4HCZA

Phf1 tudor in complex with h3k36me3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 1
publication title Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4hczA00
3NTIA 3OYEA 3OYIA 3KUFA 1OYXA 4A4GA 5KCHA 2B8AA 4C5IA 3P8DA 3FEOA 4Q5WA 3H6ZA 4C5HA 2EQMA 2E6NA 2HQEA 3MP6A 3PNWC 3QIIA 2EQJA 2PQWA 5IN1A 3OYAA 3M9QA 3ME9A 5KE3A 3META 3QJ6A 4NS5A 2QQRA 4ZTJA 3OY9A 3S3MA 2L3RA 3EAEA 2R5AA 4IUPA 4IUTA 2DIGA 2RHIA 4E7JA 2RHXA 2RHUA 3LGFA 4GY5A 4N4GA 5D6WA 3MEWA 2M0OA 4PL6A 2MWOA 2M1HA 3PMTA 1N27A 5KCOA 4IUUA 3ZEHA 4X34A 2LTOA 3F70A 1SSFA 3BDLA 3PFSA 2L89A 3MP1A 3H8ZA 4IUVA 3L2QA 2R58A 2G3RA 2CKKA 2IG0A 3NTHA 2JTFA 4QVZA 2MWPA 3OQ5A 3UWNA 3SD4A 3Q1JA 1MHNA 5D6XA 4E7LA 2YRVA 3CEYA 4LD6A 5J39A 2JZ2A 3S3NA 5FROA 2VYTA 5C0MA 2EQKA 2X35A 4C5EA 2FHDA 3OS0A 5KE2A 1OZ3A 3DB4A 4IUQA 4BDZA 1OZ2A 3L42A 4HCZA 1KHCA 2WACA 4II1A 3OYBA 5FRNA 4CRIA 3OYGA 2RI2A 3MP8A 2BIVA 4L59A 4EDUA 3DB3A 2RI5A 3OS1A 2O4XB 2RJDA 3ASKA 2BKDN 3OMGA 4IURA 4IKFA 3LGLA 3OYFA 1OI1A 2BUDA 3LX7A 3OYDA 4RG2A 4QQGA 2K3XA 1WJSA 4ZTFA 3MEVA 3O8VA 4QQ6A 5IAYA 2QQSA 2HQXA 2XK0A 2RHZA 4B9XA 3MO8A 3OYMA 3E9FA 1G5VA 3OMCA 4BE2A 4QW2A 5M9OA 3QBYA 4E7HA 4A4HA 3OA6A 2R57A 4N4IA 2EFIA 1WGSA 4BE0A 3LH0A 3OB9A 3P8HA 4PLLA 3PMIA 4FL6A 2LCCA 2F5KA 1WJQA 4E7KA 3L2UA 4B9WA 4BDYA 3OYJA 1RI0A 2E5QA 2EKOA 5CIUA 4BACA 2GFUA 3MEUA 2GFAA 4Z02A 4PLIA 5KH6A 3LYIA 3OYLA 3L2WA 2RJFA 3OYHA 3OS2A 2LVMA 3NTKA 2X4WA 4E7IA 2K3YA 3QKJA 2RJEA 2LDMA 2RJCA 5J26A 5C6SA 2NLUA 2P0KA 2X4YA 4OVAA 3UT1A 2LRQA 5D6YA 2R5MA 3E9GA 4A4EA 3GOXA 2DAQA 2XDPA 1XNIA 1H3ZA 3C4SA 2DIQA 2X4XA 4BE1A 2L8DA 3FC3A 3LLRA 2D9TA 4N4HA 3OYKA 3FLGA 3FDRA 4FU6A 3L2RA 1WJRA 2GF7A 2RO0A 2M16A 3DLMA 4QQDA 4UC4A 3S3OA 4C5GA 3L2VA 2RHYA 5FRMA 3MEAA 3OYNA 3OYCA 2EQUA 4BD3A 2RI3A 2O4XA 4A4FA 3S6WA
chains in the Genus database with same CATH superfamily
1QCNA 1YJNT 3R6OA 3RIRA 2HEQA 3FEOA 1WLPB 3CCQA 2QDYB 3G71Q 2EJ9A 4Y91A 2DK3A 3OBYA 1LVKA 3JB9H 2OTJT 4DOVA 1T0HA 4M75A 2R5AA 4IUTA 1TOVA 3LGFA 3V8LA 1AZEA 2M0OA 4PL6A 2QTVA 4M7DG 3BY7A 3F70A 2O9VA 1X75C 1K0XA 3L2QA 4XU1A 2BE9B 5J3BA 4GBQA 1D1AA 2JW4A 4QVCA 4EPCA 2VYTA 1VQ5Q 4M7DA 1YJWQ 2WSFE 1MMNA 4IUQA 2MIOA 1VQ9A 1YIJT 1KHIA 2JT4A 2VVKA 2PVGB 2F5TX 4TVRA 1JJ2P 3L1AA 2XK0A 3CCET 2XDDA 2KRMA 4LDWA 4BE2A 1UJ0A 3PTAA 4PJOG 7AT1B 2GBQA 1VQ6T 3TREA 1BK2A 5L23A 2KRSA 2E5QA 4Z8AA 1PNJA 2DTHA 2KT8A 4PJOA 3UA6A 5A0LA 4JRQA 1VA7A 2LVMA 2K3YA 2DMOA 3CCRA 1VYTA 4M75F 3VS7A 1Q82U 1Q81U 3IQLA 3M5AA 1TWBA 1WX6A 4PJNA 4J83A 4M77G 4WF2A 9ATCB 3M58A 2AZSA 1A0NB 3CD6A 4A4KA 3RUXA 3FLGA 1QVGA 1QVFP 2J06A 2LJ0A 2MK5A 3LH5A 2X9HA 1P92A 2PU9B 4M77A 1WZOA 1OPKA 3JV3A 1VQOA 4P5NA 4A4GA 1H92A 2EJFA 1IXDA 4J9DA 4ZTJA 1FMKA 2CSIA 2QA4A 1D0XA 5GJWB 4KH1B 1KC8C 3EFRA 1MNDA 3M55A 1E6GA 1V76A 2FL7A 4GLKA 3SFMA 3DLLA 3OYYA 4JRKA 1QP2A 2OTLT 1UE9A 3QHSA 4DQ2A 1U1SA 3PVLA 2V8IA 1TH7A 3QUIA 2K4YA 1Q86R 2FO0A 1X6BA 3VS0A 1M1KR 3VS2A 2YWWA 4FYYB 1TSFA 2E5KA 1QVGS 3CC4T 2DL4A 2O4XB 4ZGJB 2FRWA 3TU4K 4QT7A 4RG2A 4C92G 1E7OA 3P8BB 1UB4A 4XAXB 1WIEA 1WHMA 3QYHB 1S72T 4JDSA 4EMHA 3M0UA 1RADB 4M78E 4M77F 5DM7R 1WJQA 1VQ4Q 2I2LA 1YJWA 2QDLA 1VQLT 2DVEA 2V26A 4M78C 2DYBA 2QASA 2VASA 1QKWA 3LYIA 1K8AR 2YT6A 2F2WA 1M30A 3OS2A 4VUBA 4ELZC 1UGVA 2BZXA 2LDMA 4EMKB 1IREB 1SHGA 4HCBA 1WNLA 2GCXA 2P0QA 4J9IA 1NJIR 2ZPEB 5KYWA 4JS4A 3AT1B 3CPFA 3EHQA 3VUZA 1YI2T 2P4RA 1M1GA 2X4XA 3JCMb 2D9TA 2KEAA 3OYKA 2E70A 4FU6A 1DJ7B 5DY9A 3EGXB 3C0CA 2M16A 2XHCA 2QEXT 2QGGA 2WSEE 2CZ6B 3S6WA 2RB6A 5KCHA 5GAN3 2CDTA 3QIIA 2E6NA 1NEGA 2EYZA 3NMZC 2QQRA 2QQBA 1WPYA 1N8RR 4LNPA 1QW1A 4E7JA 1K73R 4J5YA 3MEWA 4C8QC 3VKIA 1NYFA 5L8RE 1GXIE 4F17A 3JCMg 2L89A 3CCVA 3CCMA 4RG8A 1TS9A 1D0ZA 4M7AG 6AT1B 1JRIA 3PGGA 3G71T 3FB9A 1YFNA 3T9NA 2KRNA 3CC7Q 3OS0A 1TUCA 4BDZA 4HCZA 1MGQA 4M7AA 3PT9A 2MCNA 3VS5A 2Y4XA 3H0HA 3OMGA 2VGNA 2DJQA 1BI3A 1GCQC 2AHJB 4OF1A 2DXCA 5GAN2 5IXFA 2QQSA 4C0GA 3EFOB 1VQ5T 1SRMA 3A8OB 2RN8A 3RKWA 1NBEB 2X3XD 4PLLA 1VQMQ 2L3SA 4OB1B 3PMIA 2EPDA 1Q82C 2QG9B 2CSQA 5KYUB 5I22A 3HFOA 2RH2A 3QWXX 1ARKA 1D1CA 5CIUA 5HY6A 1YITQ 3OBWA 1BBZA 2WSCE 5GANd 1RAFB 3OSSC 1VQKQ 1IO6A 4GLMA 2RQWA 1U8RA 3G4SA 2K57A 3M4YA 4J9GA 3G7ZA 1FWZA 1YNZA 4ELYC 1UTIA 1VQ4A 3PIPA 5LJ5d 4JJBA 1WJRA 1X6OA 4FW2A 1IHVA 2RHYA 3URGA 5FRMA 3MEAA 4BD3A 4ANJA 2KT1A 2YLCA 3OYEA 3OYIA 3X25B 1C6VX 1CKAA 1JXMA 3MP6A 1Y71A 2EQJA 2DZCA 1WXBA 2PUOB 3EAEA 1ZSZB 1PSEA 5GANe 2KMTA 2ZCFB 4CC7A 4AFZC 5GANg 2XU8A 2EGEA 4QVZA 2DLPA 5FU6C 3MCAB 3Q1JA 4FT4A 4LD6A 1F1BB 5GMKi 5LJ5e 1QVGP 4Y28E 2JVVA 5HK0A 1NE8A 2K9GA 4EDUA 5LJ5g 3RERA 3M54A 3A8MB 3DB3A 1AHJB 2LT1A 4M78F 3NGPA 4XTWA 2DE0X 2LQNA 1X27A 1ZUKA 4HCCA 2XMFA 1JXOA 4HKEA 4L5GA 3M59A 2RD1A 1D09B 3O8VA 4QQ6A 5CKHA 3OYMA 2QK0A 2KNBB 4FSSA 1CKBA 4KGVB 4FM4B 2V8JA 2EKHA 2DERA 4RTZA 4XTZA 2QQ9A 1LCKA 1PRMC 4LXCA 1X43A 2P4TA 1ZA1B 4PLIA 4OGCA 3QXEB 3OYHA 3OS5A 2VC8A 4JZ3A 1X6GA 2D1XA 2AIRB 3CBMA 3H0IA 4OVAA 1U5SA 3I55A 2ZPGB 4ZN1A 2AKLA 2JS0A 2NUZA 5FWBA 3FRNA 2QGFB 2KI7A 3LWIA 3L2RA 3S3OA 2HKQB 1VQ7Q 2K2MA 1B7TA 2PTKA 4KH0B 2DF6A 3JCMW 4OGEA 4EMKA 4DA4A 3CCQQ 4Q5WA 5LJ3f 5IN1A 5EG2A 1TTHB 3A8HB 2ZAEA 1ZQ1A 3EG0A 3RMSA 1RLPC 4JS5A 2CZ0B 4AG1C 4A54A 1K76A 5GJVB 1M90C 3CPWA 3M0PA 2GNCA 4C8QD 1HXDA 1KD1R 1G2BA 1I1JA 1WYXA 3EGXA 3PFSA 2ZZDA 4A63B 1KIKA 3I56A 2A08A 4OB0B 1QCOA 1C1AA 3JB9G 1M1FA 1OX9A 3UWNA 4RMOA 1I5LA 5CR2A 4ZNXA 5FROA 1RLQC 4CC2A 4E7SA 1G83A 2HAXA 1ZHIA 3CCJA 1VQ9Q 3CBOA 2J05A 1RAEB 4PKCC 3NFCA 1OU8A 1D3BB 5LJ3j 4BB7A 1GFCA 5IAYA 5D7UA 3VYHB 2ED0A 2QYZA 2COYA 2OJ2A 4ME7A 2LT4A 3CC7T 1AEYA 3RKYA 1M2VB 1YWPA 3EG1A 2F5KA 4E7KA 2LNHB 4J9EA 3U23A 3CMAQ 3CPWS 4DBHA 2CT4A 5GANh 2CP3A 3CCRQ 4F16A 2DTOA 2L5QA 1R77A 4XTYA 1YN8A 3EFOA 2FZGB 2J7IA 3CBPA 3FC3A 3CD6Q 5GMKj 1YITT 1PRLC 1T3SA 4X9DA 5KYUA 3UA7A 1VQKT 1KQ1A 3INZA 1VQOQ 2V1RA 2B8AA 3P8DA 2RA2A 1MMDA 3QO3A 5CAIA 1ZSGA 2FPFA 3M9QA 4NS5A 1FMVA 2DA9A 1RACB 1QKXA 1AOJA 3JCMV 2DIGA 4J9BA 1LJOA 3BDLA 4DOWA 2DO3A 4J9HA 5GAMf 1VQ7A 2DEQA 1HSQA 4OMLA 3NTHA 4ORZA 2F2XA 3EG9B 4B6MA 2EYQA 1QP3A 4D6WA 4BUGA 5AT1B 2BTTA 3M56A 4II1A 1W2BA 2JUFA 2ED1A 2BIVA 1X2QA 1WDXA 1ZSZA 2KXCA 3LGLA 2YXYA 1EFNA 3OW2P 1NLPC 1VQ8Q 2E65A 4ZTFA 1K1ZA 4QW2A 4BI8B 4J7FA 1YJ9A 4N4IA 1VYUA 4NOYA 3E19A 2LP5A 3P8HA 2CT3A 3TQ7P 2JXBA 5GAMj 2FEIA 2HQHA 2GFUA 4KRTA 2O01E 1LNXA 1K9MC 4DEYA 2F2VA 3D7SB 5GAN8 1TU0B 4J8OA 2A3LA 2Y90A 4M78B 1TG0A 1WHGA 3H0FA 3QZ5B 4LUEA 1WHLA 2QXFA 4RTUA 1UGPB 1W2BS 3JAME 4O5VA 3VYGA 3CMAA 3CCSA 2PUKB 2RPNA 2Y4YA 4UC4A 5GAOq 2MAMA 4C0ZA 3CMET 4C92C 1AZGB 1ABQA 3TEEA 1Q81R 1U06A 3KUFA 3KFVA 3QG1A 2HSEB 2HL3A 3VUBA 