4HCQA

Crystal structure of glmu from mycobacterium tuberculosis in complex with glucosamine-1-phosphate
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
459
structure length
452
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures identify an atypical two-metal-ion mechanism for uridyltransfer in GlmU: its significance to sugar nucleotidyl transferases
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Bifunctional protein GlmU
total genus 169
structure length 452
sequence length 459
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4hcqA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4hcqA01
2YESA 2UX8A 1FXOA 3I0IX 4KNRA 1QRGA 2ZU7A 3JUJA 1H7FA 1WVCA 4KNXA 3SX5A 1Z90A 2GGOA 2AM3A 1YP4A 4CVHA 1H5RB 1V67A 3OTZA 1LL0A 4M99A 2ZU8A 3SXDA 2X5ZA 2MZBA 1PZTA 1H5TB 1S4OA 1VM8A 1VZTA 2JCOA 3ST8A 2I5EA 1JYKA 2QGIA 4KRVA 3IXCA 4E6UA 1QRLA 1THJA 4EA7A 5C4BA 4L41C 3V8ZA 2AE7A 2BO6A 3TDTA 5EJZA 3NZ2A 1LXAA 3N9WA 4XWIA 2W0WA 3KWEA 3OTMA 1GA8A 2VFZA 2YQJA 3SXCA 1FWYA 4EEOA 1OMZA 2Y7AA 3SXGA 3ECTA 3FS8A 1H3MA 2YC5A 3OH1A 4MNDA 1ZJPA 4HZCA 1MP4A 1O23B 3P1BA 1G93A 1VGZA 4EEAA 5DEMA 1ON6A 3FSBA 4E1KA 2PGVA 2QIVX 4Y7FA 3V90A 1GQCA 2XWNA 2TDTA 4R37A 3ZGGA 4EQYA 3ZF8A 4LW6A 1SSMA 3R5CA 1ZJOA 2OI6A 2WEEA 3I0EA 4KC1A 5HS2A 2IU8A 3VNPA 4HO6A 1KK5A 2RIXA 3R5DA 1GWWA 4HZDA 4E79A 3EH0A 2RIZA 3GVDA 2JCKA 3CKJA 2AESA 1J2ZA 1IINA 3V0MA 4B3UA 5CMIA 5JQQA 3VBLA 4Y7VA 4M28A 3T57A 4N69A 2FYAA 3SXEA 4MZUA 2A8WA 3BCVA 1K4VA 1OQMB 2CU2A 4FRPA 1YP3A 2NPOA 1FR8A 3R5AA 4FRMA 4M9CA 3JQYA 4D11C 4B2WA 5C1GA 1WT1A 1G0RA 4ZDQA 1JV3A 5C4CA 4EVWA 3U0XA 1FO9A 1MC3A 3I0LA 3R2WA 3JTJA 5ADXU 5IDSA 4JD0A 1LL2A 5C36A 1R7TA 3EEVA 3ZLKA 1S4PA 3PKPA 2V0HA 3VBNA 2X60A 2V0IA 4HO2A 4UEGA 2JCJA 5FUHA 1ZIZA 2A8UA 1VICA 1VZXA 1LZ0A 3R5BA 1EZIA 4ASJA 4MYBA 4FROA 3V0OA 2WLFA 1FOAA 2D7IA 1W77A 4KPZA 1ZCVA 2FYDB 2VS3A 2WLDA 2PGYA 4Y62A 5FV9A 1OCXA 5DG3A 1FO8A 5F42A 1VZUA 4DE7A 3I0GA 1KGTA 2JF2A 5C8RA 3QVBA 1S80A 1H5RA 1KRUA 4FRDA 3BXYA 2D0JA 1HV9A 4M98A 4E6TA 2VXMA 1PZYB 2FKOA 4HO0A 2RJ9A 5FU8A 2RJ1A 2DPWA 1NMMB 1VGTA 2XATA 1R7UA 1R7XA 1SS9A 1NWGB 3DHOA 3NGWA 2RJ0A 3FSXA 3E25A 3PNNA 4JISA 1IIMA 5CMGX 5C47A 1H4EA 4HO4A 4D48A 1R81A 3BSWA 1H5SD 1R7VA 3USRA 2Z87A 2WLCA 1O7QA 2JF3A 1G23A 4FREA 4N6AA 1LL3A 1MRLA 3D8VA 2FYBA 3MQHA 3T7MA 3EG4A 1E5KA 2YQSA 4R7PA 1G95A 3DJ4A 1VGUA 4Y7UA 1ON8A 1ZDFA 3BFPA 1WT0A 1TW5A 3SX3A 1SSQA 3U2XA 2FY7A 3HL3A 1G1LA 4KXOA 2OI5A 5C3AA 2P72A 1ZCYA 4Y7TA 3OH4A 1W55A 4FRQA 4YS8A 5E3PA 2O1FA 1KRVA 4AYLA 3E26A 1V3WA 3IOJA 1MP3A 3SPTA 1XHBA 4ASYA 5C1LA 1ZI1A 4HUSA 1I52A 5CQPA 3D98A 1ZCTA 2BO7A 4IRPA 4G3SA 2Y6PA 3ZGFA 1H7LA 2WLGA 3HJJA 3V0NA 1OMXA 3DK5A 1VPAA 1MR9A 1QG8A 3CKNA 4Y6UA 2VSIA 2QH5A 3GUEA 1LZIA 3IOHA 1H7EA 1GX0A 3KIAA 4FRHA 5C4FA 2VSHA 5ADXV 3R1WA 1YROB 3C8VA 3OGZA 3V8YA 4B42A 5C49A 2D7RA 2YQHA 1WSZA 2RJ8A 3T7NA 2GGQA 1H5SB 2AGDA 4Y6NA 4Y9XA 4FRAA 4CJBA 4B2XA 3JUKA 3P47A 2ICXA 1ZJ0A 3OUPA 3BSSA 1T3DA 4Y63A 1TVYA 4ARWA 3I0JA 5FU0A 1HJJA 3Q80A 4HO9A 5DDVA 3VBPA 3IGJA 3KWDA 5EJ1A 1QREA 2XMHA 5C3BA 1YP2A 1NF5B 3T7OA 4DCLA 2WLEA 5CQMX 1R82A 4E75A 4FCEA 4D0ZA 1ZDGA 2VXLA 4M4KA 3FSYA 1H7GA 2AM5A 4KPXA 2Z86A 1O0RA 1H5TA 3F1CA 4GBPA 1XZ6A 3OH0A 4G3PA 4EE4A 2XWLA 4R36A 1KK4A 5AJOA 4HURA 4IHFA 3I0CA 4EA8A 1LVWA 2QKXA 4EAAA 3U0YA 3IOIA 1TW1A 3CKOA 4BMAA 5EIYA 3GOSA 4EABA 2PA4A 2WVMA 3U2UA 3V0PA 2RJ4A 4MFGA 4IHGA 1INJA 1VGWA 1W57A 3U2WA 4KC4A 1JVDA 2P2OA 2V0LA 1O7OA 3POLA 3K8EA 3OH3A 5CMHA 3O3PA 4B5BA 2AQ9A 3R0SA 4HG6A 3PMOA 4J09A 4BQHA 3BRKX 3SX8A 3V4EA 4N27A 3F1YA 3LW6A 3U2VA 1JVGA 4Y7GA 3OH2A 1G9RA 1XHDA 5CQOA 1FZWA 1TDTA 4HO3A 2IC7A 1FRWA 3FOQA 2I7BA 2WE9A 3V91A 3OU9A 1ZI5A 2PX7A 2WVKA 1HM0A 1JYLA 3TWDA 1G8OA 4H7OA 3ZLLA 1KRRA 4D11A 2VHEA 2P6WA 4KC2A 2E8BA 3I0KA 1KWSA 3TQDA 1KQAA 4AA7A 1FGXA 5C38A 1EYRA 2Q4JA 3PKQA 4LW3A 4FQWA 3V0QA 5C4DA 4P00A 2RIJA 4ECMA 1FGGA 4N6BA 4FRLA 2ZU9A 4P02A 1MP5A 2OI7A 2RIYA 5CQNX 3SX7A 2V0KA 2APCA 5CQLX 3SXBA 2FYCB 1NKHB 4NALA 1ZJ1A 2O1HA 1QQ0A 2JCLA 3I0HA 3R3RA 3RSBA 2YQCA 1HJLA 3EE5A 3I0DA 1FXJA 5AFUU 2X5SA 1H5SA 4AAWA 1QRMA 2VD4A 5AJNA 1HM9A 2QIAA 1FG5N 1H4CA 3R8YA 1H4DA 1MR7A 5C4EA 1JV1A 2XMEA 2YCMA 4MYOA 3CGXA 1WT2A 4HO8A 4D0TA 1XATA 1ZHJA 4NAKA 3RMVA 1GWVA 1QGSA 3KWCA 1H7QA 2YC3A 4KT7A 3TISA 2XWMA 5FTSA 4EEMA 2NXVA 5BXCA 5DDTA 1FR9A 1ZJ2A 1V84A 1V82A 2RJ5A 5E3QA 5IDTA 2OEGA 5E3RA 2Y4MA 2Y4JA 1LZ7A 3U2TA 4DDZA 5C3DA 3VBKA 3Q4SA 4G87A 1NQIB 3TZTA 2RJ6A 1H5SC 3VBMA 2BO4A 3CU0A 4B4BA 5C1HA 3HSQA 3DUVA 1ZI3A 4EE5A 4CJ8A 3USQA 2IU9A 5AJPA 2Y4KA 1KGQA 2AECA 4FRBA 4J18A 1WT3A 