4HCRH

Crystal structure of human madcam-1 d1d2 complexed with fab pf-547659
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGINWVRQAPGQGLEWMGWISVYSGNTNYAQKVQGRVTMTADTSTSTAYMDLRSLRSDDTAVYYCAREGSSSSGDYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPCSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF-547659 heavy chain
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 217
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2012-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hcrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hcrH01
1ACZA 4UNVA 1JWUA 4PJBF 3LAFA 5DHVA 3KLSA 5JLZB 2FZ3B 3Q6GL 1JNNL 2XA3A 3TIEB 1I8MB 4I0CC 3KNBA 1DUYA 3ZDZE 5DRWB 2UZYB 4Q74A 4MJID 3C6SB 1QRNE 3TVMB 2BK8A 4JN1L 2IALB 1GGCL 3IRPX 1T20B 5E0QA 1S7RB 5MENB 3ARGB 4K23H 4XAKD 4K94H 4AEHL 3C8KA 3I6LD 1YEDA 1BQLL 1ACYH 4LLUB 3V95A 4NKMA 1KIRB 2YD2A 2ZCLH 1DQQA 3WE6B 1MCRA 1GC1L 4JZOA 1RULL 3ZKMD 4M6MH 4TTDC 2FEEL 3BPOC 5F93C 3T0BA 4X4YA 1OGTA 3U83A 1FG9C 3BWUC 1LO5A 1X4YA 1MY7A 1H5BB 4BK5A 3MV01 5E6IC 1QBBA 3F6LA 3RZCC 2XKNA 2Z35A 2BVPB 1G9NH 5FCSH 4ZTPL 3QNXA 3ULVC 2VDNH 4OFPA 4OI9A 5J6GA 1ZT4A 1BOGB 4XWGL 3P30H 1MUJA 2ICWB 3SGKA 4ORGA 3DWTA 4FFWD 1HHKB 1JRHL 3GEWB 4EVNA 3KPRD 3LQAH 1MFBH 3CXHJ 3DX8A 4KK5D 2CK2A 5T3XH 5SWZD 1MLBB 4F2MA 3HI1A 1QG3A 3STLB 2D4FA 4QRRD 3FCTB 1AJ7L 1ZHBA 3B3IB 4CMMB 3QWOA 3B2VH 1MAJA 1MREL 1JN6A 4L1DA 5DGRA 2HTKD 2CDEB 3IFNL 1UXWA 2X05A 3SY0B 4X5WB 4NN5C 3RJQB 2VZ1A 1OB1A 2A6IA 4XP4H 2QSVA 1OAKL 2XICA 1IAIM 3BDBA 4LVNB 1GOGA 3B5GA 5LGHL 5DLMH 1TZIA 2F19H 3DUUB 3SDAD 4P99A 1RJCA 4HUVB 3N1PC 1FJ1B 4ORZC 5DRNA 5EZLA 3HPLB 4I3SH 1IEAB 4G6JH 5BXFA 3EOBB 1K8IB 3REVB 5EOTB 4GFTB 2HTLD 1MLCB 5TDPB 3FQNA 1RZIA 4ZDHA 3MA7B 4F8QA 4KV5E 1A2YB 4TPRH 3DGGB 4XHJD 4YHML 2VLJE 1QBMH 3GMRB 3VXSA 3KXFA 2JJWA 2Z8RA 2DIAA 3H42H 1H3XA 1A14H 5FHBL 1KCSL 4EOWL 4HH8A 4YHNA 3CFBB 3QIBA 2NY1C 5HHNB 4JFFB 4QTHA 1WIPA 2R4RH 2VKWA 4JPWH 3GJFH 3V0AC 4AJ0A 1GH7A 1TCRB 1B6UA 2WP3T 1IEBA 4TVPL 5ENWA 4U1SB 3EYOB 1LE9B 1R5IA 2OP4L 5HHVL 4KROB 5D93B 5CEXA 4LMQE 4P9ML 3GI9H 1NFIB 1J12A 4PRAB 3MLZH 5DJ8A 1CGUA 2VXQH 1UACL 1YEIL 1F5WA 1JWMA 3TM6A 2DLFH 1U8OB 2ICES 4YBQC 4JR9L 3QDMB 4YPGB 1BECA 2HJLB 3JV6B 3HAEG 3NCJH 3G5YB 1HILA 5D72L 3OZ9H 1CICB 4HF5H 4G9FE 1B9ZA 1E4WH 4NKOA 1YN7B 2R8SH 2CJUL 3S5LG 1XIWD 5ALCH 2R9HC 3GMMB 3OB0K 4WW2A 1T3FA 5BW7A 2W60B 3I2CL 3IDNA 2ILLA 2IJ0C 4JQIL 3VWKB 4ZYKA 4M8VA 3P4OB 4Z7QE 4WY7L 1R6VA 2NX5B 4TOYL 5BQ7A 5KBNC 2LFGA 1GC1C 3MR9B 4F3FA 3R0MA 2F54D 4KZDH 1BZ7B 3OSKA 2AXGA 1F97A 3CIQA 3M1BB 1R3HB 1YEKH 2HLAA 1T83A 4UINL 2VSDA 2MSPA 4EI6A 2QLVB 3QIWD 3JTSB 3VDAA 1JYNA 5DJAB 4DTGL 1FVCB 5A2IH 4X6CE 2AEIT 43CAB 3LS5H 3MACL 3OX8B 4X4MA 1MRCH 3SE9L 5T1LA 3HZVB 4J3TA 5I8EB 1AKJD 3F5WA 4TSCL 3H9HB 1D5MA 1OGAD 4Q6IA 4EJ1C 3QUZD 5IR1B 3RFZC 4XXCA 3BKMH 5EULV 2H2PD 3JV5A 3O6LH 2Q76B 4PFEA 5C07E 5D6CA 4PJAA 1ZHNB 5T5FH 5A40E 3NPSB 3LB6C 4P59H 4PRPE 3STBA 2CXGA 4OT1L 4RBPH 4R8WL 5GGUB 3B9KA 1LK3H 5J1SC 4XC1H 4NRZA 4KXZI 3QUYD 4GS7C 5IW3A 3PGFL 4LSTL 1JZ5A 2OBGA 3BPOB 1JGVH 25C8L 4GAJL 3WJJC 3WN5A 2YRZA 3QP3A 3B8SA 5AZ2H 5E6IB 1EZVY 4Z18A 3RZCB 3C08H 3TV3L 1XF4B 5HI5C 4LRNL 2OR8A 4H1LH 3QB7C 2X9YA 4PGCA 1XGUA 1UWGH 1KN2L 3IJHB 4MJ5B 4X4XA 1T1YB 1EO5A 2V17L 1P4BL 1FO0L 1AQDA 3QO1B 5GZOD 2FGWL 5FKPB 5BVPL 4K8RL 5D5MB 5H8DA 4NT6A 5DK0B 3M8OH 3MRMB 2NY2D 5JTWA 3KHQA 3D85D 4WI3A 2EEAA 3W2DH 4QXUL 4LKCA 4LLDA 3R8QA 5EPMA 4ZD3L 5BRZD 1DBBH 1KENH 4LGRB 4LVEA 3IKCA 1L4IA 2EE9A 3UYOD 4X6FA 3HB3D 4XTRD 2R0LL 3QRFM 5TPWH 5JIIA 3DX6B 3GSVA 2OL3L 5DEGB 5CBAA 4Z8FH 4HJJL 3B8YA 3T65B 2XN9A 1ONQB 5CEYA 1HSAA 4K7PH 3WEXA 1X7QA 4Q9RL 4QHNB 4CVZB 1X5ZA 2AK4B 3NFNB 1JNLL 2IG2H 1J9CT 3BP4B 4RMRA 4YXHH 4Y4HA 4JKWA 3VI4F 3GRWH 5DD1H 2YPLB 3RVVC 4O5LH 2Q86B 4GAYA 4O2FB 4ZG1A 3K80A 3O3UN 5JMOC 2YA2A 4P23D 5F1IA 3H9SB 3N50A 3PL6C 2OYPA 3U7AA 3QDME 4H26A 4EI5D 2NY1B 1EFXB 4PG2C 1RURL 5I74C 3DSFH 3UC0L 2G2RA 5IW1A 4KAQH 1AGEB 4RWHA 4ONHA 4NJAH 2F58H 2DLHA 1ZWIB 2WBKA 5C08E 2F53B 3MRKA 2P44B 5GSRA 3SJVA 4G6AC 1OTSD 3L3JA 3FB8B 2YD6A 1QLFB 4PJ9A 5EZJA 4ODVH 1H0DB 2WBJD 3CXHK 1VHPA 1LO3L 5JHLH 4G80A 1FL3A 5IF0A 1CDJA 1MCHA 4RZCB 3BH9B 4YZFE 1JP5A 2IAND 5HY9A 3O0RH 3BKJL 4WFHE 1QRNA 5HYSA 1J11A 1GGYA 2E7MA 5E4IA 2P43B 2FBJL 4Q9CA 1BQHB 1P6AB 3QI9D 4MWFA 5ADPL 1ROWA 1Q38A 1ULVA 2AAVA 3MRHA 2ED9A 5E94B 3HAEA 4JFDB 5EU4B 1Q72L 4GRWB 2BNQB 1FBIH 4NBXB 3IS1X 4F33A 5ICXA 1UM6H 4NZTH 3UYRH 1CLZH 3MBED 4IRJA 2X4UA 4G7VL 4KKCC 3ZE0E 3S5LA 2D31B 4KK9D 4DQOH 2X1XR 2QKIA 4XH2B 3DTXA 4PJ8B 1NDMB 1G9ML 1Z6JT 4L8CB 1IRAY 1B4RA 4Y16C 4BZ1H 1AO7D 3U2SA 4XNYL 4FFYH 35C8H 3PWJB 1AQKL 3R8BB 4W4OA 4B50A 3VD4A 4HXBL 4JLRA 4KHTH 4K8RC 4HS6A 4P48A 5SWQB 3RJDA 2AI0L 5E2TL 2ZG2A 3RVXC 1MVUB 4JO4L 3DIFA 3TIDB 5SX4I 3T3ME 4Y8AA 1JNHA 2QADC 2DWDA 1T21B 4OQTH 3BKCH 4PG9B 3MROA 5FYJH 4GQPH 4JVUA 5FO8B 2IPKA 5IEKA 2VJXA 3R06A 5SWSB 3CLEH 1A3RH 4GS7B 2Y23A 4D3CL 4FNLL 3L3HB 2RFXB 1N7ML 4BH7A 5I1IH 5DEZA 4JFYA 5I8OL 4NRYB 4QHUB 5EB9A 4EDXB 3K4AA 4GRMB 4MNHB 2GIYA 5LWYH 1IARB 1OWWA 5D5ME 