5DLQE 3MHXA 2YUOA 1KQSA 1NPRA 2PVOB 3CCUA 1K0SA 4QKUA 3VS6A 3CCVQ 4AT1B 3CCMQ 1OULA 1PG5B 3CCQT 2JMCA 3JB9J 1BI1A 4KULA 5GMKm 3NHNA 1M3AA 5KYNA 5KE2A 2KE9A 2EBPA 1OZ3A 1UJYA 2FG0A 1YHQQ 2KBTA 2ECZA 5GAN5 3EH1A 2JTEA 1I81A 4IKFA 4JZ4A 2A0FB 2DPPB 1Q7YR 1RABB 3ZL7C 4M75D 2LCLA 1LPLA 4MMKA 1BB9A 1BCMA 1VIEA 1YP5A 5FU7C 2FYKA 2R57A 4ESRA 3CPWP 3V7RA 4RKUE 1B34B 1LOJA 3VS4A 2KVQG 1KQSS 1M8VA 1RI0A 4XTVA 1YCSB 2O2OA 4M7DD 2AK5A 4DBRA 1I0CA 3HL8A 4DBQA 1VQ8A 3G1JA 4M7AC 4R0KA 1D3BA 2P0KA 3I9QA 1OEBA 5GAOr 3G4SQ 1RI9A 1Q86U 1WQ7A 1M3CA 2C0TA 1M1KU 1NZ9A 1PM3A 1M2VA 2HSPA 4IIOA 1YCYA 4FSXA 4LDXA 2RQVA 3CCRT 3J7AF 4OMQA 1G3YA 3GF5A 1KSWA 2JTMA 2KYMA 2MMPA 3M0SA 4C5HA 4PJOD 3ZBDA 3ME9A 2CP2A 2L3RA 2EQIA 5IHNA 1O9SA 1MUZA 1W1FA 3TCJA 3EGDB 5A2QE 2EYWA 2KXDA 4JJDA 4F7UE 1VQOT 3H8ZA 3N5BB 1B07A 1MMAA 5LL6S 3RMQA 2KK4A 1NJIU 2QA4T 5FU6B 5CKDA 4M77D 1IRXA 4C8QE 2DKGA 3DB4A 1OZ2A 2YHTA 3VRZA 2H8HA 3OS1A 4LE9A 1UUEA 2H3EB 1FYNA 2F69A 2E10A 4ZGDB 2D6FA 2JNGA 2EGCA 5I21A 3E1SA 4X1VA 2VXEA 1VQNQ 4J6XA 4JRIA 1UG1A 1BIBA 3SWNC 1M90U 3EH2A 3BE3A 4FL6A 1D0YA 3L2UA 1N8RU 1WI7A 1IB8A 2K2VA 1K73U 2E3HA 1YHQA 4LDUA 5CKEA 5IT9E 2HNIA 1WHHA 5HK3A 5C6SA 3I55Q 2MF2A 4O6JA 5LJ3d 4CI0C 1K4US 2DAQA 1YJWT 1XNIA 4AFQC 3FJPA 1IZ6A 4YTLA 2L8DA 1Y96B 2PNIA 4N4HA 2DZ9A 3SEMA 4M78G 5CKFA 3DLMA 3L2VA 2X3WD 5GAOm 4C92D 2AKKA 5DLOA 5ECAA 4M78A 1KK7A 1AWXA 1OPLA 4XQ3A 3OYAA 4N0AC 3HRUA 3OY9A 3A8LB 4IUPA 2DL3A 2ROLA 2KDSA 5D6WA 1N27A 1ZA2B 3V8JA 2K7AA 5LJ3e 3M57A 3I56Q 2A36A 2CKKA 1MNEA 4FYVB 1ACMB 4PFZA 3CXCA 3V7CA 2RK1A 5LJ3g 2JZ2A 1VQPA 1KJWA 4MZPA 3CCLA 4IIMA 2VXFA 1AD5A 2FHDA 4WTOB 3CCJQ 3L42A 5FRNA 3MP8A 2D0NA 1NEBA 2BKDN 3CCVT 3CCMT 4JJNK 2CYZB 3UPUA 1NM7A 4MDXA 4QQGA 1WJSA 2EJGA 2DL5A 4L6V5 5I2MA 3QBYA 2RF0A 3OB9A 1ZX6A 2DD5A 2KR3A 2LCCA 4HVUA 5GMKe 1UEBA 4OP0A 2LMJA 2QAZA 4OMOA 1Q86C 2GGRA 2LCSA 5CK9A 1M1KC 1WXUA 2X4WA 2QI2A 1GCPA 1PKTA 3O5ZA 4FT2A 4MMLA 3JCMf 2DX1A 1IGUA 1JU5C 3CXCS 1VQNA 4M7AD 1ZUUA 3MKDA 5KYYB 2DD4A 2XDPA 4F04B 1GCQA 1W6XA 2VB6A 1AVZC 2DETA 1B34A 3ER0A 1SEMA 3WVEB 5GAMd 2HBWA 5CQYA 4J7IA 5GAN4 3G6EA 2RI3A 2O4XA 4J6YA 1TXQA 1BIAA 4CC4B 3G4ST 2PVDB 1K8AC 4C5IA 1EIFA 1PCXA 1M27C 2FZCB 2L3PA 3QJ6A 1VQ4T 4FW1A 1K9MU 2FVUA 1NJIC 2RHXA 4N4GA 3SHWA 2OX7A 4C8QF 5FWCA 2P84A 1QVFA 4LDYA 2KGTA 2VGMA 1SKUB 2JS2A 2JN0A 2R58A 3VU3C 2G3RA 2SEMA 3BDUA 1MMGA 3I35A 2CH4A 1M2OA 4E47A 2LX9A 2E6ZA 3BW1A 4FYWB 2VUBA 4Z88A 3GLXA 4EMGA 1QQJA 4JLGA 5GAMe 2A37A 1KHCA 3OYBA 3OYGA 2RI2A 4L59A 3C94A 4OMFB 1O75A 3GPLA 1ABOA 1I8FA 3EGDA 1OI1A 1N8RC 4XU2A 3RNJA 1UECA 4RCCA 4ZGEB 1K73C 2OAUA 2MI6A 2E4HA 2IVWA 4AFUC 3REAB 2DEUA 2D8JA 5IXBA 1YJ9Q 3KXTA 5FLXE 1UFFA 1Y0MA 2JMAA 3CC2A 2YUPA 1UGRB 4Z02A 1QMCA 4V2SA 1QVFS 2RJFA 1KD1U 3M4GA 5CQXA 4BI3A 5LJ3h 4M75C 5AYFA 2C0IA 1KC8R 4MZTA 1YJNA 2R5MA 2RQUA 1H3ZA 2L3QA 2LQKA 1Q95G 4M7DE 2OTJA 3CCSQ 1IGQA 2E3IA 2MPXC 4NL2A 2IPOB 3CC4Q 4KT0E 1SRLA 2RNAA 4M7DC 2L0AA 3OYCA 3I55T 2FPEA 2K79A 1SPKA 2VKNA 2XD0A 2GTJA 3QJYA 1PKSA 4ZN3A 4C92B 1YBYA 2ZPHB 4XTXA 4JJCA 1VQMT 2PQWA 2DRMA 2NYSA 4QVDA 3S3MA 3JB9I 2YLBA 2LX7A 2RHIA 4LDVA 5GMKh 3QSUA 1GRIA 1Y96A 4OMNA 1QLYA 3CCUQ 4X34A 2LTOA 1YIJA 1SSFA 2KYBA 3GNFB 2ESWA 3MP1A 4R56A 4PJOE 1G3TA 1M9SA 4C0DC 4C0FA 2RQTA 4E7LA 2DXUA 4XK8E 2DNUA 3CCEA 4PJOC 5HCKA 4C5EA 5CVIA 2PZ1A 3J80E 1YI2Q 2FRYA 1TUGB 2A28A 3RDVA 2WACA 1RAIB 5IHKA 1PSFA 1VQ6A 2M0YA 3HRTA 3I56T 3OYFA 4AG2C 5GAN6 4HT8A 3OSVA 3CMEA 3MEVA 4DEXA 3V8KA 4B9XA 3C12A 2QTXA 1AWWA 4E7HA 1QVPA 1PD0A 3OA6A 1VIFA 3CCJT 4PFPA 4M77C 2FPDA 2O9SA 5GAN7 4HT9A 5FU7B 2V1QA 1N9SA 4BACA 3MEUA 3TVTA 2ENMA 3HP9A 4E7IA 3QKJA 2NUTB 2DILA 4BY6C 3JB9D 1BI0A 2LRQA 4KUDK 3UATA 3HKSA 1XTDA 4M7AB 2BZ8A 2CUBA 4HXJA 3LLRA 3H9NA 4Y92A 1PWTA 3GNGA 5GAMh 1MV0B 2GF7A 1ZBJA 2XDBA 1D1BA 1S1NA 2FB7A 2DJZA 3UDCA 4A4FA 3PVQA 4RTVA 3E2UA 1WHJA 1FX7A 2DM1A 3A98A 4OB2B 2OTLA 2B86A 2EYXA 3H6ZA 3X28B 1I5OB 1GBQA 3M53A 3PNWC 3META 1NPPA 5KYYA 1BYMA 1SSHA 1E6HA 3WXMB 1G8XA 4C92E 4IUUA 3VV0A 2X51A 2C06A 1K9AA 3CC4A 2EWNA 2LQWA 3PIOA 1XQHA 3TSZA 1AWOA 4XTUA 1KG1A 1R8OB 1Q82R 4RUGA 1MHNA 2VWFA 5J39A 3REBB 1I4K1 2X35A 1VYVA 4F7UB 1S72A 3QWYA 1WHKA 4KUIA 2LQ8A 2RI5A 1W70A 1VQLA 1VQ7T 3J81E 1GBRA 2COWA 1OQKA 2KQWA 2XIDA 4C8QB 1RAHB 2LNVA 5A0DA 3LW5E 1BCOA 3OMCA 1KD1C 1WGSA 4LUDA 2GQVA 3EFSA 1GL5A 1YI2A 2NUPB 2EKOA 3SWNB 2HDAA 1HYOA 1X69A 2JM8A 5KH6A 3OYLA 3QDFA 3RESA 5IH2A 4M7DF 2LZ6B 4HVWA 2RJEA 2YUNA 2O88A 2YUQA 2QEXA 2E64A 1AWJA 1N5ZA 2LC4A 1YJ9T 3RBBB 5D6YA 1U1TA 2YRDA 3RR6A 5GAOl 1VQ9T 1SG5A 4AMCA 1Y07A 4X9CA 3BFMA 1MV3A 4M7AE 1Q7YU 2P0PA 3FIFA 3M0QA 2D8HA 2ABLA 1XJWB 1BU1A 2HZYA 1XOVA 2ZPIB 1NYGA 2JM9A 4PJOF 3G71A 1PD1A 5A0GA 2XKOC 1UDLA 3CCST 3CMAT 3JCMQ 2HKNA 1H3HA 4EIKA 3PMTA 1NLOC 1H8KA 1OOTA 2K5IA 3A8GB 4RTXA 1J3TA 2IIMA 3OQ5A 2AZVA 4PJJA 4FCYA 1VQPQ 1VQ5A 4DBFA 3CCLQ 4C92A 1FMWA 3CD6T 2LJ1A 4D8KA 3CCUT 2RJDA 3ASKA 1X01A 2F1LA 1K8AU 3JCMd 4AFSC 1Z9QA 4E6RA 1WXTA 3SB2A 3E9FA 2D0QB 2EGAA 1V1CA 2I0NA 5M9OA 1QWEA 1BKBA 1QCFA 3LH0A 1V29B 3FJ5A 2E1HA 1B3QA 4B9WA 1ZUYA 3KBGA 1JBMA 2E41A 4JPBW 3A1PA 1N9RA 2NLUA 2X4YA 3UT1A 4CC3A 4A4EA 5GAOp 2HL5C 1M90R 2YDLA 2V8KA 3EG9A 5IHIA 1H641 3C4SA 2DFUA 3JCMe 2DBMA 1QWFA 1WQWA 1N6AA 1VUBA 4E7ZA 2J6FA 1I07A 1VQ8T 4MDWA 3G6EQ 3OYNA 1T3LA 4C92F 2DXBA 2DTIA 3R6NA 2NUTA 1OYXA 2X4JA 2M02A 2BE7D 5KE3A 1W2BP 2KAFA 2RK2A 2XG8D 4HA8A 1PHTA 3HHTB 1YWOA 2MWOA 4HVVA 3ZEHA 2BZYA 1X2KA 1OU9A 4RTTA 1JQQA 1M8MA 4IUVA 5KYXB 1OV3A 5D6XA 1OX8A 1SHFA 2J6OA 2EQKA 1Q81C 2EYYA 2QQAA 4PNOA 5I11A 1BI2A 4CRIA 1G3WA 3HPWA 2YSQA 8AT1B 4F7UG 2EW3A 2HQXA 3TSWA 1G5VA 2COZA 5HKCA 4BE0A 2XI9A 1EZZB 1HD3A 1RL2A 2SRCA 5CO7A 4E2FB 4PFOA 1WFWA 4F7UA 3CC2Q 2RMOA 4C8QG 4D8DA 4EMKC 1HK9A 3VRYA 2C0OA 2ZPBB 3JRZA 1SF9A 3AHUA 2W10A 3HSBA 3OW2A 4KGZB 4M7AF 4C8QA 1YJNQ 1Q7YC 3CQTA 4M75B 3HFNA 1KQSP 1YHQT 2CREA 2OTJQ 4K11A 5CKBA 3FDRA 1Z9ZA 2LJ3A 2RO0A 4QQDA 2NUPA 3SWNA 4C5GA 4JUVA 2ZPFB 3V7SA 3I5RA 4M7DB 1M3BA 3PE0A 4KGXB 1JJ2A 2K5FA 2K5LA 4PJLA 2M9UA 2DL8A 5EC7A 4J9FA 2XICA 2RHUA 3NPFA 4GY5A 3MJXA 1JEGA 2M1HA 3RKXA 2MOXA 1YIJQ 3ZFJA 1M5Q1 1ZLMA 3MPUB 2K3BA 3OW2S 4RTYA 2CS7A 2JTFA 4HCKA 2KY9A 4XU3A 4FYXB 3SD4A 4F7UF 1TUDA 4A53A 2HBPA 2H3JA 3CEYA 3S3NA 3CCEQ 1EX4A 3L2ZA 4C0DB 3CC7A 1K9MR 1PC0A 2MYSA 3QYGB 1VQ6Q 3THKA 4PJOB 2DYIA 3JCMh 2ATCB 4M78D 2O31A 2CP5A 2L2PA 4RCBA 2EVRA 2HD0A 5CCAA 4N0AA 2CGHA 2DXTA 3LX7A 3OYDA 1M4ZA 4FIBA 1NG2A 3SDZA 3JSCA 2K3XA 3CMEQ 3X20B 2RHZA 3MO8A 1VQPT 3GBQA 1JJ2S 3CCLT 2OAWA 2A7YA 4R55A 2CP7A 3QDRB 2GQIA 3EG3A 1RAAB 1UHFA 1RAGB 1VQMA 3M0TA 4NL3A 4BDYA 4M77B 3QPHA 3L2WA 1YITA 3NTKA 