4HCZA

Phf1 tudor in complex with h3k36me3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 1
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4hczA00
3PNWC 3LX7A 3NTHA 2R57A 2RI5A 4NS5A 3QBYA 2QQRA 3OB9A 2MWPA 4HCZA 3NTKA 1OI1A 3META 3UT1A 3LLRA 3LYIA 4N4GA 3M9QA 2LRQA 3UWNA 2MWOA 2G3RA 2O4XA 1N27A 3MO8A 2X4XA 4RG2A 5J26A 4QQGA 3DLMA 3OYKA 4X34A 2GFAA 3OYHA 2LTOA 2EQMA 3FEOA 4C5IA 3O8VA 4A4HA 3OY9A 2HQXA 2K3YA 2RJCA 4N4HA 5M9OA 3OS1A 2R58A 1OYXA 3KUFA 3DB4A 3MP6A 3OMGA 4FU6A 5D6YA 3S3OA 4ZTJA 4A4EA 4IUUA 4IUVA 2XK0A 3QJ6A 2X4WA 2JZ2A 3CEYA 4PL6A 5IN1A 4C5GA 2RO0A 3PMIA 2X4YA 2EQJA 5FRMA 4C5EA 5KE2A 3H8ZA 3S6WA 4QVZA 2P0KA 2NLUA 3L2UA 2X35A 5KCOA 2RHXA 3OYNA 5C0MA 4BACA 4C5HA 5KH6A 4GY5A 2EFIA 3FDRA 3MEVA 2DAQA 2IG0A 3QKJA 1KHCA 1WJQA 2EQUA 3OYIA 4LD6A 5FROA 4BDZA 3P8HA 3OYMA 3OS2A 1XNIA 4E7LA 4FL6A 3OQ5A 2XDPA 3OMCA 1WJRA 3ME9A 4BE0A 1OZ2A 2L3RA 4E7JA 2O4XB 4A4FA 4PLIA 4II1A 4BE1A 2RI2A 3L42A 1OZ3A 2R5AA 3FLGA 1WGSA 3Q1JA 2EQKA 2GFUA 3OYEA 2BUDA 3OYCA 4E7HA 2RI3A 2LCCA 3NTIA 4B9WA 3OA6A 2E5QA 3PFSA 4N4IA 2R5MA 4OVAA 4PLLA 4EDUA 2LDMA 4IUTA 3P8DA 4Z02A 4IUPA 3PMTA 3MEAA 3ZEHA 3ASKA 2PQWA 3DB3A 3EAEA 3OYFA 3OYLA 3OYJA 5IAYA 3GOXA 2VYTA 3H6ZA 4IURA 2BIVA 2L89A 2D9TA 3MP1A 3S3NA 1SSFA 2RHUA 2E6NA 2FHDA 3L2VA 2RHIA 2EKOA 1WJSA 5D6XA 3L2RA 4QW2A 3LH0A 4B9XA 1H3ZA 3C4SA 2K3XA 4BD3A 2RJDA 2YRVA 2L8DA 3MP8A 2B8AA 2RHZA 1RI0A 4QQ6A 3L2QA 1G5VA 2DIGA 5KCHA 3S3MA 4BDYA 3BDLA 3MEWA 2BKDN 2JTFA 4UC4A 3LGLA 4Q5WA 3LGFA 4IUQA 3OS0A 4QQDA 2DIQA 2M1HA 2RJFA 3E9FA 4CRIA 2LVMA 2RHYA 4E7IA 4L59A 4E7KA 2M16A 3OYBA 5C6SA 3OYGA 3L2WA 3FC3A 2RJEA 4A4GA 2QQSA 5D6WA 3E9GA 2M0OA 5KE3A 3SD4A 1MHNA 3QIIA 2WACA 2F5KA 2HQEA 3F70A 5CIUA 4IKFA 2GF7A 3OYDA 3OYAA 4ZTFA 4BE2A 5FRNA 5J39A 3MEUA 2CKKA
chains in the Genus database with same CATH superfamily
1U8RA 4FCYA 1IZ6A 2EYQA 4BB7A 1X2KA 2CT4A 2KSSA 3FJ5A 2XD0A 3META 2QA4A 3DLLA 1I0CA 2HSEB 1K8AU 5J26A 2Y90A 2CREA 1LOJA 2D0NA 2LTOA 2HQXA 1W2BS 2CSIA 1UB4A 2JW4A 4C0FA 3ZBDA 3V7SA 4C8QF 3PMIA 5ECAA 1B7TA 2X4YA 1MGQA 4C8QB 3VUZA 1OU9A 5C0MA 5IT9E 3H0IA 1KHCA 3QYHB 3OYIA 4LD6A 1VYTA 2G6FX 3OQ5A 2ZPIB 4X1VA 1B3QA 4KUDK 1O9SA 1WGSA 2RI3A 2YHTA 1WFWA 1ZLMA 2ESWA 4A4KA 2HMAA 3PFSA 1FWZA 2MPXC 2K2MA 2EGCA 4IUTA 2FG0A 4IUPA 3ASKA 1I8FA 2E5KA 3HFOA 2C06A 2RD1A 2KROA 2X3WD 3CCQT 1V1CA 2XHCA 1BI1A 2ROLA 5AYFA 1K4US 2YWWA 5GJVB 4C92G 1QMCA 5HK0A 2BTTA 4CC7A 4A53A 2A0FB 3BFMA 2VVKA 2BKDN 2X51A 4M4ZA 2I0NA 4MDWA 1M3AA 4QQDA 4CRIA 2FYKA 1JJ2P 1PWTA 1Y96A 3EGUA 5LL6S 1YITQ 3VU3C 2CT3A 1CKBA 1FMVA 1G3SA 2E10A 2LP5A 1PKTA 1R0CB 1S72Q 3PVLA 2BZXA 2J6OA 4EMGA 3OBWA 4C92E 1F1BB 3QBYA 2E12A 4M78B 1MNEA 5HCKA 2RF0A 3M9QA 1BK2A 2HZYA 2O4XA 3JCMd 3E2UA 2ED0A 3LH5A 1NJIR 4OMPA 2KDSA 4DQ2A 1Y7XA 2E6ZA 2PU9B 4OMOA 3CC4Q 2V26A 1Q81C 4OMLA 4GBQA 3X20B 4C5GA 3FB9A 1H641 3GP8A 5KE2A 2I2LA 3FIFA 4QVZA 2RHXA 5KYUA 3I9QA 1C1AA 1ZUYA 2RMOA 5GAMd 4NL3A 3JCMP 1WYXA 2CP0A 3QKJA 4OGCA 4OB1B 4BDZA 4M7DC 2F5TX 4RCBA 1RL2A 4XTVA 3JB9F 2L3RA 4BE1A 1ACMB 5GMKl 4M78G 5I11A 2QDLA 4AFUC 2LJ1A 2ZPBB 3CCST 2DXBA 5D7UA 1KD1R 2JTMA 4Z89A 2GTJA 4OVAA 5LJ5e 1QLYA 1QVGS 1VQKT 2HSPA 3A5ZB 2VYTA 3OYYA 3QUIA 1YI2A 1X43A 4JJBA 2KT8A 1N8RR 2A28A 1WXUA 4D8KA 1VA7A 4LDYA 1VQPT 3CCSA 2L8DA 2YDLA 1M2OA 1IGUA 1X6OA 5KCHA 2C0IA 2XMFA 3VRYA 4C8QD 2YXYA 3ZFJA 1VQ5Q 1Q81R 2H8HA 4HVUA 3TQ7P 3CCVT 2F2XA 4A4GA 2QG9B 1QCOA 4FIBA 2OTLT 5LJ5h 1VQ5A 3GLXA 1MV3A 3KXTA 2DLPA 2DD4A 2KRNA 1YFNA 2BZYA 2RI5A 3UDCA 2ZPEB 3RESA 4RTYA 1OI1A 1W2BP 1GXIE 1EZZB 2FB7A 1WDXA 4KRTA 2MWOA 1YJ9A 2AIRB 3SDZA 2C0TA 2E4HA 1ZA2B 2CP3A 4IUVA 4J7IA 5GAN7 1YNZA 2PNIA 2KAFA 1ZHIA 3PIOA 2RO0A 1I81A 2IVWA 4DA4A 2AZSA 1AZEA 4M75F 3RUXA 4J6XA 5L23A 2LT1A 1M27C 1WJQA 3VS3A 1M2VA 3CCJT 1C0MA 1FXXA 4OMMA 2HL3A 2QQAA 3JCMJ 2MCNA 1OZ2A 1VQ4T 4M7AG 1VQMQ 2QDYB 1XQHA 2RI2A 1UE9A 3CXCP 3CCUT 4F7UF 2GFUA 2VUBA 4F7UB 3C95A 2LCCA 2VB6A 2QEXQ 2RQTA 3CC4A 1NYFA 1WHGA 4HCCA 1EFNA 2K79A 3CBPA 1LVKA 1WHHA 1B34A 1D0YA 5CKHA 4JJDA 2PTKA 3CCJA 1VQOT 2L89A 3M4YA 1SSFA 1YBYA 2RHUA 1YIJQ 1M5Q1 4CC3A 3L2VA 3EHRA 2X9HA 5I2SA 2VC8A 2ZPHB 1OPKA 1JQQA 2CZ0B 2B8AA 2E41A 1W4SA 5GMKi 5GMKh 2VXFA 3HRSA 4C0ZA 3G7ZA 3EFOA 2JT4A 3HHTB 1YITA 3VS7A 1MHNA 2GNCA 4XU0A 1VYUA 2W10A 3MPUB 3CPWS 1WHJA 2OX7A 2OTJQ 3CCLA 2HDAA 1M3BA 2JMCA 1E6GA 2R57A 3CBOA 5IHIA 1VOMA 5GAN3 3G4ST 3WVEB 4PFOA 2QQRA 2MIOA 1ABOA 2O01E 1NEGA 4NOYA 1NE8A 1VQ9T 2G3RA 3X25B 3RKYA 1LNXA 2WSFE 1VQ9Q 4TVRA 2DZCA 2JOYA 3LWHA 4JLGA 6AT1B 4LUDA 2C0OA 1I4K1 3KUFA 1VQLA 4XTZA 1RABB 2X4WA 1TWBA 1BIBA 3SFMA 5A0GA 5GAMj 2KRMA 1M1GA 1PKSA 2J6KA 1VQNA 1AT1B 3OYNA 3PGGA 4L6V5 2X4JA 4AFZC 2IG0A 2NUTA 2EQUA 4IIOA 1T3LA 4JZ3A 5AT1B 2QGGA 1RAAB 3V8JA 1YJNA 2LNVA 1QVGP 4QT7A 2FO0A 1H3HA 1UTIA 1YN8A 1QWFA 1HJDA 4J8OA 3JCMb 1MUZA 3OA6A 3PIPA 5FU6B 1Q7YC 1G8XA 3EG9A 3GOXA 4OGEA 3QO3A 5KYYB 2BIVA 2MMPA 4M78E 2KR3A 8AT1B 2DPPB 2FHDA 4J9FA 2RHIA 5GAN8 4DBRA 4BUGA 3MHXA 4NL2A 2RJDA 4RUGA 3JCMh 1VQMA 2QEXT 3PTAA 3CC2T 1TXQA 4M78A 4R55A 3I56A 2JTFA 1UJ0A 4R56A 1OQKA 2DTHA 4RTZA 4IUQA 3OW2S 1Z9QA 3PE0A 1VQ4Q 3OYGA 3E9GA 4JRQA 1HXDA 4IKFA 4DBQA 3RBBB 1YHQQ 8ATCB 2VKNA 3A8LB 4M7AB 4MMKA 4NS5A 4C92C 4E2FB 1BU1A 1WIEA 4O6JA 1G83A 1RI9A 1G3WA 3G71T 4ORZA 1E6HA 1N27A 2RA2A 4V2SA 3JCMV 2VXEA 1KJWA 4O5VA 4JLIA 2RJCA 4N4HA 4EMKB 2FRWA 2EJGA 1Y0MA 4PKCC 1D1CA 3QXEB 1VQ7T 2XK0A 2Y4YA 4PL6A 5A0DA 4F7UE 4ZNXA 4C92F 1KK7A 1AWWA 3L2UA 5GAOr 4M7AE 4HCKA 1AVZC 1NLOC 3HL8A 1M8MA 1UGVA 5GAOp 1VIEA 2HL5C 3QWXX 2A37A 4E7LA 4FL6A 3GNFB 3OMCA 1WNLA 1TUGB 3QJYA 2EBPA 4X9CA 1KQSA 4A4FA 1VQ8Q 1N8RU 2DL7A 1U3OA 1Q7YR 2JTEA 7AT1B 4HT9A 3G6ET 3JCMX 4JDSA 3VS6A 4B9WA 2E5QA 1O75A 1VQPQ 1QVFA 2KBTA 3ZEHA 3CD6Q 4M78F 3OYJA 3KBGA 1FMWA 2LCLA 2YUOA 3VS4A 1T3SA 3V8KA 1VQKQ 4PJMA 2E3IA 4IIMA 1YJ9T 1CSKA 2DJZA 4BDYA 1Q82C 3UA6A 3CPWP 2COWA 2CZ1B 4FM4B 4LXCA 3JAME 3L2WA 1WXTA 5KYYA 5DY9A 1YWPA 4JRIA 3OYDA 2HCKA 4FYYB 3M53A 4HVWA 2KGTA 4EMKC 1W1FA 2YUQA 3LYIA 5CKEA 2FPEA 9ATCB 2DBMA 4XU2A 1YIJA 1WPYA 2M0YA 1PD0A 2HEQA 3C0CA 3URGA 1WA7A 4PJOA 4PJOB 1MMGA 1YJWA 1VQOQ 2F1LA 1PM3A 1RAFB 3S3OA 4ZTJA 1U06A 4A4EA 1KQSP 1V29B 3WXMB 1Q81U 1AWJA 1AWOA 3R6OA 1U1SA 4J6WA 3E19A 2B86A 4BACA 4GY5A 2LCSA 2LQ8A 2EFIA 3MEVA 2YLCA 4RTWA 4LNPA 1S72T 2EVRA 2K5LA 1WQ7A 1KQ2A 3H9NA 1WJRA 3EGDA 4D6WA 1K9MC 4WF2A 3V7RA 4E7JA 5CAIA 