3VBIA 4M2BA 2P73A 1QWJA 2AM4A 2X65A 2RJ7A 3I3XA 1GX4A 2RITA 3MQGA 3I0FA 1R7YA 1QRFA 5U2KA 3Q1XA 4EE3A 2WGZA 4ISXA 5I1FA 1G97A 5L6VA 4AYJA 4C2SA 5J49A 2WVLA 3TIOA 4HO5A 1ZJ3A 2Y4LA 3CKQA 4IRQA 3TK8A 2W0VA 1SSTA 4B4MA 1S4NA 3FTTA 4NANA 2IUAA 2OEFA 2BO8A 4K6RA 1H7TA 1NHEB 3OAMA 3OW5A 4HOCA 2I5KA 1G3LA 4CJCA 3OC9A 3FSCA 3CJ8A 2VS5A 3I3AA 1GQ9A 4NAIA 3RMWA 2FFVA 4Y64A 1VH3A 5FTVA 3R3IA 4G3QA 2ICYA 4B4GA 2AH9A 5FYEA 3MC4A 3TV0A 4HCQA 5C48A 3FWWA 5L6SA 5AFUV 1INIA 1TZFA 1KHRA 5CMFX 4AC3A 2VS4A 5DEPA 2WAWA 4EEGA 3VBJA 4KQLA 3SRTA 1R80A 3K8DA 5CMJA 3CKVA 2V0JA 4DECA 1H7HA 1KK6A 3BSYA 4EGGA 3OKRA 1G2VA 4EA9A 1QGQA 1V83A 2FFUA 4FCUA 3V0LA 5IFYA 3Q7UA 4M2AA 1LZJA 1HM8A 2O1GA 4IHHA 2E3DA 3F1XA 1ZCUA 3D5NA 1ZI4A 3SXAA 1VH1A
chains in the Genus database with same CATH superfamily
2YESA 2UX8A 1FXOA 3I0IX 1M8NA 4KNRA 1QRGA 2ZU7A 4O6NA 3JUJA 1H7FA 1WVCA 4KNXA 3SX5A 1Z90A 2GGOA 2AM3A 1YP4A 4CVHA 1H5RB 1V67A 3OTZA 1LL0A 4M99A 2ZU8A 3SXDA 4O6MA 2X5ZA 2MZBA 1PZTA 1H5TB 1S4OA 1VM8A 1VZTA 2JCOA 3ST8A 2I5EA 1JYKA 2QGIA 4KRVA 3IXCA 4E6UA 1QRLA 1THJA 4EA7A 5C4BA 4L41C 3V8ZA 2AE7A 2BO6A 3TDTA 5EJZA 3NZ2A 2J0AA 1LXAA 3N9WA 4XWIA 1N4IA 2W0WA 3KWEA 3OTMA 1GA8A 2VFZA 2YQJA 3SXCA 1FWYA 4EEOA 1OMZA 2Y7AA 3SXGA 3ECTA 3FS8A 1H3MA 2YC5A 3OH1A 4MNDA 1ZJPA 4HZCA 1MP4A 1O23B 3P1BA 1G93A 1VGZA 4EEAA 5DEMA 1ON6A 3FSBA 4E1KA 3SUCA 2PGVA 2QIVX 4Y7FA 3V90A 1GQCA 2XWNA 2TDTA 4R37A 3ZGGA 4EQYA 3ZF8A 4LW6A 1SSMA 3R5CA 1ZJOA 2OI6A 2WEEA 3I0EA 4KC1A 5HS2A 2IU8A 3VNPA 4HO6A 1KK5A 2RIXA 3R5DA 1GWWA 4HZDA 4E79A 3EH0A 2RIZA 3GVDA 2JCKA 3CKJA 2AESA 1J2ZA 1IINA 3V0MA 4B3UA 5CMIA 5JQQA 3VBLA 4Y7VA 4M28A 3T57A 4N69A 2FYAA 3SXEA 4MZUA 2A8WA 3BCVA 1K4VA 1OQMB 2CU2A 4FRPA 1YP3A 2NPOA 1FR8A 3R5AA 4FRMA 4M9CA 3JQYA 4D11C 4B2WA 5C1GA 1WT1A 3GQ7A 1G0RA 4ZDQA 1JV3A 5C4CA 4EVWA 3U0XA 1FO9A 1MC3A 3I0LA 3R2WA 3JTJA 5ADXU 5IDSA 4JD0A 1LL2A 5C36A 3GQ8A 1R7TA 3EEVA 3ZLKA 1S4PA 3PKPA 2V0HA 3VBNA 2X60A 2V0IA 4HO2A 4UEGA 2JCJA 5FUHA 1ZIZA 2A8UA 1VICA 1VZXA 1LZ0A 3R5BA 1EZIA 4ASJA 4MYBA 4FROA 3V0OA 2WLFA 1FOAA 2D7IA 1W77A 4KPZA 1ZCVA 2FYDB 2VS3A 2WLDA 2PGYA 4Y62A 5FV9A 1OCXA 5DG3A 1FO8A 5F42A 1VZUA 4DE7A 3I0GA 1KGTA 2JF2A 2J0BA 5C8RA 3QVBA 1S80A 1H5RA 1KRUA 4FRDA 3BXYA 2D0JA 1HV9A 4M98A 4E6TA 2VXMA 1PZYB 2FKOA 4HO0A 2RJ9A 5FU8A 2RJ1A 2DPWA 1NMMB 1VGTA 2XATA 1R7UA 1R7XA 1SS9A 1NWGB 3DHOA 3NGWA 2RJ0A 3FSXA 3E25A 3PNNA 4JISA 1IIMA 5CMGX 5C47A 1H4EA 4HO4A 4D48A 1R81A 3BSWA 1H5SD 1R7VA 3USRA 2Z87A 2WLCA 1O7QA 2JF3A 1G23A 4FREA 4N6AA 1LL3A 1MRLA 3D8VA 2FYBA 3MQHA 3T7MA 3EG4A 1E5KA 2YQSA 4R7PA 1G95A 3DJ4A 1VGUA 4Y7UA 1ON8A 1ZDFA 3BFPA 1WT0A 1TW5A 3SX3A 1SSQA 3U2XA 2FY7A 3HL3A 1G1LA 4KXOA 2OI5A 5C3AA 2P72A 1ZCYA 4Y7TA 3OH4A 1W55A 4FRQA 4YS8A 5E3PA 2O1FA 1KRVA 4AYLA 3E26A 1V3WA 3IOJA 1MP3A 3SPTA 1XHBA 4ASYA 5C1LA 1ZI1A 4HUSA 1I52A 5CQPA 3D98A 1ZCTA 2BO7A 4IRPA 4G3SA 2Y6PA 3ZGFA 1H7LA 2WLGA 3HJJA 3V0NA 1OMXA 3DK5A 1VPAA 1MR9A 1QG8A 3CKNA 4Y6UA 2VSIA 2QH5A 3GUEA 1LZIA 3IOHA 1H7EA 1GX0A 3KIAA 4FRHA 5C4FA 5D91A 2VSHA 5ADXV 3R1WA 1YROB 3C8VA 3OGZA 3V8YA 4B42A 5C49A 2D7RA 4MIXA 2YQHA 1WSZA 2RJ8A 3T7NA 2GGQA 1H5SB 2AGDA 4Y6NA 4Y9XA 4FRAA 4CJBA 4B2XA 3JUKA 3P47A 1Z2FA 2ICXA 1ZJ0A 3OUPA 3BSSA 1T3DA 4Y63A 1TVYA 4ARWA 3I0JA 5FU0A 1HJJA 3Q80A 4HO9A 5DDVA 3VBPA 3IGJA 3KWDA 5EJ1A 4Q7CA 1QREA 2XMHA 5C3BA 1YP2A 1NF5B 3T7OA 4DCLA 2WLEA 5CQMX 1R82A 4E75A 4FCEA 4D0ZA 4FIXA 1ZDGA 2VXLA 4M4KA 3FSYA 1H7GA 2AM5A 4KPXA 2Z86A 1O0RA 1H5TA 3F1CA 4GBPA 1XZ6A 3OH0A 4G3PA 4EE4A 2XWLA 4R36A 1KK4A 5AJOA 4HURA 4IHFA 3I0CA 4EA8A 1LVWA 2QKXA 4EAAA 3U0YA 3IOIA 1TW1A 3CKOA 4BMAA 5EIYA 3GOSA 4EABA 2PA4A 2WVMA 3U2UA 3V0PA 2RJ4A 4MFGA 4IHGA 1INJA 1VGWA 1W57A 3U2WA 4KC4A 1JVDA 2P2OA 2V0LA 1O7OA 3POLA 3GQ9A 3K8EA 3OH3A 5CMHA 3O3PA 4B5BA 2AQ9A 3R0SA 4HG6A 3PMOA 4J09A 4BQHA 3BRKX 3SX8A 3V4EA 4N27A 3F1YA 3LW6A 3U2VA 1JVGA 4Y7GA 3OH2A 1G9RA 1XHDA 5CQOA 1FZWA 1TDTA 4HO3A 2IC7A 1FRWA 3FOQA 2I7BA 2WE9A 3V91A 3OU9A 1ZI5A 2PX7A 2WVKA 1HM0A 3GQAA 1JYLA 3TWDA 1G8OA 4H7OA 3ZLLA 1KRRA 4D11A 2VHEA 2P6WA 4KC2A 2E8BA 3I0KA 1KWSA 3TQDA 1KQAA 4AA7A 1FGXA 5C38A 1EYRA 2Q4JA 3PKQA 4LW3A 4FQWA 3V0QA 5C4DA 4P00A 2RIJA 4ECMA 1FGGA 1L0SA 4N6BA 4FRLA 2ZU9A 4P02A 1MP5A 2OI7A 2RIYA 5CQNX 3SX7A 2V0KA 2APCA 5CQLX 3SXBA 2FYCB 1NKHB 4NALA 1ZJ1A 2O1HA 1QQ0A 2JCLA 3I0HA 3R3RA 1EWWA 3RSBA 2YQCA 1HJLA 3EE5A 3I0DA 1FXJA 5AFUU 2X5SA 1H5SA 4AAWA 1QRMA 2VD4A 5AJNA 1HM9A 2QIAA 1FG5N 1H4CA 3R8YA 1H4DA 1MR7A 5C4EA 1JV1A 2XMEA 2YCMA 4MYOA 3CGXA 1WT2A 4HO8A 4D0TA 1XATA 1ZHJA 4NAKA 3RMVA 4FIYA 1GWVA 1QGSA 3KWCA 2VK9A 1H7QA 2YC3A 4KT7A 3TISA 2XWMA 5FTSA 