3UAJD 5C3TA 2Z91A 5E8PB 4C55A 4BSVB 5HBBA 2BSRA 5DTFB 4M9PA 2EDWA 4C83A 4P49A 3ULUL 1KELH 3AS3A 4YLQT 3FQRB 2BNUB 2DDQL 4HX1B 4PRHB 4YDVA 5D7IA 3FFCA 2JJSC 2FO4B 3FOLB 4NWTH 1BIIA 3LN9A 2HT4D 4HJGB 5L88L 2VLJA 1IGYA 2A9NL 4JO1H 1Q0YL 2VLME 2XWJB 4PRDA 2FYYB 5JHDB 2APTA 4WTWA 2R1WB 1CK0H 4MA1C 3PP3K 3VU2A 3QJHB 5F1NA 1RK0A 3VXSD 3NA4A 2EIZB 3IVKA 3WNPA 3F8UB 3BYYA 1JGLL 1NQBA 2XZAH 3F7RA 4KJPC 4AH2A 5D7LE 1F3DH 1B2WL 4Y5VC 4BFEA 3QIBD 4L4VB 4OF6A 2KKQA 1U8IA 2V7NB 4LSPL 3PQYE 4IRZL 4Q0XL 4Z7WF 4NO3A 2ZUXA 4LCWE 1NGWA 5GS1A 2VNCA 3H9SE 4CU6A 1T6VN 3F7VA 1HSBB 4ERSL 1INEH 1F4AA 1ERNA 4J1UB 2Q6WA 4G9FA 2WIMA 5ACZA 1S7XB 4XC3H 1MFEL 1T04B 2XWTA 1EXUB 2CIKA 4OLXH 3BQUC 3DRTB 4NC2B 5IHUH 1QFPA 4XCCL 3LV3A 1C08B 2EDEA 1BF2A 2ZNWA 3PL6B 4N9GB 4LPTA 2H8PA 4K9EL 1Z9OA 2VZTA 1D6EB 1FPTL 4MS8C 1XGQB 4D2NA 5JLZA 2G5RA 1G9MC 2A74A 4MD0B 5I74B 4FFVC 5LQBH 1Z9LA 1ZVSB 3ZT6A 4JGUA 1IL1B 1KTKE 2DQEL 4M5ZH 3O11A 1NLDH 4NCC2 2C1OB 5DRWA 3H3PL 2MCPL 2IALA 4KUCD 1QSVA 3WDHA 5L9DL 4YDIL 1T20A 5M94B 2Y72A 5MENA 4Y5YA 2QTEA 1G7QB 5IG7B 4A6YH 3IDXL 5ID0B 4W68A 4LLUA 1KIRA 2VDOL 2Y36H 1PGRB 3WE6A 2VRAA 5TQ0L 3QRGH 4HBCH 4GXVL 2FJFB 5C07A 4FQHA 4QGTA 5FECA 5HDQH 4YPJA 4PRPA 1QBLL 4XPHH 1EK3A 1HKLH 1NFDB 1H3PL 2QBWA 4HKBA 3BGMB 1WICA 2EYTA 2VLLB 2ATKA 3UBXI 3WFEL 4I9WD 1FH5H 5I16A 4ZUTA 3QEUB 3V6OC 2DQFB 1HHKA 4LPWA 3GMOB 2H32H 3ARSA 3OHXB 4P3DB 1MLBA 4NQCB 3ULUC 3B9KD 4WI7A 3STLA 1SM3L 1JUFB 3FCTA 3IS0X 3O6KH 3BJLA 4Y16B 5FV2A 2ARJQ 3NIFF 4JPIA 4CMMA 5JIHA 1FGVH 2EXYC 1CXHA 1CGTA 1FO0B 1U3HC 3QPXH 5IQ7H 4XVTL 4LKXB 4Z77B 1C1EL 2A83A 1HWGB 3SY0A 2CDEA 5FK9B 3RNQB 1IAMA 5CIPA 2ZCKH 4HIHB 4X5WA 5CZKA 3HE6C 1UJTA 3DNKA 5D1XA 3RUGB 4HW6A 4WO4D 1OM3L 1PEWA 4TUOA 1L0XA 1OP5K 2EDRA 4JKPL 3SDXB 3RY4A 4GSDL 4BA8A 1FJ1A 3Q1SH 1IEAA 4WU7B 3EOBA 1K8IA 3HZYB 3REVA 1RZ8B 5EOTA 2OL3B 1MLCA 5FA4A 1T5XB 3KS0J 1NCDH 5HGGS 4NCDA 1A6WL 3UJIH 2DQDH 2EC9T 3GMRA 3KYKL 4N5EC 4X9GA 2IPTL 3E6FB 1JGEA 3U30C 4WEMB 4R7NA 5ACMA 4U6XA 2QSTA 3NOIA 4MCZB 4LCIH 4M93B 1WITA 4XBEL 5AUMA 2P24A 5MP6L 4JFOA 5T3ZH 1MPAL 2DMKA 1K9TA 5HHNA 1LK2B 3HFMH 3CDFA 1RHHA 2EKSB 2XN9D 2AKRB 3EYOA 1LE9A 2HJFB 5GS2H 1ZMYA 5DJCB 3K4DA 5IVNA 4Z0BL 4XCNA 4LCUA 1NFIA 4L4VE 2VDRH 5C0CB 3DUHA 1YNLH 5AYUH 1PD6A 3KPQB 3IDJA 4G9DB 3RVUC 2Q8AH 1SVZA 1RUAH 5K9OA 4MA1B 3RVWD 1U8OA 3PXHA 3QDMA 4MAYD 4NRXB 2HJLA 1CQYA 1RUKL 4FQXC 5IBLC 3RWEA 3TBSA 4P2CG 2DQIH 3CUPB 1OHQA 2FJHB 5ALBL 5F7LB 4UTAH 2WQ8A 4Y5VB 5L2JA 3T0ED 2JB6A 2E27H 3DX7B 3GMMA 4ZS6C 4YAQA 5C08A 3QDJE 4WJ5B 3RPIA 1RJYB 2APBA 2HT3C 1NL0L 1NEZB 1KNOB 3VWKA 3P4OA 4XPFH 1RJZA 2V7HB 1F58H 1I9JH 3F7PC 4O2CA 1MAMH 2AJZA 3SJVD 3U7WL 2AJXL 3M1BA 1GGIH 5DK3A 2X7LB 1KIPA 2VDML 4JKMA 3BQUB 1T80A 4PJ9D 4UIKH 1OVZA 4HMEA 1KULA 3JTSA 2GKIA 3TYGH 4U3HA 1P4LB 5DJAA 3JTTB 3HC3H 1RFDL 1U3ZA 4GMSH 3TO4C 1CTOA 4LLVB 3I50H 3DV6B 3HZVA 2PCPA 2P7TB 1TQCC 3QWQB 4GG8B 4ACPA 3QNYA 3LCYA 2J12B 1FL6B 2HAZA 5IR1A 4MB4A 3DJ9A 4J4PC 5IIEB 3VXOA 5JNYA 2Q76A 3H7BB 1VEMA 5GQBA 1SY6H 2CMRL 2FB4H 1PVHA 1ZHNA 2OMNA 1ZLUH 1A21A 1WBZA 1HCFX 1KXTB 4CVXA 1KACB 1S7QB 4RFOH 4U7KA 1UYWL 3GUTB 1QRKA 4JM2C 3GSQA 2GJZB 4NFDA 1EFQA 2ADFH 3U7YL 3WIHA 4TUJA 5EO1B 3A0OA 5F9DC 2WIIA 5ID1A 4YBLB 3SDYL 1TETL 3V5DB 2OTWB 3C8DA 2DL2A 5IFHL 3LKOB 1FCGA 1K6QL 1XF4A 1HDMB 5FYKE 2CO7B 3WFBL 3MUHL 5IMKB 2X4PB 3CJJA 3IJHA 1JGDB 4DUVA 4H0HB 1T1YA 4MNGE 2W59A 1BFOA 3VG0H 4XP6H 1E4KA 5CJ5A 2ESVE 3QDAA 3I3DA 3RUGE 5FAAA 5FKPA 4X7SH 5D5MA 2BY0A 3FKUS 5F7EL 2EIDA 5DK0A 3SDXE 3MRMA 4HKXA 1U3HB 4DWHA 1QSZA 3CXDL 1HZHH 4LNRB 1MNUL 4G8GD 5TDNB 5IFAL 3FRPG 4PREA 1MCOL 3TCXA 1IQWL 3OMZA 3HE6B 1GHFL 1KPUB 4H25B 1MELA 4AQ1B 4NFBA 2X4SB 4Y1AE 2CDFB 4FQIH 2UZIH 3JWNC 4P2OA 5D7SH 3JUZA 1EJ6A 5E2JA 2ARJB 1FIGH 3FFCD 1I7TB 1NMAH 1YPZE 4MXWH 4FZEH 5K9JH 2VLJD 3MRJA 3NIDE 2IFFL 4UNUA 4QHNA 5ICYB 2JJVA 1BBDL 3NFNA 4ZFGL 1FDLH 4AL8L 1MFDH 3BP4A 5FF6A 1I1RA 2ZUSA 5D7LA 5IB3A 2YPLA 5B3JE 2CLVA 5DD0L 3U30B 15C8H 2Q86A 1FLRH 2Q7YB 1N59A 3PQYA 4QYOB 3QDGD 4Z78A 3SE8H 4DAGL 5I71C 2Z4QB 4KQ3L 1IM9A 4LPYA 5IP4A 2AK1L 4LCWA 5FHAH 2XQYG 4PGDB 3H9SA 4JRXE 4LLMB 1QFUH 4RGOL 2FIRT 4YQXL 4YEFA 4RIRB 3VRIA 1T0NB 3BSZH 1CFNB 4HPOL 3C87A 1NCBH 3QPQD 1AGEA 5GRUL 2BERA 2EH8H 4WRLA 2Z92B 1ZWIA 1WBXB 4ZS7H 2NNAA 3QUMA 1P4IL 3QHFH 4XNUL 4R90H 1TVBA 4Z7OE 3DMMD 1XCQA 4JB9L 4FQXB 3MX0A 3RIAK 5AAMA 1H0DA 4MSWB 4G8EB 2PYEE 3BH9A 4IEFB 2B1HH 1NGXB 4LSVH 1PKQB 3ES6B 3QULB 1PKOA 5JR1L 2OR9H 3DX9B 3ZTNL 4HUXA 4PJCE 5E94A 4JFDA 5EU4A 1D5BB 3FONB 1V3LA 3AREC 3AXLB 5EOCJ 2XTJC 1G6RH 1HNGA 1CGSH 2YC1B 5MEND 4L4TB 2D31A 4ZOAA 3R1GL 4RMWA 4PJ8A 1EO7A 2FEDD 1C5DA 4UMGA 5EORH 1SYSA 3I9GL 3HMWL 3HMXL 3QG7L 3EAKA 5I76A 3RHWK 1JBJA 4UNTA 1IC4H 1NGYA 5CAYB 2VLRE 3ARFC 1GZPB 2FR4B 2WANA 3TO4B 3S98A 1TQCB 1P7HL 4GOSA 1X44A 2AJVH 2H9GB 1WZLA 4KUCF 3IFOB 4V1DB 5SWQA 4FMKA 1HXYB 1RMFL 1NCAH 2W0FB 4U6HB 1U42A 3GKWL 1S7WA 1M05B 2ZSVB 3CMOL 2ZOKB 4LOUD 2FX8H 4F57H 3V6FB 1OARL 4F7CB 4EEEA 4Y4KC 4JM2B 3L9RA 1P2CA 5TFSL 5EIIA 3WJLA 5JZ7C 1NAML 1VCAA 1YQVL 1VGKB 2GCYA 3L3HA 1YY9C 3SGEI 4I0PA 3H0TB 