5LJ5j 3A8GB 3AT1B 2YRCA 1NLPC 2DKGA 5EC7A 1SRLA 2EYZA 1BB9A 5HKCA 3EAEA 1RAIB 1GCQC 2EJFA 3EFSA 2D9TA 1YJ9Q 1R77A 1ZQ1A 2JS2A 3CMAT 1N8RC 3M0QA 1OX8A 2D8JA 4M7AA 2V1QA 4BD3A 2ROTA 4LD9K 3L2QA 2YRDA 2PVOB 2HKNA 4FW2A 4C8QG 4RTUA 1Q86U 4M77A 4JRKA 3BY7A 2LVMA 4L59A 5C6SA 4XTXA 2M0OA 1W70A 3QIIA 2HQEA 1GCPA 5KYUB 1VQ7A 2LZ6B 2CP7A 3M59A 4J9DA 1UGQB 3NTHA 1Q7YU 4E47A 1PCXA 2DVEA 3TCJA 2FZKB 1BI2A 3X24B 1X69A 5IXBA 5LJ5g 1YI2Q 1QW1A 2RNAA 2Z0WA 2DYBA 1M2VB 1X6BA 2DX1A 4KGZB 3OY9A 2QA4Q 2KK4A 1I1JA 2EW3A 3OS1A 3QDFA 5IH2A 4JUVA 2KYBA 2O31A 4IUUA 2ZZDA 1VIFA 2EQJA 2RN8A 2LX7A 3G4SQ 1I5OB 1JRIA 2X35A 5LJ3g 5KH6A 1TH7A 1VQ8T 1JXMA 2SEMA 3VS1A 1JJ2S 3CCEA 4YTLA 1NM7A 3OS2A 2DRMA 4ELYC 3A8HB 1M90U 3CQTA 1VQPA 4J5YA 2FL7A 2EJ9A 1D1AA 2EQKA 2KVQG 2BUDA 2DK3A 4Z88A 2JS0A 2ECZA 1P92A 1VQ8A 1ZUUA 2QTVA 2RH2A 1VQ6Q 3MEAA 2AT1B 4PJOG 3CCMA 1G3YA 2FZCB 1OV3A 4HA8A 1DJ7B 1QVFS 4KUIA 1EIFA 3WVDB 4KT0E 1M90C 3RERA 1TU0B 3CMEQ 4C92B 3OW2A 2EKOA 4C92D 2HKQB 3AHUA 1TTHB 2PUOB 2DTIA 3CMET 1HD3A 1PHTA 3REAB 1RI0A 4ZN1A 1G5VA 3S3MA 5FU7B 1IREB 3VS2A 4PJNA 3J7AF 1RAGB 4EIKA 1BKBA 3LW5E 2QQSA 3HTRA 4KGXB 2FPFA 1KSWA 4RCCA 4AT1B 4BE2A 3C12A 3H0FA 2L5QA 3CCQA 2K4YA 4OMFB 4F04B 4PJOD 2EYYA 2M9UA 2HBWA 5GAMg 2O88A 4DBFA 3JB9D 2F2WA 4XQ3A 2X4XA 2BE7D 1KC8C 4RMOA 4F7UA 2DO3A 1YCSB 1H92A 3X26B 4M78D 3I56Q 2FPDA 2JZ2A 2KNBB 3EG1A 1T0JA 2YSQA 4J9EA 1OEBA 1MNDA 1SPKA 2ZPFB 4RTTA 4DOWA 2IIMA 3QDRB 4CI0C 5GAMe 4BI3A 1ARKA 1M1KC 2F2VA 4PLIA 4II1A 1WI7A 4OB0B 2FEIA 3FLGA 1SSHA 1JBMA 3TREA 3C94A 3ULRB 3NTIA 1NPPA 1T0HA 4EDUA 1RACB 1UJYA 4OMNA 4AFQC 4M77B 4MZTA 2ZGWA 3GNGA 4M77F 2JVVA 2EAYA 1TOVA 5GAOq 2JM8A 5D6XA 3L2RA 1K0XA 3LH0A 5CQYA 2RQUA 4ANJA 2MOXA 3JCMe 3M0SA 1KC8R 2DNUA 2PVGB 3T9NA 1VQLQ 1FX7A 2RK2A 2GQIA 3E9FA 1K9AA 5KYWB 2DYIA 1OOTA 5FU6C 5GMKm 2EKHA 1K73C 1UGRB 2A3LA 4M75D 1BCOA 1V76A 3CXCS 4P5NA 1H8KA 3I5RA 3CCRQ 4MZPA 3SB2A 2K7AA 3M0PA 4DEYA 2AZVA 2MWPA 2O9VA 4HCZA 3VS5A 2QGFB 3CCLQ 3SWNC 3UWNA 3JV3A 4QVCA 3X28B 2LNHB 3REBB 4C5IA 1SF9A 1Q95G 1D1BA 4AG1C 1ZSZC 5GAN5 1GFDA 1NJIC 5D6YA 2COZA 1BYMA 1NPRA 3INZA 2H3EB 2XKOC 3H0HA 4HKEA 5KYXB 2P0KA 1GRIA 2L2PA 3EG0A 1M30A 5CK9A 2MK5A 1VUBA 4CC4B 1HK9A 3GBQA 3MCAB 3CCJQ 4VUBA 2XDPA 1VQ6A 3L2ZA 1JU5C 5CKBA 1PG5B 4XK8E 2PVDB 2ENMA 4F7UG 2OTLQ 5FWBA 3R6NA 3CCRT 3EGDB 5J3BA 4C0DC 3M0UA 1Z9ZA 2DXCA 2A36A 2DTOA 2ZAEA 1AOJA 1KD1C 4FYWB 1N6AA 1IXDA 3CCEQ 4A54A 3MP1A 3E1SA 2DL3A 5GANf 4JPBW 3ER0A 1YWOA 4B9XA 5GMKe 5CR2A 2A08A 1ZUKA 4E7SA 3MP8A 2DIGA 2GBQA 3OS0A 1J3TA 2RHYA 3CD6A 2M16A 4Y92A 2QA4T 3NFCA 2RJEA 2QTXA 4C8QC 4OB2B 1QVPA 1CKAA 1UGPB 2LQWA 5GAN2 1RAHB 4J83A 2L0AA 3NGPA 2CP2A 4BI8B 2P84A 5FW9A 5DM7R 1VQNT 3CCET 3HSBA 2GCXA 5CQXA 2E1HA 2AKKA 3J81E 4F14A 4QQGA 3OYKA 4X34A 3JCMf 2EQMA 2LX9A 3GIBA 1UGSB 4ZGDB 4ATOA 3OMGA 2K57A 2A7YA 3QJ6A 5LJ3j 3CC4T 1KD1U 1B07A 1YIJT 3CCSQ 4C5EA 4M7AC 3FJPA 2DF6A 4PJOE 2K5IA 1BI3A 5GANj 3M58A 1TUDA 4MDXA 5GJWB 2DXUA 3SWNB 2EYWA 1QKWA 3QPHA 4LUEA 2DE0X 5LJ3h 1OULA 1R0BG 3NPFA 1N5ZA 2JXBA 4C8QE 3OS5A 2RB6A 3I35A 4N4IA 2H3JA 3EGXB 3GF5A 2L3SA 1R8OB 1QP2A 1TUCA 4A63B 3A8MB 4IURA 4KGVB 1Y71A 4JS4A 3S3NA 3CC2Q 4ME7A 3G1JA 2E6NA 1PNJA 4FYXB 3LWIA 1UG1A 2J06A 5LJ5d 3G71A 2RHZA 2MAMA 1JXOA 1W2BA 3EG2A 4EMKA 4Q5WA 4EPCA 3EG9B 3EFOB 1VQOA 2IPOB 1YJWQ 1UEBA 1VQLT 1WHMA 5D6WA 5KE3A 2AK5A 2DVJA 4MZMA 2QYZA 2CSQA 2VGMA 1AEYA 3NTKA 4L5GA 3CXCA 1YJNQ 4KULA 1S72A 1IHWA 4MMLA 2DL5A 1Y96B 3DLMA 1SHFA 2HAXA 3OYHA 2YUNA 2K9GA 1VQNQ 2CUDA 3VKIA 5GANg 3M56A 5M9OA 3MP6A 4XTYA 3I55A 4LDWA 4OF1A 3JCMc 2EQIA 1D0XA 1A0NB 2F69A 2KQWA 2AKLA 1WHKA 3SEMA 1C6VX 3FDRA 1GFCA 3BW1A 4M77C 3M4GA 2HNIA 1QQJA 3D7SB 3JCMW 2O4XB 1QKXA 3QSUA 1OZ3A 3OSSC 3QHSA 3I5SA 1E7OA 3J80E 1ZSZB 5GAOn 4JS5A 1SEMA 2OTJA 3BDUA 4M75G 1D3BB 1X2QA 3PMTA 3OYLA 2D0QB 2PQWA 5IAYA 1G3TA 2DEQA 5KYNA 4Y28E 1TS9A 5IHKA 3M0TA 4C0GA 2KT1A 5DLQE 2P4RA 4Z8AA 3EHQA 4J9HA 4PK4A 1S1NA 5DLOA 3CPFA 2BE9B 5FLXE 2PUKB 1SG5A 3V8LA 1YJWT 4RTVA 2DIQA 2L3PA 3CCMQ 4E7KA 4C0DB 2XI9A 4OP0A 1AZGB 3SD4A 2GF7A 4CC2A 1TG0A 3LX7A 5CO7A 3EH2A 2KY9A 1N9SA 3BE3A 5IHNA 2L3QA 4J9BA 1QP3A 2CZ7B 4X9DA 4XTUA 2DZ9A 3M55A 4N0AA 2LRQA 2VASA 5I22A 4JJCA 4RG2A 4ESRA 1SHGA 3TSWA 2NUPB 2DFUA 4PJJA 5LJ3d 1VQ4A 4PJOF 1RADB 2K3YA 3G4SA 2MF2A 2PZ1A 2DRKA 1HSQA 1OYXA 4FU6A 4WTOB 3CCVA 1PSEA 2V1RA 1KIKA 2M51A 1MV0B 2ZCFB 1RUWA 4B6MA 5FRMA 3UA7A 2XG8D 2DJQA 4M7DE 1AWXA 1B34B 1FYNA 2DBKA 3M57A 4F17A 2DERA 5FU7C 3KFVA 4OB3B 3JB9G 1UHCA 4FT2A 4LDXA 3VV0A 4PNOA 2R5AA 1MMAA 3HKSA 1U1TA 4N0AC 2RQVA 4M77D 4RKUE 4XAXB 3HRTA 4PLLA 4PFZA 1OPLA 4M77E 2KMTA 2ZPGB 1UDLA 3NMZC 1JJ2A 2P4TA 3A8OB 1M3CA 1X75C 3RDVA 1H3ZA 2XICA 4WCIA 3JB9H 1AD5A 3DKMA 2CDTA 5FWCA 4M7DD 1D0ZA 5I21A 4ZN3A 2E65A 1Q82U 3RR6A 3CCUA 1OU8A 2M1HA 1D09B 2RJFA 5GMKj 3RKXA 3OYBA 1QWEA 1ZA1B 3FC3A 4KH1B 2DL8A 3EH1A 2CH4A 2E64A 2F5KA 1K76A 2YUPA 5GAMf 1LPLA 1W6XA 1YI2T 1MMDA 2KXCA 3MKDA 3I55Q 1ZBXA 5GAOl 3LLRA 3OBYA 1K8AR 2DA9A 1JB0E 1QVFP 3VS0A 3QYGB 4Y91A 2W0ZA 4C92A 5L8RE 3HP9A 1K73R 3CEYA 4M78C 4E6RA 4M75A 3THKA 4M75B 1QVGA 3TU4K 2EIFA 5KCOA 5CCAA 3VJPA 1FMKA 5GANd 4LN2A 5FROA 2GGRA 3P8HA 2MI6A 1XNIA 2KRSA 4AG2C 1K9MU 2KEAA 1QCFA 3G71Q 3TSZA 4ELZC 3CC7A 3TEEA 2VGNA 1JEGA 1X6GA 3CC2A 3SHWA 1VQMT 2ATCB 2OAWA 2LJ3A 1VQ6T 2FVUA 1Q86R 4K11A 3CCLT 1BI0A 4PFPA 2J7IA 3V7CA 1ZBJA 5CKDA 2QQBA 1K8AC 4FT4A 1WJSA 4QW2A 2M02A 4BY6B 4FSSA 2DEUA 2HQHA 2RPNA 1VQKA 1BIAA 1X01A 2LT4A 3CCQQ 5LJ5f 2OAUA 2EGEA 2NYSA 3M54A 1KHIA 4HXJA 2LMJA 1PD1A 2HD0A 1KQ1A 2VWFA 1WQWA 4E7IA 1JO8A 1GL5A 3JCMg 2JN0A 2JM9A 3OYEA 5LJ3f 3F70A 2DXTA 4KBMB 3ZL7C 3VRZA 2CGHA 3PNWC 1M1KR 2XDBA 3QZ9B 4JJNK 5KYXA 3UT1A 4N4GA 3GPLA 2NUZA 2LC4A 5A2QE 3CMEA 2NUTB 1Y07A 3MO8A 2XU8A 2P0PA 4J6YA 4EMHA 1VQ5T 4XU3A 4M7DG 2GFAA 2GQVA 3O8VA 4A4HA 3JB9J 2EWNA 2K5FA 2R58A 2CS7A 1Q86C 1PRMC 3CBMA 1EX4A 1SRMA 1WLPB 1KQSS 2CZ6B 3H8ZA 4DOVA 1RLQC 1M9SA 3RKWA 2DAQA 4M77G 3O5ZA 4GLMA 2QXFA 3OYMA 1GBRA 2NUPA 2KI7A 4BE0A 1IRXA 3M0RA 2CP6A 2FZGB 3I56T 3CMAQ 4PJLA 1XTDA 3EG3A 2KXDA 3CMAA 1YHQA 2DD5A 1OX9A 1BBZA 2DMOA 3P8DA 2J6FA 1XOVA 2JJ9A 3RNJA 3OYFA 3MJXA 1UECA 3TVTA 1YCYA 1AHJB 2RK1A 3CPWA 4J9CA 4HCBA 1K0SA 1Y57A 5GANe 4LDVA 4C8QA 3CC7Q 1IB8A 2OTLA 1Q82R 3C4SA 1BCMA 2K3XA 1M90R 3OSVA 5EG2A 1YHQT 1I07A 2LQKA 2YT6A 4QQ6A 3VYGA 3BDLA 2K6DA 1VQ7Q 1UUEA 3FRNA 5CKFA 1PSFA 