5GAMg 1UGSB 2CZ1B 1RUWA 2GTOA 2E12A 2RJCA 3GP8A 1VQKA 3C95A 5GAOn 2FZKB 4BY6B 3GOXA 3VS1A 1JB0E 2DL7A 2JOYA 2Z0WA 4JLIA 3HTRA 3GIBA 4M75E 4F14A 2EQUA 1VQNT 4RTWA 1JO8A 5GANf 3NTIA 4J6WA 3JCMc 3LWHA 2OTLQ 1ZSZC 2EQMA 2HQEA 5I2SA 1W4SA 3VS3A 4ATOA 1R0CB 4KBMB 2KROA 5KCOA 2OI3A 4XU0A 3G6ET 5LJ5f 3M0RA 2DRKA 2CP0A 2AT1B 2IG0A 2MWPA 3JCMJ 1GFDA 1KC8U 1IHWA 1R0BG 2YRVA 1ZBXA 3X24B 2YRCA 5C0MA 3I5SA 2KSSA 1S72Q 4BI4A 4J9CA 4Z89A 2J6KA 2HMAA 3A5ZB 1AT1B 3EGUA 4OB3B 1CSKA 1VOMA 3DKMA 2DVJA 4LD9K 5GANj 4OMPA 1VQLQ 4IURA 2EAYA 5GMKl 1Y7XA 2BUDA 2CUDA 1UHCA 3UF4A 2DBKA 1HJDA 4JRPA 2G6FX 5KYXA 5KYWB 4A4HA 2EFIA 3H41A 3EG2A 2VV5A 1KQ2A 5LJ5j 5LJ5h 4PJMA 8ATCB 2W0ZA 2HCKA 2JJ9A 2K6DA 2M51A 3EHRA 3OYJA 2RQRA 2GFAA 3JCMX 4PK4A 2NWMA 3X26B 1U3OA 1KFZA 1Y57A 1T0JA 4WCIA 2QEXQ 2CZ7B 5J26A 3JB9F 4LN2A 5FW9A 3VJPA 3QZ9B 4M77E 2EIFA 2CP6A 3E9GA 3ULRB 3JCMP 2QA4Q 4OMMA 2ZGWA 3CC2T 2DIQA 1G3SA 4BE1A 1UGQB 1FXXA 4MZMA 4M4ZA 2CH4W 1WA7A 2RM4A 3WVDB 1C0MA 3CXCP 2ROTA 3HRSA 4M75G
chains in the Genus database with same CATH topology
5DLOA 1YJNT 3JCMW 3R6OA 4OGEA 3RIRA 1XOVA 4M78A 4EMKA 3FEOA 4Q5WA 3CCQA 4DA4A 2QDYB 2ZPIB 5LJ3f 4PJOF 2EJ9A 5IN1A 4Y91A 2DK3A 5EG2A 4XQ3A 3G71A 3OBYA 3OYAA 3A8HB 4N0AC 1ZQ1A 3HRUA 5A0GA 3RMSA 2XKOC 4DOVA 3A8LB 2CZ0B 3OY9A 3CCST 4JS5A 3CMAT 4A54A 3JCMQ 4M75A 2R5AA 4IUPA 4IUTA 3RERA 3LGFA 2KDSA 3V8LA 5D6WA 1M90C 3CPWA 2M0OA 4PL6A 3PMTA 4C8QD 1N27A 4M7DG 1HXDA 3BY7A 3F70A 3V8JA 2K5IA 5LJ3e 3M57A 3PFSA 1X75C 2ZZDA 3A8GB 3L2QA 3I56A 4XU1A 4OB0B 3JB9G 2CKKA 5J3BA 1M1FA 3OQ5A 3UWNA 4RMOA 3CXCA 3V7CA 1I5LA 2RK1A 5CR2A 5LJ3g 4QVCA 2JZ2A 5FROA 2VYTA 4EPCA 1VQPA 1VQ5A 4MZPA 4M7DA 3CCLA 2HAXA 2VXFA 2FHDA 4C92A 3CD6T 1ZHIA 2WSFE 3CCJA 4IUQA 3L42A 5FRNA 3CCUT 1VQ9A 1YIJT 3MP8A 3CBOA 1KHIA 2RJDA 3ASKA 1X01A 2BKDN 3CCVT 3CCMT 4JJNK 4PKCC 1K8AU 3NFCA 3JCMd 2PVGB 2CYZB 2F5TX 3UPUA 4MDXA 4TVRA 3SB2A 1D3BB 4QQGA 4BB7A 5LJ3j 1WJSA 1QVGS 2OTJT 5IAYA 3L1AA 2EJGA 2XK0A 3CCET 3VYHB 3E9FA 2XDDA 2D0QB 4LDWA 4ME7A 4BE2A 2LT4A 3PTAA 4PJOG 4L6V5 5I2MA 3QBYA 5M9OA 3CC7T 3RKYA 1BKBA 3LH0A 3OB9A 2DD5A 1V29B 1VQ6T 3TREA 2LCCA 5GMKe 2E1HA 2F5KA 4E7KA 4B9WA 1UEBA 2E5QA 3CPWS 3KBGA 4OP0A 1JBMA 4HT8A 2E41A 1Q86C 5GANh 2DTHA 4PJOA 5A0LA 5CK9A 4JRQA 1M1KC 2LVMA 2X4WA 2QI2A 2K3YA 4FT2A 3JCMf 4MMLA 3CCRA 2DTOA 2L5QA 1N9RA 3CXCS 4M75F 1Q82U 1VQNA 2NLUA 4M7AD 1Q81U 2X4YA 3UT1A 3M5AA 4XTYA 3OYDA 4A4EA 5GAOp 2V8KA 4J83A 4M77G 2DD4A 2XDPA 1H641 4WF2A 3M58A 3C4SA 3JCMe 3CBPA 3FC3A 3CD6A 1WQWA 4A4KA 5GMKj 1YITT 1B34A 1N6AA 1VUBA 3ER0A 3FLGA 3RUXA 1QVGA 4X9DA 3WVEB 1P92A 5GAMd 1VQ8T 4MDWA 5CQYA 4J7IA 2PU9B 5GAN4 4M77A 3OYNA 3G6EA 1VQKT 2RI3A 2O4XA 4J6YA 3JB9H 1KQ1A 4C92F 2DXBA 1BIAA 3INZA 1VQOA 2DTIA 3G4ST 2PVDB 1K8AC 1OYXA 4P5NA 4A4GA 2B8AA 3JB9J 4C5IA 3P8DA 2X4JA 2EJFA 2RA2A 1EIFA 3QO3A 5CAIA 3M9QA 5KE3A 2KAFA 3QJ6A 2RK2A 4NS5A 2QA4A 4ZTJA 2XG8D 1VQ4T 4HA8A 1K9MU 2FVUA 3JCMV 3EFRA 1KC8C 3HHTB 2DIGA 3M55A 1NJIC 2RHXA 4N4GA 2MWOA 4C8QF 1LJOA 3ZEHA 2FL7A 3BDLA 4GLKA 3SFMA 4DOWA 3DLLA 1QVFA 4LDYA 3OYYA 4JRKA 2DO3A 4IUVA 5GAMf 2VGMA 3VU3C 1VQ7A 1QP2A 2DEQA 2JN0A 2R58A 2G3RA 3NTHA 2OTLT 3QHSA 3BDUA 4DQ2A 1U1SA 5D6XA 4E47A 2EYQA 2LX9A 2V8IA 1TH7A 1QP3A 2E6ZA 3BW1A 3QUIA 2EQKA 2K4YA 2VUBA 4D6WA 4BUGA 3GLXA 1Q81C 4EMGA 2QQAA 4PNOA 4JLGA 5GAMe 1KHCA 1BI2A 3M56A 4II1A 3OYBA 4CRIA 1G3WA 2JUFA 2RI2A 3OYGA 1W2BA 2BIVA 4L59A 3HPWA 3CC4T 2O4XB 3C94A 4OMFB 1O75A 4ZGJB 3GPLA 3LGLA 3TU4K 1I8FA 1OI1A 1N8RC 4RG2A 4C92G 4XU2A 4RCCA 4ZGEB 1K73C 2E65A 4ZTFA 2OAUA 2MI6A 1UB4A 3P8BB 4F7UG 2HQXA 2IVWA 4XAXB 1G5VA 3QYHB 4QW2A 1S72T 4JDSA 4BI8B 4EMHA 5HKCA 4J7FA 1YJ9A 4N4IA 4BE0A 3KXTA 2XI9A 4NOYA 3E19A 3P8HA 4M78E 4M77F 1RL2A 5FLXE 5DM7R 5CO7A 1WJQA 2I2LA 1YJWA 1VQLT 4F7UA 5GAMj 3CC2A 2DVEA 4C8QG 2GFUA 4EMKC 1UGRB 4M78C 4Z02A 2O01E 3LYIA 1HK9A 1LNXA 1K9MC 4V2SA 1QVFS 2ZPBB 2RJFA 3JRZA 3OS2A 3M4GA 5GAN8 1KD1U 3AHUA 4J8OA 2A3LA 4VUBA 4ELZC 5CQXA 2LDMA 4BI3A 4EMKB 1IREB 3HSBA 2Y90A 4M78B 4M75C 5LJ3h 3OW2A 5AYFA 4M7AF 4HCBA 1WNLA 2GCXA 2P0QA 4MZTA 4C8QA 1Q7YC 1YJNA 2R5MA 2ZPEB 3QZ5B 4M75B 3HFNA 3CPFA 2QXFA 4JS4A 3VUZA 1YI2T 1UGPB 1H3ZA 1M1GA 2LQKA 1YHQT 2X4XA 1W2BS 3JCMb 2D9TA 3JAME 4M7DE 2OTJA 3OYKA 2E70A 5CKBA 3FDRA 4O5VA 3VYGA 4FU6A 1DJ7B 5DY9A 3CMAA 2PUKB 2RO0A 3CCSA 2M16A 4NL2A 4QQDA 2Y4YA 4UC4A 4KT0E 3SWNA 4C5GA 5GAOq 4M7DC 2XHCA 2MAMA 2QEXT 3OYCA 4C0ZA 3CMET 4JUVA 4C92C 3S6WA 2WSEE 2CZ6B 3I55T 3TEEA 2ZPFB 3V7SA 3KUFA 2RB6A 5KCHA 5GAN3 3QJYA 2XD0A 4M7DB 4ZN3A 4C92B 1JJ2A 1YBYA 2K5FA 2ZPHB 2E6NA 2K5LA 3QIIA 3QG1A 4XTXA 1VQMT 2PQWA 4QVDA 2QQRA 3VUBA 3S3MA 2QQBA 3JB9I 1WPYA 2M9UA 2YLBA 5DLQE 1QW1A 4E7JA 2RHIA 2XICA 2RHUA 3MHXA 4GY5A 4J5YA 4LDVA 5GMKh 3MEWA 4C8QC 3VKIA 1KQSA 3QSUA 5L8RE 1NPRA 1Y96A 2M1HA 2PVOB 3RKXA 1GXIE 3CCUA 4X34A 2LTOA 3ZFJA 1YIJA 1SSFA 1M5Q1 3GNFB 3JCMg 2L89A 3CCVA 3MP1A 3CCMA 4RG8A 4R56A 3OW2S 2CS7A 4M7AG 2JTFA 4PJOE 2KY9A 3CCQT 4XU3A 1JRIA 1G3TA 1M9SA 1BI1A 3PGGA 4C0DC 3SD4A 4F7UF 3G71T 3FB9A 4KULA 4C0FA 5GMKm 4A53A 4E7LA 2HBPA 2H3JA 3CEYA 2DXUA 4XK8E 3CCEA 3S3NA 3T9NA 3L2ZA 4PJOC 4C0DB 4C5EA 3OS0A 5KE2A 5CVIA 3CC7A 3J80E 1OZ3A 4BDZA 4HCZA 2WACA 1MGQA 3QYGB 4M7AA 4PJOB 3PT9A 5GAN5 1PSFA 1VQ6A 3JCMh 2Y4XA 4M78D 3HRTA 3OMGA 1I81A 4RCBA 4IKFA 3I56T 3OYFA 2VGNA 2HD0A 2DPPB 4N0AA 5CCAA 2CGHA 2DXTA 3LX7A 5GAN6 1BI3A 1M4ZA 2AHJB 4FIBA 2DXCA 3OSVA 4OF1A 3JSCA 3SDZA 2K3XA 5GAN2 3X20B 3CMEA 3MEVA 4M75D 3V8KA 2QQSA 4B9XA 2LCLA 2RHZA 4C0GA 3MO8A 1VQPT 4MMKA 1VQ5T 3C12A 3A8OB 1JJ2S 3CCLT 2QTXA 2A7YA 3RKWA 4R55A 1VIEA 4E7HA 1QVPA 3OA6A 5FU7C 2FYKA 1VIFA 2R57A 3CCJT 3QDRB 4M77C 4PLLA 4RKUE 1B34B 3V7RA 1LOJA 4OB1B 3PMIA 1VQMA 1Q82C 4NL3A 5GAN7 2KVQG 4BDYA 3HFOA 1KQSS 1RI0A 4HT9A 2RH2A 5FU7B 1M8VA 1N9SA 5CIUA 4BACA 3MEUA 4M77B 4XTVA 3QPHA 5HY6A 3OBWA 3L2WA 1YITA 3HP9A 4M7DD 4E7IA 3NTKA 5GAMg 2WSCE 1UGSB 2CZ1B 3QKJA 5GANd 3OSSC 3HL8A 2E12A 2RJCA 1VQ8A 4BY6C 3GP8A 4M7AC 3JB9D 1BI0A 1VQKA 3C95A 1D3BA 2P0KA 5GAOn 1U8RA 2LRQA 5GAOr 3G4SA 4KUDK 2K57A 3HKSA 1XTDA 4BY6B 3GOXA 1Q86U 4M7AB 3M4YA 1WQ7A 3G7ZA 1FWZA 1M1KU 1NZ9A 3LLRA 1JB0E 4ELYC 1VQ4A 3PIPA 5LJ5d 3GNGA 5GAMh 1WJRA 1X6OA 1YCYA 2GF7A 2JOYA 4FSXA 4LDXA 4JLIA 2XDBA 3GIBA 4M75E 3CCRT 2RHYA 2FB7A 3URGA 5FRMA 1G3YA 3GF5A 3MEAA 3J7AF 2EQUA 4BD3A 2DJZA 3UDCA 1VQNT 4A4FA 5GANf 3NTIA 4J6WA 2YLCA 3JCMc 3OYEA 2JTMA 3OYIA 3X25B 3LWHA 1FX7A 4OB2B 2MMPA 2OTLA 3X28B 3H6ZA 4C5HA 2EQMA 2HQEA 3MP6A 4PJOD 3M53A 1Y71A 2EQJA 3PNWC 2DZCA 3ZBDA 3ME9A 5I2SA 3META 1NPPA 1W4SA 2L3RA 2PUOB 4ATOA 3EAEA 4KBMB 1PSEA 5GANe 1BYMA 1O9SA 3TCJA 5KCOA 4XU0A 3WXMB 5A2QE 2KMTA 4C92E 4IUUA 5LJ5f 3G6ET 