1KEGL 5B4MD 4NRYA 4UI2A 4QHUA 2GJ6B 4GRMA 4L8DB 4MNHA 3FN0H 3ZTJH 1XGTA 5D2LE 4FXGB 2D03H 4LHUB 4K3DL 5CJOH 4PJAF 2X4OB 4G8IB 5IVOA 2Y7QB 2BNUA 4HX1A 1U58B 4LLAA 4J2XA 5IB2B 1IGIL 1FGNH 4PP1C 1DBJL 1W8NA 3MOQA 3LN4B 3HI6L 3MCKA 5E2UH 4TTGA 4N0FA 4OFIA 1GRWA 1IC5L 4R96A 4NJ9L 2IGFL 1BAFL 2XWJA 1U6AH 2FYYA 4WNQA 3HR6A 2AJUL 2NLJA 3WSQH 3DV4B 3FQUB 4HIEB 4UQ2B 2DD8L 2EDLA 1NEZG 4NZJA 2OJEB 3RVTD 3QJHA 4U1MA 5C0AB 3L5XL 1KCUL 1RZKL 2ZCHL 4DUXA 2HA1A 1GPOH 1SQ2N 3O2WH 4HUMB 4I18A 1R3KB 1A6VL 4PJFB 3NACH 1JV5A 4Z0XB 1IC7L 2DYPB 1CF8L 3ZYJA 1ZXQA 2YA0A 4LAQL 1UA6L 2OZ4L 4L4VA 4JFFD 1UH4A 1A1MA 1ZANL 2R2HB 1JZ8A 3U0TB 4K07A 4AENB 1EGJL 4KROD 3ROOB 1DVFA 3D3VE 4GMTH 4D0CB 1MJ8L 1CFQB 4ZUWB 3FRPA 2XRAH 4GW4B 1S7XA 3QDMD 3FZUC 1EXUA 1RUQL 3AC0A 5BVJA 3P9WB 1CLYL 1HE7A 1N6VA 3CZJA 3NH7H 4UUJA 1CICD 2DJ4A 5I71B 3KYMB 3GSNH 5CEZH 2Z9TA 3MRBB 1L6ZA 4YHPA 1BFSA 3W5NA 2I5YH 1WIUA 5E7BA 4NQDE 1D6EA 1QSEB 3P73B 3GJEB 1WLHA 4MCYB 2UWEB 3VWKD 2NX5D 1IL1A 2APXA 3L1OL 2MQCA 5KSVA 4PY8I 2AEQL 4GKSA 5LVEA 4R3SB 1IGMH 3VW3H 2DQUL 3RX5A 1CQKA 3MYJB 1P7KA 1KCKA 1G7QA 4KI5C 1FNHA 3MLTA 3ULSB 1QD0A 4OD1L 1F4WH 1JPTH 1L9MA 4WHDA 5DHXB 1QPXA 5D96B 1Q0XL 1U8KB 5I1HH 1CBVH 3B9EA 2AW2A 2XQBL 4ZO7A 5EC1B 5H37H 1T1XB 2XT1B 2BOBB 3T2NL 4XRCB 4RMSA 4M62L 3ZKQD 3UPRA 1B4JH 3BGMA 3AREB 3S7GA 4LU5H 2XTJB 1QNZH 3AY4C 3FOMA 4X4ZA 2N7AA 1F8TH 3GMOA 4XVUD 4Z7NE 2XOTA 3X3FH 4ONGL 1Z5LB 4P3DA 2ARWA 1FZJB 1P69B 3S88H 3ARRA 2EIBA 1Y6NR 4Y16A 1MRFH 1EEZB 3ARFB 3MOBL 4TTDD 1IBGL 1EAPB 1J0IA 2X4TA 4PV9B 3LEXB 3VJ6B 1IFHL 4U2YA 5E6ID 4YH6A 5FK9A 2YRLA 3IDUA 4M1GH 4MNGA 1MIEL 3ULVD 1YN6A 2H6PB 4P4KA 4YDKL 2ESVA 2B5IB 1E4XL 3KJ6L 1F02I 3RUGA 1LO2L 4K2UL 1NSNH 3SDCB 2DQJH 2CKNA 1RZKC 2L0DA 1CXFA 3MRPB 5TE4H 3SDXA 3T2PA 1C16B 3D39B 4WU7A 4JFEB 3V52L 5HHXL 3JBG7 4ODSH 1RZ8A 4DGVL 4U1LB 1FYTB 2IF7A 1JNJA 4PR5A 2R0WL 2G60L 1SBBA 4I1NB 1FG2B 1EHNA 4NM8L 3SKOB 1OAZL 1JF1A 4Y1AA 4P9HL 4TNVK 2QQQA 4IRSC 2X9WA 1ADQA 1OW0A 4G3YH 5F70A 1L6XA 4MCZA 1YPZA 4OM0L 4G6KL 4E41B 4LEOA 5IROC 2D7TH 3ESVF 4YHLH 4NDMA 5AYQA 1LK2A 1LO4H 5DMYA 1S9XB 3AU1B 1A7RH 4DGYH 1FN4B 4H5SA 4L3CB 2HMIC 2ZUUA 4Z9KB 5E99H 2L7UA 3HNVH 1F2QA 1XGYL 5DJCA 4TNWK 4TSAL 3RU8L 1N0XH 1MWAH 2YKLL 1P5UA 2AK4D 1J5OH 5JDJA 1QR4A 5IVXE 3QFJE 5AD0B 2VTFA 4DZ8B 4JRXA 4NRXA 2YPLD 2R4SL 4ELMF 1U2HA 2BX5A 4Y19B 2I9LB 3MLXL 5CJQL 5MEOB 2FX9L 2FJHA 3CVHA 4FQ1H 4H8WL 1IM9D 3OAZH 1F4XH 2MHAB 4OLWL 1LEKB 4HCRL 3H9SD 1ZLVH 1ZHLB 2NY1D 5D7IF 1EFXD 1MJ7L 1PAMA 1T22A 3DX7A 3GKZA 1MY5A 3VFGL 1V8HA 4OCWL 3F62A 1IT9L 4POZD 1NEZA 1KNOA 4OD2B 4MXVE 1YNKH 3ELAT 4U6VL 1VESA 2HN7B 5DJZB 2F53D 4PRIE 1DLFL 4UILL 4LMQI 3SQBA 5GJTH 3UZVB 5JW4M 2PYEA 1RD6A 1T7VA 1NBVH 2XZCH 1Q9KA 1OSZB 2X1QA 1XF3B 1JRHH 3O6ML 1YEFH 2W92A 3PHQB 4X6BB 1NEUA 4NO0A 3EJJX 1DQLH 1R3LB 2WV3A 1AJ7H 4QCIA 1P4LA 3VE0B 1GGBH 4PJCA 4XZUB 4XCFH 2R9HD 4WTXA 4ODWB 1EHLL 2E6JA 4KVCH 3UPCA 1G7IB 2QR0A 1V3KA 4LEXL 4MA7L 3D18B 1RZGA 2P7TA 4WIQA 4GG8A 1NC2B 3MV7B 4YXLL 5DD5H 5B38G 2ADJA 1FNFA 4JFDD 1DBMH 3DXAB 2BNQD 3MBXH 5C0FB 5KTEH 4CAGA 5IIEA 3WO3B 1CDUA 5EUKB 3MCG1 2P8MA 4X7CC 3DRQA 1O7SA 5CHNA 3BOVA 1MEXL 4JY4A 2VLRA 1LP9F 5JUEL 5DVLA 1UADC 1S7QA 5FGRA 2R69L 4Z7QF 3GUTA 2UZXB 4PJ8D 4JDVB 1DEEB 2GT9B 3PGCA 3OKEB 5D1QA 1MCJA 1LEGB 2FIKB 2YSSB 1ZTXH 3IETB 5EO1A 2NCMA 4XGZB 4YGAB 1PZUB 2ITCB 1IAOA 2OTWA 4NHCL 1JPFB 1NAMB 3LKOA 1KYOJ 1HDMA 4EOWH 3GIVA 4U1HB 4PS4L 2EDNA 2DBJA 1U3YA 4UV7L 4P9HC 5IMKA 4CDGC 1FV1A 3OWEA 4LFHG 3LB6D 1RZJH 2APVA 2A6DA 3C5SB 4JZJC 4PIRF 1EO8H 1YNTB 4KDTA 5SWSD 3W9DA 3GGWB 3TZVA 5TF1L 1U9KA 3RWFB 4RNRB 2HH0L 3CFJB 3VFTA 4F9LA 1KN4L 4ZMAT 2ICWI 1HHHB 5AZEH 3KPNB 5D7KE 1T2XA 4U1IB 3MRLA 5HI5D 5HPOA 1HHGA 3MRGA 4H25A 5DHVH 2OR7A 4OBSA 2C7UB 4UU9A 2CJUH 1DL7H 4PRHD 1J1XH 1CZ8H 4K7PX 4ONFH 2ARJA 5FDWB 2AVGA 4H8WC 1ES0B 2XY2A 4E41E 5IEHB 3LQZA 4WY7H 2JTDA 4QHMA 4EZMA 4NWUL 5E5UB 1CXLA 4RAUA 1KLUB 5JHDD 1MOEA 3MODH 4TVPD 3S34H 4OZ4B 3V4UH 2BP3A 1SJEB 4OCRH 4IRSB 4P46C 4HG4J 3LVEA 3ARXA 2Q7YA 3TNNB 5DMJB 2WUCH 2X6MA 4LLQA 3OKNB 1A0QL 1F3RB 5FKAA 3D3VA 1NGQH 4L3EB 4LLYB 2PW1B 4L4VD 3SE4C 4LLMA 1N8ZA 4GT7A 4TRPH 5B39B 1MFCH 4Y19E 2VH5L 4J8RA 1QFWI 3SE9H 4RIRA 5BZDB 3MJ9H 5INDB 2VXSL 2VC2H 1T0NA 1Q94B 4XVJH 5K9KB 4TQEH 1EBAA 4HULB 2Z92A 1RIHH 3C9NB 1UH3A 3FT2A 3GM8A 4NNYB 1I8KB 3B5TA 3RVVD 4FQXA 1D5IL 1DBAL 4DN4L 3K7UA 4WFGD 3L3KB 1U91A 2EEDA 1I7RB 1QKZL 3MLRH 5CINH 3QXUA 3NIGF 4EN3C 3PL6D 3G04A 4RMTA 4G6FB 4JG1H 3SCMC 3KDMB 1NH6A 5BMFH 5F6HI 4GAJH 5DMGC 4OIIH 1JL8A 4MA3A 5M95B 1F13A 3FO1B 3DX9A 1RIVL 1BBJB 4LRNH 1D5BA 3FONA 1CFVH 4PB9L 5F9WC 4U2ZA 4ZO8A 1FHGA 1MHHB 3AXLA 3FQWA 4X7DC 4G6AD 3JVGC 4AYFA 4E9LA 5A16A 3N1GC 4PV8B 1BF8A 3VWJA 5F7YC 5I1LB 4K23L 1QSFE 4K94L 4MXQC 1RZ7H 3HKFA 1ZLWH 1MCQA 1ACYL 2ZCLL 5FIEA 1GZPA 2FR4A 1MCCA 4AG4H 3TO4A 1X6LA 2VE6A 4M6ML 5GS3A 5K33A 3WV0A 4HQQH 4O2EA 3PWLB 4K7FA 1HXMA 3IFOA 1Q9LA 2CUHA 3WD5H 2RHEA 3O4LB 1HXYA 4J4PA 4YZFF 1M05A 2VDNL 3MJ7B 4XWOC 5IK3A 3DYPA 3EBAA 4N0CC 4KKCD 3P30L 3V6FA 2AV7B 1QQDB 4JM2A 4NQCD 3LQAL 3OKOB 1MFBL 3HNTH 5T3XL 1GGUA 