3OYCA 2LJ0A 5CIUA 2WACA 2E3HA 2XDDA 5GAMh 3OYAA 4ZTFA 2RM4A 4M7AF 4M75C 3MEUA 2CKKA 4RG8A 1ZSZA 1NZ9A 2V8KA 3PVQA 2HBPA 4J9GA 4F16A 1NYGA 5GANh 1GBQA 2WSEE 1KFZA 3FEOA 3N5BB 3NHNA 2RQWA 2QI2A 2JMAA 1IHVA 3A1PA 4J7FA 2EYXA 2BZ8A 3EGXA 2YLBA 5HY6A 3CC7T 1UHFA 1ZX6A 3IQLA 2VV5A 5IN1A 1M1FA 3H41A 5GAN4 2D8HA 1HYOA 3S6WA 2NLUA 2NWMA 1MMNA 4C5HA 2MYSA 2CP5A 1K9MR 1KG1A 1ABQA 1VQ9A 1GCQA 2RQRA 4AFSC 3CCMT 2EPDA 1RAEB 2JUFA 2D6FA 1G2BA 3L42A 2CUBA 2XIDA 3HPWA 3UATA 4E7HA 4LDUA 1KC8U 2K3BA 1NG2A 4DEXA 2LDMA 3JRZA 4Z02A 3CD6T 4M7DB 1M4ZA 5GAOm 3HFNA 3H6ZA 4M7DF 1IO6A 2O9SA 1PC0A 4FSXA 2O2OA 4AMCA 1UFFA 3P8BB 2JNGA 1X27A 3G6EQ 4FYVB 3EFRA 5CVIA 2OTJT 2YRVA 5I2MA 1NEBA 3G6EA 3HRUA 2FRYA 4M7AD 2K2VA 3MEWA 4UC4A 2LQNA 2OJ2A 2DETA 2SRCA 4M7DA 2QASA 3JSCA 2COYA 2EGAA 4KH0B 3JCMQ 4PJOC 3VUBA 1N9RA 4XU1A 2QEXA 4HVVA 4BI4A 4DBHA 5LJ3e 2E70A 3PT9A 2CH4W 3OB9A 2CYZB 4JZ4A 1WHLA 4BY6C 4LE9A 1VYVA 1U5SA 3U23A 4OMQA 3UPUA 2P0QA 4QVDA 2X3XD 3SWNA 4R0KA 3RIRA 2OI3A 3JB9I 4ZGEB 4M75E 5GAN6 3CCUQ 3DB4A 1NJIU 2DILA 1ZSGA 1PRLC 2Y4XA 1K1ZA 1YP5A 2ED1A 1YJNT 3VYHB 3QG1A 3L1AA 1QCNA 5KYWA 1XJWB 4E7ZA 3ME9A 1TSFA 2DL4A 2J05A 1M1KU 4QKUA 4ZGJB 4XTWA 4J9IA 3RMQA 1LCKA 4GLKA 3Q1JA 3OW2P 4FW1A 1RLPC 1WXBA 2R5MA 2QK0A 1NBEB 5IXFA 3DB3A 5HK3A 3RMSA 1I5LA 3QWYA 1WX6A 4RTXA 2QQ9A 2V8JA 4D8DA 1YITT 2DM1A 1SKUB 1D3BA 4HT8A 2D1XA 2QAZA 5A0LA 2ABLA 3CCRA 2GTOA 1IGQA 3QZ5B 2AHJB 3CCVQ 2KE9A 3LGLA 3LGFA 3A98A 1WZOA 2KYMA 2WSCE 2V8IA 4JRPA 1LJOA 1K73U 3I55T 5FRNA 5J39A 1M8VA 3M5AA 3UF4A
chains in the Genus database with same CATH topology
3A8LB 4M7AB 3CXCS 4P5NA 1U8RA 4MMKA 4MZPA 4NS5A 3SB2A 3CD6T 1IZ6A 2EYQA 4BB7A 4C92C 2MWPA 1ZBXA 4HCZA 2KSSA 2XD0A 3META 2QA4A 4O6JA 3LLRA 5GAOl 3DLLA 1G3WA 3SWNC 3OBYA 3UWNA 3G71T 1K8AU 4QVCA 3X28B 2RA2A 1N27A 4V2SA 3JCMV 2VXEA 5J26A 4O5VA 2Y90A 1JB0E 1LOJA 2LTOA 4C5IA 2HQXA 4JLIA 2RJCA 4N4HA 1W2BS 4EMKB 3QYGB 2EJGA 4Y91A 5GAN5 4PKCC 1NJIC 1UB4A 4C92A 3QXEB 5D6YA 5L8RE 3HP9A 1VQ7T 4C0FA 2XK0A 3ZBDA 1BYMA 2Y4YA 3CEYA 4M78C 4PL6A 3V7SA 1NPRA 5A0DA 4C8QF 3INZA 3PMIA 4M75A 2X4YA 4M75B 4F7UE 4C92F 1QVGA 3TU4K 2XKOC 1MGQA 4HKEA 4C8QB 2EIFA 2P0KA 3VUZA 3L2UA 5GAOr 5KCOA 1YI2T 5C0MA 4M7AE 5CCAA 5IT9E 3HL8A 3VJPA 5GANd 5GAOp 1VIEA 5CK9A 1VUBA 1KHCA 3QYHB 3OYIA 4LD6A 5FROA 1HK9A 3P8HA 2MI6A 1XNIA 3MCAB 4E7LA 4VUBA 4FL6A 3OQ5A 2XDPA 3GNFB 3OMCA 2ZPIB 1WNLA 1VQ6A 3L2ZA 3QJYA 1K9MU 1KQSA 4X9CA 5CKBA 4A4FA 4XK8E 1N8RU 4ELZC 4HT9A 4KUDK 2PVDB 3JCMX 1O9SA 1WGSA 4F7UG 3G6ET 3CC7A 4JDSA 2RI3A 2YHTA 3TEEA 2VGNA 4A4KA 4B9WA 2E5QA 3PFSA 1O75A 3CCRT 3CC2A 5J3BA 4C0DC 1FWZA 1QVFA 4IUTA 1VQMT 2DXCA 4IUPA 3ZEHA 3ASKA 1VQ6T 4M78F 3OYJA 2DTOA 2FVUA 1I8FA 3KBGA 2LCLA 1KD1C 3HFOA 3CCLT 2C06A 1BI0A 1N6AA 2RD1A 4A54A 3MP1A 3E1SA 3CCQT 3V7CA 5GANf 3ER0A 2XHCA 5CKDA 2QQBA 1K8AC 1BI1A 4FT4A 1WJSA 5AYFA 4QW2A 3V8KA 4B9XA 5GMKe 5CR2A 4C92G 4BY6B 1VQKA 1BIAA 1X01A 2LT4A 3MP8A 5HK0A 1YJ9T 5LJ5f 2DIGA 2OAUA 4A53A 2DJZA 3BFMA 4BDYA 1Q82C 3M54A 2BKDN 1KHIA 4MDWA 3OS0A 2HD0A 2CZ1B 4FM4B 4QQDA 1KQ1A 4CRIA 2FYKA 1WQWA 2RHYA 3JAME 4E7IA 3CD6A 1Y96A 2M16A 5LL6S 3JCMg 2JN0A 2QA4T 3L2WA 3VU3C 3NFCA 2RJEA 5DY9A 3OYEA 2QTXA 4C8QC 4JRIA 4OB2B 1QVPA 5LJ3f 3F70A 2DXTA 4KBMB 1UGPB 5GAN2 3OYDA 1G3SA 2E10A 4J83A 2CGHA 3PNWC 4EMGA 3OBWA 4C92E 3QBYA 3M53A 2E12A 4M78B 4BI8B 5DM7R 4EMKC 1VQNT 2XDBA 3QZ9B 3CCET 4JJNK 2GCXA 3HSBA 3UT1A 5CQXA 3LYIA 4N4GA 3M9QA 5CKEA 3GPLA 2LC4A 2E1HA 5A2QE 3CMEA 4XU2A 2O4XA 3JCMd 1YIJA 1WPYA 1Y07A 3MO8A 2XU8A 2P0PA 4J6YA 3J81E 4QQGA 3URGA 4EMHA 3OYKA 4XU3A 1VQ5T 4X34A 4PJOA 4M7DG 4PJOB 3JCMf 2GFAA 2KDSA 4DQ2A 2EQMA 2GQVA 2LX9A 3O8VA 1Y7XA 2E6ZA 4A4HA 1YJWA 3GIBA 1UGSB 4ZGDB 3JB9J 2EWNA 2PU9B 2K5FA 2R58A 2CS7A 4ATOA 3OMGA 3S3OA 4ZTJA 2K57A 4A4EA 1Q86C 2A7YA 1V29B 3QJ6A 5LJ3j 3CC4T 1Q81C 3WXMB 3CBMA 1Q81U 1KD1U 3R6OA 3X20B 1U1SA 4C5GA 3FB9A 1H641 1YIJT 3GP8A 4C5EA 5KE2A 2I2LA 2CZ6B 4J6WA 3E19A 1KQSS 4M7AC 3FIFA 3FJPA 3H8ZA 4QVZA 4BACA 4PJOE 2RHXA 4DOVA 2K5IA 4GY5A 1M9SA 2LQ8A 2EFIA 3MEVA 2YLCA 5GAMd 3RKWA 2DAQA 4NL3A 3JCMP 1S72T 2K5LA 3QKJA 1BI3A 4OGCA 5GANj 4OB1B 4M77G 3M58A 1WQ7A 2QXFA 4BDZA 4M7DC 3OYMA 4MDXA 2DXUA 2F5TX 1KQ2A 3SWNB 4RCBA 3QPHA 1RL2A 1WJRA 4XTVA 4D6WA 4BE0A 1K9MC 4WF2A 3JB9F 5LJ3h 2L3RA 3V7RA 4E7JA 5CAIA 4BE1A 5GMKl 5LJ5j 3I56T 4M78G 4C8QE 3A8GB 1XTDA 3OS5A 2RB6A 2ZPBB 3CMAA 3CCST 1YHQA 2DKGA 2DXBA 2DD5A 2JTMA 4N4IA 2H3JA 4OVAA 5LJ5e 1QVGS 1VQKT 3GF5A 5HKCA 3P8DA 1R8OB 1QP2A 1XOVA 3EAEA 3A5ZB 3OYFA 2VYTA 3A8MB 1YCYA 1AHJB 2RK1A 4IURA 2EJFA 1Y71A 2D9TA 3EFSA 3OYYA 3CPWA 4JS4A 3S3NA 4HCBA 4ME7A 1ZQ1A 5GANe 3QUIA 2E6NA 4LDVA 1YI2A 4C8QA 3CMAT 1N8RC 2OTLA 3LWIA 3C4SA 4LDYA 2K3XA 5LJ5d 1VQPT 4M7AA 4BD3A 3OSVA 5EG2A 3CCSA 1YHQT 3G71A 2L8DA 2LQKA 2RHZA 4QQ6A 3L2QA 4LD9K 2MAMA 3VYGA 1W2BA 1X6OA 5KCHA 4C8QD 3BDLA 4EMKA 3ZFJA 2PVOB 4Q5WA 4C8QG 4EPCA 1Q86U 4M77A 4JRKA 1VQOA 3FRNA 3BY7A 2LVMA 5CKFA 4L59A 1UEBA 3CCVT 1VQLT 1PSFA 5C6SA 4XTXA 4A4GA 3OYCA 5D6WA 5KE3A 2M0OA 3QIIA 5CIUA 2WACA 2HQEA 4FIBA 2XDDA 5GAMh 3OYAA 2OTLT 4ZTFA 2RM4A 4MZMA 1VQ7A 4M7AF 5LJ5h 1VQ5A 3M59A 4M75C 3GLXA 3KXTA 3MEUA 2CKKA 2DD4A 1UGQB 3NTHA 1Q7YU 4E47A 2DVEA 3TCJA 2RI5A 2VGMA 3UDCA 2ZPEB 3RESA 1BI2A 4RG8A 3X24B 3NTKA 1OI1A 1NZ9A 2V8KA 4L5GA 2HBPA 3CXCA 1GXIE 4KULA 5GANh 1S72A 2FB7A 5LJ5g 4MMLA 2MWOA 1QW1A 1YJ9A 1Y96B 3DLMA 2WSEE 3SDZA 2HAXA 3OYHA 3FEOA 3N5BB 3OY9A 3VKIA 2KK4A 2QI2A 3M56A 5M9OA 5GANg 3OS1A 4J7FA 3MP6A 4JUVA 4XTYA 3I55A 4IUUA 2YLBA 4IUVA 4J7IA 4LDWA 4OF1A 5HY6A 5GAN7 3CC7T 2VV5A 2KAFA 5IN1A 3JCMc 1ZHIA 2ZZDA 1VIFA 3PIOA 2RO0A 1M1FA 2EQJA 2F69A 5GAN4 1I81A 2IVWA 2KQWA 1JRIA 3S6WA 4DA4A 2NLUA 4M75F 2X35A 5LJ3g 3RUXA 4J6XA 4C5HA 5KH6A 3FDRA 1TH7A 2LT1A 1VQ8T 1KG1A 3BW1A 1JJ2S 1WJQA 3M4GA 4M77C 3CCEA 2HNIA 4YTLA 1VQ9A 3OS2A 4ELYC 3CCJT 3A8HB 1FXXA 3JCMW 1M90U 3CCMT 2QQAA 3JCMJ 1OZ2A 1VQ4T 4M7AG 2O4XB 1VQPA 3QSUA 2JUFA 2D6FA 2QDYB 1XQHA 2RI2A 3L42A 1OZ3A 3OSSC 3QHSA 4J5YA 2FL7A 2EJ9A 2XIDA 4F7UF 3CCUT 3HPWA 3J80E 5GAOn 2EQKA 2GFUA 2KVQG 4JS5A 2VUBA 2BUDA 2DK3A 3BDUA 3C95A 4F7UB 2LCCA 4E7HA 2OTJA 4LDUA 4M75G 1KC8U 3CC4A 1VQ8A 1P92A 1D3BB 2LDMA 4HCCA 3JRZA 2RH2A 4Z02A 3PMTA 3CBPA 3MEAA 4PJOG 2D0QB 2PQWA 3OYLA 1G3YA 3CCMA 4M7DB 5IAYA 1M4ZA 1G3TA 2DEQA 1B34A 5CKHA 3HFNA 4HA8A 5GAOm 3CCJA 3H6ZA 1DJ7B 4Y28E 1VQOT 1QVFS 4M7DF 2L89A 1EIFA 4KUIA 