4HCYA

Structure of a eukaryotic thiaminase-i bound to the thiamin analogue 3-deazathiamin
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
352
structure length
352
Chain Sequence
PKTLTVGLFPYLPSWNENGNEVKLINLIKDVLPTQVSGYNIEYTEFDCYSDASLQSLPDVFSTDSIFLPYLVSLGGVKSLDESLVRGVTGDLHSFVSSSASVNGSVYGFPQYLCSNFLLSSPNATQQASSLLELAQKVGYEQIVYPDVASSSSFTVFGLYQQLLQSSSSAAVDIKASDLPQSGDQVNKDITQKYRTILDSTVVASQREYINSVKQGKPISNYYVGYSESMCEIKDIIRDQQYNVQLIGTSDKPYVYTDVLALNSNLCDEKQKVAVEVIKNLLTNTLVLDLLGLGLTLPANKNGIAHLAKSSNFYAQLSQQFDAKESEVRVLRCVDFANKEVKNCAGVLRPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a eukaryotic thiaminase I.
pubmed doi rcsb
source organism Naegleria gruberi
molecule tags Transferase
molecule keywords thiaminase-I
total genus 113
structure length 352
sequence length 352
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 2012-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4hcyA01
3.40.190.220 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4hcyA02
1ZKBA 3TTMA 3SERA 1UQWA 2QS2A 4GLIA 4XKNA 2KLFA 2DVCA 1S7YA 2H25A 1PEBA 3OO9A 5H8FB 1B3GA 4ONYA 4UACA 2XD3A 4DE8A 5I56A 1OQGA 2O1MA 1USYE 1A40A 1VR5A 4U2RA 1SW4A 1H45A 4G77A 3MPKA 1N7XA 3U92A 3MC2A 2QJEA 3SESA 3JV9A 1MRPA 1NNTA 4H67A 1B6HA 4R74A 4O3BA 4XKQA 3RTWB 3CFZA 2DXYA 2ZNSA 1FQCA 3ODBA 2RC8A 2XXWA 4PFWA 4ZECA 1I6BA 1MH4A 3H3GA 3T66A 4RY1A 3HV1A 5CMBA 4ESWA 2Y7KA 1SI1A 1R9LA 2I0CA 1OLCA 2ZYKA 4QSEA 4OFOA 3ILTB 2QRYA 4XTCQ 4ZZEA 4R6HA 4FATA 2I6EA 3MPLA 2XXTA 3CVGA 2O7UA 1POY1 2XXHA 4MF3A 3WAEA 4NF5A 3O6IA 4BDRA 1TFAA 3GLBA 2V3TA 3V83A 3G3JA 3MVXA 3KEIA 1EZ9A 3MZ9A 2I48A 4R75A 5CMCA 3O66A 3RN8A 4ELQA 4F1VA 3RNNA 3G3KA 3GXAA 5TP9A 3LR1A 3K1PA 3HSTA 3PD8A 3PUWE 2RINA 4EXKA 5AA1A 1LFIA 3KSJA 3VVDA 5M2VA 2QS1A 3D4CA 5DT6A 5H8NB 5KDTA 4H8JA 4OETA 3FXQA 4R9GA 3ZKKA 1B3LA 3N26A 3JZJA 3DLNA 3PMWA 2V25A 1D3KA 1N84A 1D9VA 4X48A 3MZBA 3SEUA 3USDA 4RK2A 1MXUA 2GHBA 2CZLA 3D4GA 3FVKA 4IY6A 4K3FA 5L8DA 2R9JA 1YPNA 4YB6A 1UIUA 3TKDA 3OXNA 1B40A 1LCFA 1LCTA 3A3CA 3O28A 4IO6A 2AYSA 3K02A 1HSEA 3EQ1A 3PPPA 4GRKA 3G3FA 4P11A 3FZVA 4DDDA 3S9LC 1VE4A 4R9FA 3VDFA 1MY1A 3O29A 4F1UA 2HXWA 4U22A 4GOTA 3ILUB 1A8EA 4GXAA 3FATA 1ELJA 1M5FA 4NF6B 3C32A 3PPRA 3THIA 1JVXA 2DS9A 3KJTA 3QXMA 3SETA 1LSTA 3OENA 3ZSFA 3GBBA 1ZTYA 1DTGA 3H6TA 3PMVA 4PP0A 1FQBA 5DTBA 1RYOA 2F7BA 2YJPA 3WAFA 2O51A 3OELA 5IKBA 4YMBA 2PT1A 3KN7A 1LBCA 3IOUA 3VLWA 2A5TA 2V3UA 4RXLA 2QL3A 2UYEA 3ECRA 5I59B 3MAMA 4WEPA 3IJOB 5B70A 2QS4A 2F7AA 3I6VA 1TXFA 1B5JA 2IA4A 1B46A 2VHAA 3IR1A 2Z8FA 4DZ1A 5TPAA 4JSOA 1B7HA 3FV2A 4M1VA 3R6UA 4R6YA 2XHDA 1IXHA 1ANFA 3IOTA 1NH7A 4LZ7A 3TQWA 4NTLA 5K2XA 3U1OA 4YKJA 2R6GE 5AA2A 4LQ2A 5AA2D 2XXUA 5ICQA 3QUFA 4NMYA 2RC9A 2FYIA 3PPQA 1NFTA 3RUMA 1N3XA 3PPOA 4RPNA 2ZYMA 3OD7A 2WKYA 2V84A 3IX1A 4I62A 4N13A 4PFUA 1MY3A 2DVZA 2YLNA 2Y7RA 4ZEFA 1N3WA 1NL5A 1WDNA 1MDP1 4RA1A 4U23A 3G7WA 1R1NA 3DELB 4IO5A 1DSNA 4E0WA 1B4ZA 2IEEA 2Q9TA 1OVTA 4G68B 4GIZA 2ZXTA 4F3BA 4PETA 5HPQA 1SYIA 2HZKA 3VXCA 2A5SA 3PGFA 4KQPA 4YICA 1QULA 3IOWA 4OEUA 3F11A 3SEWA 1MDQA 4IO3A 4EXLA 2FA7A 1B0HA 5AA3A 1NNPA 3FVNA 2AIXA 3EHSA 1MG1A 3FVOA 4GVOA 1EH3A 5I2KB 5AE4A 2XXPA 4C1TA 5CBSA 4FEDA 3O2AA 1B0LA 3TMGA 1OQHA 4F18A 1JNFA 1N76A 4O3AA 3U93A 3FJ7A 4R6KA 3LBSA 3FXUA 5CMKA 1MY4A 3LSWA 4OWDA 2UVHA 2H5YA 2I4BA 1XVXA 2F97A 2Y84A 2XX7A 2ONRA 3U8QA 4IY5A 1DPEA 1Z7NE 3KN8A 2Q2AA 3ZS6A 4QHQA 2ALUA 1B1XA 4EF2A 5ISUA 3IO4A 2ZYNA 1S9TA 5BWJA 1QUKA 2I49A 4X1BA 1NMUA 4AB6A 3C9HA 3N6UA 3UORA 2CMOA 4NF4A 1ZJLA 2X26A 3N94A 4QFLA 2F7CA 3H03A 2QSXA 3E13X 4KYDA 3QSLA 3KFMA 4HCYA 4YKIA 1I6QA 2G29A 5LOMA 1LLSA 2I3WA 1IXIA 4H0WA 1LAFE 1ATGA 4BDOA 3OO7A 4H5GA 5H8FA 2Z8EA 4ZEKA 2RCAA 2D3IA 4NWDA 5DEXA 3KZGA 3W15C 3H4ZA 4KCCA 4FE8A 3LUYA 4KFQA 4LZ5A 3LSFB 4ZE8A 3K6UA 2I3VA 2O69A 3MVYA 1B3FA 5HBCA 2AL4A 3C35A 1M5EA 4JXIA 1SVXB 3BFUA 1POTA 1EZPA 1URSA 4DXBA 1JW4A 4DIGA 5J1DA 5HM4B 1BKAA 2XXIA 3HN0A 5TP9B 1MQJA 3VVEA 4C1UA 3KOTA 3EHUA 5KZTA 3HHGA 4PFYA 3O6GA 3SKPA 1MXZA 5CMMA 1NH8A 3SDFA 4ELOA 1P99A 5JEIA 4QF9A 3S9NC 2NXOA 4OVJA 1FQAA 1UTHB 4QFKA 3TDJA 3TCGA 3U72A 2H98A 2FNCA 1LAGE 3S2VA 3K00A 3FVGA 1WODA 4YB5A 2Y7IA 3PPNA 2I4CA 3LSLA 4NEDA 1L5TA 3TYHA 2R71A 3IJXB 2P0SA 3DP6A 3L6HA 3OO6A 2PX1A 2DWIA 1B58A 4G68C 4ZEBA 2REJA 3IORA 3KSXA 1B5HA 2E1SA 1Q1KA 2QMWA 3MWBA 3SEYA 4F3GA 3O97A 1O7TA 3R7XA 2VGQA 1B3EA 5H8HA 4IO4A 1J1NA 3RQTA 3UP9A 1YTVA 3MVWA 1Y9UA 1IITA 1B3HA 3K4UA 5H8QA 2XXQA 1MPBA 3OOAA 5H8SA 5L9MA 3T9VA 4GXSB 4ELPA 2XX8A 4RJZA 5JTYA 1XC1A 1PBPA 3UN6A 2YPNA 1QUIA 1B7UA 3O6HA 2Q8JA 1MXXA 2VOZA 1MXVA 5DVIA 1JW1A 2LAOA 2Z23A 3W9WA 1PBQA 1ZU0A 4NF8B 5KCJA 2OWSA 1CE2A 5I59A 3M3FA 3OO8A 1SDXA 3QYTA 2O1LA 2X7PA 3OEMA 1A54A 3CRBA 2DE3A 1FW0A 3B6TA 2AL5A 3FIRA 4RPOA 1FTKA 4BLAA 4R2BA 4I1DA 3BFTA 4GD5A 4ZDMA 3FUZA 2PVUA 4I9DA 1FTOA 4U1ZA 3PV0E 4JB7A 5TPAB 4OERA 1JW5A 4OZ9A 4FJPA 5I57A 5ICTA 2D5WA 1Y1ZA 1MY2A 3EPEA 1GV8A 1ZMGA 2UVIA 4H5FA 2B65A 3PUYE 1GTKA 1QKBA 3MJNA 1MQIA 1H76A 5I58B 4FAJA 3KG2A 4XXUA 1LB9A 4F22A 2ZNUA 3HPIA 5DVJA 4F31B 1UTHA 5A5XB 5CBRA 5CM6A 4AQ4A 4MH5A 4M4GA 3OSQA 4ZZAA 2BJJX 2DE2A 4L17A 1GGGA 2O6AA 3EF7A 4U1OA 1A8FA 3E4RA 2H99A 1HSJA 2G93A 4G68A 5ITOA 4DXUA 1SBPA 3MUQA 5EYFA 3UK4A 2F5XA 3MVZA 5ELVA 3RTFB 4DLDA 1AIVA 5I84A 2RCBA 1UTBB 4H8IA 5DYHA 4U4XA 1XT8A 2XXYA 5B7DA 4Q5TA 3LSXA 3QIMA 4POXA 3CG3A 1MXWA 2DYXA 2O84X 2ONSA 4O3CA 4ESXA 2PYYA 4Z0IA 1VFDA 1BTJA 1LAHE 1MH3A 3KBRA 2ABHA 4KHZE 4OXVA 2NOOA 3RT6B 3VFJA 4LA9A 1USYH 2VD2A 3AXFA 3UIFA 2NWJA 1M5BA 1PC3A 1S50A 2Y7PA 4RNSA 5EHMA 1FQFA 1QKAA 4OTEA 4H1XA 3TEPA 1P1UA 4MLQA 3IB2A 3BKIB 3VLVA 1DOTA 2QS3A 2UYFA 4YB7A 4P0GA 1WVJA 4QSDA 4IB2A 1YCJA 4C0RA 3A3UA 3SEXA 4LUBA 4PQJA 2OZZA 5L9OA 4MBPA 1Y20A 1H44A 3DM0A 3MZ1A 3QUJA 4NWCA 3E3KA 5FTIA 3B6WA 1RKMA 3CR9A 3PMXA 4U21A 4NF6A 1LGBC 1MPCA 2Q88A 5I2NB 3TUSA 4BDQA 1SD3A 3KOSA 1US5A 4X9TA 2UXAA 3BBRA 1B7ZA 5DEXB 3Q28A 3A09A 4KI0E 4XKRA 3IK6B 3OEKA 3PD9A 1PB7A 2XXRA 4NF4B 1O64A 3S9EA 1B51A 3SEVA 4F39A 5I58A 4ND9A 4KCDA 4TLMB 1Y1MA 3PU5A 3T22A 1GR2A 4KYSA 4E0XA 1B9JA 3C31A 4H6DA 3OMBA 2OJTA 3TTRA 1Y3QA 3T96B 5A5XA 4G8HA 3I3VA 2PMSA 3TTNA 5JK4A 3CG1A 4LQ5A 2Y7WA 3V5AA 3C34A 5FHOA 4N6PA 1MY0A 2M8CA 2RC7A 3CSGA 3G3HA 4GFRA 4X1DA 1B1HA 1MXYA 1XVYA 2PBWA 3H6UA 1FCKA 4YAHX 1MQHA 1IEJA 5FHNA 4HS7A 4LVQA 1M5CA 3TFLA 4ELRA 1LFGA 4R2FA 1Y3PA 1A55A 1N04A 4XIGQ 1TWYA 2ZNTA 1FQEA 2VD3A 1II5A 2XD2A 3H6VA 3MQ9A 3PUXE 1GVCA 5FTHA 1OVBA 2DE4A 3K6VA 3ZKLA 4AB5A 2I0BA 3TODA 4EQ7A 4YKPA 3TELA 1QUJA 1BP5A 1OLAA 3MP6A 3TPAA 2F8DA 1ZLQA 4F2OA 1XHYA 4TLLB 4TOZA 4XKPA 2NVUB 3VLUA 4WKMA 1TT1A 3H7MA 4KR5A 2D21A 3KGCA 1I6AA 1FTJA 4U4SA 1H43A 3CSBA 1BLFA 3CFLA 4PE5B 3TAJA 1MM6A 1PB8A 1JEVA 1Y4CA 1SW5A 1MM7A 2Z22A 1O63A 3G3GA 2H4IA 3IB1A 3JYRA 3TCHA 5CRYA 1IQ7A 4F3PA 1MQDA 3GZGA 3RPWA 3RT8A 1FQDA 2F6PA 2XXXA 5FHMA 3CI8A 4ECFA 3HCQA 1JEUA 3R26A 4EDPA 3K01A 4NF5B 2DWJA 4JWOA 1DMBA 3K1NA 2O68A 4F3SA 3FJGA 3Q25A 5I2KA 1I69A 3K6WA 4R72A 4ZE9A 2GHAA 3GBAA 2P2AA 2OBGA 3OSRA 4JWXA 1QVSA 4QFOA 5H8QB 4LATA 2UVJA 5F7VA 5AA4B 4QFNA 2F36A 5ITPA 3LC8A 1SW1A 4LP2B 3K6XA 3ONMA 4OFJA 1F9BA 2RF1A 4R73A 2Q89A 3M3LA 4RK9A 1P1OA 1SW2A 2ZMBA 4UA8A 4THIA 4LZ8A 1FTLA 5H8NA 5AA2B 2NUVA 2V93A 1Q35A 3C33A 3EHTA 3KN3A 3QAXA 4FIMA 4FORA 4KD5A 4ISUA 4POWA 2ANJA 1EU8A 3TCFA 4BDMA 4DCYA 4JWYA 4F29A 1DTZA 4HW8A 5I57B 3K0VA 2E0SA 1AMFA 2I58A 1TFDA 1BIYA 3DP8A 1D4NA 2HCAA 3O9PA 4GL0A 4F19A 1QJMA 2DP8A 3E9XA 4N07A 4GL8A 4NE4A 4OESA 5TU0A 2GFEA 2DOJA 3W9VA 3B6QA 5KDTB 4Q8RA 1A99A 2THIA 3IOVA 1YAEA 4GWOA 4KPTA 3TTKA 4QFPA 2ONKE 3T93B 2OK2A 4FECA 3U94A 2ESNA 3Q29A 2VP1A 1DPPA 1P1WA 1SQYA 1VSOA 2X7QA 2XXVA 1Y4TA 3IL1B 1NKXA 3N5LA 3Q26A 4JSDA 4OHNA 4ZEIA 4P0IA 3TTLA 4G2ZA 4Q0CA 2HAVA 1MQGA 2HEUA 2OWTA 2H9BA 2GRVA 1UTBA 1LAXA 1B2HA 4Z7EA 4JBZA 3HHFA 1B5IA 1SYHA 1AL3A 3L6GA 3RGYA 3S9MC 2HFBA 2HAUA 5IAIA 1T0KA 4EF1A 5L9SA 4MLVA 1B52A 2A5TB 3PUVE 4FEBA 4KYEA 1MS7A 4YMAA 2ZYOA 2DSFA 1XS5A 1JQFA 2DWHA 2F35A 4IO7A 1US4A 3G3IA 5BUUA 1JETA 3MW0A 3MP8A 5EHSA 3UGWA 1D9YA 4GF8A 4F2QA 2OCUA 4WXJA 4QSCA 4WEDA 3H6WA 4F1YA 2PT2A 1N7WA 3C4MA 4JDFA 1IXGA 1Z7ME 3VVFA 3M3KA 4EQBA 1XOCA 5K2YA 3K2DA 3T9UA 3HO7A 1N0TA 1OIBA 2F6GA 3FGSA 4MFIA 4OENA 4BDLA 2QPQA 5I56B 1IIWA 1URDA 2UVGA 3K1MA 1IXCA 2O7IA 2V3QA 4DXCA 4GQOA 1IUDA 4OQOA 4QRZA 1JVYA 1PDAA 2QMXA 3H06B 2OLBA 4BDNA 1B4HA 3VXBA 5AA4A 1NNKA 5H8HB 3S4UA 4TQUQ 4EUOA 1HSLA 2REGA 1P1QA 2F34A 2HQ0A 5CC2A 3CIJA 3FD3A 3VV5A 5I2NA 1AOVA 4G8NA 1A7LA 4I8CA 1LB8A 3TZAA 1R9QA 4ZEDA 2Q2CA 2DWAA 2P1SA 3B7DA 3M8UA 3Q27A 4G4PA 1M5DA 1LBBA 3QK6A 3N6TA 1RYXA 4OFLA 3UA8A 3PUZE 3T9XB 3V8XB 3VE1B 1UIVA 4NF8A 1ZBMA 4YKKA 1AH5A 1R6ZA 1NNFA 4OMBA 3DP4A 1SI0A 3IAZA 3RLFE 1EZOA 1LFHA 4RYAA 4HCWA 3P7IA 4IGRA 1P1NA 2GH9A 3TQLA 3MBPA 5JTYB 1VFEA 2B3BA 1Y3NA 3RY3A 4DCXA 4LONB 5F1QA 1B05A 1OMPA 4H65A 2Z8DA 1B32A 1URGA 3FJMA 2RKMA 1IZ1A 3I5OA 2HZLA 3C36A 3IO6A 1CB6A 4G8MA 4OYVA 5CI5A 4ZS9A 1KWHA 2XX9A 4OEVA 3CFXA 3T9HB 4YU0A 4IO2A 1ZIUA 2DQVA 5DVFA 4Q30B 5KCJB 3V89B 3MP1A 1H3DA 3EN3A 3FV1A 3KJ7A 3IB0A 4YZZA 3FASA 2F78A 2B3FA 1MPDA 1PB9A 2DXRA 4IGTA 4EQ9A 4PFTA 1FTMA 4HTGA 2W7YA 1QW0A 3FXRA