4EEMA 2NXVA 5BXCA 5DDTA 1FR9A 1ZJ2A 1V84A 1V82A 2RJ5A 5E3QA 5IDTA 2OEGA 5E3RA 2Y4MA 2Y4JA 1LZ7A 3U2TA 4DDZA 5C3DA 3VBKA 3Q4SA 4G87A 1NQIB 3TZTA 2RJ6A 1H5SC 3VBMA 2BO4A 3CU0A 4B4BA 5C1HA 2C0NA 3HSQA 3DUVA 1ZI3A 4EE5A 4CJ8A 3USQA 2IU9A 5AJPA 2Y4KA 1KGQA 2AECA 4FRBA 4J18A 1WT3A 3VBIA 4M2BA 2P73A 1QWJA 2AM4A 2X65A 2RJ7A 3I3XA 1GX4A 2RITA 3MQGA 3I0FA 1R7YA 1QRFA 5U2KA 3Q1XA 4EE3A 2WGZA 4ISXA 5I1FA 1G97A 5L6VA 4AYJA 4C2SA 5J49A 2WVLA 3TIOA 4HO5A 1ZJ3A 2Y4LA 3CKQA 4IRQA 3TK8A 2W0VA 1SSTA 4B4MA 1S4NA 3FTTA 4NANA 2IUAA 2OEFA 2BO8A 4K6RA 1H7TA 1NHEB 3OAMA 3OW5A 4HOCA 2I5KA 1G3LA 4CJCA 3OC9A 3FSCA 3CJ8A 2VS5A 3I3AA 1GQ9A 4NAIA 3RMWA 2FFVA 4Y64A 5D92A 1VH3A 5FTVA 3R3IA 4G3QA 2ICYA 4B4GA 2AH9A 5FYEA 3MC4A 3TV0A 4HCQA 5C48A 3FWWA 5L6SA 5AFUV 1INIA 1TZFA 1KHRA 5CMFX 4AC3A 2VS4A 5DEPA 2WAWA 4EEGA 3VBJA 4KQLA 3SRTA 1R80A 3K8DA 5CMJA 3CKVA 2V0JA 4DECA 1H7HA 1KK6A 3BSYA 4EGGA 3OKRA 1G2VA 4EA9A 1QGQA 1V83A 2FFUA 4FCUA 3V0LA 5IFYA 3Q7UA 4M2AA 1LZJA 1HM8A 2O1GA 4IHHA 2E3DA 3F1XA 1ZCUA 3D5NA 1ZI4A 3SXAA 1VH1A
chains in the Genus database with same CATH topology
2YESA 2UX8A 1FXOA 3I0IX 4KNRA 1QRGA 2ZU7A 4O6NA 3JUJA 1H7FA 1WVCA 4KNXA 3SX5A 1Z90A 2GGOA 2AM3A 1YP4A 4CVHA 1H5RB 1V67A 3OTZA 1LL0A 4M99A 2ZU8A 3SXDA 4O6MA 2X5ZA 2MZBA 1PZTA 1H5TB 1S4OA 1VM8A 1VZTA 2JCOA 3ST8A 2I5EA 1JYKA 2QGIA 4KRVA 3IXCA 4E6UA 1QRLA 1THJA 4EA7A 5C4BA 4L41C 3V8ZA 2AE7A 2BO6A 3TDTA 5EJZA 3NZ2A 2J0AA 1LXAA 3N9WA 4XWIA 2W0WA 3KWEA 3OTMA 1GA8A 2VFZA 2YQJA 3SXCA 1FWYA 4EEOA 1OMZA 2Y7AA 3SXGA 3ECTA 3FS8A 1H3MA 2YC5A 3OH1A 4MNDA 1ZJPA 4HZCA 1MP4A 1O23B 3P1BA 1G93A 1VGZA 4EEAA 5DEMA 1ON6A 3FSBA 4E1KA 2PGVA 2QIVX 4Y7FA 3V90A 1GQCA 2XWNA 2TDTA 4R37A 3ZGGA 4EQYA 3ZF8A 4LW6A 1SSMA 3R5CA 1ZJOA 2OI6A 2WEEA 3I0EA 4KC1A 5HS2A 2IU8A 3VNPA 4HO6A 1KK5A 2RIXA 3R5DA 1GWWA 4HZDA 4E79A 3EH0A 2RIZA 3GVDA 2JCKA 3CKJA 2AESA 1J2ZA 1IINA 3V0MA 4B3UA 5CMIA 5JQQA 3VBLA 4Y7VA 4M28A 3T57A 4N69A 2FYAA 3SXEA 4MZUA 2A8WA 3BCVA 1K4VA 1OQMB 2CU2A 4FRPA 1YP3A 2NPOA 1FR8A 3R5AA 4FRMA 4M9CA 3JQYA 4D11C 4B2WA 5C1GA 1WT1A 1G0RA 4ZDQA 1JV3A 5C4CA 4EVWA 3U0XA 1FO9A 1MC3A 3I0LA 3R2WA 3JTJA 5ADXU 5IDSA 4JD0A 1LL2A 5C36A 1R7TA 3EEVA 3ZLKA 1S4PA 3PKPA 2V0HA 3VBNA 2X60A 2V0IA 4HO2A 4UEGA 2JCJA 5FUHA 1ZIZA 2A8UA 1VICA 1VZXA 1LZ0A 3R5BA 1EZIA 4ASJA 4MYBA 4FROA 3V0OA 2WLFA 1FOAA 2D7IA 1W77A 4KPZA 1ZCVA 2FYDB 2VS3A 2WLDA 2PGYA 4Y62A 5FV9A 1OCXA 5DG3A 1FO8A 5F42A 1VZUA 4DE7A 3I0GA 1KGTA 2JF2A 2J0BA 5C8RA 3QVBA 1S80A 1H5RA 1KRUA 4FRDA 3BXYA 2D0JA 1HV9A 4M98A 4E6TA 2VXMA 1PZYB 2FKOA 4HO0A 2RJ9A 5FU8A 2RJ1A 2DPWA 1NMMB 1VGTA 2XATA 1R7UA 1R7XA 1SS9A 1NWGB 3DHOA 3NGWA 2RJ0A 3FSXA 3E25A 3PNNA 4JISA 1IIMA 5CMGX 5C47A 1H4EA 4HO4A 4D48A 1R81A 3BSWA 1H5SD 1R7VA 3USRA 2Z87A 2WLCA 1O7QA 2JF3A 1G23A 4FREA 4N6AA 1LL3A 1MRLA 3D8VA 2FYBA 3MQHA 3T7MA 3EG4A 1E5KA 2YQSA 4R7PA 1G95A 3DJ4A 1VGUA 4Y7UA 1ON8A 1ZDFA 3BFPA 1WT0A 1TW5A 3SX3A 1SSQA 3U2XA 2FY7A 3HL3A 1G1LA 4KXOA 2OI5A 5C3AA 2P72A 1ZCYA 4Y7TA 3OH4A 1W55A 4FRQA 4YS8A 5E3PA 2O1FA 1KRVA 4AYLA 3E26A 1V3WA 3IOJA 1MP3A 3SPTA 1XHBA 4ASYA 5C1LA 1ZI1A 4HUSA 1I52A 5CQPA 3D98A 1ZCTA 2BO7A 4IRPA 4G3SA 2Y6PA 3ZGFA 1H7LA 2WLGA 3HJJA 3V0NA 1OMXA 3DK5A 1VPAA 1MR9A 1QG8A 3CKNA 4Y6UA 2VSIA 2QH5A 3GUEA 1LZIA 3IOHA 1H7EA 1GX0A 3KIAA 4FRHA 5C4FA 5D91A 2VSHA 5ADXV 3R1WA 1YROB 3C8VA 3OGZA 3V8YA 4B42A 5C49A 2D7RA 4MIXA 2YQHA 1WSZA 2RJ8A 3T7NA 2GGQA 1H5SB 2AGDA 4Y6NA 4Y9XA 4FRAA 4CJBA 4B2XA 3JUKA 3P47A 2ICXA 1ZJ0A 3OUPA 3BSSA 1T3DA 4Y63A 1TVYA 4ARWA 3I0JA 5FU0A 1HJJA 3Q80A 4HO9A 5DDVA 3VBPA 3IGJA 3KWDA 5EJ1A 4Q7CA 1QREA 2XMHA 5C3BA 1YP2A 1NF5B 3T7OA 4DCLA 2WLEA 5CQMX 1R82A 4E75A 4FCEA 4D0ZA 4FIXA 1ZDGA 2VXLA 4M4KA 3FSYA 1H7GA 2AM5A 4KPXA 2Z86A 1O0RA 1H5TA 3F1CA 4GBPA 1XZ6A 3OH0A 4G3PA 4EE4A 2XWLA 4R36A 1KK4A 5AJOA 4HURA 4IHFA 3I0CA 4EA8A 1LVWA 2QKXA 4EAAA 3U0YA 3IOIA 1TW1A 3CKOA 4BMAA 5EIYA 3GOSA 4EABA 2PA4A 2WVMA 3U2UA 3V0PA 2RJ4A 4MFGA 4IHGA 1INJA 1VGWA 1W57A 3U2WA 4KC4A 1JVDA 2P2OA 2V0LA 1O7OA 3POLA 3K8EA 3OH3A 5CMHA 3O3PA 4B5BA 2AQ9A 3R0SA 4HG6A 3PMOA 4J09A 4BQHA 3BRKX 3SX8A 3V4EA 4N27A 3F1YA 3LW6A 3U2VA 1JVGA 4Y7GA 3OH2A 1G9RA 1XHDA 5CQOA 1FZWA 1TDTA 4HO3A 2IC7A 1FRWA 3FOQA 2I7BA 2WE9A 3V91A 3OU9A 1ZI5A 2PX7A 2WVKA 1HM0A 1JYLA 3TWDA 1G8OA 4H7OA 3ZLLA 1KRRA 4D11A 2VHEA 2P6WA 4KC2A 2E8BA 3I0KA 1KWSA 3TQDA 1KQAA 4AA7A 1FGXA 5C38A 1EYRA 2Q4JA 3PKQA 4LW3A 4FQWA 3V0QA 5C4DA 4P00A 2RIJA 4ECMA 1FGGA 4N6BA 4FRLA 2ZU9A 4P02A 1MP5A 2OI7A 2RIYA 5CQNX 3SX7A 2V0KA 2APCA 5CQLX 3SXBA 2FYCB 1NKHB 4NALA 1ZJ1A 2O1HA 1QQ0A 2JCLA 3I0HA 3R3RA 3RSBA 2YQCA 1HJLA 3EE5A 3I0DA 1FXJA 5AFUU 