3VV0A 2ZCFB 4F7UE 2C06A 3CC4A 1VQOT 2EWNA 5GANg 3H8ZA 3N5BB 3PIOA 1XQHA 2XU8A 2IG0A 4XTUA 1KG1A 1R8OB 4QVZA 2MWPA 5FU6C 5LL6S 3JCMJ 3RMQA 3MCAB 3Q1JA 1MHNA 4FT4A 1KC8U 2KK4A 2YRVA 4LD6A 5J39A 5GMKi 1ZBXA 3X24B 1I4K1 2QA4T 1NJIU 5C0MA 5LJ5e 2KSSA 2X35A 5FU6B 5CKDA 4M77D 4F7UB 4Y28E 4BI4A 2JVVA 1S72A 4C8QE 2DKGA 3A5ZB 3DB4A 1OZ2A 4OB3B 5HK0A 1NE8A 2YHTA 4KUIA 3DKMA 4EDUA 5LJ5g 3M54A 3A8MB 2LQ8A 2RI5A 1AHJB 2LT1A 3DB3A 4M78F 3OS1A 5GANj 4IURA 1VQLA 2EAYA 4ZGDB 2F69A 2E10A 4XTWA 1Y7XA 5GMKl 3J81E 2JNGA 1VQ7T 2D6FA 4HCCA 2BUDA 5I21A 3E1SA 4HKEA 4L5GA 2KQWA 2XIDA 3M59A 4C8QB 2RD1A 2VXEA 3O8VA 4J6XA 4QQ6A 2LNVA 5CKHA 5A0DA 3OYMA 4JRPA 4LD9K 3LW5E 4JRIA 3OMCA 1KD1C 1BIBA 4A4HA 3SWNC 4FM4B 2EFIA 1WGSA 2V8JA 1M90U 2VV5A 4XTZA 5LJ5j 5LJ5h 1KQ2A 4FL6A 2GQVA 2QQ9A 3EFSA 3L2UA 1N8RU 1YI2A 3OYJA 2EKOA 3SWNB 2K2VA 1K73U 2P4TA 1YHQA 2GFAA 5KH6A 4PLIA 3OYLA 3JCMX 4OGCA 4LDUA 5CKEA 3RESA 5IT9E 4M7DF 3QXEB 3X26B 2HNIA 3OYHA 3OS5A 2VC8A 2RJEA 3CBMA 2CZ7B 2E64A 2QEXA 5J26A 3JB9F 5HK3A 5C6SA 3VJPA 2LC4A 4OVAA 2MF2A 3I55A 3QZ9B 4O6JA 4M77E 5LJ3d 4CI0C 1YJ9T 2EIFA 5D6YA 3E9GA 2ZPGB 3JCMP 4ZN1A 2DAQA 1YJWT 1U1TA 1XNIA 2ZGWA 3CC2T 2DIQA 3FJPA 1IZ6A 5GAOl 1G3SA 2L8DA 4YTLA 1Y96B 4BE1A 1VQ9T 4N4HA 1UGQB 2DZ9A 1FXXA 3FRNA 1Y07A 4MZMA 4M78G 3LWIA 4X9CA 3L2RA 5CKFA 3DLMA 3BFMA 3S3OA 3L2VA 4M7AE 2RM4A 3WVDB 2P0PA 3FIFA 1Q7YU 5GAOm 3HRSA 4M75G 4C92D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTI A;  3OYE A;  3OYI A;  3KUF A;  1OYX A;  4A4G A;  5KCH A;  2B8A A;  4C5I A;  3P8D A;  3FEO A;  4Q5W A;  3H6Z A;  4C5H A;  2EQM A;  2E6N A;  2HQE A;  3MP6 A;  3PNW C;  3QII A;  2EQJ A;  2PQW A;  5IN1 A;  3OYA A;  3M9Q A;  3ME9 A;  5KE3 A;  3MET A;  3QJ6 A;  4NS5 A;  2QQR A;  4ZTJ A;  3OY9 A;  3S3M A;  2L3R A;  3EAE A;  2R5A A;  4IUP A;  4IUT A;  2DIG A;  2RHI A;  4E7J A;  2RHX A;  2RHU A;  3LGF A;  4GY5 A;  4N4G A;  5D6W A;  3MEW A;  2M0O A;  4PL6 A;  2MWO A;  2M1H A;  3PMT A;  1N27 A;  5KCO A;  4IUU A;  3ZEH A;  4X34 A;  2LTO A;  3F70 A;  1SSF A;  3BDL A;  3PFS A;  2L89 A;  3MP1 A;  3H8Z A;  4IUV A;  3L2Q A;  2R58 A;  2G3R A;  2CKK A;  2IG0 A;  3NTH A;  2JTF A;  4QVZ A;  2MWP A;  3OQ5 A;  3UWN A;  3SD4 A;  3Q1J A;  1MHN A;  5D6X A;  4E7L A;  2YRV A;  3CEY A;  4LD6 A;  5J39 A;  2JZ2 A;  3S3N A;  5FRO A;  2VYT A;  5C0M A;  2EQK A;  2X35 A;  4C5E A;  2FHD A;  3OS0 A;  5KE2 A;  1OZ3 A;  3DB4 A;  4IUQ A;  4BDZ A;  1OZ2 A;  3L42 A;  4HCZ A;  1KHC A;  2WAC A;  4II1 A;  3OYB A;  5FRN A;  4CRI A;  3OYG A;  2RI2 A;  3MP8 A;  2BIV A;  4L59 A;  4EDU A;  3DB3 A;  2RI5 A;  3OS1 A;  2O4X B;  2RJD A;  3ASK A;  2BKD N;  3OMG A;  4IUR A;  4IKF A;  3LGL A;  3OYF A;  1OI1 A;  2BUD A;  3LX7 A;  3OYD A;  4RG2 A;  4QQG A;  2K3X A;  1WJS A;  4ZTF A;  3MEV A;  3O8V A;  4QQ6 A;  5IAY A;  2QQS A;  2HQX A;  2XK0 A;  2RHZ A;  4B9X A;  3MO8 A;  3OYM A;  3E9F A;  1G5V A;  3OMC A;  4BE2 A;  4QW2 A;  5M9O A;  3QBY A;  4E7H A;  4A4H A;  3OA6 A;  2R57 A;  4N4I A;  2EFI A;  1WGS A;  4BE0 A;  3LH0 A;  3OB9 A;  3P8H A;  4PLL A;  3PMI A;  4FL6 A;  2LCC A;  2F5K A;  1WJQ A;  4E7K A;  3L2U A;  4B9W A;  4BDY A;  3OYJ A;  1RI0 A;  2E5Q A;  2EKO A;  5CIU A;  4BAC A;  2GFU A;  3MEU A;  2GFA A;  4Z02 A;  4PLI A;  5KH6 A;  3LYI A;  3OYL A;  3L2W A;  2RJF A;  3OYH A;  3OS2 A;  2LVM A;  3NTK A;  2X4W A;  4E7I A;  2K3Y A;  3QKJ A;  2RJE A;  2LDM A;  2RJC A;  5J26 A;  5C6S A;  2NLU A;  2P0K A;  2X4Y A;  4OVA A;  3UT1 A;  2LRQ A;  5D6Y A;  2R5M A;  3E9G A;  4A4E A;  3GOX A;  2DAQ A;  2XDP A;  1XNI A;  1H3Z A;  3C4S A;  2DIQ A;  2X4X A;  4BE1 A;  2L8D A;  3FC3 A;  3LLR A;  2D9T A;  4N4H A;  3OYK A;  3FLG A;  3FDR A;  4FU6 A;  3L2R A;  1WJR A;  2GF7 A;  2RO0 A;  2M16 A;  3DLM A;  4QQD A;  4UC4 A;  3S3O A;  4C5G A;  3L2V A;  2RHY A;  5FRM A;  3MEA A;  3OYN A;  3OYC A;  2EQU A;  4BD3 A;  2RI3 A;  2O4X A;  4A4F A;  3S6W A; 
#chains in the Genus database with same CATH topology
 1QCN A;  1YJN T;  3R6O A;  3RIR A;  2HEQ A;  3FEO A;  1WLP B;  3CCQ A;  2QDY B;  3G71 Q;  2EJ9 A;  4Y91 A;  2DK3 A;  3OBY A;  1LVK A;  3JB9 H;  2OTJ T;  4DOV A;  1T0H A;  4M75 A;  2R5A A;  4IUT A;  1TOV A;  3LGF A;  3V8L A;  1AZE A;  2M0O A;  4PL6 A;  2QTV A;  4M7D G;  3BY7 A;  3F70 A;  2O9V A;  1X75 C;  1K0X A;  3L2Q A;  4XU1 A;  2BE9 B;  5J3B A;  4GBQ A;  1D1A A;  2JW4 A;  4QVC A;  4EPC A;  2VYT A;  1VQ5 Q;  4M7D A;  1YJW Q;  2WSF E;  1MMN A;  4IUQ A;  2MIO A;  1VQ9 A;  1YIJ T;  1KHI A;  2JT4 A;  2VVK A;  2PVG B;  2F5T X;  4TVR A;  1JJ2 P;  3L1A A;  2XK0 A;  3CCE T;  2XDD A;  2KRM A;  4LDW A;  4BE2 A;  1UJ0 A;  3PTA A;  4PJO G;  7AT1 B;  2GBQ A;  1VQ6 T;  3TRE A;  1BK2 A;  5L23 A;  2KRS A;  2E5Q A;  4Z8A A;  1PNJ A;  2DTH A;  2KT8 A;  4PJO A;  3UA6 A;  5A0L A;  4JRQ A;  1VA7 A;  2LVM A;  2K3Y A;  2DMO A;  3CCR A;  1VYT A;  4M75 F;  3VS7 A;  1Q82 U;  1Q81 U;  3IQL A;  3M5A A;  1TWB A;  1WX6 A;  4PJN A;  4J83 A;  4M77 G;  4WF2 A;  9ATC B;  3M58 A;  2AZS A;  1A0N B;  3CD6 A;  4A4K A;  3RUX A;  3FLG A;  1QVG A;  1QVF P;  2J06 A;  2LJ0 A;  2MK5 A;  3LH5 A;  2X9H A;  1P92 A;  2PU9 B;  4M77 A;  1WZO A;  1OPK A;  3JV3 A;  1VQO A;  4P5N A;  4A4G A;  1H92 A;  2EJF A;  1IXD A;  4J9D A;  4ZTJ A;  1FMK A;  2CSI A;  2QA4 A;  1D0X A;  5GJW B;  4KH1 B;  1KC8 C;  3EFR A;  1MND A;  3M55 A;  1E6G A;  1V76 A;  2FL7 A;  4GLK A;  3SFM A;  3DLL A;  3OYY A;  4JRK A;  1QP2 A;  2OTL T;  1UE9 A;  3QHS A;  4DQ2 A;  1U1S A;  3PVL A;  2V8I A;  1TH7 A;  3QUI A;  2K4Y A;  1Q86 R;  2FO0 A;  1X6B A;  3VS0 A;  1M1K R;  3VS2 A;  2YWW A;  4FYY B;  1TSF A;  2E5K A;  1QVG S;  3CC4 T;  2DL4 A;  2O4X B;  4ZGJ B;  2FRW A;  3TU4 K;  4QT7 A;  4RG2 A;  4C92 G;  1E7O A;  3P8B B;  1UB4 A;  4XAX B;  1WIE A;  1WHM A;  3QYH B;  1S72 T;  4JDS A;  4EMH A;  3M0U A;  1RAD B;  4M78 E;  4M77 F;  5DM7 R;  1WJQ A;  1VQ4 Q;  2I2L A;  1YJW A;  2QDL A;  1VQL T;  2DVE A;  2V26 A;  4M78 C;  2DYB A;  2QAS A;  2VAS A;  1QKW A;  3LYI A;  1K8A R;  2YT6 A;  2F2W A;  1M30 A;  3OS2 A;  4VUB A;  4ELZ C;  1UGV A;  2BZX A;  2LDM A;  4EMK B;  1IRE B;  1SHG A;  4HCB A;  1WNL A;  2GCX A;  2P0Q A;  4J9I A;  1NJI R;  2ZPE B;  5KYW A;  4JS4 A;  3AT1 B;  3CPF A;  3EHQ A;  3VUZ A;  1YI2 T;  2P4R A;  1M1G A;  2X4X A;  3JCM b;  2D9T A;  2KEA A;  3OYK A;  2E70 A;  4FU6 A;  1DJ7 B;  5DY9 A;  3EGX B;  3C0C A;  2M16 A;  2XHC A;  2QEX T;  2QGG A;  2WSE E;  2CZ6 B;  3S6W A;  2RB6 A;  5KCH A;  5GAN 3;  2CDT A;  3QII A;  2E6N A;  1NEG A;  2EYZ A;  3NMZ C;  2QQR A;  2QQB A;  1WPY A;  1N8R R;  4LNP A;  1QW1 A;  4E7J A;  1K73 R;  4J5Y A;  3MEW A;  