chains in the Genus database with same CATH superfamily
2QS2A 2KLFA 2DVCA 2H25A 1LBWA 4UACA 4MAGA 1VR5A 1H45A 2QJEA 1B6HA 4XKQA 3RTWB 2DXYA 2ZNSA 3H3GA 5I3SA 4RY1A 1KA1A 3TUSA 2ZYKA 4ZZEA 1POY1 4MF3A 3WAEA 4P47A 3GLBA 2V3TA 5CMCA 3E78A 5TP9A 3HSTA 4PBHA 3PUWE 4EXKA 4H8JA 3ZKKA 3JZJA 1D9VA 3MZBA 3USDA 2V4CA 1YPNA 4YB6A 2QFLA 5EQ8A 1B40A 1LCFA 3A3CA 2AYSA 3PPPA 4NX1A 3S9LC 4P11A 3VDFA 4F1UA 4GXAA 1ELJA 1FPDA 2DS9A 4PFBA 3PMVA 4PP0A 5DTBA 4IR8A 2PT1A 3KN7A 2CZKA 1LBCA 4PC9A 1DBZA 3IJOB 3I6VA 2IA4A 2Z8FA 3FV2A 4M1VA 5ET8A 3IOTA 1ANFA 1NH7A 4NTLA 4LQ2A 4XFEA 2FYIA 4RPNA 2ZYMA 5IM2A 2PFYA 4NF0A 4ZEFA 4U23A 4YAHX 4E0WA 2R8TA 1R1NA 1OVTA 2ZZVA 3VXCA 2A5SA 2FIEA 5AA3A 1NNPA 3FVNA 3FVOA 4GVOA 1EH3A 5I2KB 1B0LA 1OQHA 4GBWA 3FJ7A 4FBPA 1XVXA 2F97A 1NMUA 2X26A 4GWWA 4KYDA 3H03A 3KFMA 2G29A 1IXIA 3OO7A 5H8FA 5DEXA 1YYZA 4KCCA 4KFQA 3LSFB 3K6UA 2AL4A 1SVXB 3BFUA 1EZPA 1K9ZA 5HM4B 1BKAA 1MQJA 5KZTA 3O6GA 3SKPA 3SDFA 4OVJA 1UTHB 3TDJA 4PFIA 2H98A 3FVGA 4YB5A 2Y7IA 3PPNA 2I4CA 3LSLA 1L5TA 1YZ0A 3KSXA 2E1SA 2QMWA 3O97A 1EYJA 1O7TA 3R7XA 2VGQA 4GWYA 1YTVA 3MVWA 3K4UA 5H8QA 1FRPA 3T9VA 4RJZA 5JTYA 2VOZA 5DVIA 1FBPA 1D9QA 2X7PA 3OEMA 2Q74A 4R2BA 4I1DA 3FUZA 4I9DA 4OERA 4GWUA 2D5WA 1ZMGA 2KQZA 3MJNA 2F3BA 1MQIA 2ZNUA 4AQ4A 4MH5A 1A8FA 4OA4A 2G93A 5ELVA 4QBAA 1XT8A 4PBQA 3LSXA 5I5PA 2O84X 2ONSA 4ESXA 1FBHA 1MH3A 4KHZE 1FJ9A 3RT6B 2ABHA 5LTCA 2VD2A 2KR0A 4MNCA 3MYUA 5EHMA 1FQFA 1QKAA 3IB2A 1DOTA 4IB2A 1YCJA 1H44A 5FTIA 4NF6A 2UXAA 4H46A 4MNIA 4XKRA 1PB7A 2PCRA 2XXRA 3S9EA 1B51A 4F39A 4KCDA 3T22A 1B9JA 4H6DA 3OMBA 1Y3QA 4PF8A 5JK4A 2Y7WA 3C34A 5FHOA 1B1HA 1LBZA 1LFGA 1Y3PA 2ZNTA 1FQEA 1II5A 3PUXE 1OVBA 3MP6A 3TPAA 4OANA 1ZLQA 1XHYA 2NVUB 2D21A 3KGCA 1AWBA 1FTJA 3CSBA 3TAJA 3TCHA 5CRYA 1IQ7A 3HCQA 5I2KA 3K6WA 2GHAA 3OSRA 4JWXA 5H8QB 4QFOA 3LC8A 1SW1A 3B50A 3ONMA 4OFJA 1F9BA 2RF1A 4R73A 4RK9A 1FTLA 3KN3A 3QAXA 1LEVA 4N4UA 4DCYA 4BDMA 1DTZA 4HW8A 1QJMA 4N07A 2GFEA 3W9VA 3B6QA 1A99A 2THIA 4GWOA 3TTKA 4QFPA 3Q29A 3IL1B 4O94A 4P0IA 3BIHA 3TTLA 4Q0CA 1MQGA 1NUYA 1UTBA 1LAXA 3LV0A 4MX6A 4Z7EA 4FEBA 3PUVE 1FPFA 2B4LA 2F35A 2OCUA 4QSCA 3H6WA 1N7WA 4JDFA 3VVFA 4OVQA 2FVZA 1N0TA 4O7MA 4BDLA 5I56B 2QPQA 1IIWA 4OQOA 1PDAA 1NNKA 3PTYA 5H8HB 4EUOA 1P1QA 2F34A 5I2NA 4G8NA 1A7LA 4I8CA 1LB8A 1R9QA 4ZEDA 4AS4A 3N6TA 1RYXA 4OFLA 4QXDA 3T9XB 3V8XB 4HE2A 1FBEA 1NNFA 3DP4A 1SI0A 1CNQA 3TQLA 3MBPA 1Y3NA 4GWZA 4DCXA 1B05A 4G8MA 3SERA 5CI5A 2RKMA 1IZ1A 4ZS9A 1KWHA 3T9HB 4IO2A 2CEXA 3FASA 2B3FA 1PB9A 4EQ9A 4PCDA 1FTMA 4PFTA 1QW0A 3FXRA 4H45A 3TTMA 5IZ1A 1S7YA 1PEBA 4NGUA 4ONYA 1VDWA 1FPGA 5ESYA 1SPIA 1OQGA 1A40A 1SW4A 4G77A 3MPKA 3ROJA 3JV9A 1MRPA 4R74A 3ODBA 2RC8A 4PFWA 1MH4A 3T66A 3HV1A 4ESWA 1SI1A 1OLCA 4QSEA 3ILTB 4R6HA 4FATA 2O7UA 4DI4B 4BDRA 1EZ9A 3MZ9A 2I48A 3RN8A 4ELQA 3G3KA 4XEQA 1KA0A 5DT6A 3T1BA 3N26A 1DCUA 3DLNA 1N84A 4RK2A 1MXUA 2OX3A 5L8DA 4IO6A 1LCTA 4JVIA 4DDDA 3G3FA 4R9FA 1MY1A 4U22A 1A8EA 1JVXA 1LSTA 3GBBA 1ZTYA 1DTGA 5EQAA 2F7BA 3WAFA 1NV2A 2XWKA 3ISPA 4X04A 4YMBA 4LN5A 4RXLA 2QL3A 3ECRA 2Y5KA 3MAMA 1FPKA 5B70A 2QS4A 4JSOA 1B7HA 2FHYA 4R6YA 1JP4A 5AA2D 2R6GE 5ICQA 3QUFA 2WYPA 2RC9A 3NOHA 3PPQA 3OD7A 2WKYA 4PFUA 4N13A 2DDKA 1N3WA 2IEEA 2Q9TA 2ZXTA 2HZKA 1QULA 2FA7A 1B0HA 3EHSA 1MG1A 5CBSA 3TMGA 4F18A 1N76A 3U93A 2Y84A 3U8QA 1NV7A 3KN8A 2Q2AA 5I7IA 1B1XA 2ZYNA 1QUKA 2I49A 3N6UA 3UORA 2CMOA 1ZJLA 2QSXA 4HCYA 1LLSA 4H0WA 1LAFE 3B8BA 4BDOA 4ZEKA 2RCAA 2WX9A 3H4ZA 4FE8A 2O69A 3MVYA 1B3FA 1URSA 1JW4A 5J1DA 1FPJA 3HN0A 2XXIA 5TP9B 3VVEA 3EHUA 5CMMA 1NH8A 1P99A 3S9NC 2OWZA 1WODA 4NEDA 2REJA 3SEYA 1NV6A 3UP9A 1Y9UA 1IITA 1B3HA 4GXSB 1XC1A 2Q8JA 1MXVA 1JW1A 3W9WA 1PBQA 1ZU0A 3D1RA 2O1LA 3FIRA 4RPOA 1FTKA 4GD5A 4GX3A 5ET6A 4OZ9A 4P1LA 3EPEA 4H5FA 5I58B 4FAJA 4F22A 3HPIA 3U65A 4M4GA 3OSQA 2DE2A 4L17A 2O6AA 5ITOA 3E4RA 2H99A 4DXUA 1SBPA 5EYFA 3RTFB 5DYHA 4U4XA 4HXVA 5B7DA 1G0HA 3CG3A 2DYXA 2PYYA 4Z0IA 4O7IA 3VFJA 2B4MA 4OXVA 2WBDA 4LA9A 3AXFA 1PC3A 1S50A 4RNSA 4OTEA 3TEPA 2QS3A 4C0RA 5L9OA 4MBPA 3DM0A 1RDXA 3PMXA 1LGBC 1MPCA 2Q88A 5I2NB 1US5A 5DEXB 4KI0E 3OEKA 5I58A 1Y1MA 3PU5A 3C31A 5A5XA 3I3VA 3V5AA 1IMEA 1FSAA 3H6UA 4HS7A 4LVQA 1M5CA 4R2FA 1A55A 1N04A 4XIGQ 1TWYA 1GVCA 3H6VA 2DE4A 3ZKLA 4AB5A 2I0BA 3TELA 1QUJA 1BP5A 4TLLB 4XKPA 3H7MA 4KR5A 4GWSA 3CFLA 4JVCA 1PB8A 1JEVA 1Y4CA 1SW5A 1MM7A 2H4IA 3RT8A 2XXXA 3CI8A 1JEUA 3R26A 4NF5B 2DWJA 1DMBA 3K1NA 1K9YA 1I69A 4R72A 5F7VA 2UVJA 5ITPA 2F36A 4PAFA 4LP2B 4DIGA 2Q89A 5H8NA 3M3LA 4UA8A 4THIA 2NUVA 3EHTA 3C33A 4KD5A 2ANJA 1EU8A 4F29A 5I57B 1AMFA 1BIYA 1D4NA 3E9XA 5KDTB 4Q8RA 1P1WA 1SQYA 1VSOA 2XXVA 4ZEIA 2HAVA 2OWTA 2GRVA 3BIGA 3LUZA 3L6GA 3S9MC 1AL3A 2HAUA 4MLVA 4KYEA 4YMAA 2DSFA 2DWHA 5BUUA 4GF8A 4F2QA 4N8YA 3M3KA 5K2YA 3T9UA 3K2DA 4OENA 2UVGA 3K1MA 1IXCA 2O7IA 4DXCA 2QMXA 2REGA 4MIJA 5CC2A 3FD3A 4N91A 4P9KA 5AA2B 3Q27A 1LBBA 3QK6A 3UA8A 4NF8A 4YKKA 1XI6A 1LFHA 1LBVA 4RYAA 2GH9A 4N81A 5JTYB 1VFEA 5F1QA 3I5OA 3C36A 3IO6A 3A29A 2XX9A 4YU0A 5KCJB 2DQVA 5DVFA 3V89B 3MP1A 1MPDA 2W7YA 2FBPA 4XKNA 5H8FB 3OO9A 2XD3A 2CZHA 4U2RA 1N7XA 3MC2A 1NNTA 4H67A 2XXWA 2Y7KA 2I0CA 3MSTA 4XTCQ 2I6EA 3MPLA 2XXTA 2XXHA 4NF5A 3O6IA 1TFAA 1NV1A 3V83A 2WYKA 1NUXA 1FBGA 3O66A 3RNNA 3K1PA 3PD8A 1LFIA 3VVDA 5H8NB 5KDTA 4R9GA 3FXQA 2XA5A 2V25A 1D3KA 2CZLA 3D4GA 4IY6A 3OXNA 4NQ8A 3O28A 3K02A 3O29A 4GOTA 3ILUB 3FATA 1M5FA 3THIA 3PPRA 3KJTA 2XXKA 4N6DA 3OENA 3H6TA 2YJPA 2HHMA 4I3EA 5IKBA 4N8GA 2A5TA 2V3UA 2XWIA 5I59B 4WEPA 2L5VA 2F7AA 1NV5A 3IR1A 3R6UA 4LZ7A 5K2XA 4YKJA 2CEYA 4NMYA 2QVUA 4OVTA 1NFTA 3PPOA 4I62A 4PGNA 1NL5A 2CZIA 1MDP1 3KC0A 3DELB 1DSNA 1B4ZA 5HPQA 4O8MA 4YICA 3PGFA 4KQPA 4OEUA 3SEWA 1MDQA 1FBFA 2AIXA 4C1TA 2HXRA 3LBSA 3FXUA 2GQ1A 2UVHA 2H5YA 3RPLA 4JVDA 2XX7A 1DPEA 3ZS6A 2P3NA 4EF2A 3IO4A 1S9TA 5IGAA 4X1BA 4AB6A 1QGXA 3C9HA 1DK4A 2F7CA 4YKIA 1I6QA 2I3WA 4H5GA 2Z8EA 2D3IA 5EYHA 3KZGA 3LUYA 4ZE8A 3GYYA 2I3VA 5HBCA 3C35A 1M5EA 1POTA 4C1UA 4ELOA 5JEIA 4QF9A 2NXOA 3U72A 4NHBA 2R71A 3IJXB 2P0SA 3DP6A 3OO6A 2DWIA 1B58A 4G68C 3IORA 1B5HA 3RPLB 2WEFA 4IO4A 3RQTA 5H8SA 3RYDA 4ELPA 2XX8A 4I40A 4OVRA 1PBPA 3UN6A 2YPNA 5ET5A 1QUIA 5I59A 3M3FA 3OO8A 4DI3D 1A54A 3CRBA 5T3JA 2AL5A 4BLAA 3BFTA 1IMFA 4ZDMA 3EKIA 4KXPA 4U1ZA 3PV0E 5ICTA 1JW5A 4PAIA 3KBZA 4FJPA 5DW8A 1NI9A 2B65A 3PUYE 1GTKA 1H76A 4MHFA 4F31B 5CBRA 4ZZAA 2BJJX 3EF7A 1NUWA 3MUQA 3UK4A 4DLDA 5I84A 4H8IA 1LBYA 4P8BA 2XXYA 2JJKA 1MXWA 1VFDA 5F24A 1LAHE 2NOOA 4N17A 1M5BA 1P1UA 3BKIB 3VLVA 2UYFA 4YB7A 4P0GA 1WVJA 4GBVA 4LUBA 4PQJA 3E3KA 4U21A 4BDQA 1SD3A 4X9TA 4P3LA 3BBRA 3Q28A 3A09A 3IK6B 1O64A 4KYSA 4E0XA 2OJTA 3T96B 4G8HA 2PMSA 3TTNA 3CG1A 5EQ9A 4N6PA 2M8CA 1FBDA 2RC7A 3CSGA 4GFRA 4X1DA 4HE0A 1MQHA 4ELRA 3MQ9A 2XD2A 3TODA 4EQ7A 1OLAA 4TOZA 4WKMA 1TT1A 1I6AA 1H43A 1BLFA 4PE5B 2Z22A 1O63A 3IB1A 4F3PA 2F6PA 4ECFA 4EDPA 3K01A 4JWOA 4F3SA 3FJGA 3Q25A 5ET7A 1QVSA 3IFAA 5AA4B 4QFNA 1SW2A 2ZMBA 4LZ8A 1Q35A 3U94A 4FIMA 4ISUA 1IMBA 4JWYA 1FBCA 4F19A 2BJIA 2DP8A 4G61A 5IZZA 2FIXA 2DOJA 1YAEA 2QVVA 2ESNA 1DPPA 3N5LA 2X7QA 4OHNA 2HEUA 2H9BA 1B2HA 4N6KA 4JBZA 3HHFA 1SYHA 5IAIA 3KC1A 1B52A 2A5TB 1MS7A 4IO7A 1US4A 3G3IA 1JETA 3MP8A 4WXJA 1FPLA 4WEDA 4F1YA 2PT2A 3C4MA 1XOCA 3HO7A 2Q8MA 2F6GA 4MFIA 5EQ7A 2V3QA 4GQOA 3H06B 4BDNA 5AA4A 1B4HA 3VXBA 3S4UA 3CIJA 3VV5A 3TZAA 2Q2CA 2DWAA 2P1SA 1M5DA 4GX4A 3PUZE 3FXBA 1FPIA 1IMAA 1AH5A 1R6ZA 4OMBA 3IAZA 1EZOA 4HCWA 3P7IA 1P1NA 1FJ6A 3E79A 3IFCA 2B3BA 4LONB 2Z8DA 4MCOA 3FJMA 3QMFA 4OYVA 4OEVA 3CFXA 1ZIUA 4Q30B 1H3DA 3EN3A 2F78A 1INPA 1ZKBA 1UQWA 4GLIA 1B3GA 4DE8A 5I56A 2O1MA 1USYE 3U92A 3SESA 4O3BA 3CFZA 4PFRA 1FQCA 2P3VA 4MNPA 4ZECA 1I6BA 5CMBA 2HPGA 1R9LA 4PDHA 4OFOA 2QRYA 3CVGA 3G3JA 3MVXA 3KEIA 4R75A 4F1VA 3GXAA 3LR1A 5IZ3A 2RINA 5AA1A 3KSJA 5M2VA 2QS1A 3D4CA 4OETA 1B3LA 3PMWA 4MEVA 4X48A 3SEUA 2GHBA 3T0JA 3FVKA 4K3FA 2R9JA 3TKDA 1UIUA 4OVSA 1HSEA 3EQ1A 4GRKA 3FZVA 1VE4A 2ZZWA 2HXWA 4HE1A 4NF6B 3C32A 3QXMA 3SETA 3ZSFA 1FQBA 1RYOA 2O51A 3OELA 3VLWA 3IOUA 1NV0A 2UYEA 2ZZXA 1TXFA 1B5JA 1B46A 2VHAA 4DZ1A 5TPAA 2XHDA 1IXHA 3TQWA 3U1OA 5AA2A 2XXUA 1RDZA 5IZ3B 3RUMA 1N3XA 2V84A 3IX1A 1MY3A 2DVZA 2YLNA 2Y7RA 1WDNA 3G7WA 4IO5A 4G68B 4GIZA 4F3BA 4PETA 1SYIA 3IOWA 3F11A 4IO3A 4EXLA 1G0IA 5AE4A 2XXPA 4FEDA 3O2AA 5J16A 1JNFA 4O3AA 4R6KA 1MY4A 4N15A 3LSWA 4OWDA 2I4BA 2ONRA 1NV3A 4IY5A 1Z7NE 4QHQA 2ALUA 5ISUA 4GWXA 5BWJA 4NF4A 3N94A 4QFLA 3E13X 2MKZA 3QSLA 5LOMA 1ATGA 4NWDA 3SZPA 3W15C 4LZ5A 2WBBA 4JXIA 4DXBA 3KOTA 3HHGA 4PFYA 1MXZA 4AS5A 4QFKA 3TCGA 1FQAA 1NV4A 1Q9DA 2FNCA 1LAGE 3S2VA 3K00A 4MJOA 5A5LA 3TYHA 4NG7A 3L6HA 2PX1A 4GX6A 4ZEBA 1Q1KA 4F3GA 3MWBA 1B3EA 5H8HA 1J1NA 5L9MA 2XXQA 1MPBA 3OOAA 1B7UA 3O6HA 1MXXA 2Z23A 2LAOA 5KCJA 4NF8B 2OWSA 1CE2A 1SDXA 2XWVA 3QYTA 2DE3A 1FW0A 3B6TA 4P1EA 2PVUA 1FTOA 5TPAB 4JB7A 5I57A 1Y1ZA 1MY2A 4P56A 1GV8A 2UVIA 1QKBA 4UABA 3KG2A 4XXUA 1LB9A 1EYIA 5DVJA 5CM6A 1UTHA 5A5XB 1GGGA 4U1OA 1HSJA 4G68A 4PDDA 2F5XA 3MVZA 1AIVA 3CHGA 2RCBA 1UTBB 4PAKA 4Q5TA 4POXA 3QIMA 4O3CA 1BTJA 3KBRA 4OVPA 5EYGA 1LBXA 1USYH 3UIFA 2NWJA 2Y7PA 4H1XA 1NUZA 4MLQA 4QSDA 3FBPA 2VPNA 3A3UA 3SEXA 2OZZA 1Y20A 3MZ1A 3QUJA 4NWCA 4NAPA 3B6WA 1RKMA 3CR9A 3KOSA 1B7ZA 4XF5A 3PD9A 4NF4B 3SEVA 4ND9A 4X8RA 4TLMB 1GR2A 3TTRA 4PTKA 4LQ5A 1MY0A 3G3HA 1MXYA 1XVYA 2PBWA 1FCKA 1IEJA 5FHNA 3TFLA 2F3DA 4PGPA 2VD3A 5FTHA 2VPOA 3K6VA 4YKPA 1YXIA 2F8DA 4F2OA 3VLUA 4U4SA 2XWOA 1MM6A 3G3GA 3JYRA 1IMCA 1MQDA 3GZGA 3RPWA 1FQDA 5FHMA 4I3YA 1EYKA 2O68A 3HFUA 4ZE9A 3GBAA 2P2AA 2OBGA 4LATA 3K6XA 1RDYA 1P1OA 2V93A 4POWA 4FORA 3TCFA 3K0VA 2E0SA 3O9PA 2I58A 1TFDA 3DP8A 4GL0A 5CMKA 2HCAA 4GL8A 4NE4A 4OESA 5TU0A 3IOVA 4KPTA 2ONKE 3T93B 2OK2A 4FECA 2VP1A 3Q26A 1Y4TA 1NKXA 4JSDA 4G2ZA 1BK4A 1B5IA 3RGYA 1T0KA 2HFBA 4EF1A 5L9SA 2ZYOA 1XS5A 1JQFA 3MW0A 3UGWA 5EHSA 1D9YA 1IXGA 1Z7ME 4EQBA 1OIBA 3FGSA 1IMDA 1URDA 5FBPA 1IUDA 4QRZA 1JVYA 2OLBA 4TQUQ 1HSLA 2HQ0A 1AOVA 2VT5A 1FPEA 3B7DA 3M8UA 4G4PA 4NN3A 2PFZA 1FTAA 3VE1B 1UIVA 4PE3A 1ZBMA 2QVRA 3RLFE 4IGRA 5LDZA 4MMPA 3RY3A 4PF6A 1OMPA 4H65A 1B32A 1URGA 2HZLA 1CB6A 1KZ8A 1FPBA 2Y5LA 3FV1A 3KJ7A 4YZZA 3IB0A 2DXRA 4IGTA 4HTGA 4RA1A