4KT0E 3WVDB 3M4YA 4FSXA 1M90C 3RERA 1SSFA 1YBYA 2RHUA 3P8BB 1M5Q1 3L2VA 4C0GA 4C92B 2EKOA 2JNGA 3OW2A 4C92D 5DLQE 3AHUA 5I2SA 3EFRA 1G5VA 2PUOB 5CVIA 2DTIA 2VC8A 2ZPHB 2OTJT 2YRVA 5I2MA 3CMET 2CZ0B 5DLOA 2B8AA 1RI0A 3HRUA 4ZN1A 2E41A 3CPFA 1W4SA 5FLXE 5GMKi 3G6EA 2PUKB 5GMKh 3S3MA 4M7AD 2K2VA 3MEWA 2VXFA 3HRSA 5FU7B 4UC4A 1IREB 3V8LA 4C0ZA 1YJWT 4M7DA 3G7ZA 3J7AF 3JSCA 2DIQA 3HHTB 4E7KA 4C0DB 1YITA 2XI9A 4OP0A 1BKBA 3JCMQ 3LW5E 2QQSA 4RCCA 4PJOC 3SD4A 1MHNA 3VUBA 1N9RA 2GF7A 4XU0A 4XU1A 2QEXA 4BE2A 4BI4A 3CPWS 3C12A 3CCLA 2L5QA 3LX7A 5CO7A 5LJ3e 3CBOA 2R57A 3CCQA 2E70A 1N9SA 2K4YA 2KY9A 3PT9A 4OMFB 5GAN3 3G4ST 3WVEB 4PJOD 2QQRA 3OB9A 2CYZB 1QP3A 2CZ7B 4X9DA 4XTUA 4BY6C 2M9UA 5GAMg 2DZ9A 2O01E 3M55A 4N0AA 4NOYA 2LRQA 3JB9D 1NE8A 1VQ9T 2G3RA 3X25B 3RKYA 1LNXA 2WSFE 3UPUA 4XQ3A 2P0QA 2X4XA 4RG2A 4TVRA 2DZCA 4QVDA 2JOYA 3LWHA 3SWNA 5LJ3d 3RIRA 1VQ4A 3JB9I 4JLGA 4ZGEB 4PJOF 2K3YA 4RMOA 4M75E 2MF2A 4F7UA 3G4SA 1KC8C 5GAN6 2DO3A 1I4K1 1OYXA 3KUFA 3DB4A 4FU6A 1PSEA 3X26B 4M78D 3CCVA 1NJIU 4XTZA 1VQLA 2Y4XA 2X4WA 2JZ2A 2ZCFB 1BIBA 1YJNT 3SFMA 5A0GA 5GAMj 5FRMA 1M1GA 3VYHB 1VQNA 2XG8D 3OYNA 3PGGA 2ZPFB 4L6V5 2X4JA 4DOWA 4M7DE 2IG0A 1B34B 2EQUA 3QDRB 3QG1A 4CI0C 3L1AA 5GAMe 4BI3A 3M57A 5FU7C 3ME9A 4OB3B 3V8JA 3JB9G 1YJNA 2LNVA 1M1KU 1M1KC 4FT2A 4ZGJB 4PLIA 4LDXA 4II1A 4XTWA 3VV0A 4OB0B 2R5AA 4PNOA 3RMQA 4GLKA 3FLGA 3HKSA 3Q1JA 1U1TA 1JBMA 3TREA 3C94A 4N0AC 4J8OA 3NTIA 3JCMb 3OA6A 1NPPA 4M77D 4RKUE 4XAXB 3PIPA 2R5MA 3HRTA 4PLLA 5FU6B 4EDUA 4M77E 4M77B 1Q7YC 3DB3A 2KMTA 2ZPGB 5HK3A 4MZTA 3RMSA 3GOXA 2ZGWA 3GNGA 1I5LA 4M77F 4OGEA 3QO3A 2QQ9A 2BIVA 2JVVA 2MMPA 4M78E 1JJ2A 2V8JA 1YITT 2EAYA 2P4TA 3A8OB 5GAOq 2DPPB 2FHDA 1D3BA 2RHIA 5GAN8 4HT8A 5D6XA 3L2RA 1X75C 3LH0A 5A0LA 5CQYA 1H3ZA 2XICA 4BUGA 3JB9H 3DKMA 3MHXA 4NL2A 2RJDA 3JCMh 1VQMA 3JCMe 2QEXT 3PTAA 3CCRA 2PVGB 4M78A 3T9NA 3CC2T 4M7DD 5I21A 4R55A 3I56A 4ZN3A 3QZ5B 2AHJB 2E65A 1Q82U 1FX7A 2RK2A 2JTFA 3LGLA 3CCUA 4R56A 3LGFA 2DTHA 4IUQA 3OW2S 2M1HA 2RJFA 3E9FA 5GMKj 3RKXA 3OYBA 2WSCE 5FU6C 2V8IA 3OYGA 4JRPA 3FC3A 3E9GA 1LJOA 4JRQA 1HXDA 2E64A 2F5KA 4IKFA 5GMKm 1K73U 1K73C 3I55T 5FRNA 5GAMf 1UGRB 5J39A 2A3LA 4M75D 1M8VA 3M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNW C;  3LX7 A;  3NTH A;  2R57 A;  2RI5 A;  4NS5 A;  3QBY A;  2QQR A;  3OB9 A;  2MWP A;  4HCZ A;  3NTK A;  1OI1 A;  3MET A;  3UT1 A;  3LLR A;  3LYI A;  4N4G A;  3M9Q A;  2LRQ A;  3UWN A;  2MWO A;  2G3R A;  2O4X A;  1N27 A;  3MO8 A;  2X4X A;  4RG2 A;  5J26 A;  4QQG A;  3DLM A;  3OYK A;  4X34 A;  2GFA A;  3OYH A;  2LTO A;  2EQM A;  3FEO A;  4C5I A;  3O8V A;  4A4H A;  3OY9 A;  2HQX A;  2K3Y A;  2RJC A;  4N4H A;  5M9O A;  3OS1 A;  2R58 A;  1OYX A;  3KUF A;  3DB4 A;  3MP6 A;  3OMG A;  4FU6 A;  5D6Y A;  3S3O A;  4ZTJ A;  4A4E A;  4IUU A;  4IUV A;  2XK0 A;  3QJ6 A;  2X4W A;  2JZ2 A;  3CEY A;  4PL6 A;  5IN1 A;  4C5G A;  2RO0 A;  3PMI A;  2X4Y A;  2EQJ A;  5FRM A;  4C5E A;  5KE2 A;  3H8Z A;  3S6W A;  4QVZ A;  2P0K A;  2NLU A;  3L2U A;  2X35 A;  5KCO A;  2RHX A;  3OYN A;  5C0M A;  4BAC A;  4C5H A;  5KH6 A;  4GY5 A;  2EFI A;  3FDR A;  3MEV A;  2DAQ A;  2IG0 A;  3QKJ A;  1KHC A;  1WJQ A;  2EQU A;  3OYI A;  4LD6 A;  5FRO A;  4BDZ A;  3P8H A;  3OYM A;  3OS2 A;  1XNI A;  4E7L A;  4FL6 A;  3OQ5 A;  2XDP A;  3OMC A;  1WJR A;  3ME9 A;  4BE0 A;  1OZ2 A;  2L3R A;  4E7J A;  2O4X B;  4A4F A;  4PLI A;  4II1 A;  4BE1 A;  2RI2 A;  3L42 A;  1OZ3 A;  2R5A A;  3FLG A;  1WGS A;  3Q1J A;  2EQK A;  2GFU A;  3OYE A;  2BUD A;  3OYC A;  4E7H A;  2RI3 A;  2LCC A;  3NTI A;  4B9W A;  3OA6 A;  2E5Q A;  3PFS A;  4N4I A;  2R5M A;  4OVA A;  4PLL A;  4EDU A;  2LDM A;  4IUT A;  3P8D A;  4Z02 A;  4IUP A;  3PMT A;  3MEA A;  3ZEH A;  3ASK A;  2PQW A;  3DB3 A;  3EAE A;  3OYF A;  3OYL A;  3OYJ A;  5IAY A;  3GOX A;  2VYT A;  3H6Z A;  4IUR A;  2BIV A;  2L89 A;  2D9T A;  3MP1 A;  3S3N A;  1SSF A;  2RHU A;  2E6N A;  2FHD A;  3L2V A;  2RHI A;  2EKO A;  1WJS A;  5D6X A;  3L2R A;  4QW2 A;  3LH0 A;  4B9X A;  1H3Z A;  3C4S A;  2K3X A;  4BD3 A;  2RJD A;  2YRV A;  2L8D A;  3MP8 A;  2B8A A;  2RHZ A;  1RI0 A;  4QQ6 A;  3L2Q A;  1G5V A;  2DIG A;  5KCH A;  3S3M A;  4BDY A;  3BDL A;  3MEW A;  2BKD N;  2JTF A;  4UC4 A;  3LGL A;  4Q5W A;  3LGF A;  4IUQ A;  3OS0 A;  4QQD A;  2DIQ A;  2M1H A;  2RJF A;  3E9F A;  4CRI A;  2LVM A;  2RHY A;  4E7I A;  4L59 A;  4E7K A;  2M16 A;  3OYB A;  5C6S A;  3OYG A;  3L2W A;  3FC3 A;  2RJE A;  4A4G A;  2QQS A;  5D6W A;  3E9G A;  2M0O A;  5KE3 A;  3SD4 A;  1MHN A;  3QII A;  2WAC A;  2F5K A;  2HQE A;  3F70 A;  5CIU A;  4IKF A;  2GF7 A;  3OYD A;  3OYA A;  4ZTF A;  4BE2 A;  5FRN A;  5J39 A;  3MEU A;  2CKK A; 
#chains in the Genus database with same CATH topology
 1U8R A;  4FCY A;  1IZ6 A;  2EYQ A;  4BB7 A;  1X2K A;  2CT4 A;  2KSS A;  3FJ5 A;  2XD0 A;  3MET A;  2QA4 A;  3DLL A;  1I0C A;  2HSE B;  1K8A U;  5J26 A;  2Y90 A;  2CRE A;  1LOJ A;  2D0N A;  2LTO A;  2HQX A;  1W2B S;  2CSI A;  1UB4 A;  2JW4 A;  4C0F A;  3ZBD A;  3V7S A;  4C8Q F;  3PMI A;  5ECA A;  1B7T A;  2X4Y A;  1MGQ A;  4C8Q B;  3VUZ A;  1OU9 A;  5C0M A;  5IT9 E;  3H0I A;  1KHC A;  3QYH B;  3OYI A;  4LD6 A;  1VYT A;  2G6F X;  3OQ5 A;  2ZPI B;  4X1V A;  1B3Q A;  4KUD K;  1O9S A;  1WGS A;  2RI3 A;  2YHT A;  1WFW A;  1ZLM A;  2ESW A;  4A4K A;  2HMA A;  3PFS A;  1FWZ A;  2MPX C;  2K2M A;  2EGC A;  4IUT A;  2FG0 A;  4IUP A;  3ASK A;  1I8F A;  2E5K A;  3HFO A;  2C06 A;  2RD1 A;  2KRO A;  2X3W D;  3CCQ T;  1V1C A;  2XHC A;  1BI1 A;  2ROL A;  5AYF A;  1K4U S;  2YWW A;  5GJV B;  4C92 G;  1QMC A;  5HK0 A;  2BTT A;  4CC7 A;  4A53 A;  2A0F B;  3BFM A;  2VVK A;  2BKD N;  2X51 A;  4M4Z A;  2I0N A;  4MDW A;  1M3A A;  4QQD A;  4CRI A;  2FYK A;  1JJ2 P;  1PWT A;  1Y96 A;  3EGU A;  5LL6 S;  1YIT Q;  3VU3 C;  2CT3 A;  1CKB A;  1FMV A;  1G3S A;  2E10 A;  2LP5 A;  1PKT A;  1R0C B;  1S72 Q;  3PVL A;  2BZX A;  2J6O A;  4EMG A;  3OBW A;  4C92 E;  1F1B B;  3QBY A;  2E12 A;  4M78 B;  1MNE A;  5HCK A;  2RF0 A;  3M9Q A;  1BK2 A;  2HZY A;  2O4X A;  3JCM d;  3E2U A;  2ED0 A;  3LH5 A;  1NJI R;  4OMP A;  2KDS A;  4DQ2 A;  1Y7X A;  2E6Z A;  2PU9 B;  4OMO A;  3CC4 Q;  2V26 A;  1Q81 C;  4OML A;  4GBQ A;  3X20 B;  4C5G A;  3FB9 A;  1H64 1;  3GP8 A;  5KE2 A;  2I2L A;  3FIF A;  4QVZ A;  2RHX A;  5KYU