4HCZA

Phf1 tudor in complex with h3k36me3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 1
publication title Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4hczA00
2RI3A 2L89A 2X4WA 4A4EA 4IKFA 3OYDA 4IUUA 4IUPA 3FLGA 4BE1A 2MWPA 4BE0A 2CKKA 1WJQA 2EKOA 3OMCA 3C4SA 2M16A 3OQ5A 3NTKA 3PMTA 2M0OA 2RI2A 4E7LA 4BE2A 2XDPA 4QQDA 1XNIA 2HQXA 3OYFA 3OYLA 2MWOA 3S3MA 2EQJA 4N4HA 3OYHA 3ASKA 2YRVA 3OYGA 3L2WA 5C0MA 3OA6A 4QVZA 3H8ZA 2EQKA 2LTOA 2RHXA 2D9TA 3DLMA 3OYBA 3QJ6A 4C5GA 4Q5WA 3S3OA 2NLUA 2GF7A 4A4HA 3S6WA 1WJSA 4N4IA 5C6SA 2M1HA 3LH0A 3OMGA 4RG2A 3FDRA 2EFIA 3QKJA 2LVMA 4C5EA 5FRNA 4GY5A 2LCCA 3CEYA 3PFSA 3OYNA 3PNWC 3S3NA 3OS2A 3OS0A 4PLLA 4C5IA 2RO0A 2X4YA 2R5AA 5D6WA 2BUDA 2RHIA 4B9XA 3FEOA 3MP6A 3L42A 4HCZA 3OYIA 3L2RA 2RJFA 1MHNA 1OZ3A 2WACA 3O8VA 4N4GA 4L59A 3KUFA 2K3YA 3BDLA 2RI5A 3MO8A 2HQEA 1OZ2A 4QQGA 4E7KA 2RHYA 5IAYA 5D6XA 3META 2L3RA 4IUVA 2IG0A 2RHZA 3LLRA 3P8HA 2R57A 4PLIA 2XK0A 3L2UA 1H3ZA 2GFUA 1KHCA 5KE2A 1SSFA 4BACA 2FHDA 4B9WA 4A4GA 5CIUA 5FROA 3NTHA 2O4XB 3MEWA 3F70A 3EAEA 3GOXA 4BD3A 3Q1JA 1G5VA 1WJRA 3M9QA 2VYTA 2DIGA 3NTIA 2R58A 2L8DA 4EDUA 2E6NA 2X4XA 4LD6A 4OVAA 3L2QA 3OY9A 3P8DA 2DAQA 4ZTFA 2P0KA 2JZ2A 4A4FA 1OI1A 3MP8A 4X34A 5KCHA 3PMIA 5M9OA 4E7HA 3L2VA 2PQWA 5KE3A 2E5QA 2B8AA 2JTFA 2LDMA 3UWNA 2LRQA 2BKDN 2X35A 3LX7A 3QBYA 3ZEHA 2RJEA 2K3XA 2RHUA 5FRMA 3E9GA 3FC3A 3MEUA 4IUQA 3UT1A 3MP1A 4PL6A 3H6ZA 4ZTJA 3OYKA 3LGFA 2QQSA 3OS1A 3OYCA 5J26A 4IURA 2F5KA 5J39A 4BDYA 3DB4A 2R5MA 3OB9A 3LYIA 4BDZA 1RI0A 2DIQA 1OYXA 2GFAA 3ME9A 4NS5A 4C5HA 5KH6A 4FU6A 2RJCA 3OYEA 3OYJA 2EQMA 4UC4A 3DB3A 3E9FA 3SD4A 2RJDA 3QIIA 4FL6A 4QW2A 4E7JA 2BIVA 5D6YA 1WGSA 3OYAA 3MEAA 5IN1A 4IUTA 2G3RA 2EQUA 4CRIA 1N27A 4QQ6A 4Z02A 5KCOA 3LGLA 4II1A 4E7IA 3OYMA 3MEVA 2QQRA 2O4XA
chains in the Genus database with same CATH superfamily
4NOYA 2CT3A 2FZKB 4KUDK 3G6ET 2KMTA 4D6WA 1AD5A 2CKKA 2EKOA 1MUZA 4AFUC 2FYKA 3CC2Q 4NL2A 1RI9A 2HQXA 5GAN5 2DRMA 1OV3A 3OYGA 5D7UA 2YLBA 1Y96B 2X51A 3V8JA 5KYWA 4HVUA 4ZGDB 1QVFS 1VQ6Q 4C8QG 3CMEA 3V7CA 2LCSA 1M1FA 2VWFA 2COWA 3M56A 2EYXA 2L0AA 1KQSA 5CQXA 1KC8U 2PZ1A 1VQOQ 2M51A 1QP2A 1RACB 4C92A 2HZYA 1BBZA 4J9HA 1VQ4T 2YLCA 4J6WA 3I5SA 4LDWA 2DEQA 4JJCA 2QEXT 2DNUA 1WA7A 8AT1B 1SSFA 4X9DA 2VV5A 3M4GA 1XJWB 2DLPA 1E7OA 5HY6A 1QVGS 2QTXA 4C0ZA 2D6FA 2R58A 5I2SA 2DL8A 2A36A 4M7AF 2QI2A 1M3BA 2VASA 2XD0A 4N0AC 3EGUA 1HJDA 3QO3A 1Q82U 4XU3A 4PL6A 2YWWA 4MDXA 2J06A 2F5KA 4XTVA 4FYWB 2DMOA 2ZPEB 3JCMd 2GTOA 2J7IA 2VGMA 4LUEA 3SD4A 2E70A 3THKA 3JCMb 3PT9A 1WGSA 5IN1A 1GL5A 1KC8C 4JRQA 5KCOA 1A0NB 4KRTA 2DZ9A 1YI2Q 2YUNA 3CCEQ 4CI0C 3M0TA 2P84A 2DXUA 3CC2A 3UA6A 1UHFA 3I5RA 4PJOG 2QG9B 4C8QB 1YHQT 3WXMB 2HSPA 3RIRA 3CCVT 2LX9A 3EH1A 2JOYA 4M78B 4GLKA 2E12A 1YCSB 1W2BP 1Q81R 1PNJA 1SHGA 1IB8A 1D1CA 5GMKe 5GMKj 4QKUA 1EX4A 1NG2A 4FYXB 1JBMA 2EFIA 1RAIB 2XICA 4FSXA 5FRNA 3RMQA 3CEYA 1WXBA 3BDUA 3PFSA 4JS5A 1VQLQ 2VB6A 2LQNA 1T3LA 1Q82C 3CCRQ 2RO0A 2R5AA 3VS2A 2DL7A 5KYUB 3SFMA 1JJ2S 3RKWA 1Z9ZA 3KUFA 2NUTB 3BE3A 3CCMT 2O01E 3EGXA 1D09B 2PTKA 3LLRA 4M7AD 3X20B 4PJLA 3QWYA 2JTEA 2YRDA 1X27A 4XTWA 3V7RA 1QQJA 1D1BA 2NWMA 2QDYB 1YITT 1K0SA 2X4JA 1ZUUA 1GCPA 3JCMe 4AFZC 4LXCA 2DXCA 5KE3A 1WI7A 2LRQA 2YRCA 2F5TX 4OMLA 2YXYA 2EGEA 3TQ7P 2EGAA 5FRMA 1OU9A 2LQ8A 1Q81U 2HMAA 1VQ8A 2HDAA 2Y90A 3CCLQ 1TUDA 2EJFA 5CCAA 2CH4W 3OYJA 4XTZA 1O75A 4C5HA 3OYEA 4AMCA 1R0BG 2RJDA 4FL6A 3HRUA 1S72A 1H92A 4CRIA 1G3TA 2ED1A 4PJOB 1YI2A 4IKFA 3PVQA 1B34B 2PU9B 2A3LA 3C4SA 4XQ3A 2M0OA 4J9IA 3CC7Q 2JTMA 3H0HA 4ZGJB 2VXEA 4O5VA 4BI8B 2FZGB 2GBQA 3X28B 2JT4A 4KGVB 2D9TA 2L3PA 2KR3A 2GF7A 3SEMA 4A4HA 2XI9A 1AEYA 1JQQA 5GJVB 5I2MA 5C6SA 4RG2A 4BI3A 2OTJQ 4Z88A 1T3SA 2FG0A 4X9CA 1VQNQ 2GTJA 2HSEB 3PNWC 5A0LA 5ECAA 4C5IA 4EMKA 3CCRA 4R55A 2EW3A 1Q81C 2YUQA 4C92G 2EVRA 1S1NA 4M75B 1YJNT 4HVVA 1V29B 1MHNA 3R6OA 1OZ3A 5CR2A 3CCUA 1WQWA 3HP9A 3X26B 1U1TA 2FZCB 2HQHA 2K2MA 2XK0A 2GFUA 1MMGA 1WHGA 1Y96A 1G5VA 1WJRA 4LD6A 5A2QE 4OB1B 4JUVA 3A8LB 4ZN3A 2MAMA 3JV3A 3LH5A 1KJWA 5AYFA 1BK2A 2CP3A 2LNVA 2B8AA 2CP0A 1Q86R 5GANd 1TS9A 1AZEA 2PUOB 4ZTJA 2BZYA 1W70A 3OYKA 2OTLT 3CCLA 1ZA1B 1SPKA 4BDZA 3HKSA 1IHWA 2GFAA 1BIBA 1D0YA 2CP6A 4A53A 2K5LA 5D6YA 2QGFB 3X25B 1VQ5A 2DL5A 1D1AA 4M7AC 2V8JA 3OYYA 4XU0A 1G2BA 1X69A 2RK1A 4WTOB 3MEVA 3MPUB 3JB9F 1JXOA 1NEBA 2COYA 1K73R 4MMKA 5DLQE 1TU0B 1EFNA 1JB0E 5IXBA 1WJQA 1YJWA 5KYYB 4M7DA 1Y7XA 5FLXE 1XOVA 2JN0A 5KYWB 4OMQA 2KAFA 1EZZB 3JCMV 5DM7R 3PIOA 3EGDB 3H8ZA 3QZ9B 2MYSA 3DLMA 1YN8A 3CC4Q 3TEEA 1JEGA 7AT1B 3S6WA 4QT7A 3CD6T 4Y92A 2CUDA 2M1HA 3LH0A 4C92B 2XMFA 4OGCA 3G4SQ 4BY6B 2OTJA 1AWOA 2SEMA 1Q86U 1UGRB 1WZOA 5I11A 1WDXA 3CMAQ 3M55A 3OS0A 2DTIA 3HSBA 3HPWA 2RJFA 1HYOA 2ESWA 1XTDA 2L3RA 3O5ZA 1BIAA 1M90R 5GAMj 1LNXA 1VQ7T 4JJDA 3NTHA 1ZHIA 2O4XB 5GANe 3JCMP 1CKAA 1K73U 1TG0A 4YTLA 5CAIA 3JB9H 1WXUA 1WXTA 4M77B 4M78A 4C0FA 2DAQA 1I07A 5GAMf 2PQWA 4A54A 4TVRA 5FU7C 2K3XA 1M1KC 2K4YA 3E9GA 2V8KA 2X3WD 3GPLA 4F16A 4C8QF 3AT1B 5KYUA 4L6V5 3A8HB 3JCMc 3CPWA 1ABOA 3JB9D 1PRLC 2NUTA 1NPPA 1U1SA 3R6NA 1QCFA 3HRSA 2E64A 3CCSA 2A28A 2LT1A 1Q86C 3OW2S 4E7IA 1TH7A 1ARKA 3OYMA 1UUEA 3QZ5B 3GF5A 1VQKA 4BE0A 1PCXA 3PMTA 2MCNA 1PWTA 4BE2A 3TVTA 1M90U 1M4ZA 3CXCA 2LP5A 3L2WA 2A37A 2LMJA 3CC4A 3OBWA 1K73C 2KY9A 3LW5E 1KG1A 1U3OA 4JZ3A 2VKNA 1LVKA 3EHQA 1VOMA 4ME7A 1NLPC 2J6KA 2ZPBB 1UB4A 4M7DE 3CMAA 1YJ9A 1QVGP 4HCBA 4FT2A 2BUDA 2RHIA 5A0GA 5FU6C 2KSSA 1B34A 5L8RE 2RMOA 2KXDA 1BI1A 1N9SA 2AK5A 4PFZA 3RUXA 3H9NA 1GCQA 2DVJA 3F70A 2XKOC 4IIOA 1QVFA 1UECA 3CCJA 3PGGA 1ZBXA 3KBGA 1BCOA 3CC2T 3MP8A 4PJOF 1VUBA 2PNIA 4LDYA 1M30A 4C8QD 2KNBB 1VYUA 2YT6A 3L2VA 4JRPA 1M90C 3UWNA 2LDMA 2BKDN 3E1SA 2KROA 4FM4B 5GAMh 2RJEA 4HCCA 5GAMg 1YBYA 2PVGB 3MP1A 1GFDA 3H6ZA 4J83A 1WIEA 1VQ9T 4FYYB 2CZ6B 4M75A 3RDVA 4AG2C 2FO0A 2GQVA 2D8JA 2KE9A 3VKIA 1IREB 4IUTA 4M78E 1MMDA 1H3HA 4DOWA 4ZGEB 1QVGA 3CBMA 2DJQA 1IO6A 2MF2A 1RAFB 4M7DG 2CH4A 2MWPA 1UTIA 3A98A 3H0FA 4QQDA 2RA2A 2QK0A 1N9RA 2LCLA 4EMGA 2EQKA 2SRCA 3QJ6A 4C5GA 2XIDA 1V1CA 2ENMA 1Z9QA 3BY7A 3RESA 2DJZA 4J6XA 4HT8A 1R77A 2DRKA 1AT1B 1M9SA 2LNHB 3CCQQ 3S3NA 3OS2A 2DK3A 1QWFA 1K1ZA 1VQ8T 4RCBA 2PVOB 1Q82R 3RERA 2WACA 1GBRA 5KYYA 2DILA 3GLXA 5D6XA 4PLIA 1Y0MA 1S72T 3G71Q 5GAN8 4OP0A 1VQPQ 2NUPA 4BACA 3EGDA 3QPHA 2WSEE 1AWJA 4M78G 1ABQA 2E1HA 4J9GA 3I56Q 4D8DA 2MIOA 2K6DA 1ZUYA 1C1AA 1UE9A 5HK0A 1NJIR 1WHLA 4PJOE 3ZL7C 2QA4A 5FWCA 1VQMQ 2L3SA 4J9FA 3JCMJ 1SF9A 1NLOC 2DD4A 2NYSA 4X1VA 2PVDB 5DLOA 3A1PA 2MK5A 5CKBA 2GCXA 5J26A 1JJ2A 3PVLA 2V1QA 3LYIA 1UGQB 4DBRA 2LQWA 2XU8A 4FU6A 1I0CA 4OB0B 3X24B 