3MOAL 5JOPD 4Y16D 1VGKA 5B38A 3J7HA 5BZWA 5HJ3A 4FTVB 3H0TA 3D2UB 3MC0A 1UT9A 3B2VL 3SE3C 1N26A 2VDKL 4PJBE 4L8DA 5CILH 4K8RD 5L8KB 4GLRI 2X4OA 4ETQA 2J8UB 4CADB 3RVXD 2Y07H 4I2XB 1G7MB 2DS4A 4G8IA 5KS9B 3CU7A 4XP4L 1U58A 4IMLB 2E7HA 3OGCA 5DLML 3DLQR 4XPTH 1KJVA 4JZJB 3UTSB 5IB2A 2DMBA 2F19L 5KAQG 1KTDA 3LN4A 5C6PB 1QLRA 1II4E 1AXTH 4Q9BA 5F6IC 4I3SL 4G6JL 4R97B 5DK2B 3HRZB 5BCAA 3KWWB 3O3DB 4UQ2A 4NN7C 5IJVB 4KKLD 4X0KA 4PYHA 2MQ0A 2OJEA 5KN5A 5C0AA 4NZRH 5H94B 1UWXH 4TPRL 3ULVF 1WISA 1QBML 2JCCB 4EIZC 4EDWH 4CNIB 3K3QA 2X9XA 1FORH 4ZOCA 1P1ZB 3CC5A 3LKNA 4JAMB 3T2QA 2P5WB 3BD4A 2LU3A 1A14L 1CXKA 2WW8A 1JZ7A 3CSPA 3LEVH 5J3HC 4OZFH 1T4KB 1I3RA 4C56E 3Q3GB 3QSKB 2CLZB 5LKNA 5D5MF 2CUMA 3KLAB 1IMHC 1A6TB 4D0CA 2GAZA 5DVNA 1H3TA 2E9BA 4JQVC 3SKMA 5C0CD 5FCUH 3GI9L 5DI8B 5IV2B 3MLZL 1CG9B 3P4MA 2VXQL 1XZ0B 4RQQB 2DB8A 2VLKE 5FYKU 3K8KA 3L5WB 2DLFL 4P46B 4HS3B 3HHRB 1KGCE 2GI7A 2AEWA 4XBGB 4L8SC 4DOHB 3S37H 3NCJL 4HHAB 4OM1H 4KJPD 1MFAH 3KYMA 3Q6FB 1I3GH 1CDBA 1ORQB 4HF5L 4JG0L 1E4WL 3EO9H 3RL1B 2R8SL 4NKIH 1AY1H 3EO1B 5ALCL 5HGBA 3PGDB 3QBTB 4GAFB 4K94C 2UWEA 3TBYB 2Z31A 4KRLB 1UQSB 4HV8B 3RWGB 1KYOK 2AI0H 2HKFH 5E2TH 4P2RB 5CZXC 1AGFA 1ZHKA 5FGCE 3V4VH 4R3SA 4KZDL 4OLYH 5HPMB 3UDWC 2DMCA 2NY6C 4N68A 3BQUD 1YEKL 1FZKA 5EA0H 1KSRA 1RQ5A 4HKJB 1DZBA 2XZZA 3HR5B 2VABB 3O3AB 4QRUB 4Z5RB 1CFBA 2Q3ZA 4EN3B 2E6PA 1CS6A 1U8KA 3SCMB 3BDYH 5EC1A 1MCEA 4X8XA 4MS8D 3MGTB 1S7VA 1NANI 3LQAC 3LS5L 4FFVD 1ZOXA 1MRCL 5DR5H 1GL4B 1MHEA 3EDEA 1M7DB 4HKZB 4UOW0 5F9WB 2H41A 1DSFL 1QA9B 3BKML 4PJ5E 4WI9A 2YD8A 1U8PB 3O6LL 3GBML 1FVDA 4MX7B 1T0PB 1NPUA 5EU6E 5T5FL 2BC4B 4P59L 2E5EA 3WLWC 2BCKB 3OXSA 3OAUH 3D69A 1W72A 3T1FA 5IMLB 1LK3L 3BUYB 2FEEI 4XC1L 3ARFA 2VN7A 1OP9A 4EXKA 2DM7A 2VWEC 3MV9E 1EAPA 5DJ2A 3U9UB 1JGVL 5KANG 5F3BA 1FVEA 4GRWF 4HG4K 5AZ2L 3ARYA 5DC0A 5I1DA 3C08L 5DMIH 5EBMB 1ZA6B 4UT6H 5EBLB 1HQ4B 4WHYG 2YZ8A 1MVFA 1UEMA 3TNMB 1M71A 1UKSA 3SDCA 1JRHI 3LN5B 4LSPH 3PP4H 3MRPA 1UWGL 1YEJH 1AD0A 2J8UE 1KIUA 1FZMB 2Y5TA 1MF2H 3ZDXE 2RCSH 4AMKH 3MLVH 3NN8B 1FYTA 3EGSB 3F7YB 2HRLA 2EXYD 4KRPC 5HI4C 1FG2A 1U3HD 3G5XB 3M8OL 3E0GA 1A4JA 1BREA 1DBBL 1KENL 4HWZB 2ATPB 2E7CA 5C6WH 4WEBH 3HE6D 3FAXA 1CD1B 2OQJA 4E41A 1A9EA 3T0DA 4ODXB 1OAQH 3B6SA 4WCYH 5TPWL 3AU1A 1I1YB 3TJHC 5KSBB 3HAEH 5IFJA 3A67H 4OCSH 4PJIB 4Z8FL 3ZT5A 3I6GA 1ZGLM 3L5IA 4JCMA 5GRVK 1V3JA 5F6IB 3M17B 4K7PL 2X41A 3ARVA 4ZXBC 5AD0A 1YA5A 4NN7B 4P5MA 4DZ8A 4ZFFA 1QEWB 4NPYB 4F7PB 4YXHL 3OAYK 4WU5A 4Y19A 3MMEB 2I9LA 3D0VB 3GRWL 2EDQA 5MEOA 4O5LL 4M7JH 4UTBH 2CRMA 4OV6F 4BUHA 3GBNH 5C8JB 4QLRA 5IUSA 1LEKA 3QFDA 1G0DA 2PW2B 2DQHH 6CGTA 4E5XB 3ZL4H 1AC6A 3RRQA 4LP5A 4XB7A 5IW6B 2BRRH 2PXYC 1QUNA 3HE7C 3DSFL 4XNXL 4M61B 2HN7A 3Q5YA 4M9OA 4KAQL 3RVUD 4NQXA 4NJAL 1X5LA 2F58L 4FQQB 2MPAH 4ZO9A 4FQXD 4PPTA 1QZ1A 5IBLD 2C9AA 1TVHB 5BO1H 1YMHB 1VGEH 3BH8B 3D87B 2NYYC 4KJQD 4ODVL 4OZGB 1R3LA 1A4KB 1DANT 3I02B 4K3EH 4X80L 4KI1A 3LZFL 3MTRA 4XZUA 3RWDB 2OSLB 2HLFC 1NCCH 4ODWA 4ZS6D 1I8LC 4WDIB 3O0RL 4U49A 2HT3D 5I0DA 4RMQA 4NZUH 1NC2A 1VACB 3HMXA 2FH8A 3BPCB 3P77B 3PDOB 3CK0H 5MEQA 4LCYA 2DIBA 1CLOH 5EU3A 5EUKA 3QEHA 1UM6L 4NZTL 1F00I 3UYRL 5HDBE 1CLZL 2NY6B 5F1OB 3VI4E 1C8PA 4Y2OA 2RBLA 3H3KA 5E2VL 3WNKA 4JDVA 2A77H 1CR9H 1DEEA 2GT9A 1JMXA 1VA9A 5E5MB 1LEGA 3O9WA 2FIKA 3U1SH 4BZ1L 3IETA 3TO4D 3O45B 3LKQA 3C09C 4XGZA 2PO6A 2IPTH 4FFYL 35C8L 4WV1A 1NAKH 2E8ZA 1JPFA 1NAMA 2VL5B 2FLRT 3ECBB 3X17A 5EDXA 3C6LC 4V1DD 1NCWH 3T4AA 4KHTL 8FABA 3RY5A 1F4HA 4CL7A 4HH9B 4J4PD 2GTZB 3RWCB 1S9WB 4LBEB 1JPST 3OTTA 1PQZA 2EDYA 3C5SA 2BMKB 2DRUA 4OQTL 4XPGH 3BKCL 4N0YL 1AIFB 4JM2D 4QHKI 3TT3H 2J6EA 1YNTA 4E42A 3QG6B 2Z93B 4PJBA 43C9B 1CL7H 5JW4Q 1S7SB 4MA8H 4HK3N 3CLEL 4OUOA 1A3RL 1VKXA 5DJDB 3BD3A 2EDBA 3GSWA 5I1IL 5BJTB 2GJ6D 1HHHA 3KPNA 4NZDA 1NFDF 2EH7H 4ZAKC 1BJMA 1R3JB 1MCWW 3FHQA 5GS0H 5LWYL 1CXEA 4LHUD 4Z7UB 3O41A 32C2B 1J18A 1EEYB 1KELL 3MPCA 2BXZA 1QFWM 1FFQA 4NBZB 3OKDB 5JOEA 1N64H 1ES0A 4UDUB 4NWTL 1E27A 3I85A 1CT8B 1J05B 3S96B 5J56B 4JO1L 1KLUA 1CIUA 4M7KH 4CU8A 5KSAB 3BP6B 2AJXH 3C5ZA 4PJIE 3GJFB 4PRBA 4KRPB 3ZT7A 3IFPB 4JRYB 4OZ4A 1EGJA 5C0AD 4IRSA 1CK0L 4ONOA 2EZ0D 4LFHD 4ODBD 1IM3B 3H2WA 3PNWB 4C56A 3RUGF 1CE6B 3OKNA 3ZZ1A 3EDKA 2DYPD 2XZAL 2ENYA 3TC9A 5E03A 3VXNB 4Y88A 4RDQG 1K5NA 3SDXF 1CWVA 1CDGA 4C4KT 3T8XA 4XAKE 1J86A 1NUNB 1J87A 3TPUB 5DO2C 3OF6D 4POUB 2VLKA 1AR1D 1Q94A 5K9KA 1DDHA 4JJHA 5D8JL 3C9NA 2CLRB 1INEL 4ZXBB 5B3NA 3MRQB 4LQ1A 4G6ML 3QIUC 5C9KA 1UYWH 3NIDF 3L3KA 4OLXL 1S5IH 1I7RA 2X70B 2XFXB 4HK0A 4N5UA 5IHUL 3U4EA 1S8DA 5CIPH 4YK4B 3T09A 4KQ4L 1QSED 3VGBA 3SHSA 3WLBB 3QQ9C 3KPPB 5SWZE 1XAUA 2PXYB 4ZQKA 3HE7B 2IBZX 3FT4A 4QRRE 5LQBL 2ZG1A 1NGPH 4YFLI 3KYOB 4GRLC 4M5ZL 4QT5B 1MHHA 1NLDL 1HHJA 1I85C 3DVNB 4U4BA 5KVFH 1MJUH 5IHZB 5ETUA 5IT2H 4PUBH 5FUCE 1EPFA 2H26A 3EUUA 1FNGA 1FFOB 5JPMA 4A6YL 2W07A 4AEIH 1UZ8B 4B0MM 4Z95H 2C3HA 1JWSA 2Y36L 3RWJA 2EDDA 5I66B 1YYMH 4Z7OF 3E8UH 3QRGL 4HBCL 3OJDB 4PJ5A 1FNSH 1MNUH 4F7MA 1T5WA 1UEYA 4OFDA 4Z6AT 1OTUC 5EU6A 3OAZK 5HDQL 2X89A 1GHFH 4OBRA 4OLVH 