 A;  1ZJP A;  2FYA A;  4EEM A;  1NKH B;  4EAA A;  1TDT A;  3VBJ A;  2FKO A;  1JV1 A;  3MQH A;  4ISX A;  1G0R A;  1R7T A;  5L6S A;  3I0H A;  3CKQ A;  5DDV A;  2JCO A;  1THJ A;  4EGG A;  3TV0 A;  4HG6 A;  1FWY A;  4EAB A;  2V0J A;  3OTZ A;  1QGS A;  2Y6P A;  4AYJ A;  3P1B A;  3R3I A;  4ZDQ A;  1FGG A;  2AES A;  1XHD A;  4R7P A;  4Y7T A;  1R81 A;  3PNN A;  4FRM A;  1S4P A;  1ZCU A;  4M98 A;  5CMH A;  3USQ A;  1KWS A;  3SX3 A;  5AJO A;  3BSY A;  3OUP A;  1G95 A;  2WLF A;  1LL0 A;  3POL A;  3KIA A;  5D92 A;  1QRF A;  1V82 A;  2WVL A;  4J09 A;  4R37 A;  1O0R A;  5CMI A;  4ARW A;  3Q7U A;  2RIT A;  1ZJ1 A;  1INJ A;  1XAT A;  1K4V A;  2RJ9 A;  1HJJ A;  2YQC A;  2YQH A;  4KC4 A;  1WT2 A;  1ZDG A;  4M28 A;  1E5K A;  3OH1 A;  2IC7 A;  3DUV A;  4FQW A;  5C47 A;  1H5T A;  1T3D A;  1G97 A;  2V0K A;  2AM3 A;  4KT7 A;  5D91 A;  3V0O A;  4MZU A;  1TZF A;  3CJ8 A;  2O1G A;  4Y7F A;  3FTT A;  3R5C A;  1W77 A;  1ON8 A;  1H5S C;  1SSM A;  2YC5 A;  1HM8 A;  5IDS A;  3I3X A;  1PZY B;  3OW5 A;  5ADX V;  3CKJ A;  4Y7V A;  2PGV A;  1ON6 A;  3SXA A;  3TIS A;  3SXD A;  3LW6 A;  1TW5 A;  5BXC A;  2WAW A;  2FYD B;  2X5Z A;  3JUJ A;  5EJZ A;  3ZF8 A;  2P2O A;  5C3B A;  1H7F A;  2RJ0 A;  4IRQ A;  3OC9 A;  3TDT A;  3SXB A;  2TDT A;  2C0N A;  4KPZ A;  1LZ7 A;  5CQP A;  1NF5 B;  4JD0 A;  1HM0 A;  4MIX A;  1HM9 A;  5U2K A;  3RMW A;  5FUH A;  5CQO A;  3SXE A;  4G87 A;  5FU8 A;  1ZJO A;  5C38 A;  4B4B A;  4AAW A;  2Z87 A;  2J0A A;  3DK5 A;  2AQ9 A;  1ZHJ A;  2ZU9 A;  5EJ1 A;  4KXO A;  1WSZ A;  1NHE B;  3EG4 A;  1V3W A;  4IHH A;  1VGU A;  1KQA A;  4MYO A;  2VD4 A;  4R36 A;  2RIZ A;  1W57 A;  1KRV A;  1ZI5 A;  1YP3 A;  1Z90 A;  3GUE A;  1MP5 A;  5J49 A;  1GX4 A;  1WT0 A;  3I0C A;  5CQN X;  4AC3 A;  3SX7 A;  3SXC A;  3V0L A;  1NQI B;  1LXA A;  2MZB A;  3E25 A;  1H5R B;  2V0I A;  2WLC A;  3JTJ A;  2VK9 A;  1TVY A;  4Y6N A;  3V0M A;  4D11 A;  3Q1X A;  2FFU A;  3R5D A;  1JVD A;  4BMA A;  3HJJ A;  2W0V A;  3IGJ A;  2P6W A;  4P00 A;  4CJ8 A;  2XAT A;  3T7M A;  1QRM A;  2D7I A;  1YP2 A;  3R1W A;  4FCU A;  4B4M A;  4MND A;  4L41 C;  2Y4M A;  1FR8 A;  5C4B A;  3N9W A;  3TIO A;  2OEG A;  2D0J A;  2JCJ A;  2XME A;  3V0N A;  1GWV A;  1VPA A;  4Q7C A;  3V4E A;  3V8Z A;  2J0B A;  4Y6U A;  3U2W A;  5AFU U;  3ZGG A;  1EZI A;  2NPO A;  3TZT A;  1VH1 A;  1W55 A;  3IXC A;  1OCX A;  3OKR A;  1SSQ A;  1LZJ A;  1NMM B;  2PA4 A;  3MQG A;  1O7O A;  4HO6 A;  3SXG A;  2AM4 A;  4J18 A;  2OI5 A;  3I3A A;  1H5R A;  1J2Z A;  4ASJ A;  1HV9 A;  4EEA A;  4HO0 A;  4EA7 A;  2YQS A;  3I0F A;  3QVB A;  3K8D A;  5C1G A;  2WGZ A;  4HUS A;  1FXO A;  2VSI A;  2WLE A;  1XHB A;  3OTM A;  4HZC A;  2GGQ A;  4EE5 A;  4ECM A;  3DHO A;  1KRR A;  1G2V A;  4YS8 A;  2WEE A;  1H4E A;  4UEG A;  4EEG A;  4H7O A;  4E1K A;  2VS4 A;  4MYB A;  4DEC A;  4FRD A;  4KNR A;  3U0X A;  3FSC A;  4FRE A;  2OI7 A;  3R2W A;  3USR A;  1VGW A;  3OGZ A;  2BO8 A;  1ZI3 A;  1VZX A;  1ZCY A;  3U2U A;  2RJ7 A;  2O1H A;  4B3U A;  4M2A A;  5C8R A;  2GGO A;  1KGT A;  2V0H A;  3T57 A;  2VHE A;  3CGX A;  2Y4J A;  2QGI A;  2FYC B;  1GQC A;  2XWN A;  3F1Y A;  1FG5 N;  3V0P A;  4KPX A;  4HCQ A;  5CMJ A;  2V0L A;  3EEV A;  2BO4 A;  2XWL A;  1S4N A;  1QRL A;  1INI A;  1JYK A;  2DPW A;  4FRA A;  4NAL A;  2VXM A;  4O6N A;  5IDT A;  1G8O A;  2I7B A;  5C3D A;  4NAK A;  4E79 A;  2NXV A;  4FIX A;  1O7Q A;  3JUK A;  5C4E A;  4D0T A;  1H5S B;  5CQM X;  4CVH A;  1H7Q A;  1FGX A;  5DDT A;  1ZJ2 A;  1G3L A;  4EEO A;  1ZI4 A;  3ST8 A;  1GQ9 A;  4HO8 A;  1R7Y A;  1H4C A;  3Q80 A;  4FRL A;  3FWW A;  4EE4 A;  1H3M A;  3ZGF A;  3BSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...