1ZSZA 3E9FA 4M7DB 1NEGA 2BIVA 3E19A 1NYGA 1WFWA 2KT8A 1UG1A 3LGLA 4XAXB 2C0IA 2O4XA 3CCRT 4C92F 4OMPA 3D7SB 1YIJQ 1C6VX 1G83A 3JCMX 1C0MA 3N5BB 4J9CA 2O31A 4M77A 2HD0A 3ULRB 1TTHB 2BE9B 2RQUA 5CKEA 2AIRB 3CCUT 4E7LA 4HCKA 4OGEA 1DJ7B 2QQ9A 4C8QC 2EQJA 3G6EQ 4M75E 2E65A 3GP8A 5GMKi 1I81A 1D3BB 1BI3A 4M78C 2EGCA 3OSVA 4LE9A 4R0KA 1NJIU 4N4IA 5I21A 4Y91A 3NHNA 3M0QA 2ZPIB 3QKJA 1N6AA 4PJJA 3DKMA 3CBPA 1SRMA 3CCQA 2MMPA 5CKHA 1ACMB 3CCLT 2QQAA 2C06A 3SWNA 3O8VA 1MGQA 4L59A 2HEQA 3BDLA 2VGNA 4EPCA 4K11A 5GAOq 5CKDA 1VQ6A 4M4ZA 2IG0A 2R57A 1U06A 4OB2B 1VQ5T 2CSIA 4PK4A 2COZA 3BW1A 3MEWA 4WF2A 3J80E 3GOXA 2DXBA 1VQ4Q 2V1RA 3EHRA 4JLIA 2DEUA 2QEXQ 2X4XA 4MZMA 1YJWT 1VQOA 2DF6A 2KRNA 3M0PA 3MKDA 1RAGB 3PMIA 2F1LA 3VYGA 4P5NA 1K9MC 2RD1A 2CUBA 3UATA 2FPFA 4M75G 2CZ0B 1OEBA 4C0GA 5A0DA 3ME9A 1AHJB 3RKYA 1NJIC 3PTAA 2OTJT 4QW2A 2KYMA 2AKLA 2D0QB 1I5OB 1M8VA 2KDSA 3SDZA 1AOJA 2X4WA 4PJOC 4J7FA 3L1AA 4C92E 5GMKm 4IUPA 3FLGA 4BE1A 1I1JA 1VIFA 3GIBA 3S3MA 4KH0B 2K9GA 5HK3A 3ASKA 3L2ZA 3GBQA 1PRMC 2JS2A 4AG1C 2QQBA 2K7AA 2JMCA 3VYHB 1M3CA 4XTXA 2J6FA 4LN2A 1IGQA 2D8HA 4ELZC 1UJ0A 3CCVQ 3CCEA 2CZ1B 2JW4A 1LCKA 1KHIA 4R56A 4M77E 4WCIA 1ZUKA 4PLLA 2E3HA 2W10A 3MP6A 3L42A 1GBQA 4RTZA 4M75C 2QASA 1BKBA 2RHYA 4LDXA 2DPPB 3L2UA 3C94A 5IH2A 3CCST 3V8LA 3VS7A 4LDVA 1XQHA 1UFFA 2OAUA 3Q1JA 3M59A 4OB3B 1VQ4A 3CCMQ 2E6NA 4XTUA 1VQKT 1VQLA 2HL3A 2RF0A 2P0KA 2JZ2A 2FB7A 1QVPA 2B86A 1IZ6A 5M9OA 2J05A 2ZZDA 2X35A 3SB2A 1YITQ 1FMVA 1TUCA 3FC3A 1ZQ1A 4J9BA 4KGXB 2F2XA 3FJPA 1VYVA 3OS1A 2IIMA 4IURA 1M1KR 1RL2A 1UGSB 3QJYA 4RCCA 2I2LA 2RM4A 5GAOp 2MPXC 2XHCA 2M02A 4QQ6A 3CMAT 1YJ9T 2KRMA 1WQ7A 5GAMd 1KD1R 1MV3A 2FVUA 4M77G 2F69A 2RH2A 2DM1A 1WLPB 5CK9A 3I35A 2G6FX 3RNJA 1PSFA 1GXIE 1OQKA 1K9AA 5CVIA 1QWEA 4QVZA 3I55T 1W2BS 1OX8A 3WVDB 3EG1A 3CCJT 2YUOA 3VS1A 1X01A 4C92C 2LVMA 3CCVA 1FWZA 2VUBA 4BY6C 3QHSA 1BU1A 2EWNA 2GGRA 4LNPA 3OW2A 3CC7A 4DQ2A 3J7AF 4E2FB 2NUPB 2VXFA 2E3IA 2EYYA 1M1KU 1AWWA 1N5ZA 3TSWA 1NBEB 3QYHB 4OMNA 3WVEB 1B7TA 2RI5A 5GJWB 3CPWP 1HXDA 2HNIA 3BFMA 1TWBA 5EG2A 2Z0WA 1KD1U 3QWXX 5GMKl 1VQNA 4M7DF 4JJBA 4J8OA 2QGGA 4M77C 1D3BA 3RKXA 4C0DC 2ZAEA 2ATCB 2PUKB 1X75C 3VRYA 4Z8AA 1ZSZB 2KT1A 2H8HA 2K79A 4ZN1A 3CXCP 3EG2A 5GAMe 3VU3C 1K4US 5LJ5h 2IVWA 1I8FA 3LGFA 1WNLA 1D0XA 1MV0B 2M0YA 2EJGA 4DBFA 3M53A 2CS7A 2DTOA 4XTYA 3VV0A 4GBQA 3ZBDA 4BDYA 4MDWA 4VUBA 1BYMA 4JRKA 2ROLA 1OOTA 5CKFA 4J6YA 2OTLQ 3JRZA 3SHWA 1N27A 1RLQC 3EFRA 4Z02A 2VVKA 4O6JA 1HD3A 1K76A 3QUIA 9ATCB 3OYDA 2H3EB 2MI6A 2OAWA 1CKBA 1G8XA 2CSQA 2QYZA 2DYIA 2VC8A 3NTKA 1OX9A 4PJMA 2DETA 3CMET 4E7ZA 3OYHA 1FXXA 1KD1C 4M78F 3AHUA 3M5AA 4Q5WA 1W1FA 1H641 4JS4A 1NZ9A 1QVFP 2D0NA 3SWNB 3M58A 1M2OA 2FPDA 3EFOB 2AT1B 2QA4T 4GY5A 2XDBA 1R8OB 3CD6Q 1SSHA 5I22A 2X4YA 1AVZC 5D6WA 2QTVA 4E7SA 4E47A 3PE0A 4HCZA 2O9SA 5CQYA 1OU8A 1ZBJA 2EKHA 4RTVA 1B3QA 2HQEA 4M7DD 1SRLA 1NPRA 4F7UA 1FX7A 3M0RA 3G4SA 4PFOA 4PKCC 1K8AR 2KVQG 1QLYA 2VYTA 3NTIA 2WSFE 2DE0X 2L5QA 3L2QA 5LJ3j 1NYFA 2X9HA 1VQ7Q 2YHTA 2V8IA 2JTFA 2LJ1A 3EFSA 1E6HA 1NE8A 5AT1B 4MMLA 4IUQA 3ZFJA 1BI2A 2JM9A 1WX6A 5LJ3f 3U23A 2HKQB 5HKCA 2R5MA 1SKUB 3NPFA 5HCKA 4CC7A 2ZGWA 2DD5A 3QIIA 2KYBA 2CGHA 1PG5B 2RK2A 4EIKA 2EJ9A 2QXFA 2JS0A 4XU1A 3CCQT 4AT1B 3GNFB 1KSWA 3VS5A 2L89A 3M0SA 2BTTA 3DLLA 3C0CA 5GAN7 8ATCB 4HXJA 4M78D 4JPBW 4DBQA 1P92A 2ZPFB 1VQ6T 1I5LA 2MWOA 3EG3A 2QDLA 1UEBA 2DKGA 3EG0A 1K8AU 2LTOA 2LZ6B 3KFVA 1WHMA 1OULA 2JJ9A 3RMSA 1VQOT 2KGTA 1W6XA 4EMKC 2HBPA 2CDTA 4LUDA 1MMNA 3V7SA 3RR6A 4ZNXA 2E10A 2GQIA 1X2QA 2F2VA 4M75F 3CD6A 1EIFA 1ZLMA 3P8BB 1PD1A 2KK4A 4N4GA 3OSSC 1G3YA 3MO8A 1JJ2P 1RADB 3REAB 2AKKA 3KXTA 1U8RA 3J81E 4A4GA 5CIUA 5FROA 1Q95G 2I0NA 2A0FB 2L8DA 2GNCA 2CT4A 3P8DA 2FPEA 1YP5A 5IXFA 4X34A 1J3TA 2AHJB 1ZX6A 2HL5C 3QDRB 3FRNA 4JRIA 3VJPA 1M8MA 1JRIA 4MZTA 3JSCA 3URGA 1K8AC 1K9MR 1X43A 2YDLA 1YWOA 4EMHA 1UHCA 2DL4A 5J39A 5GAOm 3HFNA 2K5FA 4PJOD 5GAN6 4ZTFA 4F7UE 4NS5A 1YI2T 5KH6A 1UJYA 5LJ3h 1BCMA 3UA7A 5LJ3g 3CCET 1YWPA 2LT4A 3OYAA 4M7DC 2CZ7B 1VQ9Q 2EQUA 2H3JA 2RQTA 4KULA 2YUPA 1LOJA 2AZSA 4RKUE 1YFNA 1OPKA 4RG8A 4M7AA 2V26A 2XDPA 3VUZA 4OMMA 3HRTA 2XG8D 2BZXA 2J6OA 5C0MA 1AZGB 2DYBA 2RB6A 1LJOA 6AT1B 3A8GB 2KI7A 4DA4A 2LC4A 1VQLT 4FW1A 3OMGA 4M75D 3G7ZA 3FDRA 2EYZA 2LCCA 4JDSA 3OYNA 4RTYA 1K9MU 3A8MB 4B6MA 3IQLA 1QCNA 1O9SA 1T0JA 3FEOA 1F1BB 3OYIA 1IRXA 1UGVA 2E4HA 1PD0A 1G3SA 1TXQA 3MHXA 4F7UG 1VQ8Q 3LWHA 2K5IA 5KE2A 4RTWA 2ECZA 1R0CB 4M77F 5IT9E 2K3BA 4CC2A 2HKNA 4A63B 2LJ0A 4OVAA 1U5SA 1W4SA 1S72Q 2NUZA 1Q7YR 2DX1A 3EFOA 2C0OA 3JCMW 1KK7A 4LD9K 2DVEA 2RHUA 2FEIA 4QVCA 3G71A 1VQPA 3V8KA 5FW9A 1IHVA 1Y57A 2RNAA 1SHFA 4UC4A 3QYGB 1FMWA 3I56A 5IHKA 2ED0A 1N8RR 1KQSS 1VQ9A 3QDFA 3LWIA 5GAOn 3CC7T 4II1A 4J5YA 1JU5C 2KXCA 4RMOA 1RAEB 1ZSGA 1VQMA 5LJ5d 4RTTA 2XDDA 3OQ5A 5KYXB 2E6ZA 4JZ4A 2HCKA 4Z89A 3OYFA 1AWXA 1LPLA 1FYNA 3H41A 4C92D 2D1XA 1M27C 2DO3A 3CQTA 3CCUQ 1VQNT 4PJNA 3S3OA 2DL3A 4KBMB 3A5ZB 1Q7YU 2IPOB 2Y4YA 1YIJA 4ANJA 4Y28E 3FB9A 3T9NA 1KQ2A 4XU2A 3EG9A 4F7UB 4M7AE 2ZCFB 5GAOl 1GCQC 4RTUA 3A8OB 3G6EA 2DBKA 1KIKA 2DXTA 4L5GA 2K3YA 4M77D 1YHQQ 1KQ1A 1QKWA 5IAYA 1M2VA 3G1JA 3H0IA 1N8RU 3REBB 4BUGA 1W2BA 2CREA 2KQWA 3JCMf 2O2OA 1UGPB 1JO8A 1SEMA 3TU4K 1D0ZA 1VQ5Q 2CYZB 2X3XD 5KCHA 4PNOA 1X2KA 4FIBA 3NGPA 1VA7A 2RQWA 3QBYA 1YJWQ 1PC0A 2F2WA 3TREA 3MEUA 3UT1A 5CO7A 2QQSA 5LJ5j 5LJ5e 3OYCA 3HL8A 2JXBA 3I9QA 1OYXA 1Q7YC 3FIFA 5IHNA 2EQMA 5FWBA 3JB9I 3DB3A 2QEXA 1ZA2B 1VYTA 1RABB 2E5KA 2RN8A 5DY9A 1NM7A 4ATOA 4D8KA 2FRWA 2ZPHB 2CP7A 5LJ5f 4A4EA 3OW2P 3QSUA 2CP2A 2DTHA 2FL7A 4CC3A 1V76A 5GAN2 3OMCA 4M7AG 3JAME 2M16A 3CC4T 2JUFA 2RI2A 1HK9A 2JMAA 3OYLA 1GFCA 4ESRA 4N4HA 1N8RC 2YRVA 1JXMA 5KYNA 3G4ST 4NL3A 3OYBA 1RLPC 3OS5A 5GMKh 1WJSA 2HAXA 2EQIA 5GAOr 4CC4B 4F04B 1RUWA 2LJ3A 1TUGB 3MCAB 1UDLA 2LX7A 3QG1A 4B9XA 2EYQA 3UPUA 3L2RA 2K57A 2ZPGB 4FW2A 1YHQA 3META 1IXDA 1KHCA 3VS0A 2FHDA 1FMKA 1B07A 4IIMA 2E41A 2DIGA 4ELYC 1Y71A 3OY9A 4XK8E 3JCMh 1X6OA 3CCSQ 2DERA 3JCMg 1OI1A 2RQRA 4ORZA 1QCOA 3VUBA 1M5Q1 2L2PA 5GAN3 1VQKQ 1ZSZC 3ZEHA 4A4KA 2AZVA 2HBWA 1YJNQ 3CPFA 1KFZA 2RPNA 3JCMQ 3CCMA 4RUGA 1SG5A 4E7JA 4HA8A 1M3AA 4FT4A 1PHTA 4M7AB 3VS6A 2O88A 5LL6S 2QQRA 2RI3A 1PM3A 4GLMA 1PKSA 4IUUA 2W0ZA 1RAHB 1YITA 4DBHA 1BB9A 1HSQA 5LJ5g 4N0AA 1XNIA 2WSCE 1YJ9Q 2EPDA 5LJ3d 1QP3A 2FRYA 3C95A 3HHTB 3OA6A 4BB7A 2RHXA 2DFUA 2EIFA 2A7YA 5L23A 4C8QA 2BE7D 1M1GA 1CSKA 2ABLA 3I55Q 5GANj 1G3WA 4FCYA 1IGUA 3SWNC 3HFOA 2P4TA 2OI3A 3CCJQ 3C12A 4C0DB 2C0TA 4V2SA 4OMFB 3TCJA 3RBBB 3TSZA 4FYVB 3GNGA 5KYXA 4QQGA 5GANf 1OZ2A 1H8KA 4MZPA 3VS4A 4KH1B 4IUVA 2RHZA 1H3ZA 