4C8Q C;  3VKI A;  1NYF A;  5L8R E;  1GXI E;  4F17 A;  3JCM g;  2L89 A;  3CCV A;  3CCM A;  4RG8 A;  1TS9 A;  1D0Z A;  4M7A G;  6AT1 B;  1JRI A;  3PGG A;  3G71 T;  3FB9 A;  1YFN A;  3T9N A;  2KRN A;  3CC7 Q;  3OS0 A;  1TUC A;  4BDZ A;  4HCZ A;  1MGQ A;  4M7A A;  3PT9 A;  2MCN A;  3VS5 A;  2Y4X A;  3H0H A;  3OMG A;  2VGN A;  2DJQ A;  1BI3 A;  1GCQ C;  2AHJ B;  4OF1 A;  2DXC A;  5GAN 2;  5IXF A;  2QQS A;  4C0G A;  3EFO B;  1VQ5 T;  1SRM A;  3A8O B;  2RN8 A;  3RKW A;  1NBE B;  2X3X D;  4PLL A;  1VQM Q;  2L3S A;  4OB1 B;  3PMI A;  2EPD A;  1Q82 C;  2QG9 B;  2CSQ A;  5KYU B;  5I22 A;  3HFO A;  2RH2 A;  3QWX X;  1ARK A;  1D1C A;  5CIU A;  5HY6 A;  1YIT Q;  3OBW A;  1BBZ A;  2WSC E;  5GAN d;  1RAF B;  3OSS C;  1VQK Q;  1IO6 A;  4GLM A;  2RQW A;  1U8R A;  3G4S A;  2K57 A;  3M4Y A;  4J9G A;  3G7Z A;  1FWZ A;  1YNZ A;  4ELY C;  1UTI A;  1VQ4 A;  3PIP A;  5LJ5 d;  4JJB A;  1WJR A;  1X6O A;  4FW2 A;  1IHV A;  2RHY A;  3URG A;  5FRM A;  3MEA A;  4BD3 A;  4ANJ A;  2KT1 A;  2YLC A;  3OYE A;  3OYI A;  3X25 B;  1C6V X;  1CKA A;  1JXM A;  3MP6 A;  1Y71 A;  2EQJ A;  2DZC A;  1WXB A;  2PUO B;  3EAE A;  1ZSZ B;  1PSE A;  5GAN e;  2KMT A;  2ZCF B;  4CC7 A;  4AFZ C;  5GAN g;  2XU8 A;  2EGE A;  4QVZ A;  2DLP A;  5FU6 C;  3MCA B;  3Q1J A;  4FT4 A;  4LD6 A;  1F1B B;  5GMK i;  5LJ5 e;  1QVG P;  4Y28 E;  2JVV A;  5HK0 A;  1NE8 A;  2K9G A;  4EDU A;  5LJ5 g;  3RER A;  3M54 A;  3A8M B;  3DB3 A;  1AHJ B;  2LT1 A;  4M78 F;  3NGP A;  4XTW A;  2DE0 X;  2LQN A;  1X27 A;  1ZUK A;  4HCC A;  2XMF A;  1JXO A;  4HKE A;  4L5G A;  3M59 A;  2RD1 A;  1D09 B;  3O8V A;  4QQ6 A;  5CKH A;  3OYM A;  2QK0 A;  2KNB B;  4FSS A;  1CKB A;  4KGV B;  4FM4 B;  2V8J A;  2EKH A;  2DER A;  4RTZ A;  4XTZ A;  2QQ9 A;  1LCK A;  1PRM C;  4LXC A;  1X43 A;  2P4T A;  1ZA1 B;  4PLI A;  4OGC A;  3QXE B;  3OYH A;  3OS5 A;  2VC8 A;  4JZ3 A;  1X6G A;  2D1X A;  2AIR B;  3CBM A;  3H0I A;  4OVA A;  1U5S A;  3I55 A;  2ZPG B;  4ZN1 A;  2AKL A;  2JS0 A;  2NUZ A;  5FWB A;  3FRN A;  2QGF B;  2KI7 A;  3LWI A;  3L2R A;  3S3O A;  2HKQ B;  1VQ7 Q;  2K2M A;  1B7T A;  2PTK A;  4KH0 B;  2DF6 A;  3JCM W;  4OGE A;  4EMK A;  4DA4 A;  3CCQ Q;  4Q5W A;  5LJ3 f;  5IN1 A;  5EG2 A;  1TTH B;  3A8H B;  2ZAE A;  1ZQ1 A;  3EG0 A;  3RMS A;  1RLP C;  4JS5 A;  2CZ0 B;  4AG1 C;  4A54 A;  1K76 A;  5GJV B;  1M90 C;  3CPW A;  3M0P A;  2GNC A;  4C8Q D;  1HXD A;  1KD1 R;  1G2B A;  1I1J A;  1WYX A;  3EGX A;  3PFS A;  2ZZD A;  4A63 B;  1KIK A;  3I56 A;  2A08 A;  4OB0 B;  1QCO A;  1C1A A;  3JB9 G;  1M1F A;  1OX9 A;  3UWN A;  4RMO A;  1I5L A;  5CR2 A;  4ZNX A;  5FRO A;  1RLQ C;  4CC2 A;  4E7S A;  1G83 A;  2HAX A;  1ZHI A;  3CCJ A;  1VQ9 Q;  3CBO A;  2J05 A;  1RAE B;  4PKC C;  3NFC A;  1OU8 A;  1D3B B;  5LJ3 j;  4BB7 A;  1GFC A;  5IAY A;  5D7U A;  3VYH B;  2ED0 A;  2QYZ A;  2COY A;  2OJ2 A;  4ME7 A;  2LT4 A;  3CC7 T;  1AEY A;  3RKY A;  1M2V B;  1YWP A;  3EG1 A;  2F5K A;  4E7K A;  2LNH B;  4J9E A;  3U23 A;  3CMA Q;  3CPW S;  4DBH A;  2CT4 A;  5GAN h;  2CP3 A;  3CCR Q;  4F16 A;  2DTO A;  2L5Q A;  1R77 A;  4XTY A;  1YN8 A;  3EFO A;  2FZG B;  2J7I A;  3CBP A;  3FC3 A;  3CD6 Q;  5GMK j;  1YIT T;  1PRL C;  1T3S A;  4X9D A;  5KYU A;  3UA7 A;  1VQK T;  1KQ1 A;  3INZ A;  1VQO Q;  2V1R A;  2B8A A;  3P8D A;  2RA2 A;  1MMD A;  3QO3 A;  5CAI A;  1ZSG A;  2FPF A;  3M9Q A;  4NS5 A;  1FMV A;  2DA9 A;  1RAC B;  1QKX A;  1AOJ A;  3JCM V;  2DIG A;  4J9B A;  1LJO A;  3BDL A;  4DOW A;  2DO3 A;  4J9H A;  5GAM f;  1VQ7 A;  2DEQ A;  1HSQ A;  4OML A;  3NTH A;  4ORZ A;  2F2X A;  3EG9 B;  4B6M A;  2EYQ A;  1QP3 A;  4D6W A;  4BUG A;  5AT1 B;  2BTT A;  3M56 A;  4II1 A;  1W2B A;  2JUF A;  2ED1 A;  2BIV A;  1X2Q A;  1WDX A;  1ZSZ A;  2KXC A;  3LGL A;  2YXY A;  1EFN A;  3OW2 P;  1NLP C;  1VQ8 Q;  2E65 A;  4ZTF A;  1K1Z A;  4QW2 A;  4BI8 B;  4J7F A;  1YJ9 A;  4N4I A;  1VYU A;  4NOY A;  3E19 A;  2LP5 A;  3P8H A;  2CT3 A;  3TQ7 P;  2JXB A;  5GAM j;  2FEI A;  2HQH A;  2GFU A;  4KRT A;  2O01 E;  1LNX A;  1K9M C;  4DEY A;  2F2V A;  3D7S B;  5GAN 8;  1TU0 B;  4J8O A;  2A3L A;  2Y90 A;  4M78 B;  1TG0 A;  1WHG A;  3H0F A;  3QZ5 B;  4LUE A;  1WHL A;  2QXF A;  4RTU A;  1UGP B;  1W2B S;  3JAM E;  4O5V A;  3VYG A;  3CMA A;  3CCS A;  2PUK B;  2RPN A;  2Y4Y A;  4UC4 A;  5GAO q;  2MAM A;  4C0Z A;  3CME T;  4C92 C;  1AZG B;  1ABQ A;  3TEE A;  1Q81 R;  1U06 A;  3KUF A;  3KFV A;  3QG1 A;  2HSE B;  2HL3 A;  3VUB A;  5DLQ E;  3MHX A;  2YUO A;  1KQS A;  1NPR A;  2PVO B;  3CCU A;  1K0S A;  4QKU A;  3VS6 A;  3CCV Q;  4AT1 B;  3CCM Q;  1OUL A;  1PG5 B;  3CCQ T;  2JMC A;  3JB9 J;  1BI1 A;  4KUL A;  5GMK m;  3NHN A;  1M3A A;  5KYN A;  5KE2 A;  2KE9 A;  2EBP A;  1OZ3 A;  1UJY A;  2FG0 A;  1YHQ Q;  2KBT A;  2ECZ A;  5GAN 5;  3EH1 A;  2JTE A;  1I81 A;  4IKF A;  4JZ4 A;  2A0F B;  2DPP B;  1Q7Y R;  1RAB B;  3ZL7 C;  4M75 D;  2LCL A;  1LPL A;  4MMK A;  1BB9 A;  1BCM A;  1VIE A;  1YP5 A;  5FU7 C;  2FYK A;  2R57 A;  4ESR A;  3CPW P;  3V7R A;  4RKU E;  1B34 B;  1LOJ A;  3VS4 A;  2KVQ G;  1KQS S;  1M8V A;  1RI0 A;  4XTV A;  1YCS B;  2O2O A;  4M7D D;  2AK5 A;  4DBR A;  1I0C A;  3HL8 A;  4DBQ A;  1VQ8 A;  3G1J A;  4M7A C;  4R0K A;  1D3B A;  2P0K A;  3I9Q A;  1OEB A;  5GAO r;  3G4S Q;  1RI9 A;  1Q86 U;  1WQ7 A;  1M3C A;  2C0T A;  1M1K U;  1NZ9 A;  1PM3 A;  1M2V A;  2HSP A;  4IIO A;  1YCY A;  4FSX A;  4LDX A;  2RQV A;  3CCR T;  3J7A F;  4OMQ A;  1G3Y A;  3GF5 A;  1KSW A;  2JTM A;  2KYM A;  2MMP A;  3M0S A;  4C5H A;  4PJO D;  3ZBD A;  3ME9 A;  2CP2 A;  2L3R A;  2EQI A;  5IHN A;  1O9S A;  1MUZ A;  1W1F A;  3TCJ A;  3EGD B;  5A2Q E;  2EYW A;  2KXD A;  4JJD A;  4F7U E;  1VQO T;  3H8Z A;  3N5B B;  1B07 A;  1MMA A;  5LL6 S;  3RMQ A;  2KK4 A;  1NJI U;  2QA4 T;  5FU6 B;  5CKD A;  4M77 D;  1IRX A;  4C8Q E;  2DKG A;  3DB4 A;  1OZ2 A;  2YHT A;  3VRZ A;  2H8H A;  3OS1 A;  4LE9 A;  1UUE A;  2H3E B;  1FYN A;  2F69 A;  2E10 A;  4ZGD B;  2D6F A;  2JNG A;  2EGC A;  5I21 A;  3E1S A;  4X1V A;  2VXE A;  1VQN Q;  4J6X A;  4JRI A;  1UG1 A;  1BIB A;  3SWN C;  1M90 U;  3EH2 A;  3BE3 A;  4FL6 A;  1D0Y A;  3L2U A;  1N8R U;  1WI7 A;  1IB8 A;  2K2V A;  1K73 U;  2E3H A;  1YHQ A;  4LDU A;  5CKE A;  5IT9 E;  2HNI A;  1WHH A;  5HK3 A;  5C6S A;  3I55 Q;  2MF2 A;  4O6J A;  5LJ3 d;  4CI0 C;  1K4U S;  2DAQ A;  1YJW T;  1XNI A;  4AFQ C;  3FJP A;  1IZ6 A;  4YTL A;  2L8D A;  1Y96 B;  2PNI A;  4N4H A;  2DZ9 A;  3SEM A;  4M78 G;  5CKF A;  3DLM A;  3L2V A;  2X3W D;  5GAO m;  4C92 D;  2AKK A;  5DLO A;  5ECA A;  4M78 A;  1KK7 A;  1AWX A;  1OPL A;  4XQ3 A;  3OYA A;  4N0A C;  