chains in the Genus database with same CATH topology
2QS2A 2KLFA 2DVCA 2H25A 1LBWA 4UACA 4MAGA 1VR5A 1H45A 2QJEA 1B6HA 4XKQA 3RTWB 2DXYA 2ZNSA 3H3GA 5I3SA 4RY1A 1KA1A 3TUSA 2ZYKA 4ZZEA 1POY1 4MF3A 3WAEA 4P47A 3GLBA 2V3TA 5CMCA 3E78A 5TP9A 3HSTA 4PBHA 3PUWE 4EXKA 4H8JA 3ZKKA 3JZJA 1D9VA 3MZBA 3USDA 2V4CA 1YPNA 4YB6A 2QFLA 5EQ8A 1B40A 1LCFA 3A3CA 2AYSA 3PPPA 3S9LC 4NX1A 4P11A 3VDFA 4F1UA 4GXAA 1ELJA 1FPDA 2DS9A 4PFBA 3PMVA 4PP0A 5DTBA 4IR8A 2PT1A 3KN7A 2CZKA 1LBCA 4PC9A 1DBZA 3IJOB 3I6VA 2IA4A 2Z8FA 3FV2A 4M1VA 5ET8A 3IOTA 1ANFA 1NH7A 4NTLA 4LQ2A 4XFEA 2FYIA 4RPNA 2ZYMA 5IM2A 2PFYA 4NF0A 4ZEFA 4U23A 4YAHX 4E0WA 2R8TA 1R1NA 1OVTA 2ZZVA 3VXCA 2A5SA 2FIEA 5AA3A 1NNPA 3FVNA 3FVOA 4GVOA 1EH3A 5I2KB 1B0LA 1OQHA 4GBWA 3FJ7A 4FBPA 1XVXA 2F97A 1NMUA 2X26A 4GWWA 4KYDA 3H03A 3KFMA 2G29A 1IXIA 3OO7A 5H8FA 5DEXA 1YYZA 4KCCA 4KFQA 3LSFB 3K6UA 2AL4A 1SVXB 3BFUA 1EZPA 1K9ZA 5HM4B 1BKAA 1MQJA 5KZTA 3O6GA 3SKPA 3SDFA 4OVJA 1UTHB 3TDJA 4PFIA 2H98A 3FVGA 4YB5A 2Y7IA 3PPNA 2I4CA 3LSLA 1L5TA 1YZ0A 3KSXA 2E1SA 2QMWA 3O97A 1O7TA 3R7XA 1EYJA 2VGQA 4GWYA 1YTVA 3MVWA 3K4UA 5H8QA 1FRPA 3T9VA 4RJZA 5JTYA 2VOZA 5DVIA 1FBPA 1D9QA 2X7PA 3OEMA 2Q74A 4R2BA 4I1DA 3FUZA 4I9DA 4OERA 4GWUA 2D5WA 1ZMGA 2KQZA 3MJNA 2F3BA 1MQIA 2ZNUA 4AQ4A 4MH5A 1A8FA 4OA4A 2G93A 5ELVA 4QBAA 1XT8A 4PBQA 3LSXA 5I5PA 2O84X 2ONSA 4ESXA 1FBHA 1MH3A 4KHZE 1FJ9A 2ABHA 3RT6B 5LTCA 2VD2A 2KR0A 4MNCA 3MYUA 5EHMA 1FQFA 1QKAA 3IB2A 1DOTA 4IB2A 1YCJA 1H44A 5FTIA 4NF6A 2UXAA 4H46A 4MNIA 4XKRA 1PB7A 2XXRA 2PCRA 3S9EA 1B51A 4F39A 4KCDA 3T22A 1B9JA 4H6DA 3OMBA 1Y3QA 4PF8A 5JK4A 2Y7WA 3C34A 5FHOA 1B1HA 1LBZA 1LFGA 1Y3PA 2ZNTA 1FQEA 1II5A 3PUXE 1OVBA 3MP6A 3TPAA 4OANA 1ZLQA 1XHYA 2NVUB 2D21A 3KGCA 1FTJA 1AWBA 3CSBA 3TAJA 3TCHA 5CRYA 1IQ7A 3HCQA 5I2KA 3K6WA 2GHAA 3OSRA 4JWXA 5H8QB 4QFOA 3LC8A 1SW1A 3ONMA 3B50A 4OFJA 1F9BA 2RF1A 4R73A 4RK9A 1FTLA 3KN3A 3QAXA 1LEVA 4DCYA 4N4UA 4BDMA 1DTZA 4HW8A 1QJMA 4N07A 2GFEA 3W9VA 3B6QA 1A99A 2THIA 4GWOA 3TTKA 4QFPA 3Q29A 3IL1B 4O94A 4P0IA 3BIHA 3TTLA 4Q0CA 1MQGA 1UTBA 1NUYA 1LAXA 3LV0A 4MX6A 4Z7EA 4FEBA 3PUVE 1FPFA 2B4LA 2F35A 2OCUA 4QSCA 3H6WA 1N7WA 4JDFA 3VVFA 4OVQA 2FVZA 1N0TA 4O7MA 4BDLA 5I56B 2QPQA 1IIWA 4OQOA 1PDAA 1NNKA 3PTYA 5H8HB 4EUOA 1P1QA 2F34A 5I2NA 4G8NA 1A7LA 4I8CA 1LB8A 1R9QA 4ZEDA 4AS4A 3N6TA 1RYXA 4OFLA 3T9XB 4QXDA 3V8XB 4HE2A 1FBEA 1NNFA 3DP4A 1SI0A 1CNQA 3TQLA 3MBPA 1Y3NA 4GWZA 4DCXA 1B05A 3SERA 4G8MA 2RKMA 1IZ1A 5CI5A 4ZS9A 1KWHA 3T9HB 4IO2A 2CEXA 3FASA 2B3FA 1PB9A 4EQ9A 4PFTA 1FTMA 4PCDA 1QW0A 3FXRA 4H45A 3TTMA 5IZ1A 1S7YA 1PEBA 4ONYA 4NGUA 1VDWA 1FPGA 5ESYA 1SPIA 1OQGA 1A40A 1SW4A 4G77A 3MPKA 3ROJA 3JV9A 1MRPA 4R74A 3ODBA 2RC8A 4PFWA 1MH4A 3T66A 3HV1A 4ESWA 1SI1A 1OLCA 4QSEA 3ILTB 4R6HA 4FATA 2O7UA 4DI4B 4BDRA 1EZ9A 3MZ9A 2I48A 3RN8A 4ELQA 3G3KA 4XEQA 1KA0A 5DT6A 3T1BA 3N26A 1DCUA 3DLNA 1N84A 4RK2A 1MXUA 2OX3A 5L8DA 4IO6A 1LCTA 4JVIA 4DDDA 3G3FA 4R9FA 1MY1A 4U22A 1A8EA 1JVXA 1LSTA 3GBBA 1ZTYA 1DTGA 5EQAA 2F7BA 3WAFA 1NV2A 2XWKA 3ISPA 4X04A 4YMBA 4LN5A 4RXLA 2QL3A 3ECRA 2Y5KA 3MAMA 5B70A 1FPKA 2QS4A 4JSOA 1B7HA 2FHYA 4R6YA 1JP4A 5AA2D 2R6GE 5ICQA 3QUFA 2WYPA 2RC9A 3NOHA 3PPQA 3OD7A 2WKYA 4PFUA 4N13A 2DDKA 1N3WA 2IEEA 2Q9TA 2ZXTA 2HZKA 1QULA 2FA7A 1B0HA 3EHSA 1MG1A 5CBSA 3TMGA 4F18A 1N76A 3U93A 2Y84A 3U8QA 1NV7A 3KN8A 2Q2AA 5I7IA 1B1XA 2ZYNA 1QUKA 2I49A 3N6UA 3UORA 2CMOA 1ZJLA 2QSXA 4HCYA 1LLSA 4H0WA 1LAFE 4BDOA 3B8BA 4ZEKA 2RCAA 2WX9A 3H4ZA 4FE8A 2O69A 3MVYA 1B3FA 1URSA 1JW4A 5J1DA 1FPJA 3HN0A 2XXIA 5TP9B 3VVEA 3EHUA 5CMMA 1NH8A 1P99A 3S9NC 2OWZA 1WODA 4NEDA 2REJA 3SEYA 1NV6A 3UP9A 1Y9UA 1IITA 1B3HA 4GXSB 1XC1A 2Q8JA 1MXVA 1JW1A 3W9WA 1PBQA 1ZU0A 3D1RA 2O1LA 3FIRA 4RPOA 1FTKA 4GD5A 4GX3A 5ET6A 4OZ9A 4P1LA 3EPEA 4H5FA 5I58B 4FAJA 4F22A 3HPIA 3U65A 4M4GA 3OSQA 2DE2A 4L17A 2O6AA 5ITOA 3E4RA 2H99A 4DXUA 1SBPA 5EYFA 3RTFB 5DYHA 4U4XA 4HXVA 5B7DA 3CG3A 1G0HA 2DYXA 2PYYA 4Z0IA 4O7IA 3VFJA 4OXVA 2B4MA 2WBDA 4LA9A 3AXFA 1PC3A 1S50A 4RNSA 4OTEA 3TEPA 2QS3A 4C0RA 5L9OA 4MBPA 3DM0A 1RDXA 3PMXA 1LGBC 1MPCA 2Q88A 5I2NB 1US5A 5DEXB 4KI0E 3OEKA 5I58A 1Y1MA 3PU5A 3C31A 5A5XA 3I3VA 3V5AA 1IMEA 1FSAA 3H6UA 4HS7A 4LVQA 1M5CA 4R2FA 1A55A 1N04A 4XIGQ 1TWYA 1GVCA 3H6VA 2DE4A 3ZKLA 4AB5A 2I0BA 3TELA 1QUJA 1BP5A 4TLLB 4XKPA 3H7MA 4KR5A 4GWSA 3CFLA 4JVCA 1PB8A 1JEVA 1Y4CA 1SW5A 1MM7A 2H4IA 3RT8A 2XXXA 3CI8A 1JEUA 3R26A 4NF5B 2DWJA 1DMBA 3K1NA 1K9YA 1I69A 4R72A 5F7VA 2UVJA 5ITPA 2F36A 4PAFA 4LP2B 4DIGA 2Q89A 3M3LA 4UA8A 5H8NA 4THIA 2NUVA 3EHTA 3C33A 4KD5A 2ANJA 1EU8A 4F29A 5I57B 1AMFA 1BIYA 1D4NA 3E9XA 5KDTB 4Q8RA 1P1WA 1SQYA 1VSOA 2XXVA 4ZEIA 2HAVA 2OWTA 2GRVA 3BIGA 3LUZA 3L6GA 3S9MC 1AL3A 2HAUA 4MLVA 4KYEA 4YMAA 2DSFA 2DWHA 5BUUA 4GF8A 4F2QA 4N8YA 3M3KA 5K2YA 3T9UA 3K2DA 4OENA 2UVGA 3K1MA 1IXCA 2O7IA 4DXCA 2QMXA 2REGA 4MIJA 5CC2A 3FD3A 4N91A 4P9KA 5AA2B 3Q27A 1LBBA 3QK6A 3UA8A 4NF8A 4YKKA 1XI6A 1LFHA 1LBVA 4RYAA 2GH9A 5JTYB 4N81A 1VFEA 5F1QA 3I5OA 3C36A 3IO6A 3A29A 2XX9A 4YU0A 5KCJB 2DQVA 5DVFA 3V89B 3MP1A 1MPDA 2W7YA 2FBPA 4XKNA 5H8FB 3OO9A 2XD3A 2CZHA 4U2RA 1N7XA 3MC2A 1NNTA 4H67A 2XXWA 2Y7KA 2I0CA 3MSTA 4XTCQ 2I6EA 3MPLA 2XXTA 2XXHA 4NF5A 3O6IA 1TFAA 1NV1A 3V83A 2WYKA 1NUXA 3O66A 1FBGA 3RNNA 3K1PA 3PD8A 1LFIA 3VVDA 5H8NB 5KDTA 4R9GA 3FXQA 2XA5A 2V25A 1D3KA 2CZLA 3D4GA 4IY6A 3OXNA 4NQ8A 3O28A 3K02A 3O29A 4GOTA 3ILUB 3FATA 1M5FA 3THIA 3PPRA 3KJTA 2XXKA 4N6DA 3OENA 3H6TA 2YJPA 2HHMA 4I3EA 5IKBA 4N8GA 2A5TA 2V3UA 5I59B 2XWIA 4WEPA 2L5VA 2F7AA 3IR1A 1NV5A 3R6UA 4LZ7A 5K2XA 4YKJA 2CEYA 4NMYA 2QVUA 4OVTA 1NFTA 3PPOA 4I62A 4PGNA 1NL5A 2CZIA 1MDP1 3KC0A 3DELB 1DSNA 1B4ZA 5HPQA 4O8MA 4YICA 3PGFA 4KQPA 4OEUA 3SEWA 1MDQA 1FBFA 2AIXA 4C1TA 2HXRA 3LBSA 3FXUA 2GQ1A 2UVHA 2H5YA 3RPLA 4JVDA 2XX7A 1DPEA 3ZS6A 2P3NA 4EF2A 3IO4A 1S9TA 5IGAA 4X1BA 4AB6A 3C9HA 1QGXA 1DK4A 2F7CA 4YKIA 1I6QA 2I3WA 4H5GA 2Z8EA 2D3IA 5EYHA 3KZGA 3LUYA 4ZE8A 3GYYA 2I3VA 5HBCA 3C35A 1M5EA 1POTA 4C1UA 4ELOA 5JEIA 4QF9A 2NXOA 3U72A 4NHBA 2R71A 3IJXB 2P0SA 3DP6A 3OO6A 2DWIA 1B58A 4G68C 3IORA 1B5HA 3RPLB 4IO4A 2WEFA 3RQTA 5H8SA 3RYDA 4ELPA 2XX8A 4I40A 4OVRA 1PBPA 3UN6A 2YPNA 5ET5A 1QUIA 5I59A 3M3FA 3OO8A 4DI3D 1A54A 3CRBA 5T3JA 2AL5A 4BLAA 3BFTA 1IMFA 4ZDMA 3EKIA 4KXPA 4U1ZA 3PV0E 5ICTA 1JW5A 4PAIA 4FJPA 3KBZA 5DW8A 1NI9A 2B65A 3PUYE 1GTKA 1H76A 4MHFA 4F31B 5CBRA 4ZZAA 2BJJX 3EF7A 1NUWA 3MUQA 3UK4A 4DLDA 5I84A 4H8IA 1LBYA 4P8BA 2XXYA 2JJKA 1MXWA 1VFDA 5F24A 1LAHE 2NOOA 4N17A 1M5BA 1P1UA 3BKIB 3VLVA 2UYFA 4YB7A 4P0GA 1WVJA 4GBVA 4LUBA 4PQJA 3E3KA 4U21A 4BDQA 1SD3A 4X9TA 4P3LA 3BBRA 3Q28A 3A09A 3IK6B 1O64A 4KYSA 4E0XA 2OJTA 3T96B 4G8HA 2PMSA 3TTNA 3CG1A 5EQ9A 4N6PA 2M8CA 2RC7A 4GFRA 3CSGA 1FBDA 4X1DA 4HE0A 1MQHA 4ELRA 3MQ9A 2XD2A 3TODA 4EQ7A 1OLAA 4TOZA 4WKMA 1TT1A 1I6AA 1H43A 1BLFA 4PE5B 2Z22A 1O63A 3IB1A 4F3PA 2F6PA 4ECFA 4EDPA 3K01A 4JWOA 4F3SA 3FJGA 3Q25A 5ET7A 1QVSA 3IFAA 5AA4B 4QFNA 1SW2A 2ZMBA 4LZ8A 1Q35A 3U94A 4FIMA 4ISUA 1IMBA 4JWYA 1FBCA 4F19A 2BJIA 2DP8A 4G61A 5IZZA 2FIXA 2DOJA 1YAEA 2QVVA 2ESNA 1DPPA 3N5LA 2X7QA 4OHNA 2HEUA 2H9BA 1B2HA 4N6KA 4JBZA 3HHFA 1SYHA 5IAIA 3KC1A 1B52A 2A5TB 1MS7A 4IO7A 1US4A 3G3IA 1JETA 3MP8A 4WXJA 1FPLA 4WEDA 4F1YA 2PT2A 3C4MA 1XOCA 3HO7A 2Q8MA 2F6GA 4MFIA 5EQ7A 2V3QA 4GQOA 3H06B 4BDNA 5AA4A 1B4HA 3VXBA 3S4UA 3CIJA 3VV5A 3TZAA 2Q2CA 2DWAA 2P1SA 1M5DA 4GX4A 3PUZE 3FXBA 1FPIA 1IMAA 1AH5A 1R6ZA 4OMBA 3IAZA 1EZOA 4HCWA 3P7IA 1P1NA 1FJ6A 3E79A 3IFCA 2B3BA 4LONB 2Z8DA 3FJMA 4MCOA 4OYVA 3QMFA 4OEVA 3CFXA 1ZIUA 4Q30B 1H3DA 3EN3A 2F78A 1INPA 1ZKBA 1UQWA 4GLIA 1B3GA 4DE8A 5I56A 2O1MA 1USYE 3U92A 3SESA 4O3BA 3CFZA 4PFRA 1FQCA 2P3VA 4ZECA 4MNPA 1I6BA 5CMBA 2HPGA 1R9LA 4PDHA 4OFOA 2QRYA 3CVGA 3G3JA 3MVXA 3KEIA 4R75A 4F1VA 