1MNDA 3ER0A 2MOXA 3QXEB 4BD3A 2M9UA 2OX7A 4OMOA 1QKXA 4A4FA 2DZCA 1Y07A 5FU7B 2E5QA 4DEXA 1RAAB 4F14A 3UDCA 2CP5A 4DOVA 4J9DA 4JJNK 2KEAA 3CBOA 1YJNA 3DB4A 3OB9A 2P0QA 2DIQA 4HKEA 4E6RA 4RTXA 3OBYA 5LJ3e 2JVVA 4F17A 1MMAA 2BZ8A 3MEAA 5EC7A 1QMCA 1X6BA 3JB9J 4KUIA 2KBTA 1I4K1 2P4RA 2QAZA 1VIEA 2JNGA 2EAYA 1WYXA 3EGXB 2A08A 4F7UF 2DA9A 4PJOA 5J3BA 1GRIA 2RQVA 2K2VA 1WHHA 2KRSA 1WPYA 3M54A 3NMZC 4BI4A 1T0HA 2OTLA 3EG9B 3CMEQ 2NLUA 2O9VA 2Y4XA 1WHJA 3PIPA 3I55A 4C5EA 3INZA 4LDUA 3UF4A 4KT0E 1M2VB 4KGZB 3MJXA 4HT9A 4J9EA 3G71T 5FU6B 3JB9G 1VQPT 2YSQA 3VS3A 2QA4Q 3NFCA 3EH2A 1YNZA 4JLGA 1K0XA 3CPWS 3I56T 4E7KA 2OJ2A 1BI0A 2JM8A 3P8HA 4QVDA 1TSFA 2EYWA 5GANh 5GAN4 4B9WA 3M57A 5GANg 4C8QE 3EAEA 1WHKA 3M0UA 3M9QA 1VQMT 4DEYA 4EDUA 1PSEA 2LQKA 3HTRA 2L3QA 2DBMA 2ROTA 4E7HA 3VRZA 1E6GA 1KQSP 4AFSC 3CXCS 3LX7A 1KC8R 5IHIA 4HVWA 1YCYA 4AFQC 4J7IA 1QW1A 3M4YA 2P0PA 4FSSA 3FJ5A 1RI0A 4OF1A 2RJCA 4PFPA 1YIJT 1PKTA 1X6GA 3E2UA 1TOVA 2G3RA 1MNEA 1VQ7A 1OPLA 4EMKB 2EBPA
chains in the Genus database with same CATH topology
4NOYA 4RMOA 2FVUA 3QZ5B 4M77G 1VQMA 5LJ5d 4KUDK 3GF5A 3G6ET 2KMTA 4D6WA 2XDDA 1VQKA 2F69A 2RH2A 4BE0A 2CKKA 2EKOA 3OQ5A 2E6ZA 2FYKA 5CK9A 3PMTA 4NL2A 4BE2A 2HQXA 3OYFA 1M90U 5GAN5 1PSFA 1M4ZA 3CXCA 1GXIE 3OYGA 3L2WA 4C92D 5CVIA 2YLBA 1Y96B 4QVZA 3I55T 1W2BS 2DO3A 3CC4A 3OBWA 3V8JA 2KY9A 3LW5E 3WVDB 4ZGDB 3CCJT 3S3OA 1K73C 1QVFS 4C8QG 1KG1A 4KBMB 3CMEA 3V7CA 3A5ZB 1Q7YU 1M1FA 2Y4YA 1YIJA 3M56A 1X01A 4C92C 2LVMA 4ME7A 4Y28E 1FWZA 2VUBA 3CCVA 3FB9A 4BY6C 1KQSA 3QHSA 2EWNA 2ZPBB 5CQXA 3T9NA 3OW2A 1KC8U 1KQ2A 4XU2A 3CC7A 1UB4A 4M7DE 3CMAA 4DQ2A 1YJ9A 3J7AF 4HCBA 1QP2A 4F7UB 4M7AE 2ZCFB 5GAOl 2VXFA 2BUDA 2RHIA 4FT2A 5A0GA 3A8OB 3G6EA 1M1KU 5FU6C 4C92A 2KSSA 1B34A 2DXTA 3QYHB 5L8RE 4L5GA 3WVEB 2YLCA 2K3YA 4J6WA 2RI5A 4LDWA 1KQ1A 4M77D 2DEQA 2QEXT 5IAYA 1BI1A 1N9SA 1HXDA 2HNIA 3BFMA 1N8RU 3RUXA 5EG2A 1SSFA 4X9DA 4BUGA 2VV5A 3M4GA 1W2BA 1KD1U 2KQWA 5HY6A 3F70A 5GMKl 2XKOC 3JCMf 1QVGS 1QVFA 2QTXA 1UGPB 4C0ZA 2R58A 1VQNA 2D6FA 3CCJA 5I2SA 4M7DF 3PGGA 4J8OA 3TU4K 4C0DC 4M77C 1D3BA 3RKXA 2QI2A 4M7AF 1ZBXA 2CYZB 3KBGA 3CC2T 5KCHA 4PNOA 2PUKB 3MP8A 4PJOF 2XD0A 1VUBA 4LDYA 4N0AC 1X75C 4C8QD 3L2VA 1M90C 4JRPA 3QO3A 3UWNA 2LDMA 4FIBA 2BKDN 3E1SA 5GAMe 1Q82U 4FM4B 3QBYA 5GAMh 2RJEA 4HCCA 4ZN1A 5GAMg 3TREA 1YBYA 4XU3A 3VU3C 2PVGB 3MEUA 3UT1A 3MP1A 4PL6A 3H6ZA 2IVWA 1I8FA 3LGFA 4J83A 5CO7A 1WNLA 5LJ5h 2QQSA 2CZ6B 4J5YA 5LJ5j 2EJGA 5LJ5e 3OYCA 3HL8A 4M75A 2F5KA 4XTVA 3M53A 2CS7A 2DTOA 4XTYA 3VV0A 3ZBDA 4BDYA 1OYXA 1Q7YC 4MDWA 3FIFA 2ZPEB 3JCMd 2EQMA 4VUBA 3JB9I 2VGMA 3DB3A 3SD4A 2E70A 2QEXA 2GQVA 1BYMA 3VKIA 3JCMb 4JRKA 3PT9A 1IREB 1WGSA 5CKFA 4IUTA 5IN1A 1VQ4T 4J6YA 4M78E 5DY9A 3JRZA 1KC8C 4ATOA 1N27A 3EFRA 4DOWA 4Z02A 5KCOA 4JRQA 4ZGEB 4O6JA 2DZ9A 3CBMA 1QVGA 2ZPHB 5LJ5f 4A4EA 4E7JA 3QUIA 3OYDA 3QSUA 2MF2A 2DTHA 2FL7A 4M7DG 2MI6A 4CI0C 2MWPA 5GAN2 3OMCA 4M7AG 3JAME 2M16A 2VC8A 3CC4T 3NTKA 2DXUA 3CC2A 2JUFA 2RI2A 1HK9A 4QQDA 1YHQT 4C8QB 4PJOG 3OYLA 3CMET 4PJOD 3WXMB 4N4HA 3OYHA 2RA2A 1N8RC 2YRVA 1N9RA 1FXXA 2LCLA 3RIRA 4EMGA 3G4ST 1KD1C 3CCVT 2EQKA 4NL3A 4M78F 3OYBA 2LX9A 3AHUA 2JOYA 3QJ6A 3M5AA 4M78B 4GLKA 4Q5WA 2XIDA 1H641 2E12A 3OS5A 4C5GA 5GMKh 3BY7A 4JS4A 1NZ9A 5GMKe 5GMKj 1WJSA 1JBMA 2HAXA 3RESA 5GAOr 3SWNB 3M58A 2EFIA 2DJZA 2XICA 4FSXA 4J6XA 2QA4T 4HT8A 5FRNA 4GY5A 3RMQA 3CEYA 3BDUA 3PFSA 2XDBA 1M9SA 4JS5A 3S3NA 1R8OB 3OS2A 1Q82C 3MCAB 2DK3A 2RO0A 2X4YA 2R5AA 5D6WA 1VQ8T 3QG1A 4B9XA 2EYQA 3UPUA 4E47A 4HCZA 4RCBA 2K57A 2PVOB 5CQYA 3SFMA 3L2RA 1JJ2S 3RERA 3RKWA 2WACA 2ZPGB 3KUFA 3GLXA 2HQEA 3CCMT 1YHQA 2O01E 5D6XA 4M7DD 3META 4PLIA 3LLRA 4M7AD 1S72T 3X20B 5GAN8 4OP0A 1KHCA 1NPRA 4F7UA 1FX7A 4BACA 2FHDA 3QPHA 3G4SA 4XTWA 2WSEE 3V7RA 4PKCC 2KVQG 4M78G 2E41A 2VYTA 2DIGA 2E1HA 2WSFE 3NTIA 2L5QA 4ELYC 2QDYB 1Y71A 3OY9A 3L2QA 5LJ3j 1YITT 4XK8E 2X4JA 1X6OA 3JCMh 3JCMg 3JCMe 1OI1A 5HK0A 2YHTA 2DXCA 3VUBA 1M5Q1 2V8IA 4PJOE 2QA4A 5KE3A 2JTFA 2LRQA 5GAN3 2F5TX 3EFSA 3JCMJ 3ZEHA 2DD4A 1NE8A 4A4KA 4MMLA 2LQ8A 5FRMA 2PVDB 4IUQA 3ZFJA 5DLOA 1Q81U 1BI2A 1VQ8A 5CKBA 2Y90A 2GCXA 2EJFA 5J26A 5LJ3f 1JJ2A 5HKCA 5CCAA 2R5MA 3LYIA 1UGQB 3OYJA 3CPFA 1O75A 4XTZA 2XU8A 4FU6A 4OB0B 3X24B 2ZGWA 2DD5A 4C5HA 3OYEA 4BDZA 3JCMQ 3E9FA 3CCMA 4M7DB 2RJDA 3QIIA 2CGHA 4FL6A 3HRUA 2BIVA 3E19A 4FT4A 4HA8A 4M7AB 2RK2A 1S72A 2EJ9A 2QXFA 4CRIA 1G3TA 4XU1A 3CCQT 3LGLA 4XAXB 5LL6S 3GNFB 4PJOB 2QQRA 2O4XA 2RI3A 4C92F 3CCRT 2L89A 1YI2A 4IKFA 3DLLA 3JCMX 3N5BB 4IUUA 4M77A 1B34B 2HD0A 2PU9B 5GAN7 2A3LA 1YITA 3C4SA 4XQ3A 5CKEA 3CCUT 2M0OA 4E7LA 4M78D 5LJ5g 2JTMA 1P92A 2ZPFB 4N0AA 1XNIA 2WSCE 1DJ7B 4OGEA 4ZGJB 5LJ3d 2MWOA 1I5LA 1QP3A 2QQ9A 1VQ6T 4C8QC 2EQJA 2VXEA 1UEBA 3C95A 4O5VA 4BI8B 4M75E 2DKGA 3HHTB 3X28B 3OA6A 4BB7A 1K8AU 2E65A 3GP8A 2LTOA 2RHXA 2D9TA 5GMKi 2EIFA 3RMSA 1I81A 2A7YA 1D3BB 1BI3A 4M78C 2GF7A 3OSVA 4A4HA 2XI9A 1VQOT 4C8QA 1M1GA 4EMKC 5I2MA 4N4IA 2HBPA 5C6SA 5I21A 1NJIU 4Y91A 4RG2A 4BI3A 2ZPIB 3QKJA 1N6AA 5GANj 1G3WA 3V7SA 3SWNC 3HFOA 4X9CA 2P4TA 3DKMA 2E10A 3CBPA 3C12A 3PNWC 4C0DB 5A0LA 3CCQA 2MMPA 5CKHA 4C5IA 4V2SA 4M75F 4EMKA 3CCRA 3CD6A 4R55A 1EIFA 1Q81C 4C92G 4OMFB 3P8BB 4M75B 3TCJA 3CCLT 1YJNT 2QQAA 1V29B 2C06A 3SWNA 1MHNA 2KK4A 1OZ3A 3R6OA 3O8VA 4N4GA 1MGQA 5CR2A 3GNGA 3OSSC 1WQWA 3CCUA 1VQNT 3HP9A 1G3YA 4L59A 3BDLA 3MO8A 4QQGA 3X26B 5GANf 1OZ2A 1U1TA 2VGNA 4EPCA 4MZPA 5CKDA 5GAOq 1VQ6A 4IUVA 2IG0A 2RHZA 3KXTA 2R57A 1H3ZA 2XK0A 4OB2B 1VQ5T 2GFUA 3ER0A 1U8RA 3J81E 4A4GA 5CIUA 5FROA 3BW1A 3MEWA 1Y96A 4WF2A 3J80E 3QXEB 4BD3A 3GOXA 1WJRA 2DXBA 4MDXA 1G5VA 2M9UA 4JLIA 2L8DA 2X4XA 4LD6A 5A2QE 4MZMA 3P8DA 1YJWT 1VQOA 4OB1B 4JUVA 4A4FA 4X34A 3PMIA 2DZCA 3A8LB 4ZN3A 2MAMA 1Y07A 4P5NA 3VYGA 2AHJB 5AYFA 1K9MC 2LNVA 2E5QA 3QDRB 5FU7B 2RD1A 2B8AA 3FRNA 4JRIA 3VJPA 1VQ9T 1JRIA 3UDCA 5GANd 4MZTA 3JSCA 3URGA 4DOVA 1K8AC 2PUOB 4ZTJA 4JJNK 3OYKA 4M75G 3CBOA 2CZ0B 2OTLT 4EMHA 3CCLA 5J39A 5GAOm 4C0GA 3HFNA 1YJNA 5A0DA 2K5FA 3DB4A 3HKSA 2P0QA 3OB9A 3ME9A 2DIQA 1AHJB 2GFAA 4F7UE 4NS5A 3RKYA 5GAN6 5KH6A 4HKEA 1YI2T 1NJIC 1BIBA 3PTAA 5LJ3h 3OBYA 4A53A 5LJ3g 4QW2A 5LJ3e 3CCET 2K5LA 2OTJT 5D6YA 2LT4A 3OYAA 4M7DC 2CZ7B 3X25B 1VQ5A 2JVVA 2EQUA 2H3JA 2D0QB 4M7AC 2V8JA 3OYYA 4KULA 4XU0A 1M8VA 2RK1A 2KDSA 1LOJA 3SDZA 3MEVA 3MEAA 3JB9F 2X4WA 4PJOC 4J7FA 4RKUE 3L1AA 4C92E 5GMKm 3JB9J 4KUIA 4MMKA 4IUPA 3FLGA 5DLQE 1JB0E 1I4K1 4BE1A 1WJQA 1YJWA 4M7DA 1VIFA 1Y7XA 1XOVA 2JN0A 5FLXE 4RG8A 4M7AA 2XDPA 1VIEA 2JNGA 2EAYA 2KAFA 3VUZA 4F7UF 3GIBA 3S3MA 3HRTA 3JCMV 5DM7R 2XG8D 5HK3A 4PJOA 3PIOA 3ASKA 5C0MA 3L2ZA 5J3BA 3H8ZA 2K2VA 