2X5SA 1H5SA 4AAWA 1QRMA 2VD4A 5AJNA 1HM9A 2QIAA 1FG5N 1H4CA 3R8YA 1H4DA 1MR7A 5C4EA 1JV1A 2XMEA 2YCMA 4MYOA 3CGXA 1WT2A 4HO8A 4D0TA 1XATA 1ZHJA 4NAKA 3RMVA 4FIYA 1GWVA 1QGSA 3KWCA 2VK9A 1H7QA 2YC3A 4KT7A 3TISA 2XWMA 5FTSA 4EEMA 2NXVA 5BXCA 5DDTA 1FR9A 1ZJ2A 1V84A 1V82A 2RJ5A 5E3QA 5IDTA 2OEGA 5E3RA 2Y4MA 2Y4JA 1LZ7A 3U2TA 4DDZA 5C3DA 3VBKA 3Q4SA 4G87A 1NQIB 3TZTA 2RJ6A 1H5SC 3VBMA 2BO4A 3CU0A 4B4BA 5C1HA 2C0NA 3HSQA 3DUVA 1ZI3A 4EE5A 4CJ8A 3USQA 2IU9A 5AJPA 2Y4KA 1KGQA 2AECA 4FRBA 4J18A 1WT3A 3VBIA 4M2BA 2P73A 1QWJA 2AM4A 2X65A 2RJ7A 3I3XA 1GX4A 2RITA 3MQGA 3I0FA 1R7YA 1QRFA 5U2KA 3Q1XA 4EE3A 2WGZA 4ISXA 5I1FA 1G97A 5L6VA 4AYJA 4C2SA 5J49A 2WVLA 3TIOA 4HO5A 1ZJ3A 2Y4LA 3CKQA 4IRQA 3TK8A 2W0VA 1SSTA 4B4MA 1S4NA 3FTTA 4NANA 2IUAA 2OEFA 2BO8A 4K6RA 1H7TA 1NHEB 3OAMA 3OW5A 4HOCA 2I5KA 1G3LA 4CJCA 3OC9A 3FSCA 3CJ8A 2VS5A 3I3AA 1GQ9A 4NAIA 3RMWA 2FFVA 4Y64A 5D92A 1VH3A 5FTVA 3R3IA 4G3QA 2ICYA 4B4GA 2AH9A 5FYEA 3MC4A 3TV0A 4HCQA 5C48A 3FWWA 5L6SA 5AFUV 1INIA 1TZFA 1KHRA 5CMFX 4AC3A 2VS4A 5DEPA 2WAWA 4EEGA 3VBJA 4KQLA 3SRTA 1R80A 3K8DA 5CMJA 3CKVA 2V0JA 4DECA 1H7HA 1KK6A 3BSYA 4EGGA 3OKRA 1G2VA 4EA9A 1QGQA 1V83A 2FFUA 4FCUA 3V0LA 5IFYA 3Q7UA 4M2AA 1LZJA 1HM8A 2O1GA 4IHHA 2E3DA 3F1XA 1ZCUA 3D5NA 1ZI4A 3SXAA 1VH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YES A;  2UX8 A;  1FXO A;  3I0I X;  4KNR A;  1QRG A;  2ZU7 A;  3JUJ A;  1H7F A;  1WVC A;  4KNX A;  3SX5 A;  1Z90 A;  2GGO A;  2AM3 A;  1YP4 A;  4CVH A;  1H5R B;  1V67 A;  3OTZ A;  1LL0 A;  4M99 A;  2ZU8 A;  3SXD A;  2X5Z A;  2MZB A;  1PZT A;  1H5T B;  1S4O A;  1VM8 A;  1VZT A;  2JCO A;  3ST8 A;  2I5E A;  1JYK A;  2QGI A;  4KRV A;  3IXC A;  4E6U A;  1QRL A;  1THJ A;  4EA7 A;  5C4B A;  4L41 C;  3V8Z A;  2AE7 A;  2BO6 A;  3TDT A;  5EJZ A;  3NZ2 A;  1LXA A;  3N9W A;  4XWI A;  2W0W A;  3KWE A;  3OTM A;  1GA8 A;  2VFZ A;  2YQJ A;  3SXC A;  1FWY A;  4EEO A;  1OMZ A;  2Y7A A;  3SXG A;  3ECT A;  3FS8 A;  1H3M A;  2YC5 A;  3OH1 A;  4MND A;  1ZJP A;  4HZC A;  1MP4 A;  1O23 B;  3P1B A;  1G93 A;  1VGZ A;  4EEA A;  5DEM A;  1ON6 A;  3FSB A;  4E1K A;  2PGV A;  2QIV X;  4Y7F A;  3V90 A;  1GQC A;  2XWN A;  2TDT A;  4R37 A;  3ZGG A;  4EQY A;  3ZF8 A;  4LW6 A;  1SSM A;  3R5C A;  1ZJO A;  2OI6 A;  2WEE A;  3I0E A;  4KC1 A;  5HS2 A;  2IU8 A;  3VNP A;  4HO6 A;  1KK5 A;  2RIX A;  3R5D A;  1GWW A;  4HZD A;  4E79 A;  3EH0 A;  2RIZ A;  3GVD A;  2JCK A;  3CKJ A;  2AES A;  1J2Z A;  1IIN A;  3V0M A;  4B3U A;  5CMI A;  5JQQ A;  3VBL A;  4Y7V A;  4M28 A;  3T57 A;  4N69 A;  2FYA A;  3SXE A;  4MZU A;  2A8W A;  3BCV A;  1K4V A;  1OQM B;  2CU2 A;  4FRP A;  1YP3 A;  2NPO A;  1FR8 A;  3R5A A;  4FRM A;  4M9C A;  3JQY A;  4D11 C;  4B2W A;  5C1G A;  1WT1 A;  1G0R A;  4ZDQ A;  1JV3 A;  5C4C A;  4EVW A;  3U0X A;  1FO9 A;  1MC3 A;  3I0L A;  3R2W A;  3JTJ A;  5ADX U;  5IDS A;  4JD0 A;  1LL2 A;  5C36 A;  1R7T A;  3EEV A;  3ZLK A;  1S4P A;  3PKP A;  2V0H A;  3VBN A;  2X60 A;  2V0I A;  4HO2 A;  4UEG A;  2JCJ A;  5FUH A;  1ZIZ A;  2A8U A;  1VIC A;  1VZX A;  1LZ0 A;  3R5B A;  1EZI A;  4ASJ A;  4MYB A;  4FRO A;  3V0O A;  2WLF A;  1FOA A;  2D7I A;  1W77 A;  4KPZ A;  1ZCV A;  2FYD B;  2VS3 A;  2WLD A;  2PGY A;  4Y62 A;  5FV9 A;  1OCX A;  5DG3 A;  1FO8 A;  5F42 A;  1VZU A;  4DE7 A;  3I0G A;  1KGT A;  2JF2 A;  5C8R A;  3QVB A;  1S80 A;  1H5R A;  1KRU A;  4FRD A;  3BXY A;  2D0J A;  1HV9 A;  4M98 A;  4E6T A;  2VXM A;  1PZY B;  2FKO A;  4HO0 A;  2RJ9 A;  5FU8 A;  2RJ1 A;  2DPW A;  1NMM B;  1VGT A;  2XAT A;  1R7U A;  1R7X A;  1SS9 A;  1NWG B;  3DHO A;  3NGW A;  2RJ0 A;  3FSX A;  3E25 A;  3PNN A;  4JIS A;  1IIM A;  5CMG X;  5C47 A;  1H4E A;  4HO4 A;  4D48 A;  1R81 A;  3BSW A;  1H5S D;  1R7V A;  3USR A;  2Z87 A;  2WLC A;  1O7Q A;  2JF3 A;  1G23 A;  4FRE A;  4N6A A;  1LL3 A;  1MRL A;  3D8V A;  2FYB A;  3MQH A;  3T7M A;  3EG4 A;  1E5K A;  2YQS A;  4R7P A;  1G95 A;  3DJ4 A;  1VGU A;  4Y7U A;  1ON8 A;  1ZDF A;  3BFP A;  1WT0 A;  1TW5 A;  3SX3 A;  1SSQ A;  3U2X A;  2FY7 A;  3HL3 A;  1G1L A;  4KXO A;  2OI5 A;  5C3A A;  2P72 A;  1ZCY A;  4Y7T A;  3OH4 A;  1W55 A;  4FRQ A;  4YS8 A;  5E3P A;  2O1F A;  1KRV A;  4AYL A;  3E26 A;  1V3W A;  3IOJ A;  1MP3 A;  3SPT A;  1XHB A;  4ASY A;  5C1L A;  1ZI1 A;  4HUS A;  1I52 A;  5CQP A;  3D98 A;  1ZCT A;  2BO7 A;  4IRP A;  4G3S A;  2Y6P A;  3ZGF A;  1H7L A;  2WLG A;  3HJJ A;  3V0N A;  1OMX A;  3DK5 A;  1VPA A;  1MR9 A;  1QG8 A;  3CKN A;  4Y6U A;  2VSI A;  2QH5 A;  3GUE A;  1LZI A;  3IOH A;  1H7E A;  1GX0 A;  3KIA A;  4FRH A;  5C4F A;  2VSH A;  5ADX V;  3R1W