1OLLA 4XPHL 3ARED 1HKLL 3VGGA 2XTJD 3GI8H 4MJ2A 2EYSA 3MLSH 4ZUSB 4LIQH 1FH5L 1OAUL 2AV7A 3MV9A 4XI5C 5FB8A 3CGTA 3LEYH 1QQDA 1BJ1H 1U8LB 4LVOC 4PJCF 3OKOA 4H1LB 4Q2ZA 3WDJA 4YDJA 1NDGB 5IMOB 1XF5A 5F21B 3ARFD 3U79A 4AL8H 3O6KL 4K3JH 3GHBH 3GMNA 3MFFA 1FGVL 3C09B 1WWBX 5CSGA 5DD6B 5CSBA 5DD0H 1X5HA 5IQ7L 3QPXL 2E3VA 4YDLC 1JYVA 3C6LB 2AK1H 1RVFH 3QEGH 2ZCKL 1G7JB 1MCNA 4XMLH 2J8UA 4CADA 4XCEA 3UP1A 1CD0A 1XR9B 3FFDB 3SDCD 4I3RL 1EVUA 2D7OA 3EYVB 1DLHB 3WNMA 3VXRB 4D9RD 2EKJA 3BISA 3D39D 2C3VB 4D94A 2LE9A 4JFED 2NR6C 3B5HA 3Q1SL 5D7KD 2YPKB 4A2MA 1U8HB 3FT3A 5JZ7D 1BQUA 5C2BL 1YYLL 1R24B 1YY9D 1FYTD 1P4IH 2O5YH 4OFYD 3KWWA 3O3DA 4PLOB 1NCDL 4NNXB 2J2ZA 2M8XA 4ZTOH 3UJIL 2D0FA 2DQDL 2JCCA 2VXUH 3DI3B 4ZAKB 4LGPB 3LIZL 4FN0A 2F54E 4MB5A 3DBXB 4E41D 2FATH 1J1OH 4LCIL 3HC4H 3HZKB 1BD2B 4P5TA 4RX4D 2JE8A 5LCVL 5T3ZL 1X5GA 1T4KA 1SEQH 3HFML 3WFCH 4P57B 2W0KA 3KLAA 1HINH 1A6TA 1F2XK 1AHWC 1MH5A 5K93A 4ZFOL 2BOCB 2VDRL 3GSRB 3WXVH 1CG9A 1YNLL 4GQ9H 1CGWA 4L5FH 2Q8AL 4RQQA 2A2QT 1JE6A 1RUAL 3ARBC 5DSCA 4Y19D 3WS6C 1OGAE 2DQIL 2FGZA 3WIHH 1I7ZB 3I9GH 1X5FA 4HIJB 5CP3A 3BKYL 3K4ZA 3SE4A 4C59B 4UTAL 4HFWA 5FO9B 3EO1A 5E2WH 2E27L 1L0QA 4JQXC 4PRNB 4L9DA 3OR6B 4P5KA 4XPFL 5FO7A 1NBYB 4BH8B 3D0LB 3GM0A 5HVWA 1F58L 4QRQA 5HYJB 1JTPA 1MAML 1AXSB 3QQ3A 3FZUD 1GGIL 3IAGC 5C0RL 1F3JB 3QIUB 2DKMA 2Y4SA 3LPFA 3S3JA 2VAAB 4HKJA 1HEZB 2IAMC 2ZSWB 1VFUA 3ILPB 4UIKL 2GUOB 4NHUB 1YQVH 1HWHB 3CFCH 4EN3A 2IWGA 3GB7B 5DC9B 1HI6B 3SCMA 3BMWA 1FIEA 5KVEL 3HC3L 4PY8J 5C0IA 2P4AB 2NY5H 4P2QB 3FAWA 3MGTA 4GMSL 5F7UA 5I75B 5GGQH 3I50L 1HHIB 1AXIB 3MV7D 1NC2D 2DOCA 4DFHA 5A3ID 4YXKH 3TA3A 2VDLH 2WUBH 1M7DA 1KXVC 4F8TA 1A3LH 3DXAD 4HKZA 3RGVC 3MUJA 2F8OA 3I75A 5C9JB 3SBWC 1WTGT 2CIIA 4YNYA 1QA9A 4N8VG 2BFVH 1U8PA 4O51B 3OB8A 5I1KH 4NKDB 1YDPB 1SY6L 3T3PE 2FB4L 4KI5D 2BC4A 2ITDA 1IC5H 1ZT7B 4RFOL 5T5NG 4GKNB 3BUYA 3RBGA 2AJUH 2HVKB 1A7PL 4B7LA 3RDTA 3TLRA 2VKXA 2XZQH 2ADFL 2GK2A 1B0GB 1I1CA 2B0SH 4S1QH 1XF2B 1KCUH 2ZCHH 4RA3A 4G43B 2AXFB 1PZ5B 3GMPA 1UH2A 1OLZA 5EBMA 3RWIB 5J0BA 4KDWA 3BVNB 4WFFD 2EO9A 1KPVB 1EERB 3WMSA 3LN5A 5DUPH 3ZE2E 2FNBA 4RGNC 4LVOB 3QUMH 3VG0L 5B8CA 4XP6L 4YHZH 3BHBA 3HG1B 2GY7B 4X7SL 1KF9B 4BFGA 4U05A 2P5EB 4MQSB 3VFVB 2XXMB 1CLYH 1HZHL 3W9EA 4YDLB 2ATPA 5CCKH 3DYMA 2SEBB 1CD1A 3MRCA 1J0HA 3TN0B 1ETZB 3TH4T 3M07A 2BHYA 1I1YA 5KSBA 4JM2F 2V2WB 2UZIL 4PJIA 5D7SL 3GSOB 3ZE1F 5IWLC 1OD9A 4MXWL 1T6WA 4FZEL 5C0JB 3M17A 3L3IB 5K9JL 4M1CC 2H45A 1V7NH 5DRXA 4XCYB 4ALAH 1TTGA 4C54A 9CGTA 2A1WH 1QEWA 1S9YA 1WBYA 1FDLL 4NPYA 4F7PA 2A9MH 5HHPA 1MFDL 1RHFA 1UJ3B 4O58L 4IRSD 4PP2B 1MAKA 1L7IH 3V5HB 2A6KB 15C8L 4PJEB 4Q58C 2AERT 5C8JA 3MCLH 3SE8L 4L3ED 2C3WA 2QEJA 4ZFZA 2R29H 5FHAL 5EFIB 4LPUA 5F7DB 2PW2A 1KG0A 1QFUL 2NW3A 4P4RB 2OTUB 2HMID 2XNAB 4E5XA 4Y89A 2VITB 3DUSB 1A6AA 5IW6A 5EN2A 1N4XL 1TMCB 3BZFB 1D3CA 1MCIA 2XWBB 1OTTC 5H35B 1AHWB 3BSZL 1K4CA 1NCBL 2DWEB 1LWRA 2D0GA 4WENB 4OFKA 1KIQB 2Z0BA 1AO7E 3CD4A 2EH8L 1EBPA 3MLPA 4ZS7L 3ARBB 3QHFL 2KBGA 2EDJA 4R90L 3V0WH 3A6BH 4Z76A 3UYPA 1AGCA 1TVHA 2VN4A 5EOQH 3TYFA 5AAWA 5E9DB 5HYJE 4UZGA 5SWZA 3I02A 5F7WC 1J8KA 4G6FD 4AEEA 2OSLA 1FNLA 2GQHA 3AB0B 3UTZB 3IDIA 1UWXK 1WZMA 3W5MA 3EYQC 5ANME 1NGZA 4LSVL 4H1LG 4A6YB 3QZWB 1B0WA 1VACA 3HNSH 2VDPH 3BPCA 3NFSH 5HGHA 5CKAA 2OR9L 3BWAA 1SJHA 4OF0A 3BZ4B 2YUZA 3E3QE 1JF5A 4XPAH 4K2UH 5DWUH 2CXKA 3KPTA 1NBZB 3LH2H 3CH1B 1G6RL 1CGSL 1I3VA 1WCBB 4LF3A 2AEPH 3G9VA 4U7MA 1RJLB 1U92B 3VXQB 2R15A 4NQSB 4R7DB 5DZLA 3PJSA 1UCBH 2XA8L 2IAMB 3V6ZB 5EORL 5GXBB 3JV4B 5D71H 1LQSR 4IHOB 1I4FB 1IC4L 3MLYH 4NSKB 2UWEF 1OAZH 4HUNB 3WO4C 4P9HH 3CSYB 1F90H 2P42B 1PY9A 2H32B 5F89B 3ECBA 5JXAH 1T2JA 2HKHH 3MUZ1 2YBRA 1JJUA 3RGVB 2GSIA 1DUZB 3VDBA 3O4LD 5IMMB 1N6UA 2AJVL 5DJYB 4HH9A 2B7DT 2LAGB 4LHQB 3RWCA 4JHWH 3WIIL 1S9WA 1WFUA 1NCAL 4PGBB 5FYJE 1A8JH 1G7LA 4KJYB 2YZ1A 3IF1B 3VXSE 3T1WA 1S78C 1XH3A 3ROLB 5E8OA 2FX8L 4F57L 1RV6X 4O00A 5EBWB 3VXTB 5DJ0A 4JFHE 4QXWA 4TSAH 3RU8H 4UQ3A 4NN6C 5F9JA 43C9A 3U0WH 4XP5H 1H3WM 3UXFA 5T1KB 4UT7H 4JHZA 2D7PA 3MZTA 3D2UD 4FTVD 1IC1A 2DLTA 5DJDA 4U1NB 4N8VA 5BJTA 2VZ3A 4HC1H 3X13A 1IGJB 2NY7H 1R3JA 3FN0L 4WHTA 3FQXB 4Z7UA 2P1YA 4B41A 4XNQA 3SKUD 1D6VH 2W9EH 1RIUH 3U6RA 4JY6B 3MRRB 5CJOL 5BS0B 5IJKC 3AUVA 1U95A 1KC5H 1I9IH 2VQTA 4ZSOE 2VOTA 2JIXB 4M5YH 2DBLH 1XIWA 2ZPKH 3VFGH 2K9UA 4OKVB 4OGXH 4RGNB 3FMGH 1KJ2H 1ITBB 2ICWJ 5EZOH 5L0QC 5E2UL 1TZHB 1U0QA 1WAAE 4X83A 4OUUA 3QUKB 4YIQB 5KSAA 4L9LA 1U6AL 1VFBB 1I75A 3WSQL 5FGBA 4KH2A 3UTOA 4AEFA 1IM3A 1Y18B 5ADOL 5DFTA 1GPOL 3QQ4B 3O2WL 5JIKA 1I7UB 2P5WD 2Y5EA 3NACL 2GK0B 1A7NH 3TPUA 4MA7H 4GUPB 4NQUA 3E1F1 1OP5H 3VCLB 1CYGA 2I24N 1OSPH 1AKJA 2EDKA 2YWZA 1LE5A 1DANU 5JOFB 1OGAA 5DRZB 4GMTL 4GXUN 3NCYS 5D6DA 3MO1A 1MEXH 4LARH 3MRQA 3NFPB 5HHOB 4ZUVA 4PLJC 3WXWH 5C86A 3QXDB 3B2UC 4WW1A 4Y2DB 5AG8A 2X70A 2C1PA 5FYKH 1ZSDA 1CFTB 4HUWB 3VFNB 3GSNL 4I9WE 5CEZL 1ED3B 3OXRB 3QUYA 4L29A 2A73B 1PSKH 3BW9B 1TJHH 4JVPA 3N06B 2I5YL 4B53A 1X5JA 4PTUB 3WLBA 4M7LT 4NHCH 5DQ9A 3KPPA 3PHSA 2JELH 2X40A 2YMXH 3HE7A 4NKQB 4RAVB 