3GXAA 3LR1A 5IZ3A 2RINA 5AA1A 3KSJA 5M2VA 2QS1A 3D4CA 4OETA 1B3LA 3PMWA 4MEVA 4X48A 3SEUA 2GHBA 3T0JA 3FVKA 4K3FA 2R9JA 3TKDA 1UIUA 4OVSA 1HSEA 3EQ1A 4GRKA 3FZVA 1VE4A 2ZZWA 2HXWA 4HE1A 4NF6B 3C32A 3QXMA 3SETA 3ZSFA 1FQBA 1RYOA 2O51A 3OELA 3VLWA 3IOUA 1NV0A 2UYEA 2ZZXA 1TXFA 1B5JA 1B46A 2VHAA 4DZ1A 5TPAA 2XHDA 1IXHA 3TQWA 3U1OA 5AA2A 2XXUA 1RDZA 5IZ3B 3RUMA 1N3XA 2V84A 3IX1A 1MY3A 2DVZA 2YLNA 2Y7RA 1WDNA 3G7WA 4IO5A 4G68B 4GIZA 4F3BA 4PETA 1SYIA 3IOWA 3F11A 4IO3A 4EXLA 1G0IA 5AE4A 2XXPA 4FEDA 3O2AA 5J16A 1JNFA 4O3AA 4R6KA 1MY4A 4N15A 3LSWA 4OWDA 2I4BA 2ONRA 1NV3A 4IY5A 1Z7NE 4QHQA 2ALUA 5ISUA 4GWXA 5BWJA 4NF4A 3N94A 4QFLA 3E13X 2MKZA 3QSLA 5LOMA 1ATGA 4NWDA 3SZPA 3W15C 4LZ5A 2WBBA 4JXIA 4DXBA 3KOTA 3HHGA 4PFYA 1MXZA 4AS5A 4QFKA 3TCGA 1FQAA 1NV4A 1Q9DA 2FNCA 1LAGE 3S2VA 3K00A 4MJOA 5A5LA 3TYHA 4NG7A 3L6HA 2PX1A 4GX6A 4ZEBA 1Q1KA 4F3GA 3MWBA 1B3EA 5H8HA 1J1NA 5L9MA 2XXQA 1MPBA 3OOAA 1B7UA 3O6HA 1MXXA 2Z23A 2LAOA 5KCJA 4NF8B 2OWSA 1CE2A 1SDXA 2XWVA 3QYTA 2DE3A 1FW0A 3B6TA 4P1EA 2PVUA 1FTOA 5TPAB 4JB7A 5I57A 1Y1ZA 1MY2A 4P56A 1GV8A 2UVIA 1QKBA 4UABA 3KG2A 4XXUA 1LB9A 1EYIA 5DVJA 5CM6A 1UTHA 5A5XB 1GGGA 4U1OA 1HSJA 4G68A 4PDDA 2F5XA 3MVZA 1AIVA 3CHGA 2RCBA 1UTBB 4PAKA 4Q5TA 4POXA 3QIMA 4O3CA 1BTJA 3KBRA 4OVPA 5EYGA 1LBXA 1USYH 3UIFA 2NWJA 2Y7PA 4H1XA 1NUZA 4MLQA 4QSDA 3FBPA 3A3UA 2VPNA 3SEXA 2OZZA 1Y20A 3MZ1A 3QUJA 4NWCA 4NAPA 3B6WA 1RKMA 3CR9A 3KOSA 1B7ZA 4XF5A 3PD9A 4NF4B 3SEVA 4ND9A 4X8RA 4TLMB 1GR2A 3TTRA 4PTKA 4LQ5A 1MY0A 3G3HA 1MXYA 1XVYA 2PBWA 1FCKA 1IEJA 5FHNA 3TFLA 2F3DA 4PGPA 2VD3A 5FTHA 3K6VA 2VPOA 4YKPA 1YXIA 2F8DA 4F2OA 3VLUA 4U4SA 2XWOA 1MM6A 3G3GA 3JYRA 1IMCA 1MQDA 3GZGA 3RPWA 1FQDA 5FHMA 4I3YA 2O68A 1EYKA 3HFUA 4ZE9A 3GBAA 2P2AA 2OBGA 4LATA 3K6XA 1RDYA 1P1OA 2V93A 4POWA 4FORA 3TCFA 3K0VA 2E0SA 5CMKA 2I58A 1TFDA 3DP8A 3O9PA 4GL0A 2HCAA 4GL8A 4NE4A 4OESA 5TU0A 3IOVA 4KPTA 2ONKE 3T93B 2OK2A 4FECA 2VP1A 3Q26A 1Y4TA 1NKXA 4JSDA 4G2ZA 1BK4A 1B5IA 3RGYA 1T0KA 2HFBA 4EF1A 5L9SA 2ZYOA 1XS5A 1JQFA 3MW0A 3UGWA 5EHSA 1D9YA 1IXGA 1Z7ME 4EQBA 1OIBA 3FGSA 1IMDA 1URDA 5FBPA 1IUDA 4QRZA 1JVYA 2OLBA 4TQUQ 1HSLA 2HQ0A 1AOVA 2VT5A 1FPEA 3B7DA 3M8UA 4G4PA 4NN3A 2PFZA 1FTAA 3VE1B 1UIVA 4PE3A 1ZBMA 2QVRA 3RLFE 4IGRA 5LDZA 4MMPA 3RY3A 4PF6A 1OMPA 4H65A 1B32A 1URGA 2HZLA 1CB6A 1KZ8A 1FPBA 2Y5LA 3FV1A 3KJ7A 4YZZA 3IB0A 2DXRA 4IGTA 4HTGA 4RA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKB A;  3TTM A;  3SER A;  1UQW A;  2QS2 A;  4GLI A;  4XKN A;  2KLF A;  2DVC A;  1S7Y A;  2H25 A;  1PEB A;  3OO9 A;  5H8F B;  1B3G A;  4ONY A;  4UAC A;  2XD3 A;  4DE8 A;  5I56 A;  1OQG A;  2O1M A;  1USY E;  1A40 A;  1VR5 A;  4U2R A;  1SW4 A;  1H45 A;  4G77 A;  3MPK A;  1N7X A;  3U92 A;  3MC2 A;  2QJE A;  3SES A;  3JV9 A;  1MRP A;  1NNT A;  4H67 A;  1B6H A;  4R74 A;  4O3B A;  4XKQ A;  3RTW B;  3CFZ A;  2DXY A;  2ZNS A;  1FQC A;  3ODB A;  2RC8 A;  2XXW A;  4PFW A;  4ZEC A;  1I6B A;  1MH4 A;  3H3G A;  3T66 A;  4RY1 A;  3HV1 A;  5CMB A;  4ESW A;  2Y7K A;  1SI1 A;  1R9L A;  2I0C A;  1OLC A;  2ZYK A;  4QSE A;  4OFO A;  3ILT B;  2QRY A;  4XTC Q;  4ZZE A;  4R6H A;  4FAT A;  2I6E A;  3MPL A;  2XXT A;  3CVG A;  2O7U A;  1POY 1;  2XXH A;  4MF3 A;  3WAE A;  4NF5 A;  3O6I A;  4BDR A;  1TFA A;  3GLB A;  2V3T A;  3V83 A;  3G3J A;  3MVX A;  3KEI A;  1EZ9 A;  3MZ9 A;  2I48 A;  4R75 A;  5CMC A;  3O66 A;  3RN8 A;  4ELQ A;  4F1V A;  3RNN A;  3G3K A;  3GXA A;  5TP9 A;  3LR1 A;  3K1P A;  3HST A;  3PD8 A;  3PUW E;  2RIN A;  4EXK A;  5AA1 A;  1LFI A;  3KSJ A;  3VVD A;  5M2V A;  2QS1 A;  3D4C A;  5DT6 A;  5H8N B;  5KDT A;  4H8J A;  4OET A;  3FXQ A;  4R9G A;  3ZKK A;  1B3L A;  3N26 A;  3JZJ A;  3DLN A;  3PMW A;  2V25 A;  1D3K A;  1N84 A;  1D9V A;  4X48 A;  3MZB A;  3SEU A;  3USD A;  4RK2 A;  1MXU A;  2GHB A;  2CZL A;  3D4G A;  3FVK A;  4IY6 A;  4K3F A;  5L8D A;  2R9J A;  1YPN A;  4YB6 A;  1UIU A;  3TKD A;  3OXN A;  1B40 A;  1LCF A;  1LCT A;  3A3C A;  3O28 A;  4IO6 A;  2AYS A;  3K02 A;  1HSE A;  3EQ1 A;  3PPP A;  4GRK A;  3G3F A;  4P11 A;  3FZV A;  4DDD A;  3S9L C;  1VE4 A;  4R9F A;  3VDF A;  1MY1 A;  3O29 A;  4F1U A;  2HXW A;  4U22 A;  4GOT A;  3ILU B;  1A8E A;  4GXA A;  3FAT A;  1ELJ A;  1M5F A;  4NF6 B;  3C32 A;  3PPR A;  3THI A;  1JVX A;  2DS9 A;  3KJT A;  3QXM A;  3SET A;  1LST A;  3OEN A;  3ZSF A;  3GBB A;  1ZTY A;  1DTG A;  3H6T A;  3PMV A;  4PP0 A;  1FQB A;  5DTB A;  1RYO A;  2F7B A;  2YJP A;  3WAF A;  2O51 A;  3OEL A;  5IKB A;  4YMB A;  2PT1 A;  3KN7 A;  1LBC A;  3IOU A;  3VLW A;  2A5T A;  2V3U A;  4RXL A;  2QL3 A;  2UYE A;  3ECR A;  5I59 B;  3MAM A;  4WEP A;  3IJO B;  5B70 A;  2QS4 A;  2F7A A;  3I6V A;  1TXF A;  1B5J A;  2IA4 A;  1B46 A;  2VHA A;  3IR1 A;  2Z8F A;  4DZ1 A;  5TPA A;  4JSO A;  1B7H A;  3FV2 A;  4M1V A;  3R6U A;  4R6Y A;  2XHD A;  1IXH A;  1ANF A;  3IOT A;  1NH7 A;  4LZ7 A;  3TQW A;  4NTL A;  5K2X A;  3U1O A;  4YKJ A;  2R6G E;  5AA2 A;  4LQ2 A;  5AA2 D;  2XXU A;  5ICQ A;  3QUF A;  4NMY A;  2RC9 A;  2FYI A;  3PPQ A;  1NFT A;  3RUM A;  1N3X A;  3PPO A;  4RPN A;  2ZYM A;  3OD7 A;  2WKY A;  2V84 A;  3IX1 A;  4I62 A;  4N13 A;  4PFU A;  1MY3 A;  2DVZ A;  2YLN A;  2Y7R A;  4ZEF A;  1N3W A;  1NL5 A;  1WDN A;  1MDP 1;  4RA1 A;  4U23 A;  3G7W A;  1R1N A;  3DEL B;  4IO5 A;  1DSN A;  4E0W A;  1B4Z A;  2IEE A;  2Q9T A;  1OVT A;  4G68 B;  4GIZ A;  2ZXT A;  4F3B A;  4PET A;  5HPQ A;  1SYI A;  2HZK A;  3VXC A;  2A5S A;  3PGF A;  4KQP A;  4YIC A;  1QUL A;  3IOW A;  4OEU A;  3F11 A;  3SEW A;  1MDQ A;  4IO3 A;  4EXL A;  2FA7 A;  1B0H A;  5AA3 A;  1NNP A;  3FVN A;  2AIX A;  3EHS A;  1MG1 A;  3FVO A;  4GVO A;  1EH3 A;  5I2K B;  5AE4 A;  2XXP A;  4C1T A;  5CBS A;  4FED A;  3O2A A;  1B0L A;  3TMG A;  1OQH A;  4F18 A;  1JNF A;  1N76 A;  4O3A A;  3U93 A;  3FJ7 A;  4R6K A;  3LBS A;  3FXU A;  5CMK A;  1MY4 A;  3LSW A;  4OWD A;  2UVH A;  2H5Y A;  2I4B A;  1XVX A;  2F97 A;  2Y84 A;  2XX7 A;  2ONR A;  3U8Q A;  4IY5 A;  1DPE A;  1Z7N E;  3KN8 A;  2Q2A A;  3ZS6 A;  4QHQ A;  2ALU A;  1B1X A;  4EF2 A;  5ISU A;  3IO4 A;  2ZYN A;  1S9T A;  5BWJ A;  1QUK A;  2I49 A;  4X1B A;  1NMU A;  4AB6 A;  3C9H A;  3N6U A;  3UOR A;  2CMO A;  4NF4 A;  1ZJL A;  2X26 A;  3N94 A;  4QFL A;  2F7C A;  3H03 A;  2QSX A;  3E13 X;  4KYD A;  3QSL A;  3KFM A;  4HCY A;  4YKI A;  1I6Q A;  2G29 A;  5LOM A;  1LLS A;  2I3W A;  1IXI A;  4H0W A;  1LAF E;  1ATG A;  4BDO A;  3OO7 A;  4H5G A;  5H8F A;  2Z8E A;  4ZEK A;  2RCA A;  2D3I A;  4NWD A;  5DEX A;  3KZG A;  3W15 C;  3H4Z A;  4KCC A;  4FE8 A;  3LUY A;  4KFQ A;  4LZ5 A;  3LSF B;  4ZE8 A;  3K6U A;  2I3V A;  2O69 A;  3MVY A;  1B3F A;  5HBC A;  2AL4 A;  3C35 A;  1M5E A;  4JXI A;  1SVX B;  3BFU A;  1POT A;  1EZP A;  1URS A;  4DXB A;  1JW4 A;  4DIG A;  5J1D A;  5HM4 B;  1BKA A;  2XXI A;  3HN0 A;  5TP9 B;  1MQJ A;  3VVE A;  4C1U A;  3KOT A;  3EHU A;  5KZT A;  3HHG A;  4PFY A;  3O6G A;  3SKP A;  1MXZ A;  5CMM A;  1NH8 A;  3SDF A;  4ELO A;  1P99 A;  5JEI A;  4QF9 A;  3S9N C;  2NXO A;  4OVJ A;  1FQA A;  1UTH B;  4QFK A;  3TDJ A;  3TCG A;  3U72 A;  2H98 A;  2FNC A;  1LAG E;  3S2V A;  3K00 A;  3FVG A;  1WOD A;  4YB5 A;  2Y7I A;  3PPN A;  2I4C A;  3LSL A;  4NED A;  1L5T A;  3TYH A;  2R71 A;  3IJX B;  2P0S A;  3DP6 A;  3L6H A;  3OO6 A;  2PX1 A;  2DWI A;  1B58 A;  4G68 C;  4ZEB A;  2REJ A;  3IOR A;  3KSX A;  1B5H A;  2E1S A;  1Q1K A;  2QMW A;  3MWB A;  3SEY A;  4F3G A;  3O97 A;  1O7T A;  3R7X A;  2VGQ A;  1B3E A;  5H8H A;  4IO4 A;  1J1N A;  3RQT A;  3UP9 A;  1YTV A;  3MVW A;  1Y9U A;  1IIT A;  1B3H A;  3K4U A;  5H8Q A;  2XXQ A;  1MPB A;  3OOA A;  5H8S A;  5L9M A;  3T9V A;  4GXS B;  4ELP A;  2XX8 A;  4RJZ A;  5JTY A;  1XC1 A;  1PBP A;  3UN6 A;  2YPN A;  1QUI A;  1B7U A;  3O6H A;  2Q8J A;  1MXX A;  2VOZ A;  1MXV A;  5DVI A;  1JW1 A;  2LAO A;  2Z23 A;  3W9W A;  1PBQ A;  1ZU0 A;  4NF8 B;  5KCJ A;  2OWS A;  1CE2 A;  5I59 A;  3M3F A;  3OO8 A;  1SDX A;  3QYT A;  2O1L A;  2X7P A;  3OEM A;  1A54 A;  3CRB A;  2DE3 A;  1FW0 A;  3B6T A;  2AL5 A;  3FIR A;  4RPO A;  1FTK A;  4BLA A;  4R2B A;  4I1D A;  3BFT A;  4GD5 A;  4ZDM A;  3FUZ A;  2PVU A;  4I9D A;  1FTO A;  4U1Z A;  3PV0 E;  4JB7 A;  5TPA B;  4OER A;  1JW5 A;  4OZ9 A;  4FJP A;  5I57 A;  5ICT A;  2D5W A;  1Y1Z A;  1MY2 A;  3EPE A;  1GV8 A;  1ZMG A;  2UVI A;  4H5F A;  2B65 A;  3PUY E;  1GTK A;  1QKB A;  3MJN A;  1MQI A;  1H76 A;  5I58 B;  4FAJ A;  3KG2 A;  4XXU A;  1LB9 A;  4F22 A;  2ZNU A;  3HPI A;  5DVJ A;  4F31 B;  1UTH A;  5A5X B;  5CBR A;  5CM6 A;  4AQ4 A;  4MH5 A;  4M4G A;  3OSQ A;  4ZZA A;  2BJJ X;  2DE2 A;  4L17 A;  1GGG A;  2O6A A;  3EF7 A;  4U1O A;  1A8F A;  3E4R A;  2H99 A;  1HSJ A;  2G93 A;  4G68 A;  5ITO A;  4DXU A;  1SBP A;  3MUQ A;  5EYF A;  3UK4 A;  2F5X A;  3MVZ A;  5ELV A;  3RTF B;  4DLD A;  1AIV A;  5I84 A;  2RCB A;  1UTB B;  4H8I A;  5DYH A;  4U4X A;  1XT8 A;  2XXY A;  5B7D A;  4Q5T A;  3LSX A;  3QIM A;  4POX A;  3CG3 A;  1MXW A;  2DYX A;  2O84 X;  