A;  1YRO B;  3C8V A;  3OGZ A;  3V8Y A;  4B42 A;  5C49 A;  2D7R A;  2YQH A;  1WSZ A;  2RJ8 A;  3T7N A;  2GGQ A;  1H5S B;  2AGD A;  4Y6N A;  4Y9X A;  4FRA A;  4CJB A;  4B2X A;  3JUK A;  3P47 A;  2ICX A;  1ZJ0 A;  3OUP A;  3BSS A;  1T3D A;  4Y63 A;  1TVY A;  4ARW A;  3I0J A;  5FU0 A;  1HJJ A;  3Q80 A;  4HO9 A;  5DDV A;  3VBP A;  3IGJ A;  3KWD A;  5EJ1 A;  1QRE A;  2XMH A;  5C3B A;  1YP2 A;  1NF5 B;  3T7O A;  4DCL A;  2WLE A;  5CQM X;  1R82 A;  4E75 A;  4FCE A;  4D0Z A;  1ZDG A;  2VXL A;  4M4K A;  3FSY A;  1H7G A;  2AM5 A;  4KPX A;  2Z86 A;  1O0R A;  1H5T A;  3F1C A;  4GBP A;  1XZ6 A;  3OH0 A;  4G3P A;  4EE4 A;  2XWL A;  4R36 A;  1KK4 A;  5AJO A;  4HUR A;  4IHF A;  3I0C A;  4EA8 A;  1LVW A;  2QKX A;  4EAA A;  3U0Y A;  3IOI A;  1TW1 A;  3CKO A;  4BMA A;  5EIY A;  3GOS A;  4EAB A;  2PA4 A;  2WVM A;  3U2U A;  3V0P A;  2RJ4 A;  4MFG A;  4IHG A;  1INJ A;  1VGW A;  1W57 A;  3U2W A;  4KC4 A;  1JVD A;  2P2O A;  2V0L A;  1O7O A;  3POL A;  3K8E A;  3OH3 A;  5CMH A;  3O3P A;  4B5B A;  2AQ9 A;  3R0S A;  4HG6 A;  3PMO A;  4J09 A;  4BQH A;  3BRK X;  3SX8 A;  3V4E A;  4N27 A;  3F1Y A;  3LW6 A;  3U2V A;  1JVG A;  4Y7G A;  3OH2 A;  1G9R A;  1XHD A;  5CQO A;  1FZW A;  1TDT A;  4HO3 A;  2IC7 A;  1FRW A;  3FOQ A;  2I7B A;  2WE9 A;  3V91 A;  3OU9 A;  1ZI5 A;  2PX7 A;  2WVK A;  1HM0 A;  1JYL A;  3TWD A;  1G8O A;  4H7O A;  3ZLL A;  1KRR A;  4D11 A;  2VHE A;  2P6W A;  4KC2 A;  2E8B A;  3I0K A;  1KWS A;  3TQD A;  1KQA A;  4AA7 A;  1FGX A;  5C38 A;  1EYR A;  2Q4J A;  3PKQ A;  4LW3 A;  4FQW A;  3V0Q A;  5C4D A;  4P00 A;  2RIJ A;  4ECM A;  1FGG A;  4N6B A;  4FRL A;  2ZU9 A;  4P02 A;  1MP5 A;  2OI7 A;  2RIY A;  5CQN X;  3SX7 A;  2V0K A;  2APC A;  5CQL X;  3SXB A;  2FYC B;  1NKH B;  4NAL A;  1ZJ1 A;  2O1H A;  1QQ0 A;  2JCL A;  3I0H A;  3R3R A;  3RSB A;  2YQC A;  1HJL A;  3EE5 A;  3I0D A;  1FXJ A;  5AFU U;  2X5S A;  1H5S A;  4AAW A;  1QRM A;  2VD4 A;  5AJN A;  1HM9 A;  2QIA A;  1FG5 N;  1H4C A;  3R8Y A;  1H4D A;  1MR7 A;  5C4E A;  1JV1 A;  2XME A;  2YCM A;  4MYO A;  3CGX A;  1WT2 A;  4HO8 A;  4D0T A;  1XAT A;  1ZHJ A;  4NAK A;  3RMV A;  1GWV A;  1QGS A;  3KWC A;  1H7Q A;  2YC3 A;  4KT7 A;  3TIS A;  2XWM A;  5FTS A;  4EEM A;  2NXV A;  5BXC A;  5DDT A;  1FR9 A;  1ZJ2 A;  1V84 A;  1V82 A;  2RJ5 A;  5E3Q A;  5IDT A;  2OEG A;  5E3R A;  2Y4M A;  2Y4J A;  1LZ7 A;  3U2T A;  4DDZ A;  5C3D A;  3VBK A;  3Q4S A;  4G87 A;  1NQI B;  3TZT A;  2RJ6 A;  1H5S C;  3VBM A;  2BO4 A;  3CU0 A;  4B4B A;  5C1H A;  3HSQ A;  3DUV A;  1ZI3 A;  4EE5 A;  4CJ8 A;  3USQ A;  2IU9 A;  5AJP A;  2Y4K A;  1KGQ A;  2AEC A;  4FRB A;  4J18 A;  1WT3 A;  3VBI A;  4M2B A;  2P73 A;  1QWJ A;  2AM4 A;  2X65 A;  2RJ7 A;  3I3X A;  1GX4 A;  2RIT A;  3MQG A;  3I0F A;  1R7Y A;  1QRF A;  5U2K A;  3Q1X A;  4EE3 A;  2WGZ A;  4ISX A;  5I1F A;  1G97 A;  5L6V A;  4AYJ A;  4C2S A;  5J49 A;  2WVL A;  3TIO A;  4HO5 A;  1ZJ3 A;  2Y4L A;  3CKQ A;  4IRQ A;  3TK8 A;  2W0V A;  1SST A;  4B4M A;  1S4N A;  3FTT A;  4NAN A;  2IUA A;  2OEF A;  2BO8 A;  4K6R A;  1H7T A;  1NHE B;  3OAM A;  3OW5 A;  4HOC A;  2I5K A;  1G3L A;  4CJC A;  3OC9 A;  3FSC A;  3CJ8 A;  2VS5 A;  3I3A A;  1GQ9 A;  4NAI A;  3RMW A;  2FFV A;  4Y64 A;  1VH3 A;  5FTV A;  3R3I A;  4G3Q A;  2ICY A;  4B4G A;  2AH9 A;  5FYE A;  3MC4 A;  3TV0 A;  4HCQ A;  5C48 A;  3FWW A;  5L6S A;  5AFU V;  1INI A;  1TZF A;  1KHR A;  5CMF X;  4AC3 A;  2VS4 A;  5DEP A;  2WAW A;  4EEG A;  3VBJ A;  4KQL A;  3SRT A;  1R80 A;  3K8D A;  5CMJ A;  3CKV A;  2V0J A;  4DEC A;  1H7H A;  1KK6 A;  3BSY A;  4EGG A;  3OKR A;  1G2V A;  4EA9 A;  1QGQ A;  1V83 A;  2FFU A;  4FCU A;  3V0L A;  5IFY A;  3Q7U A;  4M2A A;  1LZJ A;  1HM8 A;  2O1G A;  4IHH A;  2E3D A;  3F1X A;  1ZCU A;  3D5N A;  1ZI4 A;  3SXA A;  1VH1 A; 
#chains in the Genus database with same CATH topology
 2YES A;  2UX8 A;  1FXO A;  3I0I X;  1M8N A;  4KNR A;  1QRG A;  2ZU7 A;  4O6N A;  3JUJ A;  1H7F A;  1WVC A;  4KNX A;  3SX5 A;  1Z90 A;  2GGO A;  2AM3 A;  1YP4 A;  4CVH A;  1H5R B;  1V67 A;  3OTZ A;  1LL0 A;  4M99 A;  2ZU8 A;  3SXD A;  4O6M A;  2X5Z A;  2MZB A;  1PZT A;  1H5T B;  1S4O A;  1VM8 A;  1VZT A;  2JCO A;  3ST8 A;  2I5E A;  1JYK A;  2QGI A;  4KRV A;  3IXC A;  4E6U A;  1QRL A;  1THJ A;  4EA7 A;  5C4B A;  4L41 C;  3V8Z A;  2AE7 A;  2BO6 A;  3TDT A;  5EJZ A;  3NZ2 A;  2J0A A;  1LXA A;  3N9W A;  4XWI A;  1N4I A;  2W0W A;  3KWE A;  3OTM A;  1GA8 A;  2VFZ A;  2YQJ A;  3SXC A;  1FWY A;  4EEO A;  1OMZ A;  2Y7A A;  3SXG A;  3ECT A;  3FS8 A;  1H3M A;  2YC5 A;  3OH1 A;  4MND A;  1ZJP A;  4HZC A;  