5T33H 2A38A 3QH3A 2DKUA 3KYOA 4P2RD 5HI3C 4KJWD 3VH8B 3AM8C 2F15A 3QNZB 1FSKC 3DVNA 4Y5XC 1KCRL 1CI5A 1IGML 2V5MA 3VW3L 5ICZB 1KFAH 3O3EB 1CGXA 2XYCA 3P40A 1PLGH 5KAQF 3ZSSA 3SDDC 5I0ZA 5F6HJ 3BRFA 1IKFH 3L7EB 1F4WL 1JPTL 3DARA 1CE1H 3ARDC 3IKKA 3QXAB 4EN3D 1EHXA 4OV5B 2Y6SD 4WWKA 4HMCA 4FHBD 3SCMD 1WF5A 2I60H 2HH0H 1ADQH 3EOAA 1KOAA 4HWEL 3D6GA 4IS6B 3AGVA 1CBVL 5DMGD 4HGWA 4BFIA 1YMMB 1TENA 1G9EA 1AFVH 1HIML 3TESA 3CFDB 1B4JL 4OZHB 4TYUA 4QXTA 1DQDL 4LU5L 4Y4FB 4ZUSA 1QNZL 3P0GB 1PJ9A 3OKKB 3EOYG 5JW3H 4TUKH 2OI9C 3INUH 1F8TL 1U8LA 5DYOB 3C5JB 3X3FL 4AM0B 2J8HA 1AE6H 3MGOB 4H1LA 4U7SA 4F9PA 3S88L 3SPVB 2CKBH 3CVHH 2XN9E 4D0DA 3WO4B 5EC2A 5I8CA 3LKPA 3EFFA 4J3VA 4M4PA 5I8KH 2OCFD 4TVSa 3LRSB 4IOIA 3MRFB 3VI3E 3MV8B 5TDOA 2G75A 4Y7MA 1MQ8A 4LRIA 4M1GL 1G7JA 2HVJB 1X5XA 4U6YB 4XWOD 2LQRA 4WEUD 1EH9A 4IOFC 4KI5F 4CVWA 4N0CD 5GRYA 3VXRA 1NSNL 5GISH 1IGTB 2KH2B 3G9AB 4I5BB 5TE4L 1HQRB 2R23B 1A6PA 1U8HA 1JFQL 4LLWB 4PJDB 4ODSL 5EUOB 3T0EE 1C5BH 4L1HA 5DEFB 2EYRA 1HK6A 4RGNE 2X4NA 4LSRH 4D9LL 3RTQB 1DTUA 4W70A 3TJEH 1JZ6A 4PBVC 3FB7B 2R2EA 4G3YL 4FFWC 1ZAGA 3WUWG 3SOBH 5ERWB 4CBPA 2D7TL 3OR7B 4YHLL 1KB5A 4KZEH 1ITCA 1LO4L 5GGSB 5CSZB 3F65A 3PUCA 1A7RL 4DGYL 3WKMH 1GIGH 1ZS8B 4YC2C 1RIVH 1JHTA 4OCYL 2F74A 5CD5D 3QI9A 5E99L 3HNVL 7FABH 3OJ2C 5L0QB 3O6FC 4PB9H 1VFAB 2B20A 1N0XL 1HH6B 3UZEA 2AQ3A 1MWAL 1J5OL 1H3GA 1WT5A 3SO3C 3QZWG 3EJYC 2OTPA 3MBEA 5ESVB 5DHYB 1JF6A 1L7TH 3TBVA 5AEAA 3L5HA 3OBAA 5KANI 1B0RB 3EDFA 4FQ1L 1F4XL 3P3YA 4RISL 3FL7A 4AQOA 5J1AB 3G6DH 4JZNB 3EJZC 5HD8C 5J3HD 2KDGA 3CZFB 1AO7A 2VISB 5EO0A 4PRNA 4U1KA 1MHCA 2UY7A 3OR6A 4QKXB 3G6AB 3HS0B 1NBYA 4JHBA 4BH8A 1YNKL 5MERB 3T04D 5HYJA 3O8XC 1AXSA 5GJTL 1VFMA 3OKLB 5SV3A 1GXEA 4UDTA 1I9EA 3SGDH 2VR4A 1NBVL 2XZCL 1F3JA 3QIUA 4JFXB 4R0LA 3V7MA 2FECL 1YEFL 2I9TA 2XXCB 4MAUH 5ANMA 2GUOA 5FM8A 2YEZA 3MOAH 3VFUA 3KPLA 3KYNB 1DQLL 5FM5M 3EDDA 1SEBA 1GGBL 4P2QA 4MNQB 4YHIB 4XCFL 2NPLX 2VDKH 1TXKA 4KVCL 1HHIA 2HFFA 1MJJB 1K2DB 5J12C 4DJMA 3JWDL 4JFQB 4PJHB 5DD5L 3SKJH 5IB4B 1INQB 1U36A 5CZXD 4EUPG 2AP2A 1DBML 3A6CH 5C6TH 1FCCA 5JDSB 3MBXL 5KTEL 1FSKB 4Y5XB 4O51A 1A1OB 5DJXB 3SGJC 1YMME 2R2BA 4G8GE 2NY6D 3ABZA 5F7FA 3DYOA 3VXPB 3ARWA 3SDDB 3WNNA 3RPKA 4ELME 4OZHE 1ZT7A 4I3GA 1F4YH 3KPSB 2BY1A 1T1ZB 5CWSB 1IKNA 2WNGA 1ZTXL 5D7IE 1A6ZB 3FFCE 4QHLB 1QR1A 2Y06H 2AXFA 5T3XD 5DA4A 1LD9B 4RFEB 3IB4A 1GAFH 1MIMH 3QIWC 5C0NC 1PG7H 3MV8E 2OI9B 3QDGE 1RZJL 3BPNC 3WLWD 1EO8L 4IOSD 1C7SA 1G7PA 4CKVX 3PHOB 4GO6B 3P9MA 2LTQC 2X09A 1S9VA 1FFRA 4QEGA 1AC0A 1MQKH 3KS0H 4JO3H 4I77H 5IB1B 1WZKA 2ICEA 3VFVA 4ZSOA 4CGTA 5AZEL 1ORSB 5EUOE 4OLEA 1E4XI 2YA1A 2YD7A 4U33A 2Q8BH 2IH1B 4JG0H 3DROA 5EU5B 1FE8H 2RAMA 1LNUB 1MCWM 3TN0A 1ETZA 2FRGP 1WAAA 4APQC 1SYVB 4P3CL 1DL7L 2V2WA 1J1XL 1CZ8L 3GSOA 1LP9E 2IFGA 3NVQA 4ONFL 3MJ8B 2IH3A 4F15C 1PDKA 3L3IA 1KPRB 3EIFA 5GSVA 4PY7A 5KSAD 4KRPD 3DETC 5HI4D 1BMGA 3MODL 5FXCH 3L5JA 3ARZA 1UJ3A 3S34L 3V4UL 1A7BA 4OCRL 2J8UF 3DURB 2A6KA 4NC1C 3VH8G 3ZDXF 2PN5A 1IAIH 1R3IH 2WUCL 2Q20A 5FM4A 5CD3B 4O4YL 5EFIA 4D0BA 4M43H 1NGQL 5MENE 1CU4H 2K7QA 3RL2B 4TRPL 4P4RA 2OTUA 1MFCL 4KKBC 5GZOC 4PJXB 2VITA 3DUSA 4HS8H 2P47B 3L3DB 4YC2B 2LVCA 1FNEB 2PR4H 3MJ9L 2CK0H 2VC2L 3GSNB 3O6FB 5H35A 1DSFH 2DWEA 1S5HB 4XVJL 3VGAC 4TQEL 2BHUA 4ZXBD 1XR8B 1RIHL 3GBMH 3WUWA 2JCCF 3SO3B 4QXGH 2E7LA 4DK6A 5KG9A 3JWDC 4FXKB 1TZGH 4QOKB 4M6NH 4BKLB 5JXEA 4KTEH 4HDIB 4QRPB 2AJYL 5JO5B 3MLRL 5CINL 2NW2B 1IILE 2V9RA 4JG1L 4QRSB 5BMFL 2UUDK 4OIIL 3QZWA 4A6YA 2PXYD 1IJ9A 3HE7D 3FRUB 5E08H 2KL6A 4MNQE 1CDYA 1CFVL 4BUGA 4G42B 5E1HB 3O8XB 1NBZA 4WO4A 1WCBA 4PJHE 1WSST 4X6DB 1RJLA 1AH1A 5CJXC 3L7FA 4EI5C 2A6JB 4J23A 5TF0A 2NYYD 4W4NA 5KSUA 2YUXA 3BP5B 3ZHKA 3V6ZA 3G5VA 3NCYP 1RZ7L 4WWKD 2HLFD 3MNWA 4J3OC 3Q48A 3FO9B 1RZJC 4AG4L 4KMTH 4PGZA 5F89A 3CX2A 4KK8D 3NTCL 3STZA 3KPSE 5J12B 4YWGH 1YUHB 1EHAA 4HQQL 3Q2CA 1ZKAA 4NUJB 4NN5B 5DJYA 4MDIA 3T0VA 5IMMA 1YZZA 3WD5L 1UKQA 5CKGA 4PGBA 4RDQF 4ZPTB 1Z2KA 2AGJH 4IDJH 3CCHB 1ZLSH 1QVOB 5E00B 4MJ6B 3QO0B 1RAMA 4HLZG 1M6OB 4AIXA 4CN6A 1KB9J 5J6HB 3CFEA 2W65B 5T1KA 3HNTL 4JFFE 2OLDA 3GO1H 3LPWA 5I6XC 1N3NB 3NIGE 4JY5H 4EUPA 2VO5A 5HDBF 3ZDYF 5FYLE 2IQAB 4KK6C 3PE9A 1A6UH 1RY7B 4NO5B 4MAYA 4O02H 3WCYA 4M8QA 5CILL 3C6LD 3IXTA 3U4BH 4HT1H 1W8OA 4QHKJ 3MRRA 3CDCA 3QHTC 1QHPA 3QIWB 2Y07L 3W39B 2JIXA 1AD9B 3CH8A 5KZCB 3T0EA 3VXRD 1F6AA 3PWUB 4XPTL 3BPNB 4MDJB 1T89A 2FSEA 1U8QA 4XNXH 1TZHA 1AXTL 2LVEA 5I17A 4HWUA 4TSBH 4EIGB 2FL5B 1VFBA 3FO0H 3KPOA 3L3OB 1AI1L 2R1XB 5E6ZA 3S3PA 4NZRL 4ZAKD 2NX5E 1Y18A 2R56H 3MLWH 3W0WB 3SGKC 1MWAB 4EDWL 4X80H 2UVFA 1FORL 3P4NB 2ICCA 1BD2D 3LZFH 4U31A 3FB5A 3TF7C 4APQB 4IMKA 4S1SH 2E9IA 1OP3K 1R5WA 1K3ZA 2DAVA 3CFKB 2RGSA 3LEVL 4GUPA 3U0PB 3VCLA 2OM5A 4F15B 3QA3B 4Z7VB 5MEPB 5ESAB 5JOFA 1Y0LB 1FFNA 2CRIA 5FCUL 3FN9A 4PJXE 3ETBF 4RMUA 3TT1H 3PV6B 2X10A 3NFPA 5HHOA 1JTTA 1W72H 2WLZA 1WWWX 3F12A 3QXDA 5E2VH 3O2VH 4OSUH 1I1FB 4FOMA 4Y2DA 5ITFA 2IBBA 3S37L 2R0ZH 4OM1L 1CFTA 1RSFA 2WM0A 4HUWA 1MFAL 5KSBF 4M03A 1I3GL 1ZK9A 3MNZB 4PJIF 4M1DH 3EO9L 3VFSB 