2ONS A;  4O3C A;  4ESX A;  2PYY A;  4Z0I A;  1VFD A;  1BTJ A;  1LAH E;  1MH3 A;  3KBR A;  2ABH A;  4KHZ E;  4OXV A;  2NOO A;  3RT6 B;  3VFJ A;  4LA9 A;  1USY H;  2VD2 A;  3AXF A;  3UIF A;  2NWJ A;  1M5B A;  1PC3 A;  1S50 A;  2Y7P A;  4RNS A;  5EHM A;  1FQF A;  1QKA A;  4OTE A;  4H1X A;  3TEP A;  1P1U A;  4MLQ A;  3IB2 A;  3BKI B;  3VLV A;  1DOT A;  2QS3 A;  2UYF A;  4YB7 A;  4P0G A;  1WVJ A;  4QSD A;  4IB2 A;  1YCJ A;  4C0R A;  3A3U A;  3SEX A;  4LUB A;  4PQJ A;  2OZZ A;  5L9O A;  4MBP A;  1Y20 A;  1H44 A;  3DM0 A;  3MZ1 A;  3QUJ A;  4NWC A;  3E3K A;  5FTI A;  3B6W A;  1RKM A;  3CR9 A;  3PMX A;  4U21 A;  4NF6 A;  1LGB C;  1MPC A;  2Q88 A;  5I2N B;  3TUS A;  4BDQ A;  1SD3 A;  3KOS A;  1US5 A;  4X9T A;  2UXA A;  3BBR A;  1B7Z A;  5DEX B;  3Q28 A;  3A09 A;  4KI0 E;  4XKR A;  3IK6 B;  3OEK A;  3PD9 A;  1PB7 A;  2XXR A;  4NF4 B;  1O64 A;  3S9E A;  1B51 A;  3SEV A;  4F39 A;  5I58 A;  4ND9 A;  4KCD A;  4TLM B;  1Y1M A;  3PU5 A;  3T22 A;  1GR2 A;  4KYS A;  4E0X A;  1B9J A;  3C31 A;  4H6D A;  3OMB A;  2OJT A;  3TTR A;  1Y3Q A;  3T96 B;  5A5X A;  4G8H A;  3I3V A;  2PMS A;  3TTN A;  5JK4 A;  3CG1 A;  4LQ5 A;  2Y7W A;  3V5A A;  3C34 A;  5FHO A;  4N6P A;  1MY0 A;  2M8C A;  2RC7 A;  3CSG A;  3G3H A;  4GFR A;  4X1D A;  1B1H A;  1MXY A;  1XVY A;  2PBW A;  3H6U A;  1FCK A;  4YAH X;  1MQH A;  1IEJ A;  5FHN A;  4HS7 A;  4LVQ A;  1M5C A;  3TFL A;  4ELR A;  1LFG A;  4R2F A;  1Y3P A;  1A55 A;  1N04 A;  4XIG Q;  1TWY A;  2ZNT A;  1FQE A;  2VD3 A;  1II5 A;  2XD2 A;  3H6V A;  3MQ9 A;  3PUX E;  1GVC A;  5FTH A;  1OVB A;  2DE4 A;  3K6V A;  3ZKL A;  4AB5 A;  2I0B A;  3TOD A;  4EQ7 A;  4YKP A;  3TEL A;  1QUJ A;  1BP5 A;  1OLA A;  3MP6 A;  3TPA A;  2F8D A;  1ZLQ A;  4F2O A;  1XHY A;  4TLL B;  4TOZ A;  4XKP A;  2NVU B;  3VLU A;  4WKM A;  1TT1 A;  3H7M A;  4KR5 A;  2D21 A;  3KGC A;  1I6A A;  1FTJ A;  4U4S A;  1H43 A;  3CSB A;  1BLF A;  3CFL A;  4PE5 B;  3TAJ A;  1MM6 A;  1PB8 A;  1JEV A;  1Y4C A;  1SW5 A;  1MM7 A;  2Z22 A;  1O63 A;  3G3G A;  2H4I A;  3IB1 A;  3JYR A;  3TCH A;  5CRY A;  1IQ7 A;  4F3P A;  1MQD A;  3GZG A;  3RPW A;  3RT8 A;  1FQD A;  2F6P A;  2XXX A;  5FHM A;  3CI8 A;  4ECF A;  3HCQ A;  1JEU A;  3R26 A;  4EDP A;  3K01 A;  4NF5 B;  2DWJ A;  4JWO A;  1DMB A;  3K1N A;  2O68 A;  4F3S A;  3FJG A;  3Q25 A;  5I2K A;  1I69 A;  3K6W A;  4R72 A;  4ZE9 A;  2GHA A;  3GBA A;  2P2A A;  2OBG A;  3OSR A;  4JWX A;  1QVS A;  4QFO A;  5H8Q B;  4LAT A;  2UVJ A;  5F7V A;  5AA4 B;  4QFN A;  2F36 A;  5ITP A;  3LC8 A;  1SW1 A;  4LP2 B;  3K6X A;  3ONM A;  4OFJ A;  1F9B A;  2RF1 A;  4R73 A;  2Q89 A;  3M3L A;  4RK9 A;  1P1O A;  1SW2 A;  2ZMB A;  4UA8 A;  4THI A;  4LZ8 A;  1FTL A;  5H8N A;  5AA2 B;  2NUV A;  2V93 A;  1Q35 A;  3C33 A;  3EHT A;  3KN3 A;  3QAX A;  4FIM A;  4FOR A;  4KD5 A;  4ISU A;  4POW A;  2ANJ A;  1EU8 A;  3TCF A;  4BDM A;  4DCY A;  4JWY A;  4F29 A;  1DTZ A;  4HW8 A;  5I57 B;  3K0V A;  2E0S A;  1AMF A;  2I58 A;  1TFD A;  1BIY A;  3DP8 A;  1D4N A;  2HCA A;  3O9P A;  4GL0 A;  4F19 A;  1QJM A;  2DP8 A;  3E9X A;  4N07 A;  4GL8 A;  4NE4 A;  4OES A;  5TU0 A;  2GFE A;  2DOJ A;  3W9V A;  3B6Q A;  5KDT B;  4Q8R A;  1A99 A;  2THI A;  3IOV A;  1YAE A;  4GWO A;  4KPT A;  3TTK A;  4QFP A;  2ONK E;  3T93 B;  2OK2 A;  4FEC A;  3U94 A;  2ESN A;  3Q29 A;  2VP1 A;  1DPP A;  1P1W A;  1SQY A;  1VSO A;  2X7Q A;  2XXV A;  1Y4T A;  3IL1 B;  1NKX A;  3N5L A;  3Q26 A;  4JSD A;  4OHN A;  4ZEI A;  4P0I A;  3TTL A;  4G2Z A;  4Q0C A;  2HAV A;  1MQG A;  2HEU A;  2OWT A;  2H9B A;  2GRV A;  1UTB A;  1LAX A;  1B2H A;  4Z7E A;  4JBZ A;  3HHF A;  1B5I A;  1SYH A;  1AL3 A;  3L6G A;  3RGY A;  3S9M C;  2HFB A;  2HAU A;  5IAI A;  1T0K A;  4EF1 A;  5L9S A;  4MLV A;  1B52 A;  2A5T B;  3PUV E;  4FEB A;  4KYE A;  1MS7 A;  4YMA A;  2ZYO A;  2DSF A;  1XS5 A;  1JQF A;  2DWH A;  2F35 A;  4IO7 A;  1US4 A;  3G3I A;  5BUU A;  1JET A;  3MW0 A;  3MP8 A;  5EHS A;  3UGW A;  1D9Y A;  4GF8 A;  4F2Q A;  2OCU A;  4WXJ A;  4QSC A;  4WED A;  3H6W A;  4F1Y A;  2PT2 A;  1N7W A;  3C4M A;  4JDF A;  1IXG A;  1Z7M E;  3VVF A;  3M3K A;  4EQB A;  1XOC A;  5K2Y A;  3K2D A;  3T9U A;  3HO7 A;  1N0T A;  1OIB A;  2F6G A;  3FGS A;  4MFI A;  4OEN A;  4BDL A;  2QPQ A;  5I56 B;  1IIW A;  1URD A;  2UVG A;  3K1M A;  1IXC A;  2O7I A;  2V3Q A;  4DXC A;  4GQO A;  1IUD A;  4OQO A;  4QRZ A;  1JVY A;  1PDA A;  2QMX A;  3H06 B;  2OLB A;  4BDN A;  1B4H A;  3VXB A;  5AA4 A;  1NNK A;  5H8H B;  3S4U A;  4TQU Q;  4EUO A;  1HSL A;  2REG A;  1P1Q A;  2F34 A;  2HQ0 A;  5CC2 A;  3CIJ A;  3FD3 A;  3VV5 A;  5I2N A;  1AOV A;  4G8N A;  1A7L A;  4I8C A;  1LB8 A;  3TZA A;  1R9Q A;  4ZED A;  2Q2C A;  2DWA A;  2P1S A;  3B7D A;  3M8U A;  3Q27 A;  4G4P A;  1M5D A;  1LBB A;  3QK6 A;  3N6T A;  1RYX A;  4OFL A;  3UA8 A;  3PUZ E;  3T9X B;  3V8X B;  3VE1 B;  1UIV A;  4NF8 A;  1ZBM A;  4YKK A;  1AH5 A;  1R6Z A;  1NNF A;  4OMB A;  3DP4 A;  1SI0 A;  3IAZ A;  3RLF E;  1EZO A;  1LFH A;  4RYA A;  4HCW A;  3P7I A;  4IGR A;  1P1N A;  2GH9 A;  3TQL A;  3MBP A;  5JTY B;  1VFE A;  2B3B A;  1Y3N A;  3RY3 A;  4DCX A;  4LON B;  5F1Q A;  1B05 A;  1OMP A;  4H65 A;  2Z8D A;  1B32 A;  1URG A;  3FJM A;  2RKM A;  1IZ1 A;  3I5O A;  2HZL A;  3C36 A;  3IO6 A;  1CB6 A;  4G8M A;  4OYV A;  5CI5 A;  4ZS9 A;  1KWH A;  2XX9 A;  4OEV A;  3CFX A;  3T9H B;  4YU0 A;  4IO2 A;  1ZIU A;  2DQV A;  5DVF A;  4Q30 B;  5KCJ B;  3V89 B;  3MP1 A;  1H3D A;  3EN3 A;  3FV1 A;  3KJ7 A;  3IB0 A;  4YZZ A;  3FAS A;  2F78 A;  2B3F A;  1MPD A;  1PB9 A;  2DXR A;  4IGT A;  4EQ9 A;  4PFT A;  1FTM A;  4HTG A;  2W7Y A;  1QW0 A;  3FXR A; 
#chains in the Genus database with same CATH topology
 2QS2 A;  2KLF A;  2DVC A;  2H25 A;  1LBW A;  4UAC A;  4MAG A;  1VR5 A;  1H45 A;  2QJE A;  1B6H A;  4XKQ A;  3RTW B;  2DXY A;  2ZNS A;  3H3G A;  5I3S A;  4RY1 A;  1KA1 A;  3TUS A;  2ZYK A;  4ZZE A;  1POY 1;  4MF3 A;  3WAE A;  4P47 A;  3GLB A;  2V3T A;  5CMC A;  3E78 A;  5TP9 A;  3HST A;  4PBH A;  3PUW E;  4EXK A;  4H8J A;  3ZKK A;  3JZJ A;  1D9V A;  3MZB A;  3USD A;  2V4C A;  1YPN A;  4YB6 A;  2QFL A;  5EQ8 A;  1B40 A;  1LCF A;  3A3C A;  2AYS A;  3PPP A;  4NX1 A;  3S9L C;  4P11 A;  3VDF A;  4F1U A;  4GXA A;  1ELJ A;  1FPD A;  2DS9 A;  4PFB A;  3PMV A;  4PP0 A;  5DTB A;  4IR8 A;  2PT1 A;  3KN7 A;  2CZK A;  1LBC A;  4PC9 A;  1DBZ A;  3IJO B;  3I6V A;  2IA4 A;  2Z8F A;  3FV2 A;  4M1V A;  5ET8 A;  3IOT A;  1ANF A;  1NH7 A;  4NTL A;  4LQ2 A;  4XFE A;  2FYI A;  4RPN A;  2ZYM A;  5IM2 A;  2PFY A;  4NF0 A;  4ZEF A;  4U23 A;  4YAH X;  4E0W A;  2R8T A;  1R1N A;  1OVT A;  2ZZV A;  3VXC A;  2A5S A;  2FIE A;  5AA3 A;  1NNP A;  3FVN A;  3FVO A;  4GVO A;  1EH3 A;  5I2K B;  1B0L A;  1OQH A;  4GBW A;  3FJ7 A;  4FBP A;  1XVX A;  2F97 A;  1NMU A;  2X26 A;  4GWW A;  4KYD A;  3H03 A;  3KFM A;  2G29 A;  1IXI A;  3OO7 A;  5H8F A;  5DEX A;  1YYZ A;  4KCC A;  4KFQ A;  3LSF B;  3K6U A;  2AL4 A;  1SVX B;  3BFU A;  1EZP A;  1K9Z A;  5HM4 B;  1BKA A;  1MQJ A;  5KZT A;  3O6G A;  3SKP A;  3SDF A;  4OVJ A;  1UTH B;  3TDJ A;  4PFI A;  2H98 A;  3FVG A;  4YB5 A;  2Y7I A;  3PPN A;  2I4C A;  3LSL A;  1L5T A;  1YZ0 A;  3KSX A;  2E1S A;  2QMW A;  3O97 A;  1EYJ A;  1O7T A;  3R7X A;  2VGQ A;  4GWY A;  1YTV A;  3MVW A;  3K4U A;  5H8Q A;  1FRP A;  3T9V A;  4RJZ A;  5JTY A;  2VOZ A;  5DVI A;  1FBP A;  1D9Q A;  2X7P A;  3OEM A;  2Q74 A;  4R2B A;  4I1D A;  3FUZ A;  4I9D A;  4OER A;  4GWU A;  2D5W A;  1ZMG A;  2KQZ A;  3MJN A;  2F3B A;  1MQI A;  2ZNU A;  4AQ4 A;  4MH5 A;  1A8F A;  4OA4 A;  2G93 A;  5ELV A;  4QBA A;  1XT8 A;  4PBQ A;  3LSX A;  5I5P A;  2O84 X;  2ONS A;  4ESX A;  1FBH A;  1MH3 A;  4KHZ E;  1FJ9 A;  3RT6 B;  2ABH A;  5LTC A;  2VD2 A;  2KR0 A;  4MNC A;  3MYU A;  5EHM A;  1FQF A;  1QKA A;  3IB2 A;  1DOT A;  4IB2 A;  1YCJ A;  1H44 A;  5FTI A;  4NF6 A;  2UXA A;  4H46 A;  4MNI A;  4XKR A;  1PB7 A;  2PCR A;  2XXR A;  3S9E A;  1B51 A;  4F39 A;  4KCD A;  3T22 A;  1B9J A;  4H6D A;  3OMB A;  1Y3Q A;  4PF8 A;  5JK4 A;  2Y7W A;  3C34 A;  5FHO A;  1B1H A;  1LBZ A;  1LFG A;  1Y3P A;  2ZNT A;  1FQE A;  1II5 A;  3PUX E;  1OVB A;  3MP6 A;  3TPA A;  4OAN A;  1ZLQ A;  1XHY A;  2NVU B;  2D21 A;  3KGC A;  1AWB A;  1FTJ A;  3CSB A;  3TAJ A;  3TCH A;  5CRY A;  1IQ7 A;  3HCQ A;  5I2K A;  3K6W A;  2GHA A;  3OSR A;  4JWX A;  5H8Q B;  4QFO A;  3LC8 A;  1SW1 A;  3B50 A;  3ONM A;  4OFJ A;  1F9B A;  2RF1 A;  4R73 A;  4RK9 A;  1FTL A;  3KN3 A;  3QAX A;  1LEV A;  4N4U A;  4DCY A;  4BDM A;  1DTZ A;  4HW8 A;  1QJM A;  4N07 A;  2GFE A;  3W9V A;  3B6Q A;  1A99 A;  2THI A;  4GWO A;  3TTK A;  4QFP A;  3Q29 A;  3IL1 B;  4O94 A;  4P0I A;  3BIH A;  3TTL A;  4Q0C A;  1MQG A;  1NUY A;  1UTB A;  1LAX A;  3LV0 A;  4MX6 A;  4Z7E A;  4FEB A;  3PUV E;  1FPF A;  2B4L A;  2F35 A;  2OCU A;  4QSC A;  3H6W A;  1N7W A;  4JDF A;  3VVF A;  4OVQ A;  2FVZ A;  1N0T A;  4O7M A;  4BDL A;  5I56 B;  2QPQ A;  1IIW A;  4OQO A;  1PDA A;  1NNK A;  3PTY