1MP4 A;  1O23 B;  3P1B A;  1G93 A;  1VGZ A;  4EEA A;  5DEM A;  1ON6 A;  3FSB A;  4E1K A;  3SUC A;  2PGV A;  2QIV X;  4Y7F A;  3V90 A;  1GQC A;  2XWN A;  2TDT A;  4R37 A;  3ZGG A;  4EQY A;  3ZF8 A;  4LW6 A;  1SSM A;  3R5C A;  1ZJO A;  2OI6 A;  2WEE A;  3I0E A;  4KC1 A;  5HS2 A;  2IU8 A;  3VNP A;  4HO6 A;  1KK5 A;  2RIX A;  3R5D A;  1GWW A;  4HZD A;  4E79 A;  3EH0 A;  2RIZ A;  3GVD A;  2JCK A;  3CKJ A;  2AES A;  1J2Z A;  1IIN A;  3V0M A;  4B3U A;  5CMI A;  5JQQ A;  3VBL A;  4Y7V A;  4M28 A;  3T57 A;  4N69 A;  2FYA A;  3SXE A;  4MZU A;  2A8W A;  3BCV A;  1K4V A;  1OQM B;  2CU2 A;  4FRP A;  1YP3 A;  2NPO A;  1FR8 A;  3R5A A;  4FRM A;  4M9C A;  3JQY A;  4D11 C;  4B2W A;  5C1G A;  1WT1 A;  3GQ7 A;  1G0R A;  4ZDQ A;  1JV3 A;  5C4C A;  4EVW A;  3U0X A;  1FO9 A;  1MC3 A;  3I0L A;  3R2W A;  3JTJ A;  5ADX U;  5IDS A;  4JD0 A;  1LL2 A;  5C36 A;  3GQ8 A;  1R7T A;  3EEV A;  3ZLK A;  1S4P A;  3PKP A;  2V0H A;  3VBN A;  2X60 A;  2V0I A;  4HO2 A;  4UEG A;  2JCJ A;  5FUH A;  1ZIZ A;  2A8U A;  1VIC A;  1VZX A;  1LZ0 A;  3R5B A;  1EZI A;  4ASJ A;  4MYB A;  4FRO A;  3V0O A;  2WLF A;  1FOA A;  2D7I A;  1W77 A;  4KPZ A;  1ZCV A;  2FYD B;  2VS3 A;  2WLD A;  2PGY A;  4Y62 A;  5FV9 A;  1OCX A;  5DG3 A;  1FO8 A;  5F42 A;  1VZU A;  4DE7 A;  3I0G A;  1KGT A;  2JF2 A;  2J0B A;  5C8R A;  3QVB A;  1S80 A;  1H5R A;  1KRU A;  4FRD A;  3BXY A;  2D0J A;  1HV9 A;  4M98 A;  4E6T A;  2VXM A;  1PZY B;  2FKO A;  4HO0 A;  2RJ9 A;  5FU8 A;  2RJ1 A;  2DPW A;  1NMM B;  1VGT A;  2XAT A;  1R7U A;  1R7X A;  1SS9 A;  1NWG B;  3DHO A;  3NGW A;  2RJ0 A;  3FSX A;  3E25 A;  3PNN A;  4JIS A;  1IIM A;  5CMG X;  5C47 A;  1H4E A;  4HO4 A;  4D48 A;  1R81 A;  3BSW A;  1H5S D;  1R7V A;  3USR A;  2Z87 A;  2WLC A;  1O7Q A;  2JF3 A;  1G23 A;  4FRE A;  4N6A A;  1LL3 A;  1MRL A;  3D8V A;  2FYB A;  3MQH A;  3T7M A;  3EG4 A;  1E5K A;  2YQS A;  4R7P A;  1G95 A;  3DJ4 A;  1VGU A;  4Y7U A;  1ON8 A;  1ZDF A;  3BFP A;  1WT0 A;  1TW5 A;  3SX3 A;  1SSQ A;  3U2X A;  2FY7 A;  3HL3 A;  1G1L A;  4KXO A;  2OI5 A;  5C3A A;  2P72 A;  1ZCY A;  4Y7T A;  3OH4 A;  1W55 A;  4FRQ A;  4YS8 A;  5E3P A;  2O1F A;  1KRV A;  4AYL A;  3E26 A;  1V3W A;  3IOJ A;  1MP3 A;  3SPT A;  1XHB A;  4ASY A;  5C1L A;  1ZI1 A;  4HUS A;  1I52 A;  5CQP A;  3D98 A;  1ZCT A;  2BO7 A;  4IRP A;  4G3S A;  2Y6P A;  3ZGF A;  1H7L A;  2WLG A;  3HJJ A;  3V0N A;  1OMX A;  3DK5 A;  1VPA A;  1MR9 A;  1QG8 A;  3CKN A;  4Y6U A;  2VSI A;  2QH5 A;  3GUE A;  1LZI A;  3IOH A;  1H7E A;  1GX0 A;  3KIA A;  4FRH A;  5C4F A;  5D91 A;  2VSH A;  5ADX V;  3R1W A;  1YRO B;  3C8V A;  3OGZ A;  3V8Y A;  4B42 A;  5C49 A;  2D7R A;  4MIX A;  2YQH A;  1WSZ A;  2RJ8 A;  3T7N A;  2GGQ A;  1H5S B;  2AGD A;  4Y6N A;  4Y9X A;  4FRA A;  4CJB A;  4B2X A;  3JUK A;  3P47 A;  1Z2F A;  2ICX A;  1ZJ0 A;  3OUP A;  3BSS A;  1T3D A;  4Y63 A;  1TVY A;  4ARW A;  3I0J A;  5FU0 A;  1HJJ A;  3Q80 A;  4HO9 A;  5DDV A;  3VBP A;  3IGJ A;  3KWD A;  5EJ1 A;  4Q7C A;  1QRE A;  2XMH A;  5C3B A;  1YP2 A;  1NF5 B;  3T7O A;  4DCL A;  2WLE A;  5CQM X;  1R82 A;  4E75 A;  4FCE A;  4D0Z A;  4FIX A;  1ZDG A;  2VXL A;  4M4K A;  3FSY A;  1H7G A;  2AM5 A;  4KPX A;  2Z86 A;  1O0R A;  1H5T A;  3F1C A;  4GBP A;  1XZ6 A;  3OH0 A;  4G3P A;  4EE4 A;  2XWL A;  4R36 A;  1KK4 A;  5AJO A;  4HUR A;  4IHF A;  3I0C A;  4EA8 A;  1LVW A;  2QKX A;  4EAA A;  3U0Y A;  3IOI A;  1TW1 A;  3CKO A;  4BMA A;  5EIY A;  3GOS A;  4EAB A;  2PA4 A;  2WVM A;  3U2U A;  3V0P A;  2RJ4 A;  4MFG A;  4IHG A;  1INJ A;  1VGW A;  1W57 A;  3U2W A;  4KC4 A;  1JVD A;  2P2O A;  2V0L A;  1O7O A;  3POL A;  3GQ9 A;  3K8E A;  3OH3 A;  5CMH A;  3O3P A;  4B5B A;  2AQ9 A;  3R0S A;  4HG6 A;  3PMO A;  4J09 A;  4BQH A;  3BRK X;  3SX8 A;  3V4E A;  4N27 A;  3F1Y A;  3LW6 A;  3U2V A;  1JVG A;  4Y7G A;  3OH2 A;  1G9R A;  1XHD A;  5CQO A;  1FZW A;  1TDT A;  4HO3 A;  2IC7 A;  1FRW A;  3FOQ A;  2I7B A;  2WE9 A;  3V91 A;  3OU9 A;  1ZI5 A;  2PX7 A;  2WVK A;  1HM0 A;  3GQA A;  1JYL A;  3TWD A;  1G8O A;  4H7O A;  3ZLL A;  1KRR A;  4D11 A;  2VHE A;  2P6W A;  4KC2 A;  2E8B A;  3I0K A;  1KWS A;  3TQD A;  1KQA A;  4AA7 A;  1FGX A;  5C38 A;  1EYR A;  2Q4J A;  3PKQ A;  4LW3 A;  4FQW A;  3V0Q A;  5C4D A;  4P00 A;  2RIJ A;  4ECM A;  1FGG A;  1L0S A;  4N6B A;  4FRL A;  2ZU9 A;  4P02 A;  1MP5 A;  2OI7 A;  2RIY A;  5CQN X;  3SX7 A;  2V0K A;  2APC A;  5CQL X;  3SXB A;  2FYC B;  1NKH B;  4NAL A;  1ZJ1 A;  2O1H A;  1QQ0 A;  2JCL A;  3I0H A;  3R3R A;  1EWW A;  3RSB A;  2YQC A;  1HJL A;  3EE5 A;  3I0D A;  1FXJ A;  5AFU U;  2X5S A;  1H5S