5ESQA 1FFPA 3EYFB 2LABA 3IDYC 4NKIL 4OGAC 4QOKE 4UV4L 5HDLA 5IVZB 1WUNT 4PTUA 1AY1L 3BE1H 4HEPG 2FX7H 2GITB 4U1JB 1T1WB 3D85B 1JK8B 4RAVA 3T0AA 3VGAB 5I30H 4NO2B 5I2IA 3HRPA 1VPOH 2HKFL 3QNZA 5HYJD 2DLIA 2WWKT 3V4VL 4OLYL 5ICZA 4YX2H 4F7TB 5EOCH 5L2KB 1U93B 3QIUD 3T4YA 5ECJE 4N0YH 2H3NB 3ULVE 5EA0L 1UM5H 3MUGA 3QXAA 2ZOLA 3OKMB 5EO9A 1WWAX 2JK5B 4OJFH 5F8QC 3ZTJG 4P2QD 4IS6A 3TO2A 3BDYL 1SJXA 3IU3A 3QQ9D 5JQ6H 5JW5A 1YMMA 4G8GA 2HFEA 3GSXB 5DQJB 1OAYH 2V5SA 3OV6A 2WINB 5DR5L 1WFOA 4LAJH 4XXDB 5E1AB 4ELMA 3CFDA 1MHPH 4OZHA 1UB6A 3O81A 1KT2B 4Y4FA 2HG5B 3BI9X 4HXAL 3RI5F 1VSCA 5HYIA 3OKKA 4OZGF 2DQCH 3NCFB 2BVEA 5KJRH 1F6FB 1GZQB 3C5JA 4KRMB 4AM0A 2EDFA 2D7MA 2RQ8A 4WW2C 2K1MA 3MGOA 3VD9A 5BW7C 4S2SB 1QYGH 3OAUL 1BZ9A 3OG6B 3LPGA 1KTLB 1HOCB 3NZ8B 4RWYH 5FYJD 2AJ3B 1ZGLA 3BEVA 3LRSA 3WBDA 4KRNA 3MV8A 2AK4E 3QDGA 2HVJA 4JFHD 1T83C 4U6YA 5FUOH 4JKLA 4HJ0C 5DMIL 4UT6L 4GKZB 3SQOH 5IQ9B 2YPLE 2EDXA 3DO7B 1OOAA 2BSSA 4D8PB 1XGRA 4AZ8A 5DVMA 3PP4L 2IANB 1OPGH 1UVQA 1YEJL 3EO0B 2R23A 5D8JH 5DHVB 1MF2L 3T0WA 4PJDA 5EUOA 3PDGA 3O2DH 2RCSL 1HYSC 5I6XB 4AMKL 3MLVL 3KNBB 4Q6IC 4DVBA 5CMAA 3HLAB 2P5ED 4XXCC 3RTQA 3DMMA 4G6MH 2VQ1B 1A5FH 5AG9A 5BOPA 3FB7A 1LP9A 1I8IA 2F53E 4WEBL 3X14B 3TN0D 5GGVY 3UZQA 1LHZA 5IJKA 5E6YA 4FZ8H 3C8KB 4NQEB 4LPVA 4KQ4H 2W0PA 1OAQL 5CSZA 4WCYL 1DQQB 3MRNB 4FQCH 1ZS8A 3A67L 4OCSL 4UBDC 2FZ3A 2NR6D 4LNVA 1EZVX 4X4YB 4RA0C 3TIEA 1I8MA 2MCG1 1J8HB 3WN5C 3TVMA 3C6SA 2XKNB 2Z35B 4RGMC 5GJSH 2DTSA 3CVIH 3QNXB 5ESVA 5J6GB 1S7RA 3ARGA 4Z7UF 1O0VA 1FC2D 2YUVA 4JFDE 2B2XH 4GRWE 2BNQE 4XMKH 1MUJB 4XNZC 4ORGB 4M7JL 1B0RA 3FB6B 4UTBL 5H37G 5T5NF 3DECA 5ITBH 1MCDA 3GBNL 1LMKA 3MXWH 5J1AA 4J12A 3DX8B 4JZNA 4F2MB 3HI1B 3IFLH 3VG9C 2VISA 3WL9B 3IU4H 2DQHL 1K8DB 1ZHBB 4JN2B 1H5BA 3ZL4L 1ZEAH 2BRRL 2BVPA 3HS0A 5LAXB 4YUEH 5MERA 1BOGA 1UXWB 1MRDH 2J6EH 4OKDA 3ARBD 1OAUH 3OKLA 2MPAL 2A6IB 2ICWA 1BM3H 4JFXA 5L8LB 2R1YB 5JXED 5E9DD 2XQYK 5BO1L 1TZIB 1KB9K 1VGEL 1WFNA 3JXAA 4I48B 1NJ9B 2CD0A 5I1AB 3IDGB 4K3EL 2D4DA 3B3IA 2WLYA 5F8RC 5BXFB 3IDYB 4MNQA 1NCCL 3LQMA 5JA8B 3R4DA 1MI5B 5SWSE 3TP4A 4NZUL 4Y4HC 4JFQA 4PJHA 3RVWC 3CK0L 1W0YT 3KXFB 1CLOL 2EICA 4PJGB 1EEUA 4PBWD 4I3RH 3DUUA 1GSMA 2QADB 4YHNB 3SDDA 4HUVA 4HPYL 4QTHB 2BVYA 2IAMD 3HPLA 5C2BH 4WHYH 1YYLH 1IEBB 2A77L 2BVOB 3KPSA 1CR9L 4LP4A 4JKKA 4PRHE 3TEUA 3CMGA 2IMNA 5TDPA 5D1ZC 3MA7A 1HN1A 3RIFF 3U1SL 1A6ZA 3QXVA 2C4FT 1A2YA 3DGGA 5L7XH 5DJ8B 1R0AL 5C2UB 4RMVA 3LIZH 1LD9A 1NAKL 1PW3A 1Z9MA 4C58B 4RFEA 3RGVD 5JHDE 4WUUB 1U8NB 2QQKH 1NCWL 4V2CB 4TVPE 1HILB 4PJ9C 5LCVH 1SJVA 3CFBA 4JFFA 4YE4H 4NKOB 1TCRA 2GTWB 3RWHB 1U8JB 4N8CH 4U1SA 4CDHA 4OZIB 4XPGL 3TT3L 4WW2B 5T1KD 1T3FB 2ZUWA 1CL7L 3IDNB 4X99B 4B7IA 4PRAA 4MA8L 4ZYKB 5E8EB 1BQHG 3T3PF 4F3FB 5IB1A 4MHHI 4YPGA 5I1JH 2NQCA 2AXGB 3JV6A 3G5YA 1ORSA 3NCMA 2EH7L 4IRJC 1E6JH 1BPVA 1JZ2A 1CICA 2HLAB 5GS0L 5JW4R 1K3IA 5J1TC 1LNUA 3BKYH 1YN7A 2K3TA 5BS0D 1Q1JH 1JI2A 5L8JB 1SYVA 4X5LA 3K1KC 2JIXD 3PDDA 3X3GH 2O26U 4WI5A 4FXLA 3X11B 4WFGE 4S1DD 4RGND 2W60A 2H2SC 1N64L 1KPRA 1UC6A 2NX5A 2M1KA 3MR9A 5T3ZD 3HTLX 5T1LB 1BZ7A 3F5WB 4W4OC 4M7KL 1D5MB 4Q6IB 4OZFB 1R3HA 2HRPH 3BGAA 4OGYH 3MXVH 4GKOA 5C0RH 3ZE2F 3C2SA 5GS2D 5A2FA 1J8HE 2E9WA 3EHBC 3DURA 3HUJB 5D6CB 4DW2H 2Z8VC 7CGTA 3BESR 5CD3A 5J4MA 5KVEH 1FVCA 1VENA 3RL2A 2QL1A 4PJXA 43CAA 1RUPH 3OX8A 3T08A 5JIPA 1FNEA 5I8EA 5FOBB 3VFRB 3H9HA 3GSNA 3O6FA 4M1CD 3WN5B 3P0YH 1XR8A 4RGMB 1A64A 5HHOD 3N85H 3N1QC 4DN3H 4H88H 5CLWA 4QOKA 4PGCB 1NFDE 1TJGL 2ADGB 4XNZB 4Y2DD 5I15H 1CFSB 1S5IL 2VQUA 5GGUA 5INCB 2X44D 5JO5A 1A7PH 3OQ3B 3EFDL 4LK4A 3QAZC 4I8DA 2QQLH 2VB5A 3VG9B 2O5XH 3MRIB 4NQCE 5E6IA 1OTTD 3RZCA 4LLDB 4LKCB 5JOPE 1T66D 2YR3A 3S36H 4K3HA 4PLKC 1NGPL 1Y6MR 4G42A 3U82B 3NGBC 5E5RB 3MGAA 1QTYT 4MJ5A 5KVFL 1MJUL 5IT2L 4PUBL 3GSVB 3UTTB 1NLBL 5F9OH 1UG9A 3BP5A 4HMDA 4PB0H 2KPNA 3QO1A 1T7ZA 3VRLE 5CEYB 3UEZA 1CXIA 5DJ6B 1HSAB 4NIKB 4AEIL 5GS1C 4Z95L 3WEXB 5KVDH 3QPQC 1YYML 2EXWC 3EYQD 4U3XA 1DP0A 3LHPH 3E8UL 1JPSH 1FNSL 1MCPH 1YMMD 4Y4HB 5GGRB 3VGHA 5DZNA 3EZJB 4WUKH 1RU9H 4OLVL 3LDBC 8CGTA 5F97E 4Y4FD 3DX6A 5DEGA 3SGJA 3GI8L 1QVOA 3OJVC 3I84A 3MLSL 4MJ6A 3QO0A 4LIQL 4OLZH 1B88A 4WUUE 3T65A 1ONQA 4KXZH 5GS0C 1QLEL 5J6HA 3LEYL 3ZYOA 2W65A 3G6JB 4JJ5B 4AK1A 4CVZA 2R0KH 5DFVC 2AK4A 5D1ZB 5F7HA 1N5YH 2G2RB 4K3JL 4O58H 3GHBL 4OZIE 2VXVH 4LPXA 1P6FA 4ONHB 4TULH 4NO5A 3MRKB 5CP3H 2KQNA 4O2FA 3MV8D 4Q9QH 5C0CE 3L3JB 4KGJA 4YHYC 4Y5YC 3VMNA 1RVFL 3QEGL 1BWMA 1J10A 4NCC1 4XMLL 4YGVB 5EZJB 3B9AA 1O5DT 1EFXA 1S78D 1AD9A 4G80B 1FL3B 2C4XA 5C71A 5IF0B 2WWMC 4FABH 1N4XH 1WZ1H 4XVSH 4R4NC 4M02A 3MA9H 1QRNB 3L3GB 5HYSB 3BN3B 5M7QA 1PBYA 4MWFB 2FL5A 2F53A 1WQVT 3MRHB 4X7FC 2O5YL 3HAEB 2X1WL 3RTQD 2Z8SA 4FQLH 3FB8A 1XFPA 4ZTOL 1QLFA 4LASH 2VXUL 4DUWA 1OL0A 4IRJB 3SEPA 1MWAA 5SX5H 4C57C 1KBGH 1DBKH 5HVFB 3JWOH 2QKIB 4LDEB 3DTXB 2FATL 1J1OL 4RZCA 3LD8C 3HC4L 4U1GC 3VD3A 2RIKA 1ZGLP 1SEQL 3WFCL 4EXPX 1BQHA 3IAQA 3U2SB 5DVKA 5MEPA 4EKXA 4PD4J 1HINL 3ILQC 1Y0LA 2BNQA 1UGNA 3TVMD 4JLRB 3PV6A 5J06A 3WXVL 4HS6B 5I1GL 4GQ9L 3AROA 