3QZ9B 2RB6A 3DLMA 1LJOA 1WPYA 3M54A 4BI4A 2QQBA 3TEEA 2OTLA 3A8GB 4DA4A 2NLUA 2LC4A 1VQLT 3VYHB 4XTXA 3S6WA 2Y4XA 3CD6T 2M1HA 3LH0A 3OMGA 4M75D 4C92B 4ELZC 4OGCA 3PIPA 3G7ZA 3FDRA 4BY6B 3CCEA 2OTJA 3I55A 4C5EA 3INZA 4LDUA 2CZ1B 2LCCA 4JDSA 1Q86U 1UGRB 1KHIA 4R56A 4KT0E 4M77E 3OYNA 1K9MU 3M55A 3OS0A 3A8MB 2DTIA 4PLLA 3HSBA 4HT9A 3G71T 5FU6B 3JB9G 1O9SA 1VQPT 3FEOA 3MP6A 3L42A 3HPWA 3OYIA 2RJFA 4M75C 3NFCA 4JLGA 1G3SA 3CPWS 1XTDA 3I56T 4E7KA 1BKBA 2RHYA 1BI0A 4LDXA 3MHXA 2L3RA 1BIAA 2DPPB 3P8HA 4F7UG 4QVDA 5GAMj 3L2UA 3C94A 3LWHA 2K5IA 5KE2A 3CCST 5GANh 5GAN4 3OYMA 3V8LA 3M57A 1LNXA 4B9WA 1VQ7T 5GANg 5GANe 3NTHA 1ZHIA 2O4XB 4LDVA 4C8QE 3JCMP 1XQHA 2OAUA 3EAEA 3Q1JA 4M77F 3M9QA 1K73U 3M59A 4OB3B 4YTLA 5CAIA 5IT9E 1VQMT 3JB9H 1VQ4A 4M77B 4M78A 4EDUA 2E6NA 1PSEA 4XTUA 4OVAA 2LQKA 1VQKT 1VQLA 4C0FA 1W4SA 2DAQA 4ZTFA 2P0KA 2JZ2A 2FB7A 5GAMf 1QVPA 5M9OA 1IZ6A 4E7HA 2PQWA 4A54A 3JCMW 2ZZDA 4TVRA 3CXCS 2X35A 5FU7C 4LD9K 2DVEA 3LX7A 3SB2A 2K3XA 2RHUA 1M1KC 2K4YA 3E9GA 2V8KA 3FC3A 3GPLA 1ZQ1A 4QVCA 1YCYA 3FJPA 4C8QF 3G71A 3OS1A 1VQPA 4J7IA 1QW1A 3M4YA 4IURA 3V8KA 2P0PA 4L6V5 1RL2A 3A8HB 1RI0A 4OF1A 3JCMc 3CPWA 1UGSB 2RJCA 3QJYA 4UC4A 3QYGB 4RCCA 3I56A 1YIJT 3JB9D 2I2LA 2RM4A 5GAOp 1NPPA 1U1SA 3HRSA 2G3RA 2E64A 3CCSA 2XHCA 2LT1A 1Q86C 1KQSS 1VQ9A 3LWIA 5GAOn 1VQ7A 4QQ6A 3OW2S 4E7IA 3CC7T 1TH7A 4II1A 3CMAT 1YJ9T 4EMKB 1WQ7A 5GAMd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI3 A;  2L89 A;  2X4W A;  4A4E A;  4IKF A;  3OYD A;  4IUU A;  4IUP A;  3FLG A;  4BE1 A;  2MWP A;  4BE0 A;  2CKK A;  1WJQ A;  2EKO A;  3OMC A;  3C4S A;  2M16 A;  3OQ5 A;  3NTK A;  3PMT A;  2M0O A;  2RI2 A;  4E7L A;  4BE2 A;  2XDP A;  4QQD A;  1XNI A;  2HQX A;  3OYF A;  3OYL A;  2MWO A;  3S3M A;  2EQJ A;  4N4H A;  3OYH A;  3ASK A;  2YRV A;  3OYG A;  3L2W A;  5C0M A;  3OA6 A;  4QVZ A;  3H8Z A;  2EQK A;  2LTO A;  2RHX A;  2D9T A;  3DLM A;  3OYB A;  3QJ6 A;  4C5G A;  4Q5W A;  3S3O A;  2NLU A;  2GF7 A;  4A4H A;  3S6W A;  1WJS A;  4N4I A;  5C6S A;  2M1H A;  3LH0 A;  3OMG A;  4RG2 A;  3FDR A;  2EFI A;  3QKJ A;  2LVM A;  4C5E A;  5FRN A;  4GY5 A;  2LCC A;  3CEY A;  3PFS A;  3OYN A;  3PNW C;  3S3N A;  3OS2 A;  3OS0 A;  4PLL A;  4C5I A;  2RO0 A;  2X4Y A;  2R5A A;  5D6W A;  2BUD A;  2RHI A;  4B9X A;  3FEO A;  3MP6 A;  3L42 A;  4HCZ A;  3OYI A;  3L2R A;  2RJF A;  1MHN A;  1OZ3 A;  2WAC A;  3O8V A;  4N4G A;  4L59 A;  3KUF A;  2K3Y A;  3BDL A;  2RI5 A;  3MO8 A;  2HQE A;  1OZ2 A;  4QQG A;  4E7K A;  2RHY A;  5IAY A;  5D6X A;  3MET A;  2L3R A;  4IUV A;  2IG0 A;  2RHZ A;  3LLR A;  3P8H A;  2R57 A;  4PLI A;  2XK0 A;  3L2U A;  1H3Z A;  2GFU A;  1KHC A;  5KE2 A;  1SSF A;  4BAC A;  2FHD A;  4B9W A;  4A4G A;  5CIU A;  5FRO A;  3NTH A;  2O4X B;  3MEW A;  3F70 A;  3EAE A;  3GOX A;  4BD3 A;  3Q1J A;  1G5V A;  1WJR A;  3M9Q A;  2VYT A;  2DIG A;  3NTI A;  2R58 A;  2L8D A;  4EDU A;  2E6N A;  2X4X A;  4LD6 A;  4OVA A;  3L2Q A;  3OY9 A;  3P8D A;  2DAQ A;  4ZTF A;  2P0K A;  2JZ2 A;  4A4F A;  1OI1 A;  3MP8 A;  4X34 A;  5KCH A;  3PMI A;  5M9O A;  4E7H A;  3L2V A;  2PQW A;  5KE3 A;  2E5Q A;  2B8A A;  2JTF A;  2LDM A;  3UWN A;  2LRQ A;  2BKD N;  2X35 A;  3LX7 A;  3QBY A;  3ZEH A;  2RJE A;  2K3X A;  2RHU A;  5FRM A;  3E9G A;  3FC3 A;  3MEU A;  4IUQ A;  3UT1 A;  3MP1 A;  4PL6 A;  3H6Z A;  4ZTJ A;  3OYK A;  3LGF A;  2QQS A;  3OS1 A;  3OYC A;  5J26 A;  4IUR A;  2F5K A;  5J39 A;  4BDY A;  3DB4 A;  2R5M A;  3OB9 A;  3LYI A;  4BDZ A;  1RI0 A;  2DIQ A;  1OYX A;  2GFA A;  3ME9 A;  4NS5 A;  4C5H A;  5KH6 A;  4FU6 A;  2RJC A;  3OYE A;  3OYJ A;  2EQM A;  4UC4 A;  3DB3 A;  3E9F A;  3SD4 A;  2RJD A;  3QII A;  4FL6 A;  4QW2 A;  4E7J A;  2BIV A;  5D6Y A;  1WGS A;  3OYA A;  3MEA A;  5IN1 A;  4IUT A;  2G3R A;  2EQU A;  4CRI A;  1N27 A;  4QQ6 A;  4Z02 A;  5KCO A;  3LGL A;  4II1 A;  4E7I A;  3OYM A;  3MEV A;  2QQR A;  2O4X A; 
#chains in the Genus database with same CATH topology
 4NOY A;  2CT3 A;  2FZK B;  4KUD K;  3G6E T;  2KMT A;  4D6W A;  1AD5 A;  2CKK A;  2EKO A;  1MUZ A;  4AFU C;  2FYK A;  3CC2 Q;  4NL2 A;  1RI9 A;  2HQX A;  5GAN 5;  2DRM A;  1OV3 A;  3OYG A;  5D7U A;  2YLB A;  1Y96 B;  2X51 A;  3V8J A;  5KYW A;  4HVU A;  4ZGD B;  1QVF S;  1VQ6 Q;  4C8Q G;  3CME A;  3V7C A;  2LCS A;  1M1F A;  2VWF A;  2COW A;  3M56 A;  2EYX A;  2L0A A;  1KQS A;  5CQX A;  1KC8 U;  2PZ1 A;  1VQO Q;  2M51 A;  1QP2 A;  1RAC B;  4C92 A;  2HZY A;  1BBZ A;  4J9H A;  1VQ4 T;  2YLC A;  4J6W A;  3I5S A;  4LDW A;  2DEQ A;  4JJC A;  2QEX T;  2DNU A;  1WA7 A;  8AT1 B;  1SSF A;  4X9D A;  2VV5 A;  3M4G A;  1XJW B;  2DLP A;  1E7O A;  5HY6 A;  1QVG S;  2QTX A;  4C0Z A;  2D6F A;  2R58 A;  5I2S A;  2DL8 A;  2A36 A;  4M7A F;  2QI2 A;  1M3B A;  2VAS A;  2XD0 A;  4N0A C;  3EGU A;  1HJD A;  3QO3 A;  1Q82 U;  4XU3 A;  4PL6 A;  2YWW A;  4MDX A;  2J06 A;  2F5K A;  4XTV A;  4FYW B;  2DMO A;  2ZPE B;  3JCM d;  2GTO A;  2J7I A;  2VGM A;  4LUE A;  3SD4 A;  2E70 A;  3THK A;  3JCM b;  3PT9 A;  1WGS A;  5IN1 A;  1GL5 A;  1KC8 C;  4JRQ A;  5KCO A;  1A0N B;  4KRT A;  2DZ9 A;  1YI2 Q;  2YUN A;  3CCE Q;  4CI0 C;  3M0T A;  2P84 A;  2DXU A;  3CC2 A;  3UA6 A;  1UHF A;  3I5R A;  4PJO G;  2QG9 B;  4C8Q B;  1YHQ T;  3WXM B;  2HSP A;  3RIR A;  3CCV T;  2LX9 A;  3EH1 A;  2JOY A;  4M78 B;  4GLK A;  2E12 A;  1YCS B;  1W2B P;  1Q81 R;  1PNJ A;  1SHG A;  1IB8 A;  1D1C A;  5GMK e;  5GMK j;  4QKU A;  1EX4 A;  1NG2 A;  4FYX B;  1JBM A;  2EFI A;  1RAI B;  2XIC A;  4FSX A;  5FRN A;  3RMQ A;  3CEY A;  1WXB A;  3BDU A;  3PFS A;  4JS5 A;  1VQL Q;  2VB6 A;  2LQN A;  1T3L A;  1Q82 C;  3CCR Q;  2RO0 A;  2R5A A;  3VS2 A;  2DL7 A;  5KYU B;  3SFM A;  1JJ2 S;  3RKW A;  1Z9Z A;  3KUF A;  2NUT B;  3BE3 A;  3CCM T;  2O01 E;  3EGX A;  1D09 B;  2PTK A;  3LLR A;  4M7A D;  3X20 B;  4PJL A;  3QWY A;  2JTE A;  2YRD A;  1X27 A;  4XTW A;  3V7R A;  1QQJ A;  1D1B A;  2NWM A;  2QDY B;  1YIT T;  1K0S A;  2X4J A;  1ZUU A;  1GCP A;  3JCM e;  4AFZ C;  4LXC A;  2DXC A;  5KE3 A;  1WI7 A;  2LRQ A;  2YRC A;  2F5T X;  4OML A;  2YXY A;  2EGE A;  3TQ7 P;  2EGA A;  5FRM A;  1OU9 A;  2LQ8 A;  1Q81 U;  2HMA A;  1VQ8 A;  2HDA A;  2Y90 A;  3CCL Q;  1TUD A;  2EJF A;  5CCA A;  2CH4 W;  3OYJ A;  4XTZ A;  1O75 A;  4C5H A;  3OYE A;  4AMC A;  1R0B G;  2RJD A;  4FL6 A;  3HRU A;  1S72 A;  1H92 A;  4CRI A;  1G3T A;  2ED1 A;  4PJO B;  1YI2 A;  4IKF A;  3PVQ A;  1B34 B;  2PU9 B;  2A3L A;  3C4S A;  4XQ3 A;  2M0O A;  4J9I A;  3CC7 Q;  2JTM A;  3H0H A;  4ZGJ B;  2VXE A;  4O5V A;  4BI8 B;  2FZG B;  2GBQ A;  3X28 B;  2JT4 A;  4KGV B;  2D9T A;  2L3P A;  2KR3 