A;  4AAW A;  1QRM A;  2VD4 A;  5AJN A;  1HM9 A;  2QIA A;  1FG5 N;  1H4C A;  3R8Y A;  1H4D A;  1MR7 A;  5C4E A;  1JV1 A;  2XME A;  2YCM A;  4MYO A;  3CGX A;  1WT2 A;  4HO8 A;  4D0T A;  1XAT A;  1ZHJ A;  4NAK A;  3RMV A;  4FIY A;  1GWV A;  1QGS A;  3KWC A;  2VK9 A;  1H7Q A;  2YC3 A;  4KT7 A;  3TIS A;  2XWM A;  5FTS A;  4EEM A;  2NXV A;  5BXC A;  5DDT A;  1FR9 A;  1ZJ2 A;  1V84 A;  1V82 A;  2RJ5 A;  5E3Q A;  5IDT A;  2OEG A;  5E3R A;  2Y4M A;  2Y4J A;  1LZ7 A;  3U2T A;  4DDZ A;  5C3D A;  3VBK A;  3Q4S A;  4G87 A;  1NQI B;  3TZT A;  2RJ6 A;  1H5S C;  3VBM A;  2BO4 A;  3CU0 A;  4B4B A;  5C1H A;  2C0N A;  3HSQ A;  3DUV A;  1ZI3 A;  4EE5 A;  4CJ8 A;  3USQ A;  2IU9 A;  5AJP A;  2Y4K A;  1KGQ A;  2AEC A;  4FRB A;  4J18 A;  1WT3 A;  3VBI A;  4M2B A;  2P73 A;  1QWJ A;  2AM4 A;  2X65 A;  2RJ7 A;  3I3X A;  1GX4 A;  2RIT A;  3MQG A;  3I0F A;  1R7Y A;  1QRF A;  5U2K A;  3Q1X A;  4EE3 A;  2WGZ A;  4ISX A;  5I1F A;  1G97 A;  5L6V A;  4AYJ A;  4C2S A;  5J49 A;  2WVL A;  3TIO A;  4HO5 A;  1ZJ3 A;  2Y4L A;  3CKQ A;  4IRQ A;  3TK8 A;  2W0V A;  1SST A;  4B4M A;  1S4N A;  3FTT A;  4NAN A;  2IUA A;  2OEF A;  2BO8 A;  4K6R A;  1H7T A;  1NHE B;  3OAM A;  3OW5 A;  4HOC A;  2I5K A;  1G3L A;  4CJC A;  3OC9 A;  3FSC A;  3CJ8 A;  2VS5 A;  3I3A A;  1GQ9 A;  4NAI A;  3RMW A;  2FFV A;  4Y64 A;  5D92 A;  1VH3 A;  5FTV A;  3R3I A;  4G3Q A;  2ICY A;  4B4G A;  2AH9 A;  5FYE A;  3MC4 A;  3TV0 A;  4HCQ A;  5C48 A;  3FWW A;  5L6S A;  5AFU V;  1INI A;  1TZF A;  1KHR A;  5CMF X;  4AC3 A;  2VS4 A;  5DEP A;  2WAW A;  4EEG A;  3VBJ A;  4KQL A;  3SRT A;  1R80 A;  3K8D A;  5CMJ A;  3CKV A;  2V0J A;  4DEC A;  1H7H A;  1KK6 A;  3BSY A;  4EGG A;  3OKR A;  1G2V A;  4EA9 A;  1QGQ A;  1V83 A;  2FFU A;  4FCU A;  3V0L A;  5IFY A;  3Q7U A;  4M2A A;  1LZJ A;  1HM8 A;  2O1G A;  4IHH A;  2E3D A;  3F1X A;  1ZCU A;  3D5N A;  1ZI4 A;  3SXA A;  1VH1 A; 
#chains in the Genus database with same CATH homology
 2YES A;  2UX8 A;  1FXO A;  3I0I X;  4KNR A;  1QRG A;  2ZU7 A;  4O6N A;  3JUJ A;  1H7F A;  1WVC A;  4KNX A;  3SX5 A;  1Z90 A;  2GGO A;  2AM3 A;  1YP4 A;  4CVH A;  1H5R B;  1V67 A;  3OTZ A;  1LL0 A;  4M99 A;  2ZU8 A;  3SXD A;  4O6M A;  2X5Z A;  2MZB A;  1PZT A;  1H5T B;  1S4O A;  1VM8 A;  1VZT A;  2JCO A;  3ST8 A;  2I5E A;  1JYK A;  2QGI A;  4KRV A;  3IXC A;  4E6U A;  1QRL A;  1THJ A;  4EA7 A;  5C4B A;  4L41 C;  3V8Z A;  2AE7 A;  2BO6 A;  3TDT A;  5EJZ A;  3NZ2 A;  2J0A A;  1LXA A;  3N9W A;  4XWI A;  2W0W A;  3KWE A;  3OTM A;  1GA8 A;  2VFZ A;  2YQJ A;  3SXC A;  1FWY A;  4EEO A;  1OMZ A;  2Y7A A;  3SXG A;  3ECT A;  3FS8 A;  1H3M A;  2YC5 A;  3OH1 A;  4MND A;  1ZJP A;  4HZC A;  1MP4 A;  1O23 B;  3P1B A;  1G93 A;  1VGZ A;  4EEA A;  5DEM A;  1ON6 A;  3FSB A;  4E1K A;  2PGV A;  2QIV X;  4Y7F A;  3V90 A;  1GQC A;  2XWN A;  2TDT A;  4R37 A;  3ZGG A;  4EQY A;  3ZF8 A;  4LW6 A;  1SSM A;  3R5C A;  1ZJO A;  2OI6 A;  2WEE A;  3I0E A;  4KC1 A;  5HS2 A;  2IU8 A;  3VNP A;  4HO6 A;  1KK5 A;  2RIX A;  3R5D A;  1GWW A;  4HZD A;  4E79 A;  3EH0 A;  2RIZ A;  3GVD A;  2JCK A;  3CKJ A;  2AES A;  1J2Z A;  1IIN A;  3V0M A;  4B3U A;  5CMI A;  5JQQ A;  3VBL A;  4Y7V A;  4M28 A;  3T57 A;  4N69 A;  2FYA A;  3SXE A;  4MZU A;  2A8W A;  3BCV A;  1K4V A;  1OQM B;  2CU2 A;  4FRP A;  1YP3 A;  2NPO A;  1FR8 A;  3R5A A;  4FRM A;  4M9C A;  3JQY A;  4D11 C;  4B2W A;  5C1G A;  1WT1 A;  1G0R A;  4ZDQ A;  1JV3 A;  5C4C A;  4EVW A;  3U0X A;  1FO9 A;  1MC3 A;  3I0L A;  3R2W A;  3JTJ A;  5ADX U;  5IDS A;  4JD0 A;  1LL2 A;  5C36 A;  1R7T A;  3EEV A;  3ZLK A;  1S4P A;  3PKP A;  2V0H A;  3VBN A;  2X60 A;  2V0I A;  4HO2 A;  4UEG A;  2JCJ A;  5FUH A;  1ZIZ A;  2A8U A;  1VIC A;  1VZX A;  1LZ0 A;  3R5B A;  1EZI A;  4ASJ A;  4MYB A;  4FRO A;  3V0O A;  2WLF A;  1FOA A;  2D7I A;  1W77 A;  4KPZ A;  1ZCV A;  2FYD B;  2VS3 A;  2WLD A;  2PGY A;  4Y62 A;  5FV9 A;  1OCX A;  5DG3 A;  1FO8 A;  5F42 A;  1VZU A;  4DE7 A;  3I0G A;  1KGT A;  2JF2 A;  2J0B A;  5C8R A;  3QVB A;  1S80 A;  1H5R A;  1KRU A;  4FRD A;  3BXY A;  2D0J A;  1HV9 A;  4M98 A;  4E6T A;  2VXM A;  1PZY B;  2FKO A;  4HO0 A;  2RJ9 A;  5FU8 A;  2RJ1 A;  2DPW A;  1NMM B;  1VGT A;  2XAT A;  1R7U A;  1R7X A;  1SS9 A;  1NWG B;  3DHO A;  3NGW A;  2RJ0 A;  3FSX A;  3E25 A;  3PNN A;  4JIS A;  1IIM A;  5CMG X;  5C47 A;  1H4E A;  4HO4 A;  4D48 A;  1R81 A;  3BSW A;  1H5S D;  1R7V A;  3USR A;  2Z87 A;  2WLC A;  1O7Q A;  2JF3 A;  1G23 A;  4FRE A;  4N6A A;  1LL3 A;  1MRL A;  3D8V A;  2FYB A;  3MQH A;  3T7M A;  3EG4 A;  1E5K A;  2YQS A;  4R7P A;  1G95 A;  