4L5FL 3ARGD 1NUFA 1CCZA 5D1XC 4LVNC 3QCVH 2XA8H 3D9AH 4MQ7B 4XH2A 4CVUA 1JNHB 1WAAF 1NDMA 5D2NC 4MGXA 2DWDB 3WIHL 3MROB 1UM4H 5EWIH 4L8CA 4R9HA 4S11A 4YFDB 2IPKB 3VFSA 5IEKB 3NZHH 3EYFA 3R06B 3H3BC 3UTPD 1IGCH 5E2WL 3PWJA 4U1JA 3F6IA 3FN3A 1JK8A 2W9DH 3QYCA 3V8CA 5GGTH 3WIIH 1OT2A 3HC0B 3V79C 4FMFA 1MVUA 2Z91B 3TIDA 4PLJD 4PJEF 2BSRB 3GMQB 3ALWA 3OAYH 1T21A 2PNDA 3B2UD 2J88H 4PG9A 2H3NA 5FO8A 4J6RH 4S0TD 3OKMA 5SWSA 1BIIB 4JHAH 3DVIA 3CFCL 3V6OE 2VLJB 1IGYB 2RFXA 4MNQD 3PIQB 3UTTE 2NY5L 4PRDB 3TGXA 4EDXA 3WJJA 5DFWH 3ULUE 5A2JH 5HTSA 1VB9A 5GGQL 4YXKL 4XXDA 2VDLL 2WUBL 5HI3D 1A3LL 5E8PA 2V6HA 4BSVA 5DTFA 3IVKB 3NGBB 2BFVL 2HG5A 3FQRA 4G5ZH 4PRHA 3L95B 3ZYZA 5I1KL 3SDDD 5FOJA 1RK1B 2FO4A 3FOLA 4LSSH 4HJGA 4NO3B 4P0DA 3KPSD 2X1PA 4AIOA 2AXJA 5JHDA 5GS1B 3PXJA 3F7VB 4FQPA 4BZ2L 2R1WA 2XZQL 1M7IB 3ARUA 2AJ3A 3G6JE 1PX3A 4M6AA 2Q6WB 2B0SL 2CO6B 2EIZA 4G9FB 4S1QL 3CFIC 3MNVB 5ADOH 5ACZB 5I19H 3B9VA 5SX4H 5F9AC 4OZFG 1BP3B 4ZUUB 2CIKB 4HAFA 3LDBB 1KCVL 5HYQB 2YD5A 1RPQA 1S9KC 3CLFH 3LV3B 4MVBC 1MSPA 2V7NA 4ZODA 3N1FC 5DUPL 4I4WB 3S6CA 5F71A 4LHJB 5FYLD 3EO0A 2VR5A 3QUML 4X9HA 4YHZL 1HSBA 2A74B 4J1UA 3O11B 3HLAA 1INDH 4C4KO 1T04A 2VQ1A 3BP7B 3BFOA 3DRTA 1E6OL 2J7LA 2EECA 3NPSC 4YHYB 4Y5YB 5CCKL 3X14A 1DN0B 1C08A 2A0LC 4XVUC 4IOFD 4X6CB 5F7MC 3PL6A 4N9GA 4U0QB 1YQ2A 4NQEA 2ZUYA 4KWUA 3GBLA 4NNPL 3MRNA 3W82A 1CD8A 1XGQA 3TWCH 4PG2A 1B3JA 4MD0A 3VI3F 1ZVSA 5HHMB 4R2GC 1J8HA 4S10A 5C07B 4FQHB 1G0XA 2C1OA 5FECB 1V7NL 1QO3B 3WIFB 3WS3B 1KCRH 4PRPB 3RY6C 4ALAL 1I9RH 1PKQE 4IBLT 1EEQA 2A1WL 3MJ9A 3OJMB 4HKBB 2A9ML 3BX7C 5FA3B 2EYTB 2ATKB 1FL5B 5I16B 1L7IL 4ZUTB 3L6FB 5IG7A 3FB6A 5ID0A 1WWCA 4LVHC 3MCLL 1E4KC 3LD8B 2R29L 4L4TE 4U1GB 3U9PH 4HWEH 1BLNB 3RAJL 3WL9A 2FJFA 3NA9H 5JPNB 1K8DA 4JN2A 4JPIB 4ZO6A 5FUZH 4DEPC 2APFA 3O6FD 5CEZD 1HIMH 5LAXA 1FC1A 1NFDA 2A83B 1DQDH 2VLLA 5CIPB 3V2AR 2NY5C 3EJYD 1UKTA 3QEUA 1UXSB 2DQFA 1ND0B 5D1XB 2R1YA 2GEEA 3WFDH 4MQXC 4QOKD 5DD3H 3V0WL 4JGMA 3A6BL 1A47A 4V1DE 1D9KC 5GHWH 4TUOB 5EOQL 4P2OC 3OHXA 4QRPD 2CH8A 4NQCA 5D2NB 1Q8MA 1NJ9A 4I48A 1JUFA 5I1AA 3IDGA 3EJZD 5HD8D 4WVRA 1FO0A 1OWRM 1AP2B 3FO2B 5FA4B 1MI5A 4LKXA 4Z77A 3TFKC 4MMXC 1FAIH 4K3GA 3ZE1E 3RNQA 4OIBA 3RZCD 3HNSL 4KTDH 2VDPL 3NFSL 4HIHA 2ZUQC 1JGEB 1KXQE 4R7NB 1NCTA 3O8XD 4PJGA 1TNMA 4U6XB 2GJ6E 5CJBA 4XPAL 5DWUL 5AUMB 2P24B 4JFOB 3LH2L 5EZIL 2V2XB 4WI8A 1KJMB 5E8DH 5EH1A 3V5KB 2AEPL 1P7QB 5F1KC 4Y4KB 4M48H 2F8XC 1JFQH 1RHHB 1UCBL 2B4CL 3BZEB 2BVOA 3HZYA 2OL3A 1WFTA 4POZC 1T5XA 3E6HB 5D71L 5F3HB 3FTGB 2QQNL 2YD1A 4LCUB 4XCNB 4D9LH 3IXAB 4XB8A 3MLYL 2DI9A 3QDHA 2XG5A 3IDJB 1A7QH 5HYSG 3E6FA 1F90L 5K9OB 4PYGA 4LDOB 4WUUA 1U8NA 5JXAL 2HKHL 3RWEB 4K71C 3TBSB 4OI8A 1A7OH 1PG7X 5C0AE 4JHWL 2XV6B 2GTWA 4H0GA 3RWHA 1CGYA 2EKSA 3ESUF 3AS2A 5L2JB 1U8JA 4OCYH 5GGVL 4PJFE 2AKRA 2JJSA 4N0UB 4OZIA 2HJFA 2JB6B 4KHXH 4YAQB 1BEYH 5C08B 3PG2A 3RPIB 4XP5L 4PD4K 5EBGA 3U0WL 4NM4H 4X99A 3BAEL 5C0CA 4UT7L 4G9DA 3KPQA 5E8EA 5KW9H 2YHGA 1RJZB 4XX1E 4L3AA 4O2CB 2AJZB 4HC1L 2NY7L 4OZHF 3CUPA 1DR9A 1BGXH 1Z3GL 3OKYA 1KIPB 3D48R 1G7HB 4RISH 1D6VL 2W9EL 1RIUL 3KLHC 4Y5VA 4PJ8C 1G0YR 3H7LA 5KZCD 5C0ND 1KC5L 1I9IL 2XACC 3X11A 3T77B 4M5YL 2DBLL 4KKAC 4WJ5A 1RJYA 1D5XB 1U41A 1UENA 2ZPKL 2B39A 4HWBH 1WEJH 4OGXL 2JF1A 1KJ2L 3FMGL 5EZOL 2PCPB 1TLKA 2V7HA 3QWRD 3QNYB 1QSEE 4OZFA 1CGVA 2IC2A 1V7MH 4GW1B 2UWEE 4YBQD 5HHME 1JHLH 2X7LA 3VXOB 5JNYB 3PV7A 4JE4B 2FLBT 3BQUA 3EOTH 3HUJA 3W0WD 2COQA 2HT2C 4JFZH 1WBZB 1CDHA 5IOPB 4CVXB 4APQD 3JTTA 2EDOA 3GSQB 3WJLC 4LLVA 1A7NL 2YXMA 3DV6A 1NKOA 3IRZA 4I0PC 4PJDF 3BO8B 5EUOF 5CZVL 3JWDH 5FOBA 4TUJB 2ZKHH 3VFRA 4R2GB 2F9BT 2WIIB 1FL6A 1OSPL 1A02N 5ID1B 4HZLB 5I1EH 4LDLB 2HYMA 3DETD 3H7BA 1OD7A 1JGUH 1JHKH 4LARL 3HI5L 5HXMA 2X5PA 4LHUG 3WXWL 5LBSH 2ADGA 1EDQA 1CFSA 4KPHH 1C12B 4LVHB 5INCA 2XTJE 2D2OA 1BFOB 2IQ9H 5FYKL 2GJZA 4JPKH 2E9JA 3WHE1 2Y25A 5DGQA 4KKBD 1PSKL 4OB5H 1TJHL 5CGTA 5LJYH 5T1MB 3MRIA 3R0NA 4DEPB 5D2NE 3V5DA 4FA8A 2B4CC 2JELL 4HKXB 3VFOB 2YMXL 5T33L 2GSGB 4PREB 3MLUH 4LGSB 4I18C 2C4FU 2NZ9C 3MZGB 2X4PA 2EC9U 5L2KD 1JGDA 3V6OA 1KFAL 5KVGH 3DVFA 3AMKA 1PLGL 2GW5A 1D9KB 3UTTA 3N9GH 4P2OB 1WTLA 1IKFL 1NUDA 1QBAA 1ZT1B 5DJ6A 1CE1L 1DVFC 1GVIA 3MRJB 2KQMA 4D9RE 2I60L 4OF7A 4XX1G 5CGYC 1ADQL 5IB5B 1U3HA 3D39E 4LNRA 5DT1L 4JFEE 5TDNA 5FF6B 5GGRA 2Y1VA 5D7LB 3KR3H 5IB3B 4JO2H 1KB5H 3GNMH 3HE6A 1FYTE 2ZUQB 4LIQE 2CLVB 1AFVL 1KPUA 1N59B 4L8BB 4GH7B 6FABH 3PQYB 1UCTA 4Z78B 2X4SA 2PTTB 2CDFA 4AIZB 4P3CH 5GRWA 1IM9B 2O5ZH 4LCWB 1RUML 4ODTH 5GRJH 4UOW1 1NMBL 1I7TA 5JW3L 4TUKL 4XP9H 3INUL 2E8YA 3G6JA 4JJ5A 4U3CA 3GHEH 1AE6L 5GIRB 5ICYA 3VRIB 2MWCA 2YK1H 3W11C 2NXYC 5D1ZA 5ILTH 1MCBA 2BDNH 5DMKB 2CKBL 1LVEA 4N0UE 3CVHL 4PJHF 4IM8A 2DJUA 2NNAB 3QUMB 5DVOA 4F7EB 5I8KL 1F6LL 1TVBB 4QYOA 1OQXA 1XCQB 4O4YH 2Z4QA 4K71B 1UZ6E 3P0VL 4PGDA 4YGVA 1LO0H 5ABDE 3G5ZB 3VGEA 1W0VB 1KLGB 5GISL 1TPXC 2FDBP 3LKSB 1CFNA 2J3SA 2YPVH 3L3GA 2APWA 3V4PH 1WBXA 2DTMH 4XMPH 4HUXB 2Q7NA 1C5BL 2DI7A 4DGIH 4KK6D 1J1PH 4LSRL 5TH2B 1BVKB 1ZA3B 4MSWA 3TJEL 2AJYH 4CRPA 1KJ3H 4G8EA