A;  2GF7 A;  3SEM A;  4A4H A;  2XI9 A;  1AEY A;  1JQQ A;  5GJV B;  5I2M A;  5C6S A;  4RG2 A;  4BI3 A;  2OTJ Q;  4Z88 A;  1T3S A;  2FG0 A;  4X9C A;  1VQN Q;  2GTJ A;  2HSE B;  3PNW C;  5A0L A;  5ECA A;  4C5I A;  4EMK A;  3CCR A;  4R55 A;  2EW3 A;  1Q81 C;  2YUQ A;  4C92 G;  2EVR A;  1S1N A;  4M75 B;  1YJN T;  4HVV A;  1V29 B;  1MHN A;  3R6O A;  1OZ3 A;  5CR2 A;  3CCU A;  1WQW A;  3HP9 A;  3X26 B;  1U1T A;  2FZC B;  2HQH A;  2K2M A;  2XK0 A;  2GFU A;  1MMG A;  1WHG A;  1Y96 A;  1G5V A;  1WJR A;  4LD6 A;  5A2Q E;  4OB1 B;  4JUV A;  3A8L B;  4ZN3 A;  2MAM A;  3JV3 A;  3LH5 A;  1KJW A;  5AYF A;  1BK2 A;  2CP3 A;  2LNV A;  2B8A A;  2CP0 A;  1Q86 R;  5GAN d;  1TS9 A;  1AZE A;  2PUO B;  4ZTJ A;  2BZY A;  1W70 A;  3OYK A;  2OTL T;  3CCL A;  1ZA1 B;  1SPK A;  4BDZ A;  3HKS A;  1IHW A;  2GFA A;  1BIB A;  1D0Y A;  2CP6 A;  4A53 A;  2K5L A;  5D6Y A;  2QGF B;  3X25 B;  1VQ5 A;  2DL5 A;  1D1A A;  4M7A C;  2V8J A;  3OYY A;  4XU0 A;  1G2B A;  1X69 A;  2RK1 A;  4WTO B;  3MEV A;  3MPU B;  3JB9 F;  1JXO A;  1NEB A;  2COY A;  1K73 R;  4MMK A;  5DLQ E;  1TU0 B;  1EFN A;  1JB0 E;  5IXB A;  1WJQ A;  1YJW A;  5KYY B;  4M7D A;  1Y7X A;  5FLX E;  1XOV A;  2JN0 A;  5KYW B;  4OMQ A;  2KAF A;  1EZZ B;  3JCM V;  5DM7 R;  3PIO A;  3EGD B;  3H8Z A;  3QZ9 B;  2MYS A;  3DLM A;  1YN8 A;  3CC4 Q;  3TEE A;  1JEG A;  7AT1 B;  3S6W A;  4QT7 A;  3CD6 T;  4Y92 A;  2CUD A;  2M1H A;  3LH0 A;  4C92 B;  2XMF A;  4OGC A;  3G4S Q;  4BY6 B;  2OTJ A;  1AWO A;  2SEM A;  1Q86 U;  1UGR B;  1WZO A;  5I11 A;  1WDX A;  3CMA Q;  3M55 A;  3OS0 A;  2DTI A;  3HSB A;  3HPW A;  2RJF A;  1HYO A;  2ESW A;  1XTD A;  2L3R A;  3O5Z A;  1BIA A;  1M90 R;  5GAM j;  1LNX A;  1VQ7 T;  4JJD A;  3NTH A;  1ZHI A;  2O4X B;  5GAN e;  3JCM P;  1CKA A;  1K73 U;  1TG0 A;  4YTL A;  5CAI A;  3JB9 H;  1WXU A;  1WXT A;  4M77 B;  4M78 A;  4C0F A;  2DAQ A;  1I07 A;  5GAM f;  2PQW A;  4A54 A;  4TVR A;  5FU7 C;  2K3X A;  1M1K C;  2K4Y A;  3E9G A;  2V8K A;  2X3W D;  3GPL A;  4F16 A;  4C8Q F;  3AT1 B;  5KYU A;  4L6V 5;  3A8H B;  3JCM c;  3CPW A;  1ABO A;  3JB9 D;  1PRL C;  2NUT A;  1NPP A;  1U1S A;  3R6N A;  1QCF A;  3HRS A;  2E64 A;  3CCS A;  2A28 A;  2LT1 A;  1Q86 C;  3OW2 S;  4E7I A;  1TH7 A;  1ARK A;  3OYM A;  1UUE A;  3QZ5 B;  3GF5 A;  1VQK A;  4BE0 A;  1PCX A;  3PMT A;  2MCN A;  1PWT A;  4BE2 A;  3TVT A;  1M90 U;  1M4Z A;  3CXC A;  2LP5 A;  3L2W A;  2A37 A;  2LMJ A;  3CC4 A;  3OBW A;  1K73 C;  2KY9 A;  3LW5 E;  1KG1 A;  1U3O A;  4JZ3 A;  2VKN A;  1LVK A;  3EHQ A;  1VOM A;  4ME7 A;  1NLP C;  2J6K A;  2ZPB B;  1UB4 A;  4M7D E;  3CMA A;  1YJ9 A;  1QVG P;  4HCB A;  4FT2 A;  2BUD A;  2RHI A;  5A0G A;  5FU6 C;  2KSS A;  1B34 A;  5L8R E;  2RMO A;  2KXD A;  1BI1 A;  1N9S A;  2AK5 A;  4PFZ A;  3RUX A;  3H9N A;  1GCQ A;  2DVJ A;  3F70 A;  2XKO C;  4IIO A;  1QVF A;  1UEC A;  3CCJ A;  3PGG A;  1ZBX A;  3KBG A;  1BCO A;  3CC2 T;  3MP8 A;  4PJO F;  1VUB A;  2PNI A;  4LDY A;  1M30 A;  4C8Q D;  2KNB B;  1VYU A;  2YT6 A;  3L2V A;  4JRP A;  1M90 C;  3UWN A;  2LDM A;  2BKD N;  3E1S A;  2KRO A;  4FM4 B;  5GAM h;  2RJE A;  4HCC A;  5GAM g;  1YBY A;  2PVG B;  3MP1 A;  1GFD A;  3H6Z A;  4J83 A;  1WIE A;  1VQ9 T;  4FYY B;  2CZ6 B;  4M75 A;  3RDV A;  4AG2 C;  2FO0 A;  2GQV A;  2D8J A;  2KE9 A;  3VKI A;  1IRE B;  4IUT A;  4M78 E;  1MMD A;  1H3H A;  4DOW A;  4ZGE B;  1QVG A;  3CBM A;  2DJQ A;  1IO6 A;  2MF2 A;  1RAF B;  4M7D G;  2CH4 A;  2MWP A;  1UTI A;  3A98 A;  3H0F A;  4QQD A;  2RA2 A;  2QK0 A;  1N9R A;  2LCL A;  4EMG A;  2EQK A;  2SRC A;  3QJ6 A;  4C5G A;  2XID A;  1V1C A;  2ENM A;  1Z9Q A;  3BY7 A;  3RES A;  2DJZ A;  4J6X A;  4HT8 A;  1R77 A;  2DRK A;  1AT1 B;  1M9S A;  2LNH B;  3CCQ Q;  3S3N A;  3OS2 A;  2DK3 A;  1QWF A;  1K1Z A;  1VQ8 T;  4RCB A;  2PVO B;  1Q82 R;  3RER A;  2WAC A;  1GBR A;  5KYY A;  2DIL A;  3GLX A;  5D6X A;  4PLI A;  1Y0M A;  1S72 T;  3G71 Q;  5GAN 8;  4OP0 A;  1VQP Q;  2NUP A;  4BAC A;  3EGD A;  3QPH A;  2WSE E;  1AWJ A;  4M78 G;  1ABQ A;  2E1H A;  4J9G A;  3I56 Q;  4D8D A;  2MIO A;  2K6D A;  1ZUY A;  1C1A A;  1UE9 A;  5HK0 A;  1NJI R;  1WHL A;  4PJO E;  3ZL7 C;  2QA4 A;  5FWC A;  1VQM Q;  2L3S A;  4J9F A;  3JCM J;  1SF9 A;  1NLO C;  2DD4 A;  2NYS A;  4X1V A;  2PVD B;  5DLO A;  3A1P A;  2MK5 A;  5CKB A;  2GCX A;  5J26 A;  1JJ2 A;  3PVL A;  2V1Q A;  3LYI A;  1UGQ B;  4DBR A;  2LQW A;  2XU8 A;  4FU6 A;  1I0C A;  4OB0 B;  3X24 B;  1ZSZ A;  3E9F A;  4M7D B;  1NEG A;  2BIV A;  3E19 A;  1NYG A;  1WFW A;  2KT8 A;  1UG1 A;  3LGL A;  4XAX B;  2C0I A;  2O4X A;  3CCR T;  4C92 F;  4OMP A;  3D7S B;  1YIJ Q;  1C6V X;  1G83 A;  3JCM X;  1C0M A;  3N5B B;  4J9C A;  2O31 A;  4M77 A;  2HD0 A;  3ULR B;  1TTH B;  2BE9 B;  2RQU A;  5CKE A;  2AIR B;  3CCU T;  4E7L A;  4HCK A;  4OGE A;  1DJ7 B;  2QQ9 A;  4C8Q C;  2EQJ A;  3G6E Q;  4M75 E;  2E65 A;  3GP8 A;  5GMK i;  1I81 A;  1D3B B;  1BI3 A;  4M78 C;  2EGC A;  3OSV A;  4LE9 A;  4R0K A;  1NJI U;  4N4I A;  5I21 A;  4Y91 A;  3NHN A;  3M0Q A;  2ZPI B;  3QKJ A;  1N6A A;  4PJJ A;  3DKM A;  3CBP A;  1SRM A;  3CCQ A;  2MMP A;  5CKH A;  1ACM B;  3CCL T;  2QQA A;  2C06 A;  3SWN A;  3O8V A;  1MGQ A;  4L59 A;  2HEQ A;  3BDL A;  2VGN A;  4EPC A;  4K11 A;  5GAO q;  5CKD A;  1VQ6 A;  4M4Z A;  2IG0 A;  2R57 A;  1U06 A;  4OB2 B;  1VQ5 T;  2CSI A;  4PK4 A;  2COZ A;  3BW1 A;  3MEW A;  4WF2 A;  3J80 E;  3GOX A;  2DXB A;  1VQ4 Q;  2V1R A;  3EHR A;  4JLI A;  2DEU A;  2QEX Q;  2X4X A;  4MZM A;  1YJW T;  1VQO A;  2DF6 A;  2KRN A;  3M0P A;  3MKD A;  1RAG B;  3PMI A;  2F1L A;  3VYG A;  4P5N A;  1K9M C;  2RD1 A;  2CUB A;  3UAT A;  2FPF A;  4M75 G;  2CZ0 B;  1OEB A;  4C0G A;  5A0D A;  3ME9 A;  1AHJ B;  3RKY A;  1NJI C;  3PTA A;  2OTJ T;  4QW2 A;  2KYM A;  2AKL A;  2D0Q B;  1I5O B;  1M8V A;  2KDS A;  3SDZ A;  1AOJ A;  2X4W A;  4PJO C;  4J7F A;  3L1A A;  4C92 E;  5GMK m;  4IUP A;  3FLG A;  4BE1 A;  1I1J A;  1VIF A;  3GIB A;  3S3M A;  4KH0 B;  2K9G A;  5HK3 A;  3ASK A;  3L2Z A;  3GBQ A;  1PRM C;  2JS2 A;  4AG1 C;  2QQB A;  2K7A A;  2JMC A;  3VYH B;  1M3C A;  4XTX A;  2J6F A;  4LN2 A;  1IGQ A;  2D8H A;  4ELZ C;  1UJ0 A;  3CCV Q;  3CCE A;  2CZ1 B;  2JW4 A;  1LCK A;  1KHI A;  4R56 A;  4M77 E;  4WCI A;  1ZUK A;  4PLL A;  2E3H A;  2W10 A;  3MP6 A;  3L42 A;  1GBQ A;  4RTZ A;  4M75 C;  2QAS A;  1BKB A;  2RHY A;  4LDX A;  2DPP B;  3L2U A;  3C94 A;  5IH2 A;  3CCS T;  3V8L A;  3VS7 A;  4LDV A;  1XQH A;  1UFF A;  2OAU A;  3Q1J A;  3M59 A;  4OB3 B;  1VQ4 A;  3CCM Q;  2E6N A;  4XTU A;  1VQK T;  1VQL A;  2HL3 A;  2RF0 A;  2P0K A;  2JZ2 A;  