A;  5H8H B;  4EUO A;  1P1Q A;  2F34 A;  5I2N A;  4G8N A;  1A7L A;  4I8C A;  1LB8 A;  1R9Q A;  4ZED A;  4AS4 A;  3N6T A;  1RYX A;  4OFL A;  4QXD A;  3T9X B;  3V8X B;  4HE2 A;  1FBE A;  1NNF A;  3DP4 A;  1SI0 A;  1CNQ A;  3TQL A;  3MBP A;  1Y3N A;  4GWZ A;  4DCX A;  1B05 A;  4G8M A;  3SER A;  5CI5 A;  2RKM A;  1IZ1 A;  4ZS9 A;  1KWH A;  3T9H B;  4IO2 A;  2CEX A;  3FAS A;  2B3F A;  1PB9 A;  4EQ9 A;  4PCD A;  1FTM A;  4PFT A;  1QW0 A;  3FXR A;  4H45 A;  3TTM A;  5IZ1 A;  1S7Y A;  1PEB A;  4NGU A;  4ONY A;  1VDW A;  1FPG A;  5ESY A;  1SPI A;  1OQG A;  1A40 A;  1SW4 A;  4G77 A;  3MPK A;  3ROJ A;  3JV9 A;  1MRP A;  4R74 A;  3ODB A;  2RC8 A;  4PFW A;  1MH4 A;  3T66 A;  3HV1 A;  4ESW A;  1SI1 A;  1OLC A;  4QSE A;  3ILT B;  4R6H A;  4FAT A;  2O7U A;  4DI4 B;  4BDR A;  1EZ9 A;  3MZ9 A;  2I48 A;  3RN8 A;  4ELQ A;  3G3K A;  4XEQ A;  1KA0 A;  5DT6 A;  3T1B A;  3N26 A;  1DCU A;  3DLN A;  1N84 A;  4RK2 A;  1MXU A;  2OX3 A;  5L8D A;  4IO6 A;  1LCT A;  4JVI A;  4DDD A;  3G3F A;  4R9F A;  1MY1 A;  4U22 A;  1A8E A;  1JVX A;  1LST A;  3GBB A;  1ZTY A;  1DTG A;  5EQA A;  2F7B A;  3WAF A;  1NV2 A;  2XWK A;  3ISP A;  4X04 A;  4YMB A;  4LN5 A;  4RXL A;  2QL3 A;  3ECR A;  2Y5K A;  3MAM A;  1FPK A;  5B70 A;  2QS4 A;  4JSO A;  1B7H A;  2FHY A;  4R6Y A;  1JP4 A;  5AA2 D;  2R6G E;  5ICQ A;  3QUF A;  2WYP A;  2RC9 A;  3NOH A;  3PPQ A;  3OD7 A;  2WKY A;  4PFU A;  4N13 A;  2DDK A;  1N3W A;  2IEE A;  2Q9T A;  2ZXT A;  2HZK A;  1QUL A;  2FA7 A;  1B0H A;  3EHS A;  1MG1 A;  5CBS A;  3TMG A;  4F18 A;  1N76 A;  3U93 A;  2Y84 A;  3U8Q A;  1NV7 A;  3KN8 A;  2Q2A A;  5I7I A;  1B1X A;  2ZYN A;  1QUK A;  2I49 A;  3N6U A;  3UOR A;  2CMO A;  1ZJL A;  2QSX A;  4HCY A;  1LLS A;  4H0W A;  1LAF E;  3B8B A;  4BDO A;  4ZEK A;  2RCA A;  2WX9 A;  3H4Z A;  4FE8 A;  2O69 A;  3MVY A;  1B3F A;  1URS A;  1JW4 A;  5J1D A;  1FPJ A;  3HN0 A;  2XXI A;  5TP9 B;  3VVE A;  3EHU A;  5CMM A;  1NH8 A;  1P99 A;  3S9N C;  2OWZ A;  1WOD A;  4NED A;  2REJ A;  3SEY A;  1NV6 A;  3UP9 A;  1Y9U A;  1IIT A;  1B3H A;  4GXS B;  1XC1 A;  2Q8J A;  1MXV A;  1JW1 A;  3W9W A;  1PBQ A;  1ZU0 A;  3D1R A;  2O1L A;  3FIR A;  4RPO A;  1FTK A;  4GD5 A;  4GX3 A;  5ET6 A;  4OZ9 A;  4P1L A;  3EPE A;  4H5F A;  5I58 B;  4FAJ A;  4F22 A;  3HPI A;  3U65 A;  4M4G A;  3OSQ A;  2DE2 A;  4L17 A;  2O6A A;  5ITO A;  3E4R A;  2H99 A;  4DXU A;  1SBP A;  5EYF A;  3RTF B;  5DYH A;  4U4X A;  4HXV A;  5B7D A;  1G0H A;  3CG3 A;  2DYX A;  2PYY A;  4Z0I A;  4O7I A;  3VFJ A;  2B4M A;  4OXV A;  2WBD A;  4LA9 A;  3AXF A;  1PC3 A;  1S50 A;  4RNS A;  4OTE A;  3TEP A;  2QS3 A;  4C0R A;  5L9O A;  4MBP A;  3DM0 A;  1RDX A;  3PMX A;  1LGB C;  1MPC A;  2Q88 A;  5I2N B;  1US5 A;  5DEX B;  4KI0 E;  3OEK A;  5I58 A;  1Y1M A;  3PU5 A;  3C31 A;  5A5X A;  3I3V A;  3V5A A;  1IME A;  1FSA A;  3H6U A;  4HS7 A;  4LVQ A;  1M5C A;  4R2F A;  1A55 A;  1N04 A;  4XIG Q;  1TWY A;  1GVC A;  3H6V A;  2DE4 A;  3ZKL A;  4AB5 A;  2I0B A;  3TEL A;  1QUJ A;  1BP5 A;  4TLL B;  4XKP A;  3H7M A;  4KR5 A;  4GWS A;  3CFL A;  4JVC A;  1PB8 A;  1JEV A;  1Y4C A;  1SW5 A;  1MM7 A;  2H4I A;  3RT8 A;  2XXX A;  3CI8 A;  1JEU A;  3R26 A;  4NF5 B;  2DWJ A;  1DMB A;  3K1N A;  1K9Y A;  1I69 A;  4R72 A;  5F7V A;  2UVJ A;  5ITP A;  2F36 A;  4PAF A;  4LP2 B;  4DIG A;  2Q89 A;  5H8N A;  3M3L A;  4UA8 A;  4THI A;  2NUV A;  3EHT A;  3C33 A;  4KD5 A;  2ANJ A;  1EU8 A;  4F29 A;  5I57 B;  1AMF A;  1BIY A;  1D4N A;  3E9X A;  5KDT B;  4Q8R A;  1P1W A;  1SQY A;  1VSO A;  2XXV A;  4ZEI A;  2HAV A;  2OWT A;  2GRV A;  3BIG A;  3LUZ A;  3L6G A;  3S9M C;  1AL3 A;  2HAU A;  4MLV A;  4KYE A;  4YMA A;  2DSF A;  2DWH A;  5BUU A;  4GF8 A;  4F2Q A;  4N8Y A;  3M3K A;  5K2Y A;  3T9U A;  3K2D A;  4OEN A;  2UVG A;  3K1M A;  1IXC A;  2O7I A;  4DXC A;  2QMX A;  2REG A;  4MIJ A;  5CC2 A;  3FD3 A;  4N91 A;  4P9K A;  5AA2 B;  3Q27 A;  1LBB A;  3QK6 A;  3UA8 A;  4NF8 A;  4YKK A;  1XI6 A;  1LFH A;  1LBV A;  4RYA A;  2GH9 A;  4N81 A;  5JTY B;  1VFE A;  5F1Q A;  3I5O A;  3C36 A;  3IO6 A;  3A29 A;  2XX9 A;  4YU0 A;  5KCJ B;  2DQV A;  5DVF A;  3V89 B;  3MP1 A;  1MPD A;  2W7Y A;  2FBP A;  4XKN A;  5H8F B;  3OO9 A;  2XD3 A;  2CZH A;  4U2R A;  1N7X A;  3MC2 A;  1NNT A;  4H67 A;  2XXW A;  2Y7K A;  2I0C A;  3MST A;  4XTC Q;  2I6E A;  3MPL A;  2XXT A;  2XXH A;  4NF5 A;  3O6I A;  1TFA A;  1NV1 A;  3V83 A;  2WYK A;  1NUX A;  1FBG A;  3O66 A;  3RNN A;  3K1P A;  3PD8 A;  1LFI A;  3VVD A;  5H8N B;  5KDT A;  4R9G A;  3FXQ A;  2XA5 A;  2V25 A;  1D3K A;  2CZL A;  3D4G A;  4IY6 A;  3OXN A;  4NQ8 A;  3O28 A;  3K02 A;  3O29 A;  4GOT A;  3ILU B;  3FAT A;  1M5F A;  3THI A;  3PPR A;  3KJT A;  2XXK A;  4N6D A;  3OEN A;  3H6T A;  2YJP A;  2HHM A;  4I3E A;  5IKB A;  4N8G A;  2A5T A;  2V3U A;  2XWI A;  5I59 B;  4WEP A;  2L5V A;  2F7A A;  1NV5 A;  3IR1 A;  3R6U A;  4LZ7 A;  5K2X A;  4YKJ A;  2CEY A;  4NMY A;  2QVU A;  4OVT A;  1NFT A;  3PPO A;  4I62 A;  4PGN A;  1NL5 A;  2CZI A;  1MDP 1;  3KC0 A;  3DEL B;  1DSN A;  1B4Z A;  5HPQ A;  4O8M A;  4YIC A;  3PGF A;  4KQP A;  4OEU A;  3SEW A;  1MDQ A;  1FBF A;  2AIX A;  4C1T A;  2HXR A;  3LBS A;  3FXU A;  2GQ1 A;  2UVH A;  2H5Y A;  3RPL A;  4JVD A;  2XX7 A;  1DPE A;  3ZS6 A;  2P3N A;  4EF2 A;  3IO4 A;  1S9T A;  5IGA A;  4X1B A;  4AB6 A;  1QGX A;  3C9H A;  1DK4 A;  2F7C A;  4YKI A;  1I6Q A;  2I3W A;  4H5G A;  2Z8E A;  2D3I A;  5EYH A;  3KZG A;  3LUY A;  4ZE8 A;  3GYY A;  2I3V A;  5HBC A;  3C35 A;  1M5E A;  1POT A;  4C1U A;  4ELO A;  5JEI A;  4QF9 A;  2NXO A;  3U72 A;  4NHB A;  2R71 A;  3IJX B;  2P0S A;  3DP6 A;  3OO6 A;  2DWI A;  1B58 A;  4G68 C;  3IOR A;  1B5H A;  3RPL B;  2WEF A;  4IO4 A;  3RQT A;  5H8S A;  3RYD A;  4ELP A;  2XX8 A;  4I40 A;  4OVR A;  1PBP A;  3UN6 A;  2YPN A;  5ET5 A;  1QUI A;  5I59 A;  3M3F A;  3OO8 A;  4DI3 D;  1A54 A;  3CRB A;  5T3J A;  2AL5 A;  4BLA A;  3BFT A;  1IMF A;  4ZDM A;  3EKI A;  4KXP A;  4U1Z A;  3PV0 E;  5ICT A;  1JW5 A;  4PAI A;  3KBZ A;  4FJP A;  5DW8 A;  1NI9 A;  2B65 A;  3PUY E;  1GTK A;  1H76 A;  4MHF A;  4F31 B;  5CBR A;  4ZZA A;  2BJJ X;  3EF7 A;  1NUW A;  3MUQ A;  3UK4 A;  4DLD A;  5I84 A;  4H8I A;  1LBY A;  4P8B A;  2XXY A;  2JJK A;  1MXW A;  1VFD A;  5F24 A;  1LAH E;  2NOO A;  4N17 A;  1M5B A;  1P1U A;  3BKI B;  3VLV A;  2UYF A;  4YB7 A;  4P0G A;  1WVJ A;  4GBV A;  4LUB A;  4PQJ A;  3E3K A;  4U21 A;  4BDQ A;  1SD3 A;  4X9T A;  4P3L A;  3BBR A;  3Q28 A;  3A09 A;  3IK6 B;  1O64 A;  4KYS A;  4E0X A;  2OJT A;  3T96 B;  4G8H A;  2PMS A;  3TTN A;  3CG1 A;  5EQ9 A;  4N6P A;  2M8C A;  1FBD A;  2RC7 A;  3CSG A;  4GFR A;  4X1D A;  4HE0 A;  1MQH A;  4ELR A;  3MQ9 A;  2XD2 A;  3TOD A;  4EQ7 A;  1OLA A;  4TOZ A;  4WKM A;  1TT1 A;  1I6A A;  1H43 A;  1BLF A;  4PE5 B;  2Z22 A;  1O63 A;  3IB1 A;  4F3P A;  2F6P A;  4ECF A;  4EDP A;  3K01 A;  4JWO A;  4F3S A;  3FJG A;  3Q25 A;  5ET7 A;  1QVS A;  3IFA A;  5AA4 B;  4QFN A;  1SW2 A;  2ZMB A;  4LZ8 A;  1Q35 A;  3U94 A;  4FIM A;  4ISU A;  1IMB A;  4JWY A;  1FBC A;  4F19 A;  2BJI A;  2DP8 A;  4G61 A;  5IZZ A;  2FIX A;  2DOJ A;  1YAE A;  2QVV A;  2ESN A;  1DPP A;  3N5L A;  2X7Q A;  4OHN A;  2HEU A;  2H9B A;  1B2H A;  4N6K A;  4JBZ A;  3HHF A;  1SYH A;  5IAI A;  3KC1 A;  1B52 A;  2A5T B;  1MS7 A;  4IO7 A;  1US4 A;  3G3I A;  1JET A;  3MP8 A;  4WXJ A;  1FPL A;  4WED A;  4F1Y A;  2PT2 A;  3C4M A;  1XOC A;  3HO7 A;  2Q8M A;  2F6G A;  4MFI A;  5EQ7 A;  2V3Q A;  4GQO A;  3H06 B;  4BDN A;  5AA4 A;  1B4H A;  3VXB A;  3S4U A;  3CIJ A;  3VV5 A;  3TZA A;  2Q2C A;  2DWA A;  2P1S A;  1M5D A;  4GX4 A;  3PUZ E;  3FXB A;  1FPI A;  1IMA A;  1AH5 A;  1R6Z A;  4OMB A;  3IAZ A;  1EZO A;  4HCW A;  3P7I A;  1P1N A;  1FJ6 A;  3E79 A;  3IFC A;  2B3B A;  4LON B;  2Z8D A;  4MCO A;  3FJM A;  3QMF A;  4OYV A;  4OEV A;  3CFX A;  1ZIU A;  4Q30 B;  1H3D A;  3EN3 A;  2F78 A;  1INP A;  1ZKB A;  1UQW A;  4GLI A;  1B3G A;  4DE8 A;  5I56 A;  2O1M A;  1USY E;  3U92 A;  3SES A;  4O3B A;  3CFZ A;  4PFR A;  1FQC A;  2P3V A;  4MNP A;  4ZEC A;  1I6B A;  5CMB A;  2HPG A;  1R9L A;  4PDH A;  4OFO A;  2QRY A;  3CVG A;  3G3J A;  3MVX A;  3KEI A;  4R75 A;  4F1V A;  3GXA A;  3LR1 A;  5IZ3 A;  2RIN A;  5AA1 A;  3KSJ A;  5M2V A;  2QS1 A;  3D4C A;  4OET A;  1B3L A;  3PMW A;  4MEV A;  4X48 A;  3SEU A;  2GHB A;  3T0J A;  3FVK A;  4K3F A;  2R9J A;  3TKD A;  1UIU A;  4OVS A;  1HSE A;  3EQ1 A;  4GRK A;  3FZV A;  1VE4 A;  2ZZW A;  2HXW A;  4HE1 A;  4NF6 B;  3C32 A;  3QXM A;  3SET A;  3ZSF A;  1FQB A;  1RYO A;  2O51 A;  3OEL A;  3VLW A;  3IOU A;  1NV0 A;  2UYE A;  2ZZX A;  1TXF A;  1B5J A;  1B46 A;  2VHA A;  4DZ1 A;  5TPA A;  2XHD A;  1IXH A;  3TQW A;  3U1O A;  5AA2 A;  2XXU A;  1RDZ A;  5IZ3 B;  3RUM A;  1N3X A;  2V84 A;  3IX1 A;  1MY3 A;  2DVZ A;  2YLN A;  2Y7R A;  1WDN A;  3G7W A;  4IO5 A;  4G68 B;  4GIZ A;  4F3B A;  4PET A;  1SYI A;  3IOW A;  3F11 A;  4IO3 A;  4EXL A;  1G0I A;  5AE4 A;  2XXP A;  4FED A;  3O2A A;  