3HRU A;  3OY9 A;  3A8L B;  4IUP A;  2DL3 A;  2ROL A;  2KDS A;  5D6W A;  1N27 A;  1ZA2 B;  3V8J A;  2K7A A;  5LJ3 e;  3M57 A;  3I56 Q;  2A36 A;  2CKK A;  1MNE A;  4FYV B;  1ACM B;  4PFZ A;  3CXC A;  3V7C A;  2RK1 A;  5LJ3 g;  2JZ2 A;  1VQP A;  1KJW A;  4MZP A;  3CCL A;  4IIM A;  2VXF A;  1AD5 A;  2FHD A;  4WTO B;  3CCJ Q;  3L42 A;  5FRN A;  3MP8 A;  2D0N A;  1NEB A;  2BKD N;  3CCV T;  3CCM T;  4JJN K;  2CYZ B;  3UPU A;  1NM7 A;  4MDX A;  4QQG A;  1WJS A;  2EJG A;  2DL5 A;  4L6V 5;  5I2M A;  3QBY A;  2RF0 A;  3OB9 A;  1ZX6 A;  2DD5 A;  2KR3 A;  2LCC A;  4HVU A;  5GMK e;  1UEB A;  4OP0 A;  2LMJ A;  2QAZ A;  4OMO A;  1Q86 C;  2GGR A;  2LCS A;  5CK9 A;  1M1K C;  1WXU A;  2X4W A;  2QI2 A;  1GCP A;  1PKT A;  3O5Z A;  4FT2 A;  4MML A;  3JCM f;  2DX1 A;  1IGU A;  1JU5 C;  3CXC S;  1VQN A;  4M7A D;  1ZUU A;  3MKD A;  5KYY B;  2DD4 A;  2XDP A;  4F04 B;  1GCQ A;  1W6X A;  2VB6 A;  1AVZ C;  2DET A;  1B34 A;  3ER0 A;  1SEM A;  3WVE B;  5GAM d;  2HBW A;  5CQY A;  4J7I A;  5GAN 4;  3G6E A;  2RI3 A;  2O4X A;  4J6Y A;  1TXQ A;  1BIA A;  4CC4 B;  3G4S T;  2PVD B;  1K8A C;  4C5I A;  1EIF A;  1PCX A;  1M27 C;  2FZC B;  2L3P A;  3QJ6 A;  1VQ4 T;  4FW1 A;  1K9M U;  2FVU A;  1NJI C;  2RHX A;  4N4G A;  3SHW A;  2OX7 A;  4C8Q F;  5FWC A;  2P84 A;  1QVF A;  4LDY A;  2KGT A;  2VGM A;  1SKU B;  2JS2 A;  2JN0 A;  2R58 A;  3VU3 C;  2G3R A;  2SEM A;  3BDU A;  1MMG A;  3I35 A;  2CH4 A;  1M2O A;  4E47 A;  2LX9 A;  2E6Z A;  3BW1 A;  4FYW B;  2VUB A;  4Z88 A;  3GLX A;  4EMG A;  1QQJ A;  4JLG A;  5GAM e;  2A37 A;  1KHC A;  3OYB A;  3OYG A;  2RI2 A;  4L59 A;  3C94 A;  4OMF B;  1O75 A;  3GPL A;  1ABO A;  1I8F A;  3EGD A;  1OI1 A;  1N8R C;  4XU2 A;  3RNJ A;  1UEC A;  4RCC A;  4ZGE B;  1K73 C;  2OAU A;  2MI6 A;  2E4H A;  2IVW A;  4AFU C;  3REA B;  2DEU A;  2D8J A;  5IXB A;  1YJ9 Q;  3KXT A;  5FLX E;  1UFF A;  1Y0M A;  2JMA A;  3CC2 A;  2YUP A;  1UGR B;  4Z02 A;  1QMC A;  4V2S A;  1QVF S;  2RJF A;  1KD1 U;  3M4G A;  5CQX A;  4BI3 A;  5LJ3 h;  4M75 C;  5AYF A;  2C0I A;  1KC8 R;  4MZT A;  1YJN A;  2R5M A;  2RQU A;  1H3Z A;  2L3Q A;  2LQK A;  1Q95 G;  4M7D E;  2OTJ A;  3CCS Q;  1IGQ A;  2E3I A;  2MPX C;  4NL2 A;  2IPO B;  3CC4 Q;  4KT0 E;  1SRL A;  2RNA A;  4M7D C;  2L0A A;  3OYC A;  3I55 T;  2FPE A;  2K79 A;  1SPK A;  2VKN A;  2XD0 A;  2GTJ A;  3QJY A;  1PKS A;  4ZN3 A;  4C92 B;  1YBY A;  2ZPH B;  4XTX A;  4JJC A;  1VQM T;  2PQW A;  2DRM A;  2NYS A;  4QVD A;  3S3M A;  3JB9 I;  2YLB A;  2LX7 A;  2RHI A;  4LDV A;  5GMK h;  3QSU A;  1GRI A;  1Y96 A;  4OMN A;  1QLY A;  3CCU Q;  4X34 A;  2LTO A;  1YIJ A;  1SSF A;  2KYB A;  3GNF B;  2ESW A;  3MP1 A;  4R56 A;  4PJO E;  1G3T A;  1M9S A;  4C0D C;  4C0F A;  2RQT A;  4E7L A;  2DXU A;  4XK8 E;  2DNU A;  3CCE A;  4PJO C;  5HCK A;  4C5E A;  5CVI A;  2PZ1 A;  3J80 E;  1YI2 Q;  2FRY A;  1TUG B;  2A28 A;  3RDV A;  2WAC A;  1RAI B;  5IHK A;  1PSF A;  1VQ6 A;  2M0Y A;  3HRT A;  3I56 T;  3OYF A;  4AG2 C;  5GAN 6;  4HT8 A;  3OSV A;  3CME A;  3MEV A;  4DEX A;  3V8K A;  4B9X A;  3C12 A;  2QTX A;  1AWW A;  4E7H A;  1QVP A;  1PD0 A;  3OA6 A;  1VIF A;  3CCJ T;  4PFP A;  4M77 C;  2FPD A;  2O9S A;  5GAN 7;  4HT9 A;  5FU7 B;  2V1Q A;  1N9S A;  4BAC A;  3MEU A;  3TVT A;  2ENM A;  3HP9 A;  4E7I A;  3QKJ A;  2NUT B;  2DIL A;  4BY6 C;  3JB9 D;  1BI0 A;  2LRQ A;  4KUD K;  3UAT A;  3HKS A;  1XTD A;  4M7A B;  2BZ8 A;  2CUB A;  4HXJ A;  3LLR A;  3H9N A;  4Y92 A;  1PWT A;  3GNG A;  5GAM h;  1MV0 B;  2GF7 A;  1ZBJ A;  2XDB A;  1D1B A;  1S1N A;  2FB7 A;  2DJZ A;  3UDC A;  4A4F A;  3PVQ A;  4RTV A;  3E2U A;  1WHJ A;  1FX7 A;  2DM1 A;  3A98 A;  4OB2 B;  2OTL A;  2B86 A;  2EYX A;  3H6Z A;  3X28 B;  1I5O B;  1GBQ A;  3M53 A;  3PNW C;  3MET A;  1NPP A;  5KYY A;  1BYM A;  1SSH A;  1E6H A;  3WXM B;  1G8X A;  4C92 E;  4IUU A;  3VV0 A;  2X51 A;  2C06 A;  1K9A A;  3CC4 A;  2EWN A;  2LQW A;  3PIO A;  1XQH A;  3TSZ A;  1AWO A;  4XTU A;  1KG1 A;  1R8O B;  1Q82 R;  4RUG A;  1MHN A;  2VWF A;  5J39 A;  3REB B;  1I4K 1;  2X35 A;  1VYV A;  4F7U B;  1S72 A;  3QWY A;  1WHK A;  4KUI A;  2LQ8 A;  2RI5 A;  1W70 A;  1VQL A;  1VQ7 T;  3J81 E;  1GBR A;  2COW A;  1OQK A;  2KQW A;  2XID A;  4C8Q B;  1RAH B;  2LNV A;  5A0D A;  3LW5 E;  1BCO A;  3OMC A;  1KD1 C;  1WGS A;  4LUD A;  2GQV A;  3EFS A;  1GL5 A;  1YI2 A;  2NUP B;  2EKO A;  3SWN B;  2HDA A;  1HYO A;  1X69 A;  2JM8 A;  5KH6 A;  3OYL A;  3QDF A;  3RES A;  5IH2 A;  4M7D F;  2LZ6 B;  4HVW A;  2RJE A;  2YUN A;  2O88 A;  2YUQ A;  2QEX A;  2E64 A;  1AWJ A;  1N5Z A;  2LC4 A;  1YJ9 T;  3RBB B;  5D6Y A;  1U1T A;  2YRD A;  3RR6 A;  5GAO l;  1VQ9 T;  1SG5 A;  4AMC A;  1Y07 A;  4X9C A;  3BFM A;  1MV3 A;  4M7A E;  1Q7Y U;  2P0P A;  3FIF A;  3M0Q A;  2D8H A;  2ABL A;  1XJW B;  1BU1 A;  2HZY A;  1XOV A;  2ZPI B;  1NYG A;  2JM9 A;  4PJO F;  3G71 A;  1PD1 A;  5A0G A;  2XKO C;  1UDL A;  3CCS T;  3CMA T;  3JCM Q;  2HKN A;  1H3H A;  4EIK A;  3PMT A;  1NLO C;  1H8K A;  1OOT A;  2K5I A;  3A8G B;  4RTX A;  1J3T A;  2IIM A;  3OQ5 A;  2AZV A;  4PJJ A;  4FCY A;  1VQP Q;  1VQ5 A;  4DBF A;  3CCL Q;  4C92 A;  1FMW A;  3CD6 T;  2LJ1 A;  4D8K A;  3CCU T;  2RJD A;  3ASK A;  1X01 A;  2F1L A;  1K8A U;  3JCM d;  4AFS C;  1Z9Q A;  4E6R A;  1WXT A;  3SB2 A;  3E9F A;  2D0Q B;  2EGA A;  1V1C A;  2I0N A;  5M9O A;  1QWE A;  1BKB A;  1QCF A;  3LH0 A;  1V29 B;  3FJ5 A;  2E1H A;  1B3Q A;  4B9W A;  1ZUY A;  3KBG A;  1JBM A;  2E41 A;  4JPB W;  3A1P A;  1N9R A;  2NLU A;  2X4Y A;  3UT1 A;  4CC3 A;  4A4E A;  5GAO p;  2HL5 C;  1M90 R;  2YDL A;  2V8K A;  3EG9 A;  5IHI A;  1H64 1;  3C4S A;  2DFU A;  3JCM e;  2DBM A;  1QWF A;  1WQW A;  1N6A A;  1VUB A;  4E7Z A;  2J6F A;  1I07 A;  1VQ8 T;  4MDW A;  3G6E Q;  3OYN A;  1T3L A;  4C92 F;  2DXB A;  2DTI A;  3R6N A;  2NUT A;  1OYX A;  2X4J A;  2M02 A;  2BE7 D;  5KE3 A;  1W2B P;  2KAF A;  2RK2 A;  2XG8 D;  4HA8 A;  1PHT A;  3HHT B;  1YWO A;  2MWO A;  4HVV A;  3ZEH A;  2BZY A;  1X2K A;  1OU9 A;  4RTT A;  1JQQ A;  1M8M A;  4IUV A;  5KYX B;  1OV3 A;  5D6X A;  1OX8 A;  1SHF A;  2J6O A;  2EQK A;  1Q81 C;  2EYY A;  2QQA A;  4PNO A;  5I11 A;  1BI2 A;  4CRI A;  1G3W A;  3HPW A;  2YSQ A;  8AT1 B;  4F7U G;  2EW3 A;  2HQX A;  3TSW A;  1G5V A;  2COZ A;  5HKC A;  4BE0 A;  2XI9 A;  1EZZ B;  1HD3 A;  1RL2 A;  2SRC A;  5CO7 A;  4E2F B;  4PFO A;  1WFW A;  4F7U A;  3CC2 Q;  2RMO A;  4C8Q G;  4D8D A;  4EMK C;  1HK9 A;  3VRY A;  2C0O A;  2ZPB B;  3JRZ A;  1SF9 A;  3AHU A;  2W10 A;  3HSB A;  3OW2 A;  4KGZ B;  4M7A F;  4C8Q A;  1YJN Q;  1Q7Y C;  3CQT A;  4M75 B;  3HFN A;  1KQS