2FB7 A;  1QVP A;  2B86 A;  1IZ6 A;  5M9O A;  2J05 A;  2ZZD A;  2X35 A;  3SB2 A;  1YIT Q;  1FMV A;  1TUC A;  3FC3 A;  1ZQ1 A;  4J9B A;  4KGX B;  2F2X A;  3FJP A;  1VYV A;  3OS1 A;  2IIM A;  4IUR A;  1M1K R;  1RL2 A;  1UGS B;  3QJY A;  4RCC A;  2I2L A;  2RM4 A;  5GAO p;  2MPX C;  2XHC A;  2M02 A;  4QQ6 A;  3CMA T;  1YJ9 T;  2KRM A;  1WQ7 A;  5GAM d;  1KD1 R;  1MV3 A;  2FVU A;  4M77 G;  2F69 A;  2RH2 A;  2DM1 A;  1WLP B;  5CK9 A;  3I35 A;  2G6F X;  3RNJ A;  1PSF A;  1GXI E;  1OQK A;  1K9A A;  5CVI A;  1QWE A;  4QVZ A;  3I55 T;  1W2B S;  1OX8 A;  3WVD B;  3EG1 A;  3CCJ T;  2YUO A;  3VS1 A;  1X01 A;  4C92 C;  2LVM A;  3CCV A;  1FWZ A;  2VUB A;  4BY6 C;  3QHS A;  1BU1 A;  2EWN A;  2GGR A;  4LNP A;  3OW2 A;  3CC7 A;  4DQ2 A;  3J7A F;  4E2F B;  2NUP B;  2VXF A;  2E3I A;  2EYY A;  1M1K U;  1AWW A;  1N5Z A;  3TSW A;  1NBE B;  3QYH B;  4OMN A;  3WVE B;  1B7T A;  2RI5 A;  5GJW B;  3CPW P;  1HXD A;  2HNI A;  3BFM A;  1TWB A;  5EG2 A;  2Z0W A;  1KD1 U;  3QWX X;  5GMK l;  1VQN A;  4M7D F;  4JJB A;  4J8O A;  2QGG A;  4M77 C;  1D3B A;  3RKX A;  4C0D C;  2ZAE A;  2ATC B;  2PUK B;  1X75 C;  3VRY A;  4Z8A A;  1ZSZ B;  2KT1 A;  2H8H A;  2K79 A;  4ZN1 A;  3CXC P;  3EG2 A;  5GAM e;  3VU3 C;  1K4U S;  5LJ5 h;  2IVW A;  1I8F A;  3LGF A;  1WNL A;  1D0X A;  1MV0 B;  2M0Y A;  2EJG A;  4DBF A;  3M53 A;  2CS7 A;  2DTO A;  4XTY A;  3VV0 A;  4GBQ A;  3ZBD A;  4BDY A;  4MDW A;  4VUB A;  1BYM A;  4JRK A;  2ROL A;  1OOT A;  5CKF A;  4J6Y A;  2OTL Q;  3JRZ A;  3SHW A;  1N27 A;  1RLQ C;  3EFR A;  4Z02 A;  2VVK A;  4O6J A;  1HD3 A;  1K76 A;  3QUI A;  9ATC B;  3OYD A;  2H3E B;  2MI6 A;  2OAW A;  1CKB A;  1G8X A;  2CSQ A;  2QYZ A;  2DYI A;  2VC8 A;  3NTK A;  1OX9 A;  4PJM A;  2DET A;  3CME T;  4E7Z A;  3OYH A;  1FXX A;  1KD1 C;  4M78 F;  3AHU A;  3M5A A;  4Q5W A;  1W1F A;  1H64 1;  4JS4 A;  1NZ9 A;  1QVF P;  2D0N A;  3SWN B;  3M58 A;  1M2O A;  2FPD A;  3EFO B;  2AT1 B;  2QA4 T;  4GY5 A;  2XDB A;  1R8O B;  3CD6 Q;  1SSH A;  5I22 A;  2X4Y A;  1AVZ C;  5D6W A;  2QTV A;  4E7S A;  4E47 A;  3PE0 A;  4HCZ A;  2O9S A;  5CQY A;  1OU8 A;  1ZBJ A;  2EKH A;  4RTV A;  1B3Q A;  2HQE A;  4M7D D;  1SRL A;  1NPR A;  4F7U A;  1FX7 A;  3M0R A;  3G4S A;  4PFO A;  4PKC C;  1K8A R;  2KVQ G;  1QLY A;  2VYT A;  3NTI A;  2WSF E;  2DE0 X;  2L5Q A;  3L2Q A;  5LJ3 j;  1NYF A;  2X9H A;  1VQ7 Q;  2YHT A;  2V8I A;  2JTF A;  2LJ1 A;  3EFS A;  1E6H A;  1NE8 A;  5AT1 B;  4MML A;  4IUQ A;  3ZFJ A;  1BI2 A;  2JM9 A;  1WX6 A;  5LJ3 f;  3U23 A;  2HKQ B;  5HKC A;  2R5M A;  1SKU B;  3NPF A;  5HCK A;  4CC7 A;  2ZGW A;  2DD5 A;  3QII A;  2KYB A;  2CGH A;  1PG5 B;  2RK2 A;  4EIK A;  2EJ9 A;  2QXF A;  2JS0 A;  4XU1 A;  3CCQ T;  4AT1 B;  3GNF B;  1KSW A;  3VS5 A;  2L89 A;  3M0S A;  2BTT A;  3DLL A;  3C0C A;  5GAN 7;  8ATC B;  4HXJ A;  4M78 D;  4JPB W;  4DBQ A;  1P92 A;  2ZPF B;  1VQ6 T;  1I5L A;  2MWO A;  3EG3 A;  2QDL A;  1UEB A;  2DKG A;  3EG0 A;  1K8A U;  2LTO A;  2LZ6 B;  3KFV A;  1WHM A;  1OUL A;  2JJ9 A;  3RMS A;  1VQO T;  2KGT A;  1W6X A;  4EMK C;  2HBP A;  2CDT A;  4LUD A;  1MMN A;  3V7S A;  3RR6 A;  4ZNX A;  2E10 A;  2GQI A;  1X2Q A;  2F2V A;  4M75 F;  3CD6 A;  1EIF A;  1ZLM A;  3P8B B;  1PD1 A;  2KK4 A;  4N4G A;  3OSS C;  1G3Y A;  3MO8 A;  1JJ2 P;  1RAD B;  3REA B;  2AKK A;  3KXT A;  1U8R A;  3J81 E;  4A4G A;  5CIU A;  5FRO A;  1Q95 G;  2I0N A;  2A0F B;  2L8D A;  2GNC A;  2CT4 A;  3P8D A;  2FPE A;  1YP5 A;  5IXF A;  4X34 A;  1J3T A;  2AHJ B;  1ZX6 A;  2HL5 C;  3QDR B;  3FRN A;  4JRI A;  3VJP A;  1M8M A;  1JRI A;  4MZT A;  3JSC A;  3URG A;  1K8A C;  1K9M R;  1X43 A;  2YDL A;  1YWO A;  4EMH A;  1UHC A;  2DL4 A;  5J39 A;  5GAO m;  3HFN A;  2K5F A;  4PJO D;  5GAN 6;  4ZTF A;  4F7U E;  4NS5 A;  1YI2 T;  5KH6 A;  1UJY A;  5LJ3 h;  1BCM A;  3UA7 A;  5LJ3 g;  3CCE T;  1YWP A;  2LT4 A;  3OYA A;  4M7D C;  2CZ7 B;  1VQ9 Q;  2EQU A;  2H3J A;  2RQT A;  4KUL A;  2YUP A;  1LOJ A;  2AZS A;  4RKU E;  1YFN A;  1OPK A;  4RG8 A;  4M7A A;  2V26 A;  2XDP A;  3VUZ A;  4OMM A;  3HRT A;  2XG8 D;  2BZX A;  2J6O A;  5C0M A;  1AZG B;  2DYB A;  2RB6 A;  1LJO A;  6AT1 B;  3A8G B;  2KI7 A;  4DA4 A;  2LC4 A;  1VQL T;  4FW1 A;  3OMG A;  4M75 D;  3G7Z A;  3FDR A;  2EYZ A;  2LCC A;  4JDS A;  3OYN A;  4RTY A;  1K9M U;  3A8M B;  4B6M A;  3IQL A;  1QCN A;  1O9S A;  1T0J A;  3FEO A;  1F1B B;  3OYI A;  1IRX A;  1UGV A;  2E4H A;  1PD0 A;  1G3S A;  1TXQ A;  3MHX A;  4F7U G;  1VQ8 Q;  3LWH A;  2K5I A;  5KE2 A;  4RTW A;  2ECZ A;  1R0C B;  4M77 F;  5IT9 E;  2K3B A;  4CC2 A;  2HKN A;  4A63 B;  2LJ0 A;  4OVA A;  1U5S A;  1W4S A;  1S72 Q;  2NUZ A;  1Q7Y R;  2DX1 A;  3EFO A;  2C0O A;  3JCM W;  1KK7 A;  4LD9 K;  2DVE A;  2RHU A;  2FEI A;  4QVC A;  3G71 A;  1VQP A;  3V8K A;  5FW9 A;  1IHV A;  1Y57 A;  2RNA A;  1SHF A;  4UC4 A;  3QYG B;  1FMW A;  3I56 A;  5IHK A;  2ED0 A;  1N8R R;  1KQS S;  1VQ9 A;  3QDF A;  3LWI A;  5GAO n;  3CC7 T;  4II1 A;  4J5Y A;  1JU5 C;  2KXC A;  4RMO A;  1RAE B;  1ZSG A;  1VQM A;  5LJ5 d;  4RTT A;  2XDD A;  3OQ5 A;  5KYX B;  2E6Z A;  4JZ4 A;  2HCK A;  4Z89 A;  3OYF A;  1AWX A;  1LPL A;  1FYN A;  3H41 A;  4C92 D;  2D1X A;  1M27 C;  2DO3 A;  3CQT A;  3CCU Q;  1VQN T;  4PJN A;  3S3O A;  2DL3 A;  4KBM B;  3A5Z B;  1Q7Y U;  2IPO B;  2Y4Y A;  1YIJ A;  4ANJ A;  4Y28 E;  3FB9 A;  3T9N A;  1KQ2 A;  4XU2 A;  3EG9 A;  4F7U B;  4M7A E;  2ZCF B;  5GAO l;  1GCQ C;  4RTU A;  3A8O B;  3G6E A;  2DBK A;  1KIK A;  2DXT A;  4L5G A;  2K3Y A;  4M77 D;  1YHQ Q;  1KQ1 A;  1QKW A;  5IAY A;  1M2V A;  3G1J A;  3H0I A;  1N8R U;  3REB B;  4BUG A;  1W2B A;  2CRE A;  2KQW A;  3JCM f;  2O2O A;  1UGP B;  1JO8 A;  1SEM A;  3TU4 K;  1D0Z A;  1VQ5 Q;  2CYZ B;  2X3X D;  5KCH A;  4PNO A;  1X2K A;  4FIB A;  3NGP A;  1VA7 A;  2RQW A;  3QBY A;  1YJW Q;  1PC0 A;  2F2W A;  3TRE A;  3MEU A;  3UT1 A;  5CO7 A;  2QQS A;  5LJ5 j;  5LJ5 e;  3OYC A;  3HL8 A;  2JXB A;  3I9Q A;  1OYX A;  1Q7Y C;  3FIF A;  5IHN A;  2EQM A;  5FWB A;  3JB9 I;  3DB3 A;  2QEX A;  1ZA2 B;  1VYT A;  1RAB B;  2E5K A;  2RN8 A;  5DY9 A;  1NM7 A;  4ATO A;  4D8K A;  2FRW A;  2ZPH B;  2CP7 A;  5LJ5 f;  4A4E A;  3OW2 P;  3QSU A;  2CP2 A;  2DTH A;  2FL7 A;  4CC3 A;  1V76 A;  5GAN 2;  3OMC A;  4M7A G;  3JAM E;  2M16 A;  3CC4 T;  2JUF A;  2RI2 A;  1HK9 A;  2JMA A;  3OYL A;  1GFC A;  4ESR A;  4N4H A;  1N8R C;  2YRV A;  1JXM A;  5KYN A;  3G4S T;  4NL3 A;  3OYB A;  1RLP C;  3OS5 A;  5GMK h;  1WJS A;  2HAX A;  2EQI A;  5GAO r;  4CC4 B;  4F04 B;  1RUW A;  2LJ3 A;  1TUG B;  3MCA B;  1UDL A;  2LX7 A;  3QG1 A;  4B9X A;  2EYQ A;  3UPU