5J16 A;  1JNF A;  4O3A A;  4R6K A;  1MY4 A;  4N15 A;  3LSW A;  4OWD A;  2I4B A;  2ONR A;  1NV3 A;  4IY5 A;  1Z7N E;  4QHQ A;  2ALU A;  5ISU A;  4GWX A;  5BWJ A;  4NF4 A;  3N94 A;  4QFL A;  3E13 X;  2MKZ A;  3QSL A;  5LOM A;  1ATG A;  4NWD A;  3SZP A;  3W15 C;  4LZ5 A;  2WBB A;  4JXI A;  4DXB A;  3KOT A;  3HHG A;  4PFY A;  1MXZ A;  4AS5 A;  4QFK A;  3TCG A;  1FQA A;  1NV4 A;  1Q9D A;  2FNC A;  1LAG E;  3S2V A;  3K00 A;  4MJO A;  5A5L A;  3TYH A;  4NG7 A;  3L6H A;  2PX1 A;  4GX6 A;  4ZEB A;  1Q1K A;  4F3G A;  3MWB A;  1B3E A;  5H8H A;  1J1N A;  5L9M A;  2XXQ A;  1MPB A;  3OOA A;  1B7U A;  3O6H A;  1MXX A;  2Z23 A;  2LAO A;  5KCJ A;  4NF8 B;  2OWS A;  1CE2 A;  1SDX A;  2XWV A;  3QYT A;  2DE3 A;  1FW0 A;  3B6T A;  4P1E A;  2PVU A;  1FTO A;  5TPA B;  4JB7 A;  5I57 A;  1Y1Z A;  1MY2 A;  4P56 A;  1GV8 A;  2UVI A;  1QKB A;  4UAB A;  3KG2 A;  4XXU A;  1LB9 A;  1EYI A;  5DVJ A;  5CM6 A;  1UTH A;  5A5X B;  1GGG A;  4U1O A;  1HSJ A;  4G68 A;  4PDD A;  2F5X A;  3MVZ A;  1AIV A;  3CHG A;  2RCB A;  1UTB B;  4PAK A;  4Q5T A;  4POX A;  3QIM A;  4O3C A;  1BTJ A;  3KBR A;  4OVP A;  5EYG A;  1LBX A;  1USY H;  3UIF A;  2NWJ A;  2Y7P A;  4H1X A;  1NUZ A;  4MLQ A;  4QSD A;  3FBP A;  2VPN A;  3A3U A;  3SEX A;  2OZZ A;  1Y20 A;  3MZ1 A;  3QUJ A;  4NWC A;  4NAP A;  3B6W A;  1RKM A;  3CR9 A;  3KOS A;  1B7Z A;  4XF5 A;  3PD9 A;  4NF4 B;  3SEV A;  4ND9 A;  4X8R A;  4TLM B;  1GR2 A;  3TTR A;  4PTK A;  4LQ5 A;  1MY0 A;  3G3H A;  1MXY A;  1XVY A;  2PBW A;  1FCK A;  1IEJ A;  5FHN A;  3TFL A;  2F3D A;  4PGP A;  2VD3 A;  5FTH A;  2VPO A;  3K6V A;  4YKP A;  1YXI A;  2F8D A;  4F2O A;  3VLU A;  4U4S A;  2XWO A;  1MM6 A;  3G3G A;  3JYR A;  1IMC A;  1MQD A;  3GZG A;  3RPW A;  1FQD A;  5FHM A;  4I3Y A;  1EYK A;  2O68 A;  3HFU A;  4ZE9 A;  3GBA A;  2P2A A;  2OBG A;  4LAT A;  3K6X A;  1RDY A;  1P1O A;  2V93 A;  4POW A;  4FOR A;  3TCF A;  3K0V A;  2E0S A;  3O9P A;  2I58 A;  1TFD A;  3DP8 A;  4GL0 A;  5CMK A;  2HCA A;  4GL8 A;  4NE4 A;  4OES A;  5TU0 A;  3IOV A;  4KPT A;  2ONK E;  3T93 B;  2OK2 A;  4FEC A;  2VP1 A;  3Q26 A;  1Y4T A;  1NKX A;  4JSD A;  4G2Z A;  1BK4 A;  1B5I A;  3RGY A;  1T0K A;  2HFB A;  4EF1 A;  5L9S A;  2ZYO A;  1XS5 A;  1JQF A;  3MW0 A;  3UGW A;  5EHS A;  1D9Y A;  1IXG A;  1Z7M E;  4EQB A;  1OIB A;  3FGS A;  1IMD A;  1URD A;  5FBP A;  1IUD A;  4QRZ A;  1JVY A;  2OLB A;  4TQU Q;  1HSL A;  2HQ0 A;  1AOV A;  2VT5 A;  1FPE A;  3B7D A;  3M8U A;  4G4P A;  4NN3 A;  2PFZ A;  1FTA A;  3VE1 B;  1UIV A;  4PE3 A;  1ZBM A;  2QVR A;  3RLF E;  4IGR A;  5LDZ A;  4MMP A;  3RY3 A;  4PF6 A;  1OMP A;  4H65 A;  1B32 A;  1URG A;  2HZL A;  1CB6 A;  1KZ8 A;  1FPB A;  2Y5L A;  3FV1 A;  3KJ7 A;  4YZZ A;  3IB0 A;  2DXR A;  4IGT A;  4HTG A;  4RA1 A; 
#chains in the Genus database with same CATH homology
 2QS2 A;  2KLF A;  2DVC A;  2H25 A;  1LBW A;  4UAC A;  4MAG A;  1VR5 A;  1H45 A;  2QJE A;  1B6H A;  4XKQ A;  3RTW B;  2DXY A;  2ZNS A;  3H3G A;  5I3S A;  4RY1 A;  1KA1 A;  3TUS A;  2ZYK A;  4ZZE A;  1POY 1;  4MF3 A;  3WAE A;  4P47 A;  3GLB A;  2V3T A;  5CMC A;  3E78 A;  5TP9 A;  3HST A;  4PBH A;  3PUW E;  4EXK A;  4H8J A;  3ZKK A;  3JZJ A;  1D9V A;  3MZB A;  3USD A;  2V4C A;  1YPN A;  4YB6 A;  2QFL A;  5EQ8 A;  1B40 A;  1LCF A;  3A3C A;  2AYS A;  3PPP A;  3S9L C;  4NX1 A;  4P11 A;  3VDF A;  4F1U A;  4GXA A;  1ELJ A;  1FPD A;  2DS9 A;  4PFB A;  3PMV A;  4PP0 A;  5DTB A;  4IR8 A;  2PT1 A;  3KN7 A;  2CZK A;  1LBC A;  4PC9 A;  1DBZ A;  3IJO B;  3I6V A;  2IA4 A;  2Z8F A;  3FV2 A;  4M1V A;  5ET8 A;  3IOT A;  1ANF A;  1NH7 A;  4NTL A;  4LQ2 A;  4XFE A;  2FYI A;  4RPN A;  2ZYM A;  5IM2 A;  2PFY A;  4NF0 A;  4ZEF A;  4U23 A;  4YAH X;  4E0W A;  2R8T A;  1R1N A;  1OVT A;  2ZZV A;  3VXC A;  2A5S A;  2FIE A;  5AA3 A;  1NNP A;  3FVN A;  3FVO A;  4GVO A;  1EH3 A;  5I2K B;  1B0L A;  1OQH A;  4GBW A;  3FJ7 A;  4FBP A;  1XVX A;  2F97 A;  1NMU A;  2X26 A;  4GWW A;  4KYD A;  3H03 A;  3KFM A;  2G29 A;  1IXI A;  3OO7 A;  5H8F A;  5DEX A;  1YYZ A;  4KCC A;  4KFQ A;  3LSF B;  3K6U A;  2AL4 A;  1SVX B;  3BFU A;  1EZP A;  1K9Z A;  5HM4 B;  1BKA A;  1MQJ A;  5KZT A;  3O6G A;  3SKP A;  3SDF A;  4OVJ A;  1UTH B;  3TDJ A;  4PFI A;  2H98 A;  3FVG A;  4YB5 A;  2Y7I A;  3PPN A;  2I4C A;  3LSL A;  1L5T A;  1YZ0 A;  3KSX A;  2E1S A;  2QMW A;  3O97 A;  1O7T A;  3R7X A;  1EYJ A;  2VGQ A;  4GWY A;  1YTV A;  3MVW A;  3K4U A;  5H8Q A;  1FRP A;  3T9V A;  4RJZ A;  5JTY A;  2VOZ A;  5DVI A;  1FBP A;  1D9Q A;  2X7P A;  3OEM A;  2Q74 A;  4R2B A;  4I1D A;  3FUZ A;  4I9D A;  4OER A;  4GWU A;  2D5W A;  1ZMG A;  2KQZ A;  3MJN A;  2F3B A;  1MQI A;  2ZNU A;  4AQ4 A;  4MH5 A;  1A8F A;  4OA4 A;  2G93 A;  5ELV A;  4QBA A;  1XT8 A;  4PBQ A;  3LSX A;  5I5P A;  2O84 X;  2ONS A;  4ESX A;  1FBH A;  1MH3 A;  4KHZ E;  1FJ9 A;  2ABH A;  3RT6 B;  5LTC A;  2VD2 A;  2KR0 A;  4MNC A;  3MYU A;  5EHM A;  1FQF A;  1QKA A;  3IB2 A;  1DOT A;  4IB2 A;  1YCJ A;  1H44 A;  5FTI A;  4NF6 A;  2UXA A;  4H46 A;  4MNI A;  4XKR A;  1PB7 A;  2XXR A;  2PCR A;  3S9E A;  1B51 A;  4F39 A;  4KCD A;  3T22 A;  1B9J A;  4H6D A;  3OMB A;  1Y3Q A;  4PF8 A;  5JK4 A;  2Y7W A;  3C34 A;  5FHO A;  1B1H A;  1LBZ A;  1LFG A;  1Y3P A;  2ZNT A;  1FQE A;  1II5 A;  3PUX E;  1OVB A;  3MP6 A;  3TPA A;  4OAN A;  1ZLQ A;  1XHY A;  2NVU B;  2D21 A;  3KGC A;  1FTJ A;  1AWB A;  3CSB A;  3TAJ A;  3TCH A;  5CRY A;  1IQ7 A;  3HCQ A;  5I2K A;  3K6W A;  2GHA A;  3OSR A;  4JWX A;  5H8Q B;  4QFO A;  3LC8 A;  1SW1 A;  3ONM A;  3B50 A;  4OFJ A;  1F9B A;  2RF1 A;  4R73 A;  4RK9 A;  1FTL A;  3KN3 A;  3QAX A;  1LEV A;  4DCY A;  4N4U A;  4BDM A;  1DTZ A;  4HW8 A;  1QJM A;  4N07 A;  2GFE A;  3W9V A;  3B6Q A;  1A99 A;  2THI A;  4GWO A;  3TTK A;  4QFP A;  3Q29 A;  3IL1 B;  4O94 A;  4P0I A;  3BIH A;  3TTL A;  4Q0C A;  1MQG A;  1UTB A;  1NUY A;  1LAX A;  3LV0 A;  4MX6 A;  4Z7E A;  4FEB A;  3PUV E;  1FPF A;  2B4L A;  2F35 A;  2OCU A;  4QSC A;  3H6W A;  1N7W A;  4JDF A;  3VVF A;  4OVQ A;  2FVZ A;  1N0T A;  4O7M A;  4BDL A;  5I56 B;  2QPQ A;  1IIW A;  4OQO A;  1PDA A;  1NNK A;  3PTY A;  5H8H B;  4EUO A;  1P1Q A;  2F34 A;  5I2N A;  4G8N A;  1A7L A;  4I8C A;  1LB8 A;  1R9Q A;  4ZED A;  4AS4 A;  3N6T A;  1RYX A;  4OFL A;  3T9X B;  4QXD A;  3V8X B;  4HE2 A;  1FBE A;  1NNF A;  3DP4 A;  1SI0 A;  1CNQ A;  3TQL A;  3MBP A;  1Y3N A;  4GWZ A;  4DCX A;  1B05 A;  3SER A;  4G8M A;  2RKM A;  1IZ1 A;  5CI5 A;  4ZS9 A;  1KWH A;  3T9H B;  4IO2 A;  2CEX A;  3FAS A;  2B3F A;  1PB9 A;  4EQ9 A;  4PFT A;  1FTM A;  4PCD A;  1QW0 A;  3FXR A;  4H45 A;  3TTM A;  5IZ1 A;  1S7Y A;  1PEB A;  4ONY A;  4NGU A;  1VDW A;  1FPG A;  5ESY A;  1SPI A;  1OQG A;  1A40 A;  1SW4 A;  4G77 A;  3MPK A;  3ROJ A;  3JV9 A;  1MRP A;  4R74 A;  3ODB A;  2RC8 A;  4PFW A;  1MH4 A;  3T66 A;  3HV1 A;  4ESW A;  1SI1 A;  1OLC A;  4QSE A;  3ILT B;  4R6H A;  4FAT A;  2O7U A;  4DI4 B;  4BDR A;  1EZ9 A;  3MZ9 A;  2I48 A;  3RN8 A;  4ELQ A;  3G3K A;  4XEQ A;  1KA0 A;  5DT6 A;  3T1B A;  3N26 A;  1DCU A;  3DLN A;  1N84 A;  4RK2 A;  1MXU A;  2OX3 A;  5L8D A;  4IO6 A;  1LCT A;  4JVI A;  4DDD A;  3G3F A;  4R9F A;  1MY1 A;  4U22 A;  1A8E A;  1JVX A;  1LST A;  3GBB A;  1ZTY A;  1DTG A;  5EQA A;  2F7B A;  3WAF A;  1NV2 A;  2XWK A;  3ISP A;  4X04 A;  4YMB A;  4LN5 A;  4RXL A;  2QL3 A;  3ECR A;  2Y5K A;  3MAM A;  5B70 A;  1FPK A;  2QS4 A;  4JSO A;  1B7H A;  2FHY A;  4R6Y A;  1JP4 A;  5AA2 D;  2R6G E;  5ICQ A;  3QUF A;  2WYP A;  2RC9 A;  3NOH A;  3PPQ A;  3OD7 A;  2WKY A;  4PFU A;  4N13 A;  2DDK A;  1N3W A;  2IEE A;  2Q9T A;  2ZXT A;  2HZK A;  1QUL A;  2FA7 A;  1B0H A;  3EHS A;  1MG1 A;  5CBS A;  3TMG A;  4F18 A;  1N76 A;  3U93 A;  2Y84 A;  3U8Q A;  1NV7 A;  3KN8 A;  2Q2A A;  5I7I A;  1B1X A;  2ZYN A;  1QUK A;  2I49 A;  3N6U A;  3UOR A;  2CMO A;  1ZJL A;  2QSX A;  4HCY A;  1LLS A;  4H0W A;  1LAF E;  4BDO A;  3B8B A;  4ZEK A;  2RCA A;  2WX9 A;  3H4Z A;  4FE8 A;  2O69 A;  3MVY A;  1B3F A;  1URS A;  1JW4 A;  5J1D A;  1FPJ A;  3HN0 A;  2XXI A;  5TP9 B;  3VVE A;  3EHU A;  5CMM A;  1NH8 A;  1P99 A;  3S9N C;  2OWZ A;  1WOD A;  4NED A;  2REJ A;  3SEY A;  1NV6 A;  3UP9 A;  1Y9U A;  1IIT A;  1B3H A;  4GXS B;  1XC1 A;  2Q8J A;  1MXV A;  1JW1 A;  3W9W A;  1PBQ A;  1ZU0 A;  3D1R A;  2O1L A;  3FIR A;  4RPO A;  1FTK A;  4GD5 A;  4GX3 A;  5ET6 A;  4OZ9 A;  4P1L A;  3EPE A;  4H5F A;  5I58 B;  4FAJ A;  4F22 A;  3HPI A;  3U65 A;  4M4G A;  3OSQ A;  2DE2 A;  4L17 A;  2O6A A;  5ITO A;  3E4R A;  2H99 A;  4DXU A;  1SBP A;  5EYF A;  3RTF B;  5DYH A;  4U4X A;  4HXV A;  5B7D A;  3CG3 A;  1G0H A;  2DYX A;  2PYY A;  4Z0I A;  4O7I A;  3VFJ A;  4OXV A;  2B4M A;  2WBD A;  4LA9 A;  3AXF A;  1PC3 A;  1S50 A;  4RNS A;  4OTE A;  3TEP A;  2QS3 A;  4C0R A;  5L9O A;  4MBP A;  3DM0 A;  1RDX A;  3PMX A;  1LGB C;  1MPC A;  2Q88 A;  5I2N B;  1US5 A;  5DEX B;  4KI0 E;  3OEK A;  5I58 A;  1Y1M A;  3PU5 A;  3C31 A;  5A5X A;  3I3V A;  3V5A A;  