3DJ4 A;  1VGU A;  4Y7U A;  1ON8 A;  1ZDF A;  3BFP A;  1WT0 A;  1TW5 A;  3SX3 A;  1SSQ A;  3U2X A;  2FY7 A;  3HL3 A;  1G1L A;  4KXO A;  2OI5 A;  5C3A A;  2P72 A;  1ZCY A;  4Y7T A;  3OH4 A;  1W55 A;  4FRQ A;  4YS8 A;  5E3P A;  2O1F A;  1KRV A;  4AYL A;  3E26 A;  1V3W A;  3IOJ A;  1MP3 A;  3SPT A;  1XHB A;  4ASY A;  5C1L A;  1ZI1 A;  4HUS A;  1I52 A;  5CQP A;  3D98 A;  1ZCT A;  2BO7 A;  4IRP A;  4G3S A;  2Y6P A;  3ZGF A;  1H7L A;  2WLG A;  3HJJ A;  3V0N A;  1OMX A;  3DK5 A;  1VPA A;  1MR9 A;  1QG8 A;  3CKN A;  4Y6U A;  2VSI A;  2QH5 A;  3GUE A;  1LZI A;  3IOH A;  1H7E A;  1GX0 A;  3KIA A;  4FRH A;  5C4F A;  5D91 A;  2VSH A;  5ADX V;  3R1W A;  1YRO B;  3C8V A;  3OGZ A;  3V8Y A;  4B42 A;  5C49 A;  2D7R A;  4MIX A;  2YQH A;  1WSZ A;  2RJ8 A;  3T7N A;  2GGQ A;  1H5S B;  2AGD A;  4Y6N A;  4Y9X A;  4FRA A;  4CJB A;  4B2X A;  3JUK A;  3P47 A;  2ICX A;  1ZJ0 A;  3OUP A;  3BSS A;  1T3D A;  4Y63 A;  1TVY A;  4ARW A;  3I0J A;  5FU0 A;  1HJJ A;  3Q80 A;  4HO9 A;  5DDV A;  3VBP A;  3IGJ A;  3KWD A;  5EJ1 A;  4Q7C A;  1QRE A;  2XMH A;  5C3B A;  1YP2 A;  1NF5 B;  3T7O A;  4DCL A;  2WLE A;  5CQM X;  1R82 A;  4E75 A;  4FCE A;  4D0Z A;  4FIX A;  1ZDG A;  2VXL A;  4M4K A;  3FSY A;  1H7G A;  2AM5 A;  4KPX A;  2Z86 A;  1O0R A;  1H5T A;  3F1C A;  4GBP A;  1XZ6 A;  3OH0 A;  4G3P A;  4EE4 A;  2XWL A;  4R36 A;  1KK4 A;  5AJO A;  4HUR A;  4IHF A;  3I0C A;  4EA8 A;  1LVW A;  2QKX A;  4EAA A;  3U0Y A;  3IOI A;  1TW1 A;  3CKO A;  4BMA A;  5EIY A;  3GOS A;  4EAB A;  2PA4 A;  2WVM A;  3U2U A;  3V0P A;  2RJ4 A;  4MFG A;  4IHG A;  1INJ A;  1VGW A;  1W57 A;  3U2W A;  4KC4 A;  1JVD A;  2P2O A;  2V0L A;  1O7O A;  3POL A;  3K8E A;  3OH3 A;  5CMH A;  3O3P A;  4B5B A;  2AQ9 A;  3R0S A;  4HG6 A;  3PMO A;  4J09 A;  4BQH A;  3BRK X;  3SX8 A;  3V4E A;  4N27 A;  3F1Y A;  3LW6 A;  3U2V A;  1JVG A;  4Y7G A;  3OH2 A;  1G9R A;  1XHD A;  5CQO A;  1FZW A;  1TDT A;  4HO3 A;  2IC7 A;  1FRW A;  3FOQ A;  2I7B A;  2WE9 A;  3V91 A;  3OU9 A;  1ZI5 A;  2PX7 A;  2WVK A;  1HM0 A;  1JYL A;  3TWD A;  1G8O A;  4H7O A;  3ZLL A;  1KRR A;  4D11 A;  2VHE A;  2P6W A;  4KC2 A;  2E8B A;  3I0K A;  1KWS A;  3TQD A;  1KQA A;  4AA7 A;  1FGX A;  5C38 A;  1EYR A;  2Q4J A;  3PKQ A;  4LW3 A;  4FQW A;  3V0Q A;  5C4D A;  4P00 A;  2RIJ A;  4ECM A;  1FGG A;  4N6B A;  4FRL A;  2ZU9 A;  4P02 A;  1MP5 A;  2OI7 A;  2RIY A;  5CQN X;  3SX7 A;  2V0K A;  2APC A;  5CQL X;  3SXB A;  2FYC B;  1NKH B;  4NAL A;  1ZJ1 A;  2O1H A;  1QQ0 A;  2JCL A;  3I0H A;  3R3R A;  3RSB A;  2YQC A;  1HJL A;  3EE5 A;  3I0D A;  1FXJ A;  5AFU U;  2X5S A;  1H5S A;  4AAW A;  1QRM A;  2VD4 A;  5AJN A;  1HM9 A;  2QIA A;  1FG5 N;  1H4C A;  3R8Y A;  1H4D A;  1MR7 A;  5C4E A;  1JV1 A;  2XME A;  2YCM A;  4MYO A;  3CGX A;  1WT2 A;  4HO8 A;  4D0T A;  1XAT A;  1ZHJ A;  4NAK A;  3RMV A;  4FIY A;  1GWV A;  1QGS A;  3KWC A;  2VK9 A;  1H7Q A;  2YC3 A;  4KT7 A;  3TIS A;  2XWM A;  5FTS A;  4EEM A;  2NXV A;  5BXC A;  5DDT A;  1FR9 A;  1ZJ2 A;  1V84 A;  1V82 A;  2RJ5 A;  5E3Q A;  5IDT A;  2OEG A;  5E3R A;  2Y4M A;  2Y4J A;  1LZ7 A;  3U2T A;  4DDZ A;  5C3D A;  3VBK A;  3Q4S A;  4G87 A;  1NQI B;  3TZT A;  2RJ6 A;  1H5S C;  3VBM A;  2BO4 A;  3CU0 A;  4B4B A;  5C1H A;  2C0N A;  3HSQ A;  3DUV A;  1ZI3 A;  4EE5 A;  4CJ8 A;  3USQ A;  2IU9 A;  5AJP A;  2Y4K A;  1KGQ A;  2AEC A;  4FRB A;  4J18 A;  1WT3 A;  3VBI A;  4M2B A;  2P73 A;  1QWJ A;  2AM4 A;  2X65 A;  2RJ7 A;  3I3X A;  1GX4 A;  2RIT A;  3MQG A;  3I0F A;  1R7Y A;  1QRF A;  5U2K A;  3Q1X A;  4EE3 A;  2WGZ A;  4ISX A;  5I1F A;  1G97 A;  5L6V A;  4AYJ A;  4C2S A;  5J49 A;  2WVL A;  3TIO A;  4HO5 A;  1ZJ3 A;  2Y4L A;  3CKQ A;  4IRQ A;  3TK8 A;  2W0V A;  1SST A;  4B4M A;  1S4N A;  3FTT A;  4NAN A;  2IUA A;  2OEF A;  2BO8 A;  4K6R A;  1H7T A;  1NHE B;  3OAM A;  3OW5 A;  4HOC A;  2I5K A;  1G3L A;  4CJC A;  3OC9 A;  3FSC A;  3CJ8 A;  2VS5 A;  3I3A A;  1GQ9 A;  4NAI A;  3RMW A;  2FFV A;  4Y64 A;  5D92 A;  1VH3 A;  5FTV A;  3R3I A;  4G3Q A;  2ICY A;  4B4G A;  2AH9 A;  5FYE A;  3MC4 A;  3TV0 A;  4HCQ A;  5C48 A;  3FWW A;  5L6S A;  5AFU V;  1INI A;  1TZF A;  1KHR A;  5CMF X;  4AC3 A;  2VS4 A;  5DEP A;  2WAW A;  4EEG A;  3VBJ A;  4KQL A;  3SRT A;  1R80 A;  3K8D A;  5CMJ A;  3CKV A;  2V0J A;  4DEC A;  1H7H A;  1KK6 A;  3BSY A;  4EGG A;  3OKR A;  1G2V A;  4EA9 A;  1QGQ A;  1V83 A;  2FFU A;  4FCU A;  3V0L A;  5IFY A;  3Q7U A;  4M2A A;  1LZJ A;  1HM8 A;  2O1G A;  4IHH A;  2E3D A;  3F1X A;  1ZCU A;  3D5N A;  1ZI4 A;  3SXA A;  1VH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...