A;  3L2R A;  2K57 A;  2ZPG B;  4FW2 A;  1YHQ A;  3MET A;  1IXD A;  1KHC A;  3VS0 A;  2FHD A;  1FMK A;  1B07 A;  4IIM A;  2E41 A;  2DIG A;  4ELY C;  1Y71 A;  3OY9 A;  4XK8 E;  3JCM h;  1X6O A;  3CCS Q;  2DER A;  3JCM g;  1OI1 A;  2RQR A;  4ORZ A;  1QCO A;  3VUB A;  1M5Q 1;  2L2P A;  5GAN 3;  1VQK Q;  1ZSZ C;  3ZEH A;  4A4K A;  2AZV A;  2HBW A;  1YJN Q;  3CPF A;  1KFZ A;  2RPN A;  3JCM Q;  3CCM A;  4RUG A;  1SG5 A;  4E7J A;  4HA8 A;  1M3A A;  4FT4 A;  1PHT A;  4M7A B;  3VS6 A;  2O88 A;  5LL6 S;  2QQR A;  2RI3 A;  1PM3 A;  4GLM A;  1PKS A;  4IUU A;  2W0Z A;  1RAH B;  1YIT A;  4DBH A;  1BB9 A;  1HSQ A;  5LJ5 g;  4N0A A;  1XNI A;  2WSC E;  1YJ9 Q;  2EPD A;  5LJ3 d;  1QP3 A;  2FRY A;  3C95 A;  3HHT B;  3OA6 A;  4BB7 A;  2RHX A;  2DFU A;  2EIF A;  2A7Y A;  5L23 A;  4C8Q A;  2BE7 D;  1M1G A;  1CSK A;  2ABL A;  3I55 Q;  5GAN j;  1G3W A;  4FCY A;  1IGU A;  3SWN C;  3HFO A;  2P4T A;  2OI3 A;  3CCJ Q;  3C12 A;  4C0D B;  2C0T A;  4V2S A;  4OMF B;  3TCJ A;  3RBB B;  3TSZ A;  4FYV B;  3GNG A;  5KYX A;  4QQG A;  5GAN f;  1OZ2 A;  1H8K A;  4MZP A;  3VS4 A;  4KH1 B;  4IUV A;  2RHZ A;  1H3Z A;  1MND A;  3ER0 A;  2MOX A;  3QXE B;  4BD3 A;  2M9U A;  2OX7 A;  4OMO A;  1QKX A;  4A4F A;  2DZC A;  1Y07 A;  5FU7 B;  2E5Q A;  4DEX A;  1RAA B;  4F14 A;  3UDC A;  2CP5 A;  4DOV A;  4J9D A;  4JJN K;  2KEA A;  3CBO A;  1YJN A;  3DB4 A;  3OB9 A;  2P0Q A;  2DIQ A;  4HKE A;  4E6R A;  4RTX A;  3OBY A;  5LJ3 e;  2JVV A;  4F17 A;  1MMA A;  2BZ8 A;  3MEA A;  5EC7 A;  1QMC A;  1X6B A;  3JB9 J;  4KUI A;  2KBT A;  1I4K 1;  2P4R A;  2QAZ A;  1VIE A;  2JNG A;  2EAY A;  1WYX A;  3EGX B;  2A08 A;  4F7U F;  2DA9 A;  4PJO A;  5J3B A;  1GRI A;  2RQV A;  2K2V A;  1WHH A;  2KRS A;  1WPY A;  3M54 A;  3NMZ C;  4BI4 A;  1T0H A;  2OTL A;  3EG9 B;  3CME Q;  2NLU A;  2O9V A;  2Y4X A;  1WHJ A;  3PIP A;  3I55 A;  4C5E A;  3INZ A;  4LDU A;  3UF4 A;  4KT0 E;  1M2V B;  4KGZ B;  3MJX A;  4HT9 A;  4J9E A;  3G71 T;  5FU6 B;  3JB9 G;  1VQP T;  2YSQ A;  3VS3 A;  2QA4 Q;  3NFC A;  3EH2 A;  1YNZ A;  4JLG A;  1K0X A;  3CPW S;  3I56 T;  4E7K A;  2OJ2 A;  1BI0 A;  2JM8 A;  3P8H A;  4QVD A;  1TSF A;  2EYW A;  5GAN h;  5GAN 4;  4B9W A;  3M57 A;  5GAN g;  4C8Q E;  3EAE A;  1WHK A;  3M0U A;  3M9Q A;  1VQM T;  4DEY A;  4EDU A;  1PSE A;  2LQK A;  3HTR A;  2L3Q A;  2DBM A;  2ROT A;  4E7H A;  3VRZ A;  1E6G A;  1KQS P;  4AFS C;  3CXC S;  3LX7 A;  1KC8 R;  5IHI A;  4HVW A;  1YCY A;  4AFQ C;  4J7I A;  1QW1 A;  3M4Y A;  2P0P A;  4FSS A;  3FJ5 A;  1RI0 A;  4OF1 A;  2RJC A;  4PFP A;  1YIJ T;  1PKT A;  1X6G A;  3E2U A;  1TOV A;  2G3R A;  1MNE A;  1VQ7 A;  1OPL A;  4EMK B;  2EBP A; 
#chains in the Genus database with same CATH homology
 4NOY A;  4RMO A;  2FVU A;  3QZ5 B;  4M77 G;  1VQM A;  5LJ5 d;  4KUD K;  3GF5 A;  3G6E T;  2KMT A;  4D6W A;  2XDD A;  1VQK A;  2F69 A;  2RH2 A;  4BE0 A;  2CKK A;  2EKO A;  3OQ5 A;  2E6Z A;  2FYK A;  5CK9 A;  3PMT A;  4NL2 A;  4BE2 A;  2HQX A;  3OYF A;  1M90 U;  5GAN 5;  1PSF A;  1M4Z A;  3CXC A;  1GXI E;  3OYG A;  3L2W A;  4C92 D;  5CVI A;  2YLB A;  1Y96 B;  4QVZ A;  3I55 T;  1W2B S;  2DO3 A;  3CC4 A;  3OBW A;  3V8J A;  2KY9 A;  3LW5 E;  3WVD B;  4ZGD B;  3CCJ T;  3S3O A;  1K73 C;  1QVF S;  4C8Q G;  1KG1 A;  4KBM B;  3CME A;  3V7C A;  3A5Z B;  1Q7Y U;  1M1F A;  2Y4Y A;  1YIJ A;  3M56 A;  1X01 A;  4C92 C;  2LVM A;  4ME7 A;  4Y28 E;  1FWZ A;  2VUB A;  3CCV A;  3FB9 A;  4BY6 C;  1KQS A;  3QHS A;  2EWN A;  2ZPB B;  5CQX A;  3T9N A;  3OW2 A;  1KC8 U;  1KQ2 A;  4XU2 A;  3CC7 A;  1UB4 A;  4M7D E;  3CMA A;  4DQ2 A;  1YJ9 A;  3J7A F;  4HCB A;  1QP2 A;  4F7U B;  4M7A E;  2ZCF B;  5GAO l;  2VXF A;  2BUD A;  2RHI A;  4FT2 A;  5A0G A;  3A8O B;  3G6E A;  1M1K U;  5FU6 C;  4C92 A;  2KSS A;  1B34 A;  2DXT A;  3QYH B;  5L8R E;  4L5G A;  3WVE B;  2YLC A;  2K3Y A;  4J6W A;  2RI5 A;  4LDW A;  1KQ1 A;  4M77 D;  2DEQ A;  2QEX T;  5IAY A;  1BI1 A;  1N9S A;  1HXD A;  2HNI A;  3BFM A;  1N8R U;  3RUX A;  5EG2 A;  1SSF A;  4X9D A;  4BUG A;  2VV5 A;  3M4G A;  1W2B A;  1KD1 U;  2KQW A;  5HY6 A;  3F70 A;  5GMK l;  2XKO C;  3JCM f;  1QVG S;  1QVF A;  2QTX A;  1UGP B;  4C0Z A;  2R58 A;  1VQN A;  2D6F A;  3CCJ A;  5I2S A;  4M7D F;  3PGG A;  4J8O A;  3TU4 K;  4C0D C;  4M77 C;  1D3B A;  3RKX A;  2QI2 A;  4M7A F;  1ZBX A;  2CYZ B;  3KBG A;  3CC2 T;  5KCH A;  4PNO A;  2PUK B;  3MP8 A;  4PJO F;  2XD0 A;  1VUB A;  4LDY A;  4N0A C;  1X75 C;  4C8Q D;  3L2V A;  1M90 C;  4JRP A;  3QO3 A;  3UWN A;  2LDM A;  4FIB A;  2BKD N;  3E1S A;  5GAM e;  1Q82 U;  4FM4 B;  3QBY A;  5GAM h;  2RJE A;  4HCC A;  4ZN1 A;  5GAM g;  3TRE A;  1YBY A;  4XU3 A;  3VU3 C;  2PVG B;  3MEU A;  3UT1 A;  3MP1 A;  4PL6 A;  3H6Z A;  2IVW A;  1I8F A;  3LGF A;  4J83 A;  5CO7 A;  1WNL A;  5LJ5 h;  2QQS A;  2CZ6 B;  4J5Y A;  5LJ5 j;  2EJG A;  5LJ5 e;  3OYC A;  3HL8 A;  4M75 A;  2F5K A;  4XTV A;  3M53 A;  2CS7 A;  2DTO A;  4XTY A;  3VV0 A;  3ZBD A;  4BDY A;  1OYX A;  1Q7Y C;  4MDW A;  3FIF A;  2ZPE B;  3JCM d;  2EQM A;  4VUB A;  3JB9 I;  2VGM A;  3DB3 A;  3SD4 A;  2E70 A;  2QEX A;  2GQV A;  1BYM A;  3VKI A;  3JCM b;  4JRK A;  3PT9 A;  1IRE B;  1WGS A;  5CKF A;  4IUT A;  5IN1 A;  1VQ4 T;  4J6Y A;  4M78 E;  5DY9 A;  3JRZ A;  1KC8 C;  4ATO A;  1N27 A;  3EFR A;  4DOW A;  4Z02 A;  5KCO A;  4JRQ A;  4ZGE B;  4O6J A;  2DZ9 A;  3CBM A;  1QVG A;  2ZPH B;  5LJ5 f;  4A4E A;  4E7J A;  3QUI A;  3OYD A;  3QSU A;  2MF2 A;  2DTH A;  2FL7 A;  4M7D G;  2MI6 A;  4CI0 C;  2MWP A;  5GAN 2;  3OMC A;  4M7A G;  3JAM E;  2M16 A;  2VC8 A;  3CC4 T;  3NTK A;  2DXU A;  3CC2 A;  2JUF A;  2RI2 A;  1HK9 A;  4QQD A;  1YHQ T;  4C8Q B;  4PJO G;  3OYL A;  3CME T;  4PJO D;  3WXM B;  4N4H A;  3OYH A;  2RA2 A;  1N8R C;  2YRV A;  1N9R A;  1FXX A;  2LCL A;  3RIR A;  4EMG A;  3G4S T;  1KD1 C;  3CCV T;  2EQK A;  4NL3 A;  4M78 F;  3OYB A;  2LX9 A;  3AHU A;  2JOY A;  3QJ6 A;  3M5A A;  4M78 B;  4GLK A;  4Q5W A;  2XID A;  1H64 1;  2E12 A;  3OS5 A;  4C5G A;  5GMK h;  3BY7 A;  4JS4 A;  1NZ9 A;  5GMK e;  5GMK j;  1WJS A;  1JBM A;  2HAX A;  3RES A;  5GAO r;  3SWN B;  3M58 A;  2EFI A;  2DJZ A;  2XIC A;  4FSX A;  4J6X A;  2QA4 T;  4HT8 A;  5FRN A;  4GY5 A;  3RMQ A;  3CEY A;  3BDU A;  3PFS A;  2XDB A;  1M9S A;  4JS5 A;  3S3N A;  1R8O B;  3OS2 A;  1Q82 C;  3MCA B;  2DK3 A;  2RO0 A;  2X4Y A;  2R5A A;  5D6W A;  1VQ8 T;  3QG1 A;  4B9X A;  2EYQ A;  3UPU A;  4E47 A;  4HCZ A;  4RCB A;  2K57 A;  2PVO B;  5CQY A;  3SFM A;  3L2R A;  1JJ2 S;  3RER A;  3RKW A;  2WAC A;  2ZPG B;  3KUF A;  3GLX A;  2HQE A;  3CCM T;  1YHQ A;  2O01 E;  5D6X A;  