1IME A;  1FSA A;  3H6U A;  4HS7 A;  4LVQ A;  1M5C A;  4R2F A;  1A55 A;  1N04 A;  4XIG Q;  1TWY A;  1GVC A;  3H6V A;  2DE4 A;  3ZKL A;  4AB5 A;  2I0B A;  3TEL A;  1QUJ A;  1BP5 A;  4TLL B;  4XKP A;  3H7M A;  4KR5 A;  4GWS A;  3CFL A;  4JVC A;  1PB8 A;  1JEV A;  1Y4C A;  1SW5 A;  1MM7 A;  2H4I A;  3RT8 A;  2XXX A;  3CI8 A;  1JEU A;  3R26 A;  4NF5 B;  2DWJ A;  1DMB A;  3K1N A;  1K9Y A;  1I69 A;  4R72 A;  5F7V A;  2UVJ A;  5ITP A;  2F36 A;  4PAF A;  4LP2 B;  4DIG A;  2Q89 A;  3M3L A;  4UA8 A;  5H8N A;  4THI A;  2NUV A;  3EHT A;  3C33 A;  4KD5 A;  2ANJ A;  1EU8 A;  4F29 A;  5I57 B;  1AMF A;  1BIY A;  1D4N A;  3E9X A;  5KDT B;  4Q8R A;  1P1W A;  1SQY A;  1VSO A;  2XXV A;  4ZEI A;  2HAV A;  2OWT A;  2GRV A;  3BIG A;  3LUZ A;  3L6G A;  3S9M C;  1AL3 A;  2HAU A;  4MLV A;  4KYE A;  4YMA A;  2DSF A;  2DWH A;  5BUU A;  4GF8 A;  4F2Q A;  4N8Y A;  3M3K A;  5K2Y A;  3T9U A;  3K2D A;  4OEN A;  2UVG A;  3K1M A;  1IXC A;  2O7I A;  4DXC A;  2QMX A;  2REG A;  4MIJ A;  5CC2 A;  3FD3 A;  4N91 A;  4P9K A;  5AA2 B;  3Q27 A;  1LBB A;  3QK6 A;  3UA8 A;  4NF8 A;  4YKK A;  1XI6 A;  1LFH A;  1LBV A;  4RYA A;  2GH9 A;  5JTY B;  4N81 A;  1VFE A;  5F1Q A;  3I5O A;  3C36 A;  3IO6 A;  3A29 A;  2XX9 A;  4YU0 A;  5KCJ B;  2DQV A;  5DVF A;  3V89 B;  3MP1 A;  1MPD A;  2W7Y A;  2FBP A;  4XKN A;  5H8F B;  3OO9 A;  2XD3 A;  2CZH A;  4U2R A;  1N7X A;  3MC2 A;  1NNT A;  4H67 A;  2XXW A;  2Y7K A;  2I0C A;  3MST A;  4XTC Q;  2I6E A;  3MPL A;  2XXT A;  2XXH A;  4NF5 A;  3O6I A;  1TFA A;  1NV1 A;  3V83 A;  2WYK A;  1NUX A;  3O66 A;  1FBG A;  3RNN A;  3K1P A;  3PD8 A;  1LFI A;  3VVD A;  5H8N B;  5KDT A;  4R9G A;  3FXQ A;  2XA5 A;  2V25 A;  1D3K A;  2CZL A;  3D4G A;  4IY6 A;  3OXN A;  4NQ8 A;  3O28 A;  3K02 A;  3O29 A;  4GOT A;  3ILU B;  3FAT A;  1M5F A;  3THI A;  3PPR A;  3KJT A;  2XXK A;  4N6D A;  3OEN A;  3H6T A;  2YJP A;  2HHM A;  4I3E A;  5IKB A;  4N8G A;  2A5T A;  2V3U A;  5I59 B;  2XWI A;  4WEP A;  2L5V A;  2F7A A;  3IR1 A;  1NV5 A;  3R6U A;  4LZ7 A;  5K2X A;  4YKJ A;  2CEY A;  4NMY A;  2QVU A;  4OVT A;  1NFT A;  3PPO A;  4I62 A;  4PGN A;  1NL5 A;  2CZI A;  1MDP 1;  3KC0 A;  3DEL B;  1DSN A;  1B4Z A;  5HPQ A;  4O8M A;  4YIC A;  3PGF A;  4KQP A;  4OEU A;  3SEW A;  1MDQ A;  1FBF A;  2AIX A;  4C1T A;  2HXR A;  3LBS A;  3FXU A;  2GQ1 A;  2UVH A;  2H5Y A;  3RPL A;  4JVD A;  2XX7 A;  1DPE A;  3ZS6 A;  2P3N A;  4EF2 A;  3IO4 A;  1S9T A;  5IGA A;  4X1B A;  4AB6 A;  3C9H A;  1QGX A;  1DK4 A;  2F7C A;  4YKI A;  1I6Q A;  2I3W A;  4H5G A;  2Z8E A;  2D3I A;  5EYH A;  3KZG A;  3LUY A;  4ZE8 A;  3GYY A;  2I3V A;  5HBC A;  3C35 A;  1M5E A;  1POT A;  4C1U A;  4ELO A;  5JEI A;  4QF9 A;  2NXO A;  3U72 A;  4NHB A;  2R71 A;  3IJX B;  2P0S A;  3DP6 A;  3OO6 A;  2DWI A;  1B58 A;  4G68 C;  3IOR A;  1B5H A;  3RPL B;  4IO4 A;  2WEF A;  3RQT A;  5H8S A;  3RYD A;  4ELP A;  2XX8 A;  4I40 A;  4OVR A;  1PBP A;  3UN6 A;  2YPN A;  5ET5 A;  1QUI A;  5I59 A;  3M3F A;  3OO8 A;  4DI3 D;  1A54 A;  3CRB A;  5T3J A;  2AL5 A;  4BLA A;  3BFT A;  1IMF A;  4ZDM A;  3EKI A;  4KXP A;  4U1Z A;  3PV0 E;  5ICT A;  1JW5 A;  4PAI A;  4FJP A;  3KBZ A;  5DW8 A;  1NI9 A;  2B65 A;  3PUY E;  1GTK A;  1H76 A;  4MHF A;  4F31 B;  5CBR A;  4ZZA A;  2BJJ X;  3EF7 A;  1NUW A;  3MUQ A;  3UK4 A;  4DLD A;  5I84 A;  4H8I A;  1LBY A;  4P8B A;  2XXY A;  2JJK A;  1MXW A;  1VFD A;  5F24 A;  1LAH E;  2NOO A;  4N17 A;  1M5B A;  1P1U A;  3BKI B;  3VLV A;  2UYF A;  4YB7 A;  4P0G A;  1WVJ A;  4GBV A;  4LUB A;  4PQJ A;  3E3K A;  4U21 A;  4BDQ A;  1SD3 A;  4X9T A;  4P3L A;  3BBR A;  3Q28 A;  3A09 A;  3IK6 B;  1O64 A;  4KYS A;  4E0X A;  2OJT A;  3T96 B;  4G8H A;  2PMS A;  3TTN A;  3CG1 A;  5EQ9 A;  4N6P A;  2M8C A;  2RC7 A;  4GFR A;  3CSG A;  1FBD A;  4X1D A;  4HE0 A;  1MQH A;  4ELR A;  3MQ9 A;  2XD2 A;  3TOD A;  4EQ7 A;  1OLA A;  4TOZ A;  4WKM A;  1TT1 A;  1I6A A;  1H43 A;  1BLF A;  4PE5 B;  2Z22 A;  1O63 A;  3IB1 A;  4F3P A;  2F6P A;  4ECF A;  4EDP A;  3K01 A;  4JWO A;  4F3S A;  3FJG A;  3Q25 A;  5ET7 A;  1QVS A;  3IFA A;  5AA4 B;  4QFN A;  1SW2 A;  2ZMB A;  4LZ8 A;  1Q35 A;  3U94 A;  4FIM A;  4ISU A;  1IMB A;  4JWY A;  1FBC A;  4F19 A;  2BJI A;  2DP8 A;  4G61 A;  5IZZ A;  2FIX A;  2DOJ A;  1YAE A;  2QVV A;  2ESN A;  1DPP A;  3N5L A;  2X7Q A;  4OHN A;  2HEU A;  2H9B A;  1B2H A;  4N6K A;  4JBZ A;  3HHF A;  1SYH A;  5IAI A;  3KC1 A;  1B52 A;  2A5T B;  1MS7 A;  4IO7 A;  1US4 A;  3G3I A;  1JET A;  3MP8 A;  4WXJ A;  1FPL A;  4WED A;  4F1Y A;  2PT2 A;  3C4M A;  1XOC A;  3HO7 A;  2Q8M A;  2F6G A;  4MFI A;  5EQ7 A;  2V3Q A;  4GQO A;  3H06 B;  4BDN A;  5AA4 A;  1B4H A;  3VXB A;  3S4U A;  3CIJ A;  3VV5 A;  3TZA A;  2Q2C A;  2DWA A;  2P1S A;  1M5D A;  4GX4 A;  3PUZ E;  3FXB A;  1FPI A;  1IMA A;  1AH5 A;  1R6Z A;  4OMB A;  3IAZ A;  1EZO A;  4HCW A;  3P7I A;  1P1N A;  1FJ6 A;  3E79 A;  3IFC A;  2B3B A;  4LON B;  2Z8D A;  3FJM A;  4MCO A;  4OYV A;  3QMF A;  4OEV A;  3CFX A;  1ZIU A;  4Q30 B;  1H3D A;  3EN3 A;  2F78 A;  1INP A;  1ZKB A;  1UQW A;  4GLI A;  1B3G A;  4DE8 A;  5I56 A;  2O1M A;  1USY E;  3U92 A;  3SES A;  4O3B A;  3CFZ A;  4PFR A;  1FQC A;  2P3V A;  4ZEC A;  4MNP A;  1I6B A;  5CMB A;  2HPG A;  1R9L A;  4PDH A;  4OFO A;  2QRY A;  3CVG A;  3G3J A;  3MVX A;  3KEI A;  4R75 A;  4F1V A;  3GXA A;  3LR1 A;  5IZ3 A;  2RIN A;  5AA1 A;  3KSJ A;  5M2V A;  2QS1 A;  3D4C A;  4OET A;  1B3L A;  3PMW A;  4MEV A;  4X48 A;  3SEU A;  2GHB A;  3T0J A;  3FVK A;  4K3F A;  2R9J A;  3TKD A;  1UIU A;  4OVS A;  1HSE A;  3EQ1 A;  4GRK A;  3FZV A;  1VE4 A;  2ZZW A;  2HXW A;  4HE1 A;  4NF6 B;  3C32 A;  3QXM A;  3SET A;  3ZSF A;  1FQB A;  1RYO A;  2O51 A;  3OEL A;  3VLW A;  3IOU A;  1NV0 A;  2UYE A;  2ZZX A;  1TXF A;  1B5J A;  1B46 A;  2VHA A;  4DZ1 A;  5TPA A;  2XHD A;  1IXH A;  3TQW A;  3U1O A;  5AA2 A;  2XXU A;  1RDZ A;  5IZ3 B;  3RUM A;  1N3X A;  2V84 A;  3IX1 A;  1MY3 A;  2DVZ A;  2YLN A;  2Y7R A;  1WDN A;  3G7W A;  4IO5 A;  4G68 B;  4GIZ A;  4F3B A;  4PET A;  1SYI A;  3IOW A;  3F11 A;  4IO3 A;  4EXL A;  1G0I A;  5AE4 A;  2XXP A;  4FED A;  3O2A A;  5J16 A;  1JNF A;  4O3A A;  4R6K A;  1MY4 A;  4N15 A;  3LSW A;  4OWD A;  2I4B A;  2ONR A;  1NV3 A;  4IY5 A;  1Z7N E;  4QHQ A;  2ALU A;  5ISU A;  4GWX A;  5BWJ A;  4NF4 A;  3N94 A;  4QFL A;  3E13 X;  2MKZ A;  3QSL A;  5LOM A;  1ATG A;  4NWD A;  3SZP A;  3W15 C;  4LZ5 A;  2WBB A;  4JXI A;  4DXB A;  3KOT A;  3HHG A;  4PFY A;  1MXZ A;  4AS5 A;  4QFK A;  3TCG A;  1FQA A;  1NV4 A;  1Q9D A;  2FNC A;  1LAG E;  3S2V A;  3K00 A;  4MJO A;  5A5L A;  3TYH A;  4NG7 A;  3L6H A;  2PX1 A;  4GX6 A;  4ZEB A;  1Q1K A;  4F3G A;  3MWB A;  1B3E A;  5H8H A;  1J1N A;  5L9M A;  2XXQ A;  1MPB A;  3OOA A;  1B7U A;  3O6H A;  1MXX A;  2Z23 A;  2LAO A;  5KCJ A;  4NF8 B;  2OWS A;  1CE2 A;  1SDX A;  2XWV A;  3QYT A;  2DE3 A;  1FW0 A;  3B6T A;  4P1E A;  2PVU A;  1FTO A;  5TPA B;  4JB7 A;  5I57 A;  1Y1Z A;  1MY2 A;  4P56 A;  1GV8 A;  2UVI A;  1QKB A;  4UAB A;  3KG2 A;  4XXU A;  1LB9 A;  1EYI A;  5DVJ A;  5CM6 A;  1UTH A;  5A5X B;  1GGG A;  4U1O A;  1HSJ A;  4G68 A;  4PDD A;  2F5X A;  3MVZ A;  1AIV A;  3CHG A;  2RCB A;  1UTB B;  4PAK A;  4Q5T A;  4POX A;  3QIM A;  4O3C A;  1BTJ A;  3KBR A;  4OVP A;  5EYG A;  1LBX A;  1USY H;  3UIF A;  2NWJ A;  2Y7P A;  4H1X A;  1NUZ A;  4MLQ A;  4QSD A;  3FBP A;  3A3U A;  2VPN A;  3SEX A;  2OZZ A;  1Y20 A;  3MZ1 A;  3QUJ A;  4NWC A;  4NAP A;  3B6W A;  1RKM A;  3CR9 A;  3KOS A;  1B7Z A;  4XF5 A;  3PD9 A;  4NF4 B;  3SEV A;  4ND9 A;  4X8R A;  4TLM B;  1GR2 A;  3TTR A;  4PTK A;  4LQ5 A;  1MY0 A;  3G3H A;  1MXY A;  1XVY A;  2PBW A;  1FCK A;  1IEJ A;  5FHN A;  3TFL A;  2F3D A;  4PGP A;  2VD3 A;  5FTH A;  3K6V A;  2VPO A;  4YKP A;  1YXI A;  2F8D A;  4F2O A;  3VLU A;  4U4S A;  2XWO A;  1MM6 A;  3G3G A;  3JYR A;  1IMC A;  1MQD A;  3GZG A;  3RPW A;  1FQD A;  5FHM A;  4I3Y A;  2O68 A;  1EYK A;  3HFU A;  4ZE9 A;  3GBA A;  2P2A A;  2OBG A;  4LAT A;  3K6X A;  1RDY A;  1P1O A;  2V93 A;  4POW A;  4FOR A;  3TCF A;  3K0V A;  2E0S A;  5CMK A;  2I58 A;  1TFD A;  3DP8 A;  3O9P A;  4GL0 A;  2HCA A;  4GL8 A;  4NE4 A;  4OES A;  5TU0 A;  3IOV A;  4KPT A;  2ONK E;  3T93 B;  2OK2 A;  4FEC A;  2VP1 A;  3Q26 A;  1Y4T A;  1NKX A;  4JSD A;  4G2Z A;  1BK4 A;  1B5I A;  3RGY A;  1T0K A;  2HFB A;  4EF1 A;  5L9S A;  2ZYO A;  1XS5 A;  1JQF A;  3MW0 A;  3UGW A;  5EHS A;  1D9Y A;  1IXG A;  1Z7M E;  4EQB A;  1OIB A;  3FGS A;  1IMD A;  1URD A;  5FBP A;  1IUD A;  4QRZ A;  1JVY A;  2OLB A;  4TQU Q;  1HSL A;  2HQ0 A;  1AOV A;  2VT5 A;  1FPE A;  3B7D A;  3M8U A;  4G4P A;  4NN3 A;  2PFZ A;  1FTA A;  3VE1 B;  1UIV A;  4PE3 A;  1ZBM A;  2QVR A;  3RLF E;  4IGR A;  5LDZ A;  4MMP A;  3RY3 A;  4PF6 A;  1OMP A;  4H65 A;  1B32 A;  1URG A;  2HZL A;  1CB6 A;  1KZ8 A;  1FPB A;  2Y5L A;  3FV1 A;  3KJ7 A;  4YZZ A;  3IB0 A;  2DXR A;  4IGT A;  4HTG A;  4RA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...