A;  3I9Q A;  1C1A A;  1ZUY A;  2RMO A;  5GAM d;  4NL3 A;  3JCM P;  1WYX A;  2CP0 A;  3QKJ A;  4OGC A;  4OB1 B;  4BDZ A;  4M7D C;  2F5T X;  4RCB A;  1RL2 A;  4XTV A;  3JB9 F;  2L3R A;  4BE1 A;  1ACM B;  5GMK l;  4M78 G;  5I11 A;  2QDL A;  4AFU C;  2LJ1 A;  2ZPB B;  3CCS T;  2DXB A;  5D7U A;  1KD1 R;  2JTM A;  4Z89 A;  2GTJ A;  4OVA A;  5LJ5 e;  1QLY A;  1QVG S;  1VQK T;  2HSP A;  3A5Z B;  2VYT A;  3OYY A;  3QUI A;  1YI2 A;  1X43 A;  4JJB A;  2KT8 A;  1N8R R;  2A28 A;  1WXU A;  4D8K A;  1VA7 A;  4LDY A;  1VQP T;  3CCS A;  2L8D A;  2YDL A;  1M2O A;  1IGU A;  1X6O A;  5KCH A;  2C0I A;  2XMF A;  3VRY A;  4C8Q D;  2YXY A;  3ZFJ A;  1VQ5 Q;  1Q81 R;  2H8H A;  4HVU A;  3TQ7 P;  3CCV T;  2F2X A;  4A4G A;  2QG9 B;  1QCO A;  4FIB A;  2OTL T;  5LJ5 h;  1VQ5 A;  3GLX A;  1MV3 A;  3KXT A;  2DLP A;  2DD4 A;  2KRN A;  1YFN A;  2BZY A;  2RI5 A;  3UDC A;  2ZPE B;  3RES A;  4RTY A;  1OI1 A;  1W2B P;  1GXI E;  1EZZ B;  2FB7 A;  1WDX A;  4KRT A;  2MWO A;  1YJ9 A;  2AIR B;  3SDZ A;  2C0T A;  2E4H A;  1ZA2 B;  2CP3 A;  4IUV A;  4J7I A;  5GAN 7;  1YNZ A;  2PNI A;  2KAF A;  1ZHI A;  3PIO A;  2RO0 A;  1I81 A;  2IVW A;  4DA4 A;  2AZS A;  1AZE A;  4M75 F;  3RUX A;  4J6X A;  5L23 A;  2LT1 A;  1M27 C;  1WJQ A;  3VS3 A;  1M2V A;  3CCJ T;  1C0M A;  1FXX A;  4OMM A;  2HL3 A;  2QQA A;  3JCM J;  2MCN A;  1OZ2 A;  1VQ4 T;  4M7A G;  1VQM Q;  2QDY B;  1XQH A;  2RI2 A;  1UE9 A;  3CXC P;  3CCU T;  4F7U F;  2GFU A;  2VUB A;  4F7U B;  3C95 A;  2LCC A;  2VB6 A;  2QEX Q;  2RQT A;  3CC4 A;  1NYF A;  1WHG A;  4HCC A;  1EFN A;  2K79 A;  3CBP A;  1LVK A;  1WHH A;  1B34 A;  1D0Y A;  5CKH A;  4JJD A;  2PTK A;  3CCJ A;  1VQO T;  2L89 A;  3M4Y A;  1SSF A;  1YBY A;  2RHU A;  1YIJ Q;  1M5Q 1;  4CC3 A;  3L2V A;  3EHR A;  2X9H A;  5I2S A;  2VC8 A;  2ZPH B;  1OPK A;  1JQQ A;  2CZ0 B;  2B8A A;  2E41 A;  1W4S A;  5GMK i;  5GMK h;  2VXF A;  3HRS A;  4C0Z A;  3G7Z A;  3EFO A;  2JT4 A;  3HHT B;  1YIT A;  3VS7 A;  1MHN A;  2GNC A;  4XU0 A;  1VYU A;  2W10 A;  3MPU B;  3CPW S;  1WHJ A;  2OX7 A;  2OTJ Q;  3CCL A;  2HDA A;  1M3B A;  2JMC A;  1E6G A;  2R57 A;  3CBO A;  5IHI A;  1VOM A;  5GAN 3;  3G4S T;  3WVE B;  4PFO A;  2QQR A;  2MIO A;  1ABO A;  2O01 E;  1NEG A;  4NOY A;  1NE8 A;  1VQ9 T;  2G3R A;  3X25 B;  3RKY A;  1LNX A;  2WSF E;  1VQ9 Q;  4TVR A;  2DZC A;  2JOY A;  3LWH A;  4JLG A;  6AT1 B;  4LUD A;  2C0O A;  1I4K 1;  3KUF A;  1VQL A;  4XTZ A;  1RAB B;  2X4W A;  1TWB A;  1BIB A;  3SFM A;  5A0G A;  5GAM j;  2KRM A;  1M1G A;  1PKS A;  2J6K A;  1VQN A;  1AT1 B;  3OYN A;  3PGG A;  4L6V 5;  2X4J A;  4AFZ C;  2IG0 A;  2NUT A;  2EQU A;  4IIO A;  1T3L A;  4JZ3 A;  5AT1 B;  2QGG A;  1RAA B;  3V8J A;  1YJN A;  2LNV A;  1QVG P;  4QT7 A;  2FO0 A;  1H3H A;  1UTI A;  1YN8 A;  1QWF A;  1HJD A;  4J8O A;  3JCM b;  1MUZ A;  3OA6 A;  3PIP A;  5FU6 B;  1Q7Y C;  1G8X A;  3EG9 A;  3GOX A;  4OGE A;  3QO3 A;  5KYY B;  2BIV A;  2MMP A;  4M78 E;  2KR3 A;  8AT1 B;  2DPP B;  2FHD A;  4J9F A;  2RHI A;  5GAN 8;  4DBR A;  4BUG A;  3MHX A;  4NL2 A;  2RJD A;  4RUG A;  3JCM h;  1VQM A;  2QEX T;  3PTA A;  3CC2 T;  1TXQ A;  4M78 A;  4R55 A;  3I56 A;  2JTF A;  1UJ0 A;  4R56 A;  1OQK A;  2DTH A;  4RTZ A;  4IUQ A;  3OW2 S;  1Z9Q A;  3PE0 A;  1VQ4 Q;  3OYG A;  3E9G A;  4JRQ A;  1HXD A;  4IKF A;  4DBQ A;  3RBB B;  1YHQ Q;  8ATC B;  2VKN A;  3A8L B;  4M7A B;  4MMK A;  4NS5 A;  4C92 C;  4E2F B;  1BU1 A;  1WIE A;  4O6J A;  1G83 A;  1RI9 A;  1G3W A;  3G71 T;  4ORZ A;  1E6H A;  1N27 A;  2RA2 A;  4V2S A;  3JCM V;  2VXE A;  1KJW A;  4O5V A;  4JLI A;  2RJC A;  4N4H A;  4EMK B;  2FRW A;  2EJG A;  1Y0M A;  4PKC C;  1D1C A;  3QXE B;  1VQ7 T;  2XK0 A;  2Y4Y A;  4PL6 A;  5A0D A;  4F7U E;  4ZNX A;  4C92 F;  1KK7 A;  1AWW A;  3L2U A;  5GAO r;  4M7A E;  4HCK A;  1AVZ C;  1NLO C;  3HL8 A;  1M8M A;  1UGV A;  5GAO p;  1VIE A;  2HL5 C;  3QWX X;  2A37 A;  4E7L A;  4FL6 A;  3GNF B;  3OMC A;  1WNL A;  1TUG B;  3QJY A;  2EBP A;  4X9C A;  1KQS A;  4A4F A;  1VQ8 Q;  1N8R U;  2DL7 A;  1U3O A;  1Q7Y R;  2JTE A;  7AT1 B;  4HT9 A;  3G6E T;  3JCM X;  4JDS A;  3VS6 A;  4B9W A;  2E5Q A;  1O75 A;  1VQP Q;  1QVF A;  2KBT A;  3ZEH A;  3CD6 Q;  4M78 F;  3OYJ A;  3KBG A;  1FMW A;  2LCL A;  2YUO A;  3VS4 A;  1T3S A;  3V8K A;  1VQK Q;  4PJM A;  2E3I A;  4IIM A;  1YJ9 T;  1CSK A;  2DJZ A;  4BDY A;  1Q82 C;  3UA6 A;  3CPW P;  2COW A;  2CZ1 B;  4FM4 B;  4LXC A;  3JAM E;  3L2W A;  1WXT A;  5KYY A;  5DY9 A;  1YWP A;  4JRI A;  3OYD A;  2HCK A;  4FYY B;  3M53 A;  4HVW A;  2KGT A;  4EMK C;  1W1F A;  2YUQ A;  3LYI A;  5CKE A;  2FPE A;  9ATC B;  2DBM A;  4XU2 A;  1YIJ A;  1WPY A;  2M0Y A;  1PD0 A;  2HEQ A;  3C0C A;  3URG A;  1WA7 A;  4PJO A;  4PJO B;  1MMG A;  1YJW A;  1VQO Q;  2F1L A;  1PM3 A;  1RAF B;  3S3O A;  4ZTJ A;  1U06 A;  4A4E A;  1KQS P;  1V29 B;  3WXM B;  1Q81 U;  1AWJ A;  1AWO A;  3R6O A;  1U1S A;  4J6W A;  3E19 A;  2B86 A;  4BAC A;  4GY5 A;  2LCS A;  2LQ8 A;  2EFI A;  3MEV A;  2YLC A;  4RTW A;  4LNP A;  1S72 T;  2EVR A;  2K5L A;  1WQ7 A;  1KQ2 A;  3H9N A;  1WJR A;  3EGD A;  4D6W A;  1K9M C;  4WF2 A;  3V7R A;  4E7J A;  5CAI A;  5LJ5 j;  3A8G B;  3AT1 B;  2YRC A;  1NLP C;  2DKG A;  5EC7 A;  1SRL A;  2EYZ A;  1BB9 A;  5HKC A;  3EAE A;  1RAI B;  1GCQ C;  2EJF A;  3EFS A;  2D9T A;  1YJ9 Q;  1R77 A;  1ZQ1 A;  2JS2 A;  3CMA T;  1N8R C;  3M0Q A;  1OX8 A;  2D8J A;  4M7A A;  2V1Q A;  4BD3 A;  2ROT A;  4LD9 K;  3L2Q A;  2YRD A;  2PVO B;  2HKN A;  4FW2 A;  4C8Q G;  4RTU A;  1Q86 U;  4M77 A;  4JRK A;  3BY7 A;  2LVM A;  4L59 A;  5C6S A;  4XTX A;  2M0O A;  1W70 A;  3QII A;  2HQE A;  1GCP A;  5KYU B;  1VQ7 A;  2LZ6 B;  2CP7 A;  3M59 A;  4J9D A;  1UGQ B;  3NTH A;  1Q7Y U;  4E47 A;  1PCX A;  2DVE A;  3TCJ A;  2FZK B;  1BI2 A;  3X24 B;  1X69 A;  5IXB A;  5LJ5 g;  1YI2 Q;  1QW1 A;  2RNA A;  2Z0W A;  2DYB A;  1M2V B;  1X6B A;  2DX1 A;  4KGZ B;  3OY9 A;  2QA4 Q;  2KK4 A;  1I1J A;  2EW3 A;  3OS1 A;  3QDF A;  5IH2 A;  4JUV A;  2KYB A;  2O31 A;  4IUU A;  2ZZD A;  1VIF A;  2EQJ A;  2RN8 A;  2LX7 A;  3G4S Q;  1I5O B;  1JRI A;  2X35 A;  5LJ3 g;  5KH6 A;  1TH7 A;  1VQ8 T;  1JXM A;  2SEM A;  3VS1 A;  1JJ2 S;  3CCE A;  4YTL A;  1NM7 A;  3OS2 A;  2DRM A;  4ELY C;  3A8H B;  1M90 U;  3CQT A;  1VQP A;  4J5Y A;  2FL7 A;  2EJ9 A;  1D1A A;  2EQK A;  2KVQ G;  2BUD