4M7D D;  3MET A;  4PLI A;  3LLR A;  4M7A D;  1S72 T;  3X20 B;  5GAN 8;  4OP0 A;  1KHC A;  1NPR A;  4F7U A;  1FX7 A;  4BAC A;  2FHD A;  3QPH A;  3G4S A;  4XTW A;  2WSE E;  3V7R A;  4PKC C;  2KVQ G;  4M78 G;  2E41 A;  2VYT A;  2DIG A;  2E1H A;  2WSF E;  3NTI A;  2L5Q A;  4ELY C;  2QDY B;  1Y71 A;  3OY9 A;  3L2Q A;  5LJ3 j;  1YIT T;  4XK8 E;  2X4J A;  1X6O A;  3JCM h;  3JCM g;  3JCM e;  1OI1 A;  5HK0 A;  2YHT A;  2DXC A;  3VUB A;  1M5Q 1;  2V8I A;  4PJO E;  2QA4 A;  5KE3 A;  2JTF A;  2LRQ A;  5GAN 3;  2F5T X;  3EFS A;  3JCM J;  3ZEH A;  2DD4 A;  1NE8 A;  4A4K A;  4MML A;  2LQ8 A;  5FRM A;  2PVD B;  4IUQ A;  3ZFJ A;  5DLO A;  1Q81 U;  1BI2 A;  1VQ8 A;  5CKB A;  2Y90 A;  2GCX A;  2EJF A;  5J26 A;  5LJ3 f;  1JJ2 A;  5HKC A;  5CCA A;  2R5M A;  3LYI A;  1UGQ B;  3OYJ A;  3CPF A;  1O75 A;  4XTZ A;  2XU8 A;  4FU6 A;  4OB0 B;  3X24 B;  2ZGW A;  2DD5 A;  4C5H A;  3OYE A;  4BDZ A;  3JCM Q;  3E9F A;  3CCM A;  4M7D B;  2RJD A;  3QII A;  2CGH A;  4FL6 A;  3HRU A;  2BIV A;  3E19 A;  4FT4 A;  4HA8 A;  4M7A B;  2RK2 A;  1S72 A;  2EJ9 A;  2QXF A;  4CRI A;  1G3T A;  4XU1 A;  3CCQ T;  3LGL A;  4XAX B;  5LL6 S;  3GNF B;  4PJO B;  2QQR A;  2O4X A;  2RI3 A;  4C92 F;  3CCR T;  2L89 A;  1YI2 A;  4IKF A;  3DLL A;  3JCM X;  3N5B B;  4IUU A;  4M77 A;  1B34 B;  2HD0 A;  2PU9 B;  5GAN 7;  2A3L A;  1YIT A;  3C4S A;  4XQ3 A;  5CKE A;  3CCU T;  2M0O A;  4E7L A;  4M78 D;  5LJ5 g;  2JTM A;  1P92 A;  2ZPF B;  4N0A A;  1XNI A;  2WSC E;  1DJ7 B;  4OGE A;  4ZGJ B;  5LJ3 d;  2MWO A;  1I5L A;  1QP3 A;  2QQ9 A;  1VQ6 T;  4C8Q C;  2EQJ A;  2VXE A;  1UEB A;  3C95 A;  4O5V A;  4BI8 B;  4M75 E;  2DKG A;  3HHT B;  3X28 B;  3OA6 A;  4BB7 A;  1K8A U;  2E65 A;  3GP8 A;  2LTO A;  2RHX A;  2D9T A;  5GMK i;  2EIF A;  3RMS A;  1I81 A;  2A7Y A;  1D3B B;  1BI3 A;  4M78 C;  2GF7 A;  3OSV A;  4A4H A;  2XI9 A;  1VQO T;  4C8Q A;  1M1G A;  4EMK C;  5I2M A;  4N4I A;  2HBP A;  5C6S A;  5I21 A;  1NJI U;  4Y91 A;  4RG2 A;  4BI3 A;  2ZPI B;  3QKJ A;  1N6A A;  5GAN j;  1G3W A;  3V7S A;  3SWN C;  3HFO A;  4X9C A;  2P4T A;  3DKM A;  2E10 A;  3CBP A;  3C12 A;  3PNW C;  4C0D B;  5A0L A;  3CCQ A;  2MMP A;  5CKH A;  4C5I A;  4V2S A;  4M75 F;  4EMK A;  3CCR A;  3CD6 A;  4R55 A;  1EIF A;  1Q81 C;  4C92 G;  4OMF B;  3P8B B;  4M75 B;  3TCJ A;  3CCL T;  1YJN T;  2QQA A;  1V29 B;  2C06 A;  3SWN A;  1MHN A;  2KK4 A;  1OZ3 A;  3R6O A;  3O8V A;  4N4G A;  1MGQ A;  5CR2 A;  3GNG A;  3OSS C;  1WQW A;  3CCU A;  1VQN T;  3HP9 A;  1G3Y A;  4L59 A;  3BDL A;  3MO8 A;  4QQG A;  3X26 B;  5GAN f;  1OZ2 A;  1U1T A;  2VGN A;  4EPC A;  4MZP A;  5CKD A;  5GAO q;  1VQ6 A;  4IUV A;  2IG0 A;  2RHZ A;  3KXT A;  2R57 A;  1H3Z A;  2XK0 A;  4OB2 B;  1VQ5 T;  2GFU A;  3ER0 A;  1U8R A;  3J81 E;  4A4G A;  5CIU A;  5FRO A;  3BW1 A;  3MEW A;  1Y96 A;  4WF2 A;  3J80 E;  3QXE B;  4BD3 A;  3GOX A;  1WJR A;  2DXB A;  4MDX A;  1G5V A;  2M9U A;  4JLI A;  2L8D A;  2X4X A;  4LD6 A;  5A2Q E;  4MZM A;  3P8D A;  1YJW T;  1VQO A;  4OB1 B;  4JUV A;  4A4F A;  4X34 A;  3PMI A;  2DZC A;  3A8L B;  4ZN3 A;  2MAM A;  1Y07 A;  4P5N A;  3VYG A;  2AHJ B;  5AYF A;  1K9M C;  2LNV A;  2E5Q A;  3QDR B;  5FU7 B;  2RD1 A;  2B8A A;  3FRN A;  4JRI A;  3VJP A;  1VQ9 T;  1JRI A;  3UDC A;  5GAN d;  4MZT A;  3JSC A;  3URG A;  4DOV A;  1K8A C;  2PUO B;  4ZTJ A;  4JJN K;  3OYK A;  4M75 G;  3CBO A;  2CZ0 B;  2OTL T;  4EMH A;  3CCL A;  5J39 A;  5GAO m;  4C0G A;  3HFN A;  1YJN A;  5A0D A;  2K5F A;  3DB4 A;  3HKS A;  2P0Q A;  3OB9 A;  3ME9 A;  2DIQ A;  1AHJ B;  2GFA A;  4F7U E;  4NS5 A;  3RKY A;  5GAN 6;  5KH6 A;  4HKE A;  1YI2 T;  1NJI C;  1BIB A;  3PTA A;  5LJ3 h;  3OBY A;  4A53 A;  5LJ3 g;  4QW2 A;  5LJ3 e;  3CCE T;  2K5L A;  2OTJ T;  5D6Y A;  2LT4 A;  3OYA A;  4M7D C;  2CZ7 B;  3X25 B;  1VQ5 A;  2JVV A;  2EQU A;  2H3J A;  2D0Q B;  4M7A C;  2V8J A;  3OYY A;  4KUL A;  4XU0 A;  1M8V A;  2RK1 A;  2KDS A;  1LOJ A;  3SDZ A;  3MEV A;  3MEA A;  3JB9 F;  2X4W A;  4PJO C;  4J7F A;  4RKU E;  3L1A A;  4C92 E;  5GMK m;  3JB9 J;  4KUI A;  4MMK A;  4IUP A;  3FLG A;  5DLQ E;  1JB0 E;  1I4K 1;  4BE1 A;  1WJQ A;  1YJW A;  4M7D A;  1VIF A;  1Y7X A;  1XOV A;  2JN0 A;  5FLX E;  4RG8 A;  4M7A A;  2XDP A;  1VIE A;  2JNG A;  2EAY A;  2KAF A;  3VUZ A;  4F7U F;  3GIB A;  3S3M A;  3HRT A;  3JCM V;  5DM7 R;  2XG8 D;  5HK3 A;  4PJO A;  3PIO A;  3ASK A;  5C0M A;  3L2Z A;  5J3B A;  3H8Z A;  2K2V A;  3QZ9 B;  2RB6 A;  3DLM A;  1LJO A;  1WPY A;  3M54 A;  4BI4 A;  2QQB A;  3TEE A;  2OTL A;  3A8G B;  4DA4 A;  2NLU A;  2LC4 A;  1VQL T;  3VYH B;  4XTX A;  3S6W A;  2Y4X A;  3CD6 T;  2M1H A;  3LH0 A;  3OMG A;  4M75 D;  4C92 B;  4ELZ C;  4OGC A;  3PIP A;  3G7Z A;  3FDR A;  4BY6 B;  3CCE A;  2OTJ A;  3I55 A;  4C5E A;  3INZ A;  4LDU A;  2CZ1 B;  2LCC A;  4JDS A;  1Q86 U;  1UGR B;  1KHI A;  4R56 A;  4KT0 E;  4M77 E;  3OYN A;  1K9M U;  3M55 A;  3OS0 A;  3A8M B;  2DTI A;  4PLL A;  3HSB A;  4HT9 A;  3G71 T;  5FU6 B;  3JB9 G;  1O9S A;  1VQP T;  3FEO A;  3MP6 A;  3L42 A;  3HPW A;  3OYI A;  2RJF A;  4M75 C;  3NFC A;  4JLG A;  1G3S A;  3CPW S;  1XTD A;  3I56 T;  4E7K A;  1BKB A;  2RHY A;  1BI0 A;  4LDX A;  3MHX A;  2L3R A;  1BIA A;  2DPP B;  3P8H A;  4F7U G;  4QVD A;  5GAM j;  3L2U A;  3C94 A;  3LWH A;  2K5I A;  5KE2 A;  3CCS T;  5GAN h;  5GAN 4;  3OYM A;  3V8L A;  3M57 A;  1LNX A;  4B9W A;  1VQ7 T;  5GAN g;  5GAN e;  3NTH A;  1ZHI A;  2O4X B;  4LDV A;  4C8Q E;  3JCM P;  1XQH A;  2OAU A;  3EAE A;  3Q1J A;  4M77 F;  3M9Q A;  1K73 U;  3M59 A;  4OB3 B;  4YTL A;  5CAI A;  5IT9 E;  1VQM T;  3JB9 H;  1VQ4 A;  4M77 B;  4M78 A;  4EDU A;  2E6N A;  1PSE A;  4XTU A;  4OVA A;  2LQK A;  1VQK T;  1VQL A;  4C0F A;  1W4S A;  2DAQ A;  4ZTF A;  2P0K A;  2JZ2 A;  2FB7 A;  5GAM f;  1QVP A;  5M9O A;  1IZ6 A;  4E7H A;  2PQW A;  4A54 A;  3JCM W;  2ZZD A;  4TVR A;  3CXC S;  2X35 A;  5FU7 C;  4LD9 K;  2DVE A;  3LX7 A;  3SB2 A;  2K3X A;  2RHU A;  1M1K C;  2K4Y A;  3E9G A;  2V8K A;  3FC3 A;  3GPL A;  1ZQ1 A;  4QVC A;  1YCY A;  3FJP A;  4C8Q F;  3G71 A;  3OS1 A;  1VQP A;  4J7I A;  1QW1 A;  3M4Y A;  4IUR A;  3V8K A;  2P0P A;  4L6V 5;  1RL2 A;  3A8H B;  1RI0 A;  4OF1 A;  3JCM c;  3CPW A;  1UGS B;  2RJC A;  3QJY A;  4UC4 A;  3QYG B;  4RCC A;  3I56 A;  1YIJ T;  3JB9 D;  2I2L A;  2RM4 A;  5GAO p;  1NPP A;  1U1S A;  3HRS A;  2G3R A;  2E64 A;  3CCS A;  2XHC A;  2LT1 A;  1Q86 C;  1KQS S;  1VQ9 A;  3LWI A;  5GAO n;  1VQ7 A;  4QQ6 A;  3OW2 S;  4E7I A;  3CC7 T;  1TH7 A;  4II1 A;  3CMA T;  1YJ9 T;  4EMK B;  1WQ7 A;  5GAM d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...