P;  1YHQ T;  2CRE A;  2OTJ Q;  4K11 A;  5CKB A;  3FDR A;  1Z9Z A;  2LJ3 A;  2RO0 A;  4QQD A;  2NUP A;  3SWN A;  4C5G A;  4JUV A;  2ZPF B;  3V7S A;  3I5R A;  4M7D B;  1M3B A;  3PE0 A;  4KGX B;  1JJ2 A;  2K5F A;  2K5L A;  4PJL A;  2M9U A;  2DL8 A;  5EC7 A;  4J9F A;  2XIC A;  2RHU A;  3NPF A;  4GY5 A;  3MJX A;  1JEG A;  2M1H A;  3RKX A;  2MOX A;  1YIJ Q;  3ZFJ A;  1M5Q 1;  1ZLM A;  3MPU B;  2K3B A;  3OW2 S;  4RTY A;  2CS7 A;  2JTF A;  4HCK A;  2KY9 A;  4XU3 A;  4FYX B;  3SD4 A;  4F7U F;  1TUD A;  4A53 A;  2HBP A;  2H3J A;  3CEY A;  3S3N A;  3CCE Q;  1EX4 A;  3L2Z A;  4C0D B;  3CC7 A;  1K9M R;  1PC0 A;  2MYS A;  3QYG B;  1VQ6 Q;  3THK A;  4PJO B;  2DYI A;  3JCM h;  2ATC B;  4M78 D;  2O31 A;  2CP5 A;  2L2P A;  4RCB A;  2EVR A;  2HD0 A;  5CCA A;  4N0A A;  2CGH A;  2DXT A;  3LX7 A;  3OYD A;  1M4Z A;  4FIB A;  1NG2 A;  3SDZ A;  3JSC A;  2K3X A;  3CME Q;  3X20 B;  2RHZ A;  3MO8 A;  1VQP T;  3GBQ A;  1JJ2 S;  3CCL T;  2OAW A;  2A7Y A;  4R55 A;  2CP7 A;  3QDR B;  2GQI A;  3EG3 A;  1RAA B;  1UHF A;  1RAG B;  1VQM A;  3M0T A;  4NL3 A;  4BDY A;  4M77 B;  3QPH A;  3L2W A;  1YIT A;  3NTK A;  5GAM g;  1UGS B;  2CZ1 B;  1RUW A;  2GTO A;  2E12 A;  2RJC A;  3GP8 A;  1VQK A;  3C95 A;  5GAO n;  2FZK B;  4BY6 B;  3GOX A;  3VS1 A;  1JB0 E;  2DL7 A;  2JOY A;  2Z0W A;  4JLI A;  3HTR A;  3GIB A;  4M75 E;  4F14 A;  2EQU A;  1VQN T;  4RTW A;  1JO8 A;  5GAN f;  3NTI A;  4J6W A;  3JCM c;  3LWH A;  2OTL Q;  1ZSZ C;  2EQM A;  2HQE A;  5I2S A;  1W4S A;  3VS3 A;  4ATO A;  1R0C B;  4KBM B;  2KRO A;  5KCO A;  2OI3 A;  4XU0 A;  3G6E T;  5LJ5 f;  3M0R A;  2DRK A;  2CP0 A;  2AT1 B;  2IG0 A;  2MWP A;  3JCM J;  1GFD A;  1KC8 U;  1IHW A;  1R0B G;  2YRV A;  1ZBX A;  3X24 B;  2YRC A;  5C0M A;  3I5S A;  2KSS A;  1S72 Q;  4BI4 A;  4J9C A;  4Z89 A;  2J6K A;  2HMA A;  3A5Z B;  1AT1 B;  3EGU A;  4OB3 B;  1CSK A;  1VOM A;  3DKM A;  2DVJ A;  4LD9 K;  5GAN j;  4OMP A;  1VQL Q;  4IUR A;  2EAY A;  5GMK l;  1Y7X A;  2BUD A;  2CUD A;  1UHC A;  3UF4 A;  2DBK A;  1HJD A;  4JRP A;  2G6F X;  5KYX A;  5KYW B;  4A4H A;  2EFI A;  3H41 A;  3EG2 A;  2VV5 A;  1KQ2 A;  5LJ5 j;  5LJ5 h;  4PJM A;  8ATC B;  2W0Z A;  2HCK A;  2JJ9 A;  2K6D A;  2M51 A;  3EHR A;  3OYJ A;  2RQR A;  2GFA A;  3JCM X;  4PK4 A;  2NWM A;  3X26 B;  1U3O A;  1KFZ A;  1Y57 A;  1T0J A;  4WCI A;  2QEX Q;  2CZ7 B;  5J26 A;  3JB9 F;  4LN2 A;  5FW9 A;  3VJP A;  3QZ9 B;  4M77 E;  2EIF A;  2CP6 A;  3E9G A;  3ULR B;  3JCM P;  2QA4 Q;  4OMM A;  2ZGW A;  3CC2 T;  2DIQ A;  1G3S A;  4BE1 A;  1UGQ B;  1FXX A;  4MZM A;  4M4Z A;  2CH4 W;  1WA7 A;  2RM4 A;  3WVD B;  1C0M A;  3CXC P;  2ROT A;  3HRS A;  4M75 G; 
#chains in the Genus database with same CATH homology
 5DLO A;  1YJN T;  3JCM W;  3R6O A;  4OGE A;  3RIR A;  1XOV A;  4M78 A;  4EMK A;  3FEO A;  4Q5W A;  3CCQ A;  4DA4 A;  2QDY B;  2ZPI B;  5LJ3 f;  4PJO F;  2EJ9 A;  5IN1 A;  4Y91 A;  2DK3 A;  5EG2 A;  4XQ3 A;  3G71 A;  3OBY A;  3OYA A;  3A8H B;  4N0A C;  1ZQ1 A;  3HRU A;  5A0G A;  3RMS A;  2XKO C;  4DOV A;  3A8L B;  2CZ0 B;  3OY9 A;  3CCS T;  4JS5 A;  3CMA T;  4A54 A;  3JCM Q;  4M75 A;  2R5A A;  4IUP A;  4IUT A;  3RER A;  3LGF A;  2KDS A;  3V8L A;  5D6W A;  1M90 C;  3CPW A;  2M0O A;  4PL6 A;  3PMT A;  4C8Q D;  1N27 A;  4M7D G;  1HXD A;  3BY7 A;  3F70 A;  3V8J A;  2K5I A;  5LJ3 e;  3M57 A;  3PFS A;  1X75 C;  2ZZD A;  3A8G B;  3L2Q A;  3I56 A;  4XU1 A;  4OB0 B;  3JB9 G;  2CKK A;  5J3B A;  1M1F A;  3OQ5 A;  3UWN A;  4RMO A;  3CXC A;  3V7C A;  1I5L A;  2RK1 A;  5CR2 A;  5LJ3 g;  4QVC A;  2JZ2 A;  5FRO A;  2VYT A;  4EPC A;  1VQP A;  1VQ5 A;  4MZP A;  4M7D A;  3CCL A;  2HAX A;  2VXF A;  2FHD A;  4C92 A;  3CD6 T;  1ZHI A;  2WSF E;  3CCJ A;  4IUQ A;  3L42 A;  5FRN A;  3CCU T;  1VQ9 A;  1YIJ T;  3MP8 A;  3CBO A;  1KHI A;  2RJD A;  3ASK A;  1X01 A;  2BKD N;  3CCV T;  3CCM T;  4JJN K;  4PKC C;  1K8A U;  3NFC A;  3JCM d;  2PVG B;  2CYZ B;  2F5T X;  3UPU A;  4MDX A;  4TVR A;  3SB2 A;  1D3B B;  4QQG A;  4BB7 A;  5LJ3 j;  1WJS A;  1QVG S;  2OTJ T;  5IAY A;  3L1A A;  2EJG A;  2XK0 A;  3CCE T;  3VYH B;  3E9F A;  2XDD A;  2D0Q B;  4LDW A;  4ME7 A;  4BE2 A;  2LT4 A;  3PTA A;  4PJO G;  4L6V 5;  5I2M A;  3QBY A;  5M9O A;  3CC7 T;  3RKY A;  1BKB A;  3LH0 A;  3OB9 A;  2DD5 A;  1V29 B;  1VQ6 T;  3TRE A;  2LCC A;  5GMK e;  2E1H A;  2F5K A;  4E7K A;  4B9W A;  1UEB A;  2E5Q A;  3CPW S;  3KBG A;  4OP0 A;  1JBM A;  4HT8 A;  2E41 A;  1Q86 C;  5GAN h;  2DTH A;  4PJO A;  5A0L A;  5CK9 A;  4JRQ A;  1M1K C;  2LVM A;  2X4W A;  2QI2 A;  2K3Y A;  4FT2 A;  3JCM f;  4MML A;  3CCR A;  2DTO A;  2L5Q A;  1N9R A;  3CXC S;  4M75 F;  1Q82 U;  1VQN A;  2NLU A;  4M7A D;  1Q81 U;  2X4Y A;  3UT1 A;  3M5A A;  4XTY A;  3OYD A;  4A4E A;  5GAO p;  2V8K A;  4J83 A;  4M77 G;  2DD4 A;  2XDP A;  1H64 1;  4WF2 A;  3M58 A;  3C4S A;  3JCM e;  3CBP A;  3FC3 A;  3CD6 A;  1WQW A;  4A4K A;  5GMK j;  1YIT T;  1B34 A;  1N6A A;  1VUB A;  3ER0 A;  3FLG A;  3RUX A;  1QVG A;  4X9D A;  3WVE B;  1P92 A;  5GAM d;  1VQ8 T;  4MDW A;  5CQY A;  4J7I A;  2PU9 B;  5GAN 4;  4M77 A;  3OYN A;  3G6E A;  1VQK T;  2RI3 A;  2O4X A;  4J6Y A;  3JB9 H;  1KQ1 A;  4C92 F;  2DXB A;  1BIA A;  3INZ A;  1VQO A;  2DTI A;  3G4S T;  2PVD B;  1K8A C;  1OYX A;  4P5N A;  4A4G A;  2B8A A;  3JB9 J;  4C5I A;  3P8D A;  2X4J A;  2EJF A;  2RA2 A;  1EIF A;  3QO3 A;  5CAI A;  3M9Q A;  5KE3 A;  2KAF A;  3QJ6 A;  2RK2 A;  4NS5 A;  2QA4 A;  4ZTJ A;  2XG8 D;  1VQ4 T;  4HA8 A;  1K9M U;  2FVU A;  3JCM V;  3EFR A;  1KC8 C;  3HHT B;  2DIG A;  3M55 A;  1NJI C;  2RHX A;  4N4G A;  2MWO A;  4C8Q F;  1LJO A;  3ZEH A;  2FL7 A;  3BDL A;  4GLK A;  3SFM A;  4DOW A;  3DLL A;  1QVF A;  4LDY A;  3OYY A;  4JRK A;  2DO3 A;  4IUV A;  5GAM f;  2VGM A;  3VU3 C;  1VQ7 A;  1QP2 A;  2DEQ A;  2JN0 A;  2R58 A;  2G3R A;  3NTH A;  2OTL T;  3QHS A;  3BDU A;  4DQ2 A;  1U1S A;  5D6X A;  4E47 A;  2EYQ A;  2LX9 A;  2V8I A;  1TH7 A;  1QP3 A;  2E6Z A;  3BW1 A;  3QUI A;  2EQK A;  2K4Y A;  2VUB A;  4D6W A;  4BUG A;  3GLX A;  1Q81 C;  4EMG A;  2QQA A;  4PNO A;  4JLG A;  5GAM e;  1KHC A;  1BI2 A;  3M56 A;  4II1 A;  3OYB A;  4CRI A;  1G3W A;  2JUF A;  2RI2 A;  3OYG A;  1W2B A;  2BIV A;  4L59 A;  3HPW A;  3CC4 T;  2O4X B;  3C94 A;  4OMF B;  1O75 A;  4ZGJ B;  3GPL A;  3LGL A;  3TU4 K;  1I8F A;  1OI1 A;  1N8R C;  4RG2 A;  4C92 G;  4XU2 A;  4RCC A;  4ZGE B;  1K73 C;  2E65 A;  4ZTF A;  2OAU A;  2MI6 A;  1UB4 A;  3P8B B;  4F7U G;  2HQX A;  2IVW A;  4XAX B;  1G5V A;  3QYH B;  4QW2 A;  1S72 T;  4JDS A;  4BI8 B;  4EMH A;  5HKC A;  4J7F A;  1YJ9 A;  4N4I A;  