A;  2DK3 A;  4Z88 A;  2JS0 A;  2ECZ A;  1P92 A;  1VQ8 A;  1ZUU A;  2QTV A;  2RH2 A;  1VQ6 Q;  3MEA A;  2AT1 B;  4PJO G;  3CCM A;  1G3Y A;  2FZC B;  1OV3 A;  4HA8 A;  1DJ7 B;  1QVF S;  4KUI A;  1EIF A;  3WVD B;  4KT0 E;  1M90 C;  3RER A;  1TU0 B;  3CME Q;  4C92 B;  3OW2 A;  2EKO A;  4C92 D;  2HKQ B;  3AHU A;  1TTH B;  2PUO B;  2DTI A;  3CME T;  1HD3 A;  1PHT A;  3REA B;  1RI0 A;  4ZN1 A;  1G5V A;  3S3M A;  5FU7 B;  1IRE B;  3VS2 A;  4PJN A;  3J7A F;  1RAG B;  4EIK A;  1BKB A;  3LW5 E;  2QQS A;  3HTR A;  4KGX B;  2FPF A;  1KSW A;  4RCC A;  4AT1 B;  4BE2 A;  3C12 A;  3H0F A;  2L5Q A;  3CCQ A;  2K4Y A;  4OMF B;  4F04 B;  4PJO D;  2EYY A;  2M9U A;  2HBW A;  5GAM g;  2O88 A;  4DBF A;  3JB9 D;  2F2W A;  4XQ3 A;  2X4X A;  2BE7 D;  1KC8 C;  4RMO A;  4F7U A;  2DO3 A;  1YCS B;  1H92 A;  3X26 B;  4M78 D;  3I56 Q;  2FPD A;  2JZ2 A;  2KNB B;  3EG1 A;  1T0J A;  2YSQ A;  4J9E A;  1OEB A;  1MND A;  1SPK A;  2ZPF B;  4RTT A;  4DOW A;  2IIM A;  3QDR B;  4CI0 C;  5GAM e;  4BI3 A;  1ARK A;  1M1K C;  2F2V A;  4PLI A;  4II1 A;  1WI7 A;  4OB0 B;  2FEI A;  3FLG A;  1SSH A;  1JBM A;  3TRE A;  3C94 A;  3ULR B;  3NTI A;  1NPP A;  1T0H A;  4EDU A;  1RAC B;  1UJY A;  4OMN A;  4AFQ C;  4M77 B;  4MZT A;  2ZGW A;  3GNG A;  4M77 F;  2JVV A;  2EAY A;  1TOV A;  5GAO q;  2JM8 A;  5D6X A;  3L2R A;  1K0X A;  3LH0 A;  5CQY A;  2RQU A;  4ANJ A;  2MOX A;  3JCM e;  3M0S A;  1KC8 R;  2DNU A;  2PVG B;  3T9N A;  1VQL Q;  1FX7 A;  2RK2 A;  2GQI A;  3E9F A;  1K9A A;  5KYW B;  2DYI A;  1OOT A;  5FU6 C;  5GMK m;  2EKH A;  1K73 C;  1UGR B;  2A3L A;  4M75 D;  1BCO A;  1V76 A;  3CXC S;  4P5N A;  1H8K A;  3I5R A;  3CCR Q;  4MZP A;  3SB2 A;  2K7A A;  3M0P A;  4DEY A;  2AZV A;  2MWP A;  2O9V A;  4HCZ A;  3VS5 A;  2QGF B;  3CCL Q;  3SWN C;  3UWN A;  3JV3 A;  4QVC A;  3X28 B;  2LNH B;  3REB B;  4C5I A;  1SF9 A;  1Q95 G;  1D1B A;  4AG1 C;  1ZSZ C;  5GAN 5;  1GFD A;  1NJI C;  5D6Y A;  2COZ A;  1BYM A;  1NPR A;  3INZ A;  2H3E B;  2XKO C;  3H0H A;  4HKE A;  5KYX B;  2P0K A;  1GRI A;  2L2P A;  3EG0 A;  1M30 A;  5CK9 A;  2MK5 A;  1VUB A;  4CC4 B;  1HK9 A;  3GBQ A;  3MCA B;  3CCJ Q;  4VUB A;  2XDP A;  1VQ6 A;  3L2Z A;  1JU5 C;  5CKB A;  1PG5 B;  4XK8 E;  2PVD B;  2ENM A;  4F7U G;  2OTL Q;  5FWB A;  3R6N A;  3CCR T;  3EGD B;  5J3B A;  4C0D C;  3M0U A;  1Z9Z A;  2DXC A;  2A36 A;  2DTO A;  2ZAE A;  1AOJ A;  1KD1 C;  4FYW B;  1N6A A;  1IXD A;  3CCE Q;  4A54 A;  3MP1 A;  3E1S A;  2DL3 A;  5GAN f;  4JPB W;  3ER0 A;  1YWO A;  4B9X A;  5GMK e;  5CR2 A;  2A08 A;  1ZUK A;  4E7S A;  3MP8 A;  2DIG A;  2GBQ A;  3OS0 A;  1J3T A;  2RHY A;  3CD6 A;  2M16 A;  4Y92 A;  2QA4 T;  3NFC A;  2RJE A;  2QTX A;  4C8Q C;  4OB2 B;  1QVP A;  1CKA A;  1UGP B;  2LQW A;  5GAN 2;  1RAH B;  4J83 A;  2L0A A;  3NGP A;  2CP2 A;  4BI8 B;  2P84 A;  5FW9 A;  5DM7 R;  1VQN T;  3CCE T;  3HSB A;  2GCX A;  5CQX A;  2E1H A;  2AKK A;  3J81 E;  4F14 A;  4QQG A;  3OYK A;  4X34 A;  3JCM f;  2EQM A;  2LX9 A;  3GIB A;  1UGS B;  4ZGD B;  4ATO A;  3OMG A;  2K57 A;  2A7Y A;  3QJ6 A;  5LJ3 j;  3CC4 T;  1KD1 U;  1B07 A;  1YIJ T;  3CCS Q;  4C5E A;  4M7A C;  3FJP A;  2DF6 A;  4PJO E;  2K5I A;  1BI3 A;  5GAN j;  3M58 A;  1TUD A;  4MDX A;  5GJW B;  2DXU A;  3SWN B;  2EYW A;  1QKW A;  3QPH A;  4LUE A;  2DE0 X;  5LJ3 h;  1OUL A;  1R0B G;  3NPF A;  1N5Z A;  2JXB A;  4C8Q E;  3OS5 A;  2RB6 A;  3I35 A;  4N4I A;  2H3J A;  3EGX B;  3GF5 A;  2L3S A;  1R8O B;  1QP2 A;  1TUC A;  4A63 B;  3A8M B;  4IUR A;  4KGV B;  1Y71 A;  4JS4 A;  3S3N A;  3CC2 Q;  4ME7 A;  3G1J A;  2E6N A;  1PNJ A;  4FYX B;  3LWI A;  1UG1 A;  2J06 A;  5LJ5 d;  3G71 A;  2RHZ A;  2MAM A;  1JXO A;  1W2B A;  3EG2 A;  4EMK A;  4Q5W A;  4EPC A;  3EG9 B;  3EFO B;  1VQO A;  2IPO B;  1YJW Q;  1UEB A;  1VQL T;  1WHM A;  5D6W A;  5KE3 A;  2AK5 A;  2DVJ A;  4MZM A;  2QYZ A;  2CSQ A;  2VGM A;  1AEY A;  3NTK A;  4L5G A;  3CXC A;  1YJN Q;  4KUL A;  1S72 A;  1IHW A;  4MML A;  2DL5 A;  1Y96 B;  3DLM A;  1SHF A;  2HAX A;  3OYH A;  2YUN A;  2K9G A;  1VQN Q;  2CUD A;  3VKI A;  5GAN g;  3M56 A;  5M9O A;  3MP6 A;  4XTY A;  3I55 A;  4LDW A;  4OF1 A;  3JCM c;  2EQI A;  1D0X A;  1A0N B;  2F69 A;  2KQW A;  2AKL A;  1WHK A;  3SEM A;  1C6V X;  3FDR A;  1GFC A;  3BW1 A;  4M77 C;  3M4G A;  2HNI A;  1QQJ A;  3D7S B;  3JCM W;  2O4X B;  1QKX A;  3QSU A;  1OZ3 A;  3OSS C;  3QHS A;  3I5S A;  1E7O A;  3J80 E;  1ZSZ B;  5GAO n;  4JS5 A;  1SEM A;  2OTJ A;  3BDU A;  4M75 G;  1D3B B;  1X2Q A;  3PMT A;  3OYL A;  2D0Q B;  2PQW A;  5IAY A;  1G3T A;  2DEQ A;  5KYN A;  4Y28 E;  1TS9 A;  5IHK A;  3M0T A;  4C0G A;  2KT1 A;  5DLQ E;  2P4R A;  4Z8A A;  3EHQ A;  4J9H A;  4PK4 A;  1S1N A;  5DLO A;  3CPF A;  2BE9 B;  5FLX E;  2PUK B;  1SG5 A;  3V8L A;  1YJW T;  4RTV A;  2DIQ A;  2L3P A;  3CCM Q;  4E7K A;  4C0D B;  2XI9 A;  4OP0 A;  1AZG B;  3SD4 A;  2GF7 A;  4CC2 A;  1TG0 A;  3LX7 A;  5CO7 A;  3EH2 A;  2KY9 A;  1N9S A;  3BE3 A;  5IHN A;  2L3Q A;  4J9B A;  1QP3 A;  2CZ7 B;  4X9D A;  4XTU A;  2DZ9 A;  3M55 A;  4N0A A;  2LRQ A;  2VAS A;  5I22 A;  4JJC A;  4RG2 A;  4ESR A;  1SHG A;  3TSW A;  2NUP B;  2DFU A;  4PJJ A;  5LJ3 d;  1VQ4 A;  4PJO F;  1RAD B;  2K3Y A;  3G4S A;  2MF2 A;  2PZ1 A;  2DRK A;  1HSQ A;  1OYX A;  4FU6 A;  4WTO B;  3CCV A;  1PSE A;  2V1R A;  1KIK A;  2M51 A;  1MV0 B;  2ZCF B;  1RUW A;  4B6M A;  5FRM A;  3UA7 A;  2XG8 D;  2DJQ A;  4M7D E;  1AWX A;  1B34 B;  1FYN A;  2DBK A;  3M57 A;  4F17 A;  2DER A;  5FU7 C;  3KFV A;  4OB3 B;  3JB9 G;  1UHC A;  4FT2 A;  4LDX A;  3VV0 A;  4PNO A;  2R5A A;  1MMA A;  3HKS A;  1U1T A;  4N0A C;  2RQV A;  4M77 D;  4RKU E;  4XAX B;  3HRT A;  4PLL A;  4PFZ A;  1OPL A;  4M77 E;  2KMT A;  2ZPG B;  1UDL A;  3NMZ C;  1JJ2 A;  2P4T A;  3A8O B;  1M3C A;  1X75 C;  3RDV A;  1H3Z A;  2XIC A;  4WCI A;  3JB9 H;  1AD5 A;  3DKM A;  2CDT A;  5FWC A;  4M7D D;  1D0Z A;  5I21 A;  4ZN3 A;  2E65 A;  1Q82 U;  3RR6 A;  3CCU A;  1OU8 A;  2M1H A;  1D09 B;  2RJF A;  5GMK j;  3RKX A;  3OYB A;  1QWE A;  1ZA1 B;  3FC3 A;  4KH1 B;  2DL8 A;  3EH1 A;  2CH4 A;  2E64 A;  2F5K A;  1K76 A;  2YUP A;  5GAM f;  1LPL A;  1W6X A;  1YI2 T;  1MMD A;  2KXC A;  3MKD A;  3I55 Q;  1ZBX A;  5GAO l;  3LLR A;  3OBY A;  1K8A R;  2DA9 A;  1JB0 E;  1QVF P;  3VS0 A;  3QYG B;  4Y91 A;  2W0Z A;  4C92 A;  5L8R E;  3HP9 A;  1K73 R;  3CEY A;  4M78 C;  4E6R A;  4M75 A;  3THK A;  4M75 B;  1QVG A;  3TU4 K;  2EIF A;  5KCO A;  5CCA A;  3VJP A;  1FMK A;  5GAN d;  4LN2 A;  5FRO A;  2GGR A;  3P8H A;  2MI6 A;  1XNI A;  2KRS A;  4AG2 C;  1K9M U;  2KEA A;  1QCF A;  3G71 Q;  3TSZ A;  4ELZ C;  3CC7 A;  3TEE A;  2VGN A;  1JEG A;  1X6G A;  3CC2 A;  3SHW A;  1VQM T;  2ATC B;  2OAW A;  2LJ3 A;  1VQ6 T;  2FVU A;  1Q86 R;  4K11 A;  3CCL T;  1BI0 A;  4PFP A;  2J7I A;  3V7C A;  1ZBJ A;  5CKD A;  2QQB A;  1K8A C;  4FT4 A;  1WJS A;  4QW2 A;  2M02 A;  4BY6 B;  4FSS A;  2DEU A;  2HQH A;  2RPN A;  1VQK A;  1BIA A;  1X01 A;  2LT4 A;  3CCQ Q;  5LJ5 f;  2OAU A;  2EGE A;  2NYS A;  3M54 A;  1KHI A;  4HXJ A;  2LMJ A;  1PD1 A;  2HD0 A;  1KQ1 A;  2VWF A;  1WQW A;  4E7I A;  1JO8 A;  1GL5 A;  3JCM g;  2JN0 A;  2JM9 A;  3OYE A;  5LJ3 f;  3F70 A;  2DXT A;  4KBM B;  3ZL7 C;  3VRZ A;  2CGH A;  3PNW C;  1M1K R;  2XDB A;  3QZ9 B;  4JJN K;  5KYX A;  3UT1 A;  4N4G A;  3GPL A;  2NUZ A;  2LC4 A;  5A2Q E;  3CME A;  2NUT B;  1Y07 A;  3MO8 A;  2XU8 A;  2P0P A;  4J6Y A;  4EMH A;  1VQ5 T;  4XU3 A;  4M7D G;  2GFA A;  2GQV A;  3O8V A;  4A4H A;  3JB9 J;  2EWN A;  2K5F A;  2R58 A;  2CS7 A;  1Q86 C;  1PRM C;  3CBM A;  1EX4 A;  1SRM A;  1WLP B;  1KQS S;  2CZ6 B;  3H8Z A;  4DOV A;  1RLQ C;  1M9S A;  3RKW A;  2DAQ A;  4M77 G;  3O5Z A;  4GLM A;  2QXF A;  3OYM A;  1GBR A;  2NUP A;  2KI7 A;  4BE0 A;  1IRX A;  3M0R A;  2CP6 A;  2FZG B;  3I56 T;  3CMA Q;  4PJL A;  1XTD A;  3EG3 A;  2KXD A;  3CMA A;  1YHQ A;  2DD5 A;  1OX9 A;  1BBZ A;  2DMO A;  3P8D A;  2J6F A;  1XOV A;  2JJ9 A;  3RNJ A;  3OYF A;  3MJX A;  1UEC A;  3TVT A;  1YCY A;  1AHJ B;  2RK1 A;  3CPW A;  4J9C A;  4HCB A;  1K0S A;  1Y57 A;  5GAN e;  4LDV A;  4C8Q A;  3CC7 Q;  1IB8 A;  2OTL A;  1Q82 R;  3C4S A;  1BCM A;  2K3X A;  1M90 R;  3OSV A;  5EG2 A;  1YHQ T;  1I07 A;  2LQK A;  2YT6 A;  4QQ6 A;  3VYG A;  3BDL A;  2K6D A;  1VQ7 Q;  1UUE A;  3FRN A;  5CKF A;  1PSF A;  3OYC A;  2LJ0 A;  5CIU A;  2WAC A;  2E3H A;  2XDD A;  5GAM h;  3OYA A;  4ZTF A;  2RM4 A;  4M7A F;  4M75 C;  3MEU A;  2CKK A;  4RG8 A;  1ZSZ A;  1NZ9 A;  2V8K A;  3PVQ A;  2HBP A;  4J9G A;  4F16 A;  1NYG A;  5GAN h;  1GBQ A;  2WSE E;  1KFZ A;  3FEO A;  3N5B B;  3NHN A;  2RQW A;  2QI2 A;  2JMA A;  1IHV A;  3A1P A;  4J7F A;  2EYX A;  2BZ8 A;  3EGX A;  2YLB A;  5HY6 A;  3CC7 T;  1UHF A;  1ZX6 A;  3IQL A;  2VV5 A;  5IN1 A;  1M1F A;  3H41 A;  5GAN 4;  2D8H A;  1HYO A;  3S6W A;  2NLU A;  2NWM A;  1MMN A;  4C5H A;  2MYS A;  2CP5 A;  1K9M R;  1KG1 A;  1ABQ A;  1VQ9 A;  1GCQ A;  2RQR A;  4AFS C;  3CCM T;  2EPD A;  1RAE B;  2JUF A;  2D6F A;  1G2B A;  3L42 A;  2CUB A;  2XID A;  3HPW A;  3UAT A;  4E7H A;  4LDU A;  1KC8 U;  2K3B A;  1NG2 A;  4DEX A;  2LDM A;  3JRZ A;  4Z02 A;  3CD6 T;  4M7D B;  1M4Z A;  5GAO m;  3HFN A;  3H6Z A;  4M7D F;  1IO6 A;  2O9S A;  1PC0 A;  4FSX A;  2O2O A;  4AMC A;  1UFF A;  3P8B B;  2JNG A;  1X27 A;  3G6E Q;  4FYV B;  3EFR A;  5CVI A;  2OTJ T;  2YRV A;  5I2M A;  1NEB A;  3G6E A;  3HRU A;  2FRY A;  4M7A D;  2K2V A;  3MEW A;  4UC4 A;  2LQN A;  2OJ2 A;  2DET A;  2SRC A;  4M7D A;  2QAS A;  3JSC A;  2COY A;  2EGA A;  4KH0 B;  3JCM Q;  4PJO C;  3VUB A;  1N9R A;  4XU1 A;  2QEX A;  4HVV A;  4BI4 A;  4DBH A;  5LJ3 e;  2E70 A;  3PT9 A;  2CH4 W;  3OB9 A;  2CYZ B;  4JZ4 A;  1WHL A;  4BY6 C;  4LE9 A;  1VYV A;  1U5S A;  3U23 A;  4OMQ A;  3UPU A;  2P0Q A;  4QVD A;  2X3X D;  3SWN A;  4R0K A;  3RIR A;  2OI3 A;  3JB9 I;  4ZGE B;  4M75 E;  5GAN 6;  3CCU Q;  3DB4 A;  1NJI U;  2DIL A;  1ZSG A;  1PRL C;  2Y4X A;  1K1Z A;  1YP5 A;  2ED1 A;  1YJN T;  3VYH B;  3QG1 A;  3L1A A;  1QCN A;  5KYW A;  1XJW B;  4E7Z A;  3ME9 A;  1TSF A;  2DL4 A;  2J05 A;  1M1K U;  4QKU A;  4ZGJ B;  4XTW A;  4J9I A;  3RMQ A;  1LCK A;  4GLK A;  3Q1J A;  3OW2 P;  4FW1 A;  1RLP C;  1WXB A;  2R5M A;  2QK0 A;  1NBE B;  5IXF A;  3DB3 A;  5HK3 A;  3RMS A;  1I5L A;  3QWY A;  1WX6 A;  4RTX A;  2QQ9 A;  2V8J A;  4D8D A;  1YIT T;  2DM1 A;  1SKU B;  1D3B A;  4HT8 A;  2D1X A;  2QAZ A;  5A0L A;  2ABL A;  3CCR A;  2GTO A;  1IGQ A;  3QZ5 B;  2AHJ B;  3CCV Q;  2KE9 A;  3LGL A;  3LGF A;  3A98 A;  1WZO A;  2KYM A;  2WSC E;  2V8I A;  4JRP A;  1LJO A;  1K73 U;  3I55 T;  5FRN A;  5J39 A;  1M8V A;  3M5A A;  3UF4 A; 
#chains in the Genus database with same CATH homology
 3A8L B;  4M7A B;  3CXC S;  4P5N A;  1U8R A;  4MMK A;  4MZP A;  4NS5 A;  3SB2 A;  3CD6 T;  1IZ6 A;  2EYQ A;  4BB7 A;  4C92 C;  2MWP A;  1ZBX A;  4HCZ A;  2KSS A;  2XD0 A;  3MET A;  2QA4 A;  4O6J A;  3LLR A;  5GAO l;  3DLL A;  1G3W A;  3SWN C;  3OBY A;  3UWN A;  3G71 T;  1K8A U;  4QVC A;  3X28 B;  2RA2 A;  1N27 A;  4V2S A;  3JCM V;  2VXE A;  5J26 A;  4O5V A;  2Y90 A;  1JB0 E;  1LOJ A;  2LTO A;  4C5I A;  2HQX A;  4JLI A;  2RJC A;  4N4H A;  1W2B S;  4EMK B;  3QYG B;  2EJG A;  4Y91 A;  5GAN 5;  4PKC C;  1NJI C;  1UB4 A;  4C92 A;  3QXE B;  5D6Y A;  5L8R E;  3HP9 A;  1VQ7 T;  4C0F A;  2XK0 A;  3ZBD A;  1BYM A;  2Y4Y A;  3CEY A;  4M78 C;  4PL6 A;  3V7S A;  1NPR A;  5A0D A;  4C8Q F;  3INZ A;  3PMI A;  4M75 A;  2X4Y A;  4M75 B;  4F7U E;  4C92 F;  1QVG A;  3TU4 K;  2XKO C;  1MGQ A;  4HKE A;  4C8Q B;  2EIF A;  2P0K A;  3VUZ A;  3L2U A;  5GAO r;  5KCO A;  1YI2 T;  5C0M A;  4M7A E;  5CCA A;  5IT9 E;  3HL8 A;  3VJP A;  5GAN d;  5GAO p;  1VIE A;  5CK9 A;  1VUB A;  1KHC A;  3QYH B;  3OYI A;  4LD6 A;  5FRO A;  1HK9 A;  3P8H A;  2MI6 A;  1XNI A;  3MCA B;  4E7L A;  4VUB A;  4FL6 A;  3OQ5 A;  2XDP A;  3GNF B;  3OMC A;  2ZPI B;  1WNL A;  1VQ6 A;  3L2Z A;  3QJY A;  1K9M U;  1KQS A;  4X9C A;  5CKB A;  4A4F A;  4XK8 E;  1N8R U;  4ELZ C;  4HT9 A;  4KUD K;  2PVD B;  3JCM X;  1O9S A;  1WGS A;  4F7U G;  3G6E T;  3CC7 A;  4JDS A;  2RI3 A;  2YHT A;  3TEE A;  2VGN A;  4A4K A;  4B9W A;  2E5Q A;  3PFS A;  1O75 A;  3CCR T;  3CC2 A;  5J3B A;  4C0D C;  1FWZ A;  1QVF A;  4IUT A;  1VQM T;  2DXC A;  4IUP A;  3ZEH A;  3ASK A;  1VQ6 T;  4M78 F;  3OYJ A;  2DTO A;  2FVU A;  1I8F A;  3KBG A;  2LCL A;  1KD1 C;  3HFO A;  3CCL T;  2C06 A;  1BI0 A;  1N6A A;  2RD1 A;  4A54 A;  3MP1 A;  3E1S A;  3CCQ T;  3V7C A;  5GAN f;  3ER0 A;  2XHC A;  5CKD A;  2QQB A;  1K8A C;  1BI1 A;  4FT4 A;  1WJS A;  5AYF A;  4QW2 A;  3V8K A;  4B9X A;  5GMK e;  5CR2 A;  4C92 G;  4BY6 B;  1VQK A;  1BIA A;  1X01 A;  