4BE0 A;  3KXT A;  2XI9 A;  4NOY A;  3E19 A;  3P8H A;  4M78 E;  4M77 F;  1RL2 A;  5FLX E;  5DM7 R;  5CO7 A;  1WJQ A;  2I2L A;  1YJW A;  1VQL T;  4F7U A;  5GAM j;  3CC2 A;  2DVE A;  4C8Q G;  2GFU A;  4EMK C;  1UGR B;  4M78 C;  4Z02 A;  2O01 E;  3LYI A;  1HK9 A;  1LNX A;  1K9M C;  4V2S A;  1QVF S;  2ZPB B;  2RJF A;  3JRZ A;  3OS2 A;  3M4G A;  5GAN 8;  1KD1 U;  3AHU A;  4J8O A;  2A3L A;  4VUB A;  4ELZ C;  5CQX A;  2LDM A;  4BI3 A;  4EMK B;  1IRE B;  3HSB A;  2Y90 A;  4M78 B;  4M75 C;  5LJ3 h;  3OW2 A;  5AYF A;  4M7A F;  4HCB A;  1WNL A;  2GCX A;  2P0Q A;  4MZT A;  4C8Q A;  1Q7Y C;  1YJN A;  2R5M A;  2ZPE B;  3QZ5 B;  4M75 B;  3HFN A;  3CPF A;  2QXF A;  4JS4 A;  3VUZ A;  1YI2 T;  1UGP B;  1H3Z A;  1M1G A;  2LQK A;  1YHQ T;  2X4X A;  1W2B S;  3JCM b;  2D9T A;  3JAM E;  4M7D E;  2OTJ A;  3OYK A;  2E70 A;  5CKB A;  3FDR A;  4O5V A;  3VYG A;  4FU6 A;  1DJ7 B;  5DY9 A;  3CMA A;  2PUK B;  2RO0 A;  3CCS A;  2M16 A;  4NL2 A;  4QQD A;  2Y4Y A;  4UC4 A;  4KT0 E;  3SWN A;  4C5G A;  5GAO q;  4M7D C;  2XHC A;  2MAM A;  2QEX T;  3OYC A;  4C0Z A;  3CME T;  4JUV A;  4C92 C;  3S6W A;  2WSE E;  2CZ6 B;  3I55 T;  3TEE A;  2ZPF B;  3V7S A;  3KUF A;  2RB6 A;  5KCH A;  5GAN 3;  3QJY A;  2XD0 A;  4M7D B;  4ZN3 A;  4C92 B;  1JJ2 A;  1YBY A;  2K5F A;  2ZPH B;  2E6N A;  2K5L A;  3QII A;  3QG1 A;  4XTX A;  1VQM T;  2PQW A;  4QVD A;  2QQR A;  3VUB A;  3S3M A;  2QQB A;  3JB9 I;  1WPY A;  2M9U A;  2YLB A;  5DLQ E;  1QW1 A;  4E7J A;  2RHI A;  2XIC A;  2RHU A;  3MHX A;  4GY5 A;  4J5Y A;  4LDV A;  5GMK h;  3MEW A;  4C8Q C;  3VKI A;  1KQS A;  3QSU A;  5L8R E;  1NPR A;  1Y96 A;  2M1H A;  2PVO B;  3RKX A;  1GXI E;  3CCU A;  4X34 A;  2LTO A;  3ZFJ A;  1YIJ A;  1SSF A;  1M5Q 1;  3GNF B;  3JCM g;  2L89 A;  3CCV A;  3MP1 A;  3CCM A;  4RG8 A;  4R56 A;  3OW2 S;  2CS7 A;  4M7A G;  2JTF A;  4PJO E;  2KY9 A;  3CCQ T;  4XU3 A;  1JRI A;  1G3T A;  1M9S A;  1BI1 A;  3PGG A;  4C0D C;  3SD4 A;  4F7U F;  3G71 T;  3FB9 A;  4KUL A;  4C0F A;  5GMK m;  4A53 A;  4E7L A;  2HBP A;  2H3J A;  3CEY A;  2DXU A;  4XK8 E;  3CCE A;  3S3N A;  3T9N A;  3L2Z A;  4PJO C;  4C0D B;  4C5E A;  3OS0 A;  5KE2 A;  5CVI A;  3CC7 A;  3J80 E;  1OZ3 A;  4BDZ A;  4HCZ A;  2WAC A;  1MGQ A;  3QYG B;  4M7A A;  4PJO B;  3PT9 A;  5GAN 5;  1PSF A;  1VQ6 A;  3JCM h;  2Y4X A;  4M78 D;  3HRT A;  3OMG A;  1I81 A;  4RCB A;  4IKF A;  3I56 T;  3OYF A;  2VGN A;  2HD0 A;  2DPP B;  4N0A A;  5CCA A;  2CGH A;  2DXT A;  3LX7 A;  5GAN 6;  1BI3 A;  1M4Z A;  2AHJ B;  4FIB A;  2DXC A;  3OSV A;  4OF1 A;  3JSC A;  3SDZ A;  2K3X A;  5GAN 2;  3X20 B;  3CME A;  3MEV A;  4M75 D;  3V8K A;  2QQS A;  4B9X A;  2LCL A;  2RHZ A;  4C0G A;  3MO8 A;  1VQP T;  4MMK A;  1VQ5 T;  3C12 A;  3A8O B;  1JJ2 S;  3CCL T;  2QTX A;  2A7Y A;  3RKW A;  4R55 A;  1VIE A;  4E7H A;  1QVP A;  3OA6 A;  5FU7 C;  2FYK A;  1VIF A;  2R57 A;  3CCJ T;  3QDR B;  4M77 C;  4PLL A;  4RKU E;  1B34 B;  3V7R A;  1LOJ A;  4OB1 B;  3PMI A;  1VQM A;  1Q82 C;  4NL3 A;  5GAN 7;  2KVQ G;  4BDY A;  3HFO A;  1KQS S;  1RI0 A;  4HT9 A;  2RH2 A;  5FU7 B;  1M8V A;  1N9S A;  5CIU A;  4BAC A;  3MEU A;  4M77 B;  4XTV A;  3QPH A;  5HY6 A;  3OBW A;  3L2W A;  1YIT A;  3HP9 A;  4M7D D;  4E7I A;  3NTK A;  5GAM g;  2WSC E;  1UGS B;  2CZ1 B;  3QKJ A;  5GAN d;  3OSS C;  3HL8 A;  2E12 A;  2RJC A;  1VQ8 A;  4BY6 C;  3GP8 A;  4M7A C;  3JB9 D;  1BI0 A;  1VQK A;  3C95 A;  1D3B A;  2P0K A;  5GAO n;  1U8R A;  2LRQ A;  5GAO r;  3G4S A;  4KUD K;  2K57 A;  3HKS A;  1XTD A;  4BY6 B;  3GOX A;  1Q86 U;  4M7A B;  3M4Y A;  1WQ7 A;  3G7Z A;  1FWZ A;  1M1K U;  1NZ9 A;  3LLR A;  1JB0 E;  4ELY C;  1VQ4 A;  3PIP A;  5LJ5 d;  3GNG A;  5GAM h;  1WJR A;  1X6O A;  1YCY A;  2GF7 A;  2JOY A;  4FSX A;  4LDX A;  4JLI A;  2XDB A;  3GIB A;  4M75 E;  3CCR T;  2RHY A;  2FB7 A;  3URG A;  5FRM A;  1G3Y A;  3GF5 A;  3MEA A;  3J7A F;  2EQU A;  4BD3 A;  2DJZ A;  3UDC A;  1VQN T;  4A4F A;  5GAN f;  3NTI A;  4J6W A;  2YLC A;  3JCM c;  3OYE A;  2JTM A;  3OYI A;  3X25 B;  3LWH A;  1FX7 A;  4OB2 B;  2MMP A;  2OTL A;  3X28 B;  3H6Z A;  4C5H A;  2EQM A;  2HQE A;  3MP6 A;  4PJO D;  3M53 A;  1Y71 A;  2EQJ A;  3PNW C;  2DZC A;  3ZBD A;  3ME9 A;  5I2S A;  3MET A;  1NPP A;  1W4S A;  2L3R A;  2PUO B;  4ATO A;  3EAE A;  4KBM B;  1PSE A;  5GAN e;  1BYM A;  1O9S A;  3TCJ A;  5KCO A;  4XU0 A;  3WXM B;  5A2Q E;  2KMT A;  4C92 E;  4IUU A;  5LJ5 f;  3G6E T;  3VV0 A;  2ZCF B;  4F7U E;  2C06 A;  3CC4 A;  1VQO T;  2EWN A;  5GAN g;  3H8Z A;  3N5B B;  3PIO A;  1XQH A;  2XU8 A;  2IG0 A;  4XTU A;  1KG1 A;  1R8O B;  4QVZ A;  2MWP A;  5FU6 C;  5LL6 S;  3JCM J;  3RMQ A;  3MCA B;  3Q1J A;  1MHN A;  4FT4 A;  1KC8 U;  2KK4 A;  2YRV A;  4LD6 A;  5J39 A;  5GMK i;  1ZBX A;  3X24 B;  1I4K 1;  2QA4 T;  1NJI U;  5C0M A;  5LJ5 e;  2KSS A;  2X35 A;  5FU6 B;  5CKD A;  4M77 D;  4F7U B;  4Y28 E;  4BI4 A;  2JVV A;  1S72 A;  4C8Q E;  2DKG A;  3A5Z B;  3DB4 A;  1OZ2 A;  4OB3 B;  5HK0 A;  1NE8 A;  2YHT A;  4KUI A;  3DKM A;  4EDU A;  5LJ5 g;  3M54 A;  3A8M B;  2LQ8 A;  2RI5 A;  1AHJ B;  2LT1 A;  3DB3 A;  4M78 F;  3OS1 A;  5GAN j;  4IUR A;  1VQL A;  2EAY A;  4ZGD B;  2F69 A;  2E10 A;  4XTW A;  1Y7X A;  5GMK l;  3J81 E;  2JNG A;  1VQ7 T;  2D6F A;  4HCC A;  2BUD A;  5I21 A;  3E1S A;  4HKE A;  4L5G A;  2KQW A;  2XID A;  3M59 A;  4C8Q B;  2RD1 A;  2VXE A;  3O8V A;  4J6X A;  4QQ6 A;  2LNV A;  5CKH A;  5A0D A;  3OYM A;  4JRP A;  4LD9 K;  3LW5 E;  4JRI A;  3OMC A;  1KD1 C;  1BIB A;  4A4H A;  3SWN C;  4FM4 B;  2EFI A;  1WGS A;  2V8J A;  1M90 U;  2VV5 A;  4XTZ A;  5LJ5 j;  5LJ5 h;  1KQ2 A;  4FL6 A;  2GQV A;  2QQ9 A;  3EFS A;  3L2U A;  1N8R U;  1YI2 A;  3OYJ A;  2EKO A;  3SWN B;  2K2V A;  1K73 U;  2P4T A;  1YHQ A;  2GFA A;  5KH6 A;  4PLI A;  3OYL A;  3JCM X;  4OGC A;  4LDU A;  5CKE A;  3RES A;  5IT9 E;  4M7D F;  3QXE B;  3X26 B;  2HNI A;  3OYH A;  3OS5 A;  2VC8 A;  2RJE A;  3CBM A;  2CZ7 B;  2E64 A;  2QEX A;  5J26 A;  3JB9 F;  5HK3 A;  5C6S A;  3VJP A;  2LC4 A;  4OVA A;  2MF2 A;  3I55 A;  3QZ9 B;  4O6J A;  4M77 E;  5LJ3 d;  4CI0 C;  1YJ9 T;  2EIF A;  5D6Y A;  3E9G A;  2ZPG B;  3JCM P;  4ZN1 A;  2DAQ A;  1YJW T;  1U1T A;  1XNI A;  2ZGW A;  3CC2 T;  2DIQ A;  3FJP A;  1IZ6 A;  5GAO l;  1G3S A;  2L8D A;  4YTL A;  1Y96 B;  4BE1 A;  1VQ9 T;  4N4H A;  1UGQ B;  2DZ9 A;  1FXX A;  3FRN A;  1Y07 A;  4MZM A;  4M78 G;  3LWI A;  4X9C A;  3L2R A;  5CKF A;  3DLM A;  3BFM A;  3S3O A;  3L2V A;  4M7A E;  2RM4 A;  3WVD B;  2P0P A;  3FIF A;  1Q7Y U;  5GAO m;  3HRS A;  4M75 G;  4C92 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...