2LT4 A;  3MP8 A;  5HK0 A;  1YJ9 T;  5LJ5 f;  2DIG A;  2OAU A;  4A53 A;  2DJZ A;  3BFM A;  4BDY A;  1Q82 C;  3M54 A;  2BKD N;  1KHI A;  4MDW A;  3OS0 A;  2HD0 A;  2CZ1 B;  4FM4 B;  4QQD A;  1KQ1 A;  4CRI A;  2FYK A;  1WQW A;  2RHY A;  3JAM E;  4E7I A;  3CD6 A;  1Y96 A;  2M16 A;  5LL6 S;  3JCM g;  2JN0 A;  2QA4 T;  3L2W A;  3VU3 C;  3NFC A;  2RJE A;  5DY9 A;  3OYE A;  2QTX A;  4C8Q C;  4JRI A;  4OB2 B;  1QVP A;  5LJ3 f;  3F70 A;  2DXT A;  4KBM B;  1UGP B;  5GAN 2;  3OYD A;  1G3S A;  2E10 A;  4J83 A;  2CGH A;  3PNW C;  4EMG A;  3OBW A;  4C92 E;  3QBY A;  3M53 A;  2E12 A;  4M78 B;  4BI8 B;  5DM7 R;  4EMK C;  1VQN T;  2XDB A;  3QZ9 B;  3CCE T;  4JJN K;  2GCX A;  3HSB A;  3UT1 A;  5CQX A;  3LYI A;  4N4G A;  3M9Q A;  5CKE A;  3GPL A;  2LC4 A;  2E1H A;  5A2Q E;  3CME A;  4XU2 A;  2O4X A;  3JCM d;  1YIJ A;  1WPY A;  1Y07 A;  3MO8 A;  2XU8 A;  2P0P A;  4J6Y A;  3J81 E;  4QQG A;  3URG A;  4EMH A;  3OYK A;  4XU3 A;  1VQ5 T;  4X34 A;  4PJO A;  4M7D G;  4PJO B;  3JCM f;  2GFA A;  2KDS A;  4DQ2 A;  2EQM A;  2GQV A;  2LX9 A;  3O8V A;  1Y7X A;  2E6Z A;  4A4H A;  1YJW A;  3GIB A;  1UGS B;  4ZGD B;  3JB9 J;  2EWN A;  2PU9 B;  2K5F A;  2R58 A;  2CS7 A;  4ATO A;  3OMG A;  3S3O A;  4ZTJ A;  2K57 A;  4A4E A;  1Q86 C;  2A7Y A;  1V29 B;  3QJ6 A;  5LJ3 j;  3CC4 T;  1Q81 C;  3WXM B;  3CBM A;  1Q81 U;  1KD1 U;  3R6O A;  3X20 B;  1U1S A;  4C5G A;  3FB9 A;  1H64 1;  1YIJ T;  3GP8 A;  4C5E A;  5KE2 A;  2I2L A;  2CZ6 B;  4J6W A;  3E19 A;  1KQS S;  4M7A C;  3FIF A;  3FJP A;  3H8Z A;  4QVZ A;  4BAC A;  4PJO E;  2RHX A;  4DOV A;  2K5I A;  4GY5 A;  1M9S A;  2LQ8 A;  2EFI A;  3MEV A;  2YLC A;  5GAM d;  3RKW A;  2DAQ A;  4NL3 A;  3JCM P;  1S72 T;  2K5L A;  3QKJ A;  1BI3 A;  4OGC A;  5GAN j;  4OB1 B;  4M77 G;  3M58 A;  1WQ7 A;  2QXF A;  4BDZ A;  4M7D C;  3OYM A;  4MDX A;  2DXU A;  2F5T X;  1KQ2 A;  3SWN B;  4RCB A;  3QPH A;  1RL2 A;  1WJR A;  4XTV A;  4D6W A;  4BE0 A;  1K9M C;  4WF2 A;  3JB9 F;  5LJ3 h;  2L3R A;  3V7R A;  4E7J A;  5CAI A;  4BE1 A;  5GMK l;  5LJ5 j;  3I56 T;  4M78 G;  4C8Q E;  3A8G B;  1XTD A;  3OS5 A;  2RB6 A;  2ZPB B;  3CMA A;  3CCS T;  1YHQ A;  2DKG A;  2DXB A;  2DD5 A;  2JTM A;  4N4I A;  2H3J A;  4OVA A;  5LJ5 e;  1QVG S;  1VQK T;  3GF5 A;  5HKC A;  3P8D A;  1R8O B;  1QP2 A;  1XOV A;  3EAE A;  3A5Z B;  3OYF A;  2VYT A;  3A8M B;  1YCY A;  1AHJ B;  2RK1 A;  4IUR A;  2EJF A;  1Y71 A;  2D9T A;  3EFS A;  3OYY A;  3CPW A;  4JS4 A;  3S3N A;  4HCB A;  4ME7 A;  1ZQ1 A;  5GAN e;  3QUI A;  2E6N A;  4LDV A;  1YI2 A;  4C8Q A;  3CMA T;  1N8R C;  2OTL A;  3LWI A;  3C4S A;  4LDY A;  2K3X A;  5LJ5 d;  1VQP T;  4M7A A;  4BD3 A;  3OSV A;  5EG2 A;  3CCS A;  1YHQ T;  3G71 A;  2L8D A;  2LQK A;  2RHZ A;  4QQ6 A;  3L2Q A;  4LD9 K;  2MAM A;  3VYG A;  1W2B A;  1X6O A;  5KCH A;  4C8Q D;  3BDL A;  4EMK A;  3ZFJ A;  2PVO B;  4Q5W A;  4C8Q G;  4EPC A;  1Q86 U;  4M77 A;  4JRK A;  1VQO A;  3FRN A;  3BY7 A;  2LVM A;  5CKF A;  4L59 A;  1UEB A;  3CCV T;  1VQL T;  1PSF A;  5C6S A;  4XTX A;  4A4G A;  3OYC A;  5D6W A;  5KE3 A;  2M0O A;  3QII A;  5CIU A;  2WAC A;  2HQE A;  4FIB A;  2XDD A;  5GAM h;  3OYA A;  2OTL T;  4ZTF A;  2RM4 A;  4MZM A;  1VQ7 A;  4M7A F;  5LJ5 h;  1VQ5 A;  3M59 A;  4M75 C;  3GLX A;  3KXT A;  3MEU A;  2CKK A;  2DD4 A;  1UGQ B;  3NTH A;  1Q7Y U;  4E47 A;  2DVE A;  3TCJ A;  2RI5 A;  2VGM A;  3UDC A;  2ZPE B;  3RES A;  1BI2 A;  4RG8 A;  3X24 B;  3NTK A;  1OI1 A;  1NZ9 A;  2V8K A;  4L5G A;  2HBP A;  3CXC A;  1GXI E;  4KUL A;  5GAN h;  1S72 A;  2FB7 A;  5LJ5 g;  4MML A;  2MWO A;  1QW1 A;  1YJ9 A;  1Y96 B;  3DLM A;  2WSE E;  3SDZ A;  2HAX A;  3OYH A;  3FEO A;  3N5B B;  3OY9 A;  3VKI A;  2KK4 A;  2QI2 A;  3M56 A;  5M9O A;  5GAN g;  3OS1 A;  4J7F A;  3MP6 A;  4JUV A;  4XTY A;  3I55 A;  4IUU A;  2YLB A;  4IUV A;  4J7I A;  4LDW A;  4OF1 A;  5HY6 A;  5GAN 7;  3CC7 T;  2VV5 A;  2KAF A;  5IN1 A;  3JCM c;  1ZHI A;  2ZZD A;  1VIF A;  3PIO A;  2RO0 A;  1M1F A;  2EQJ A;  2F69 A;  5GAN 4;  1I81 A;  2IVW A;  2KQW A;  1JRI A;  3S6W A;  4DA4 A;  2NLU A;  4M75 F;  2X35 A;  5LJ3 g;  3RUX A;  4J6X A;  4C5H A;  5KH6 A;  3FDR A;  1TH7 A;  2LT1 A;  1VQ8 T;  1KG1 A;  3BW1 A;  1JJ2 S;  1WJQ A;  3M4G A;  4M77 C;  3CCE A;  2HNI A;  4YTL A;  1VQ9 A;  3OS2 A;  4ELY C;  3CCJ T;  3A8H B;  1FXX A;  3JCM W;  1M90 U;  3CCM T;  2QQA A;  3JCM J;  1OZ2 A;  1VQ4 T;  4M7A G;  2O4X B;  1VQP A;  3QSU A;  2JUF A;  2D6F A;  2QDY B;  1XQH A;  2RI2 A;  3L42 A;  1OZ3 A;  3OSS C;  3QHS A;  4J5Y A;  2FL7 A;  2EJ9 A;  2XID A;  4F7U F;  3CCU T;  3HPW A;  3J80 E;  5GAO n;  2EQK A;  2GFU A;  2KVQ G;  4JS5 A;  2VUB A;  2BUD A;  2DK3 A;  3BDU A;  3C95 A;  4F7U B;  2LCC A;  4E7H A;  2OTJ A;  4LDU A;  4M75 G;  1KC8 U;  3CC4 A;  1VQ8 A;  1P92 A;  1D3B B;  2LDM A;  4HCC A;  3JRZ A;  2RH2 A;  4Z02 A;  3PMT A;  3CBP A;  3MEA A;  4PJO G;  2D0Q B;  2PQW A;  3OYL A;  1G3Y A;  3CCM A;  4M7D B;  5IAY A;  1M4Z A;  1G3T A;  2DEQ A;  1B34 A;  5CKH A;  3HFN A;  4HA8 A;  5GAO m;  3CCJ A;  3H6Z A;  1DJ7 B;  4Y28 E;  1VQO T;  1QVF S;  4M7D F;  2L89 A;  1EIF A;  4KUI A;  4KT0 E;  3WVD B;  3M4Y A;  4FSX A;  1M90 C;  3RER A;  1SSF A;  1YBY A;  2RHU A;  3P8B B;  1M5Q 1;  3L2V A;  4C0G A;  4C92 B;  2EKO A;  2JNG A;  3OW2 A;  4C92 D;  5DLQ E;  3AHU A;  5I2S A;  3EFR A;  1G5V A;  2PUO B;  5CVI A;  2DTI A;  2VC8 A;  2ZPH B;  2OTJ T;  2YRV A;  5I2M A;  3CME T;  2CZ0 B;  5DLO A;  2B8A A;  1RI0 A;  3HRU A;  4ZN1 A;  2E41 A;  3CPF A;  1W4S A;  5FLX E;  5GMK i;  3G6E A;  2PUK B;  5GMK h;  3S3M A;  4M7A D;  2K2V A;  3MEW A;  2VXF A;  3HRS A;  5FU7 B;  4UC4 A;  1IRE B;  3V8L A;  4C0Z A;  1YJW T;  4M7D A;  3G7Z A;  3J7A F;  3JSC A;  2DIQ A;  3HHT B;  4E7K A;  4C0D B;  1YIT A;  2XI9 A;  4OP0 A;  1BKB A;  3JCM Q;  3LW5 E;  2QQS A;  4RCC A;  4PJO C;  3SD4 A;  1MHN A;  3VUB A;  1N9R A;  2GF7 A;  4XU0 A;  4XU1 A;  2QEX A;  4BE2 A;  4BI4 A;  3CPW S;  3C12 A;  3CCL A;  2L5Q A;  3LX7 A;  5CO7 A;  5LJ3 e;  3CBO A;  2R57 A;  3CCQ A;  2E70 A;  1N9S A;  2K4Y A;  2KY9 A;  3PT9 A;  4OMF B;  5GAN 3;  3G4S T;  3WVE B;  4PJO D;  2QQR A;  3OB9 A;  2CYZ B;  1QP3 A;  2CZ7 B;  4X9D A;  4XTU A;  4BY6 C;  2M9U A;  5GAM g;  2DZ9 A;  2O01 E;  3M55 A;  4N0A A;  4NOY A;  2LRQ A;  3JB9 D;  1NE8 A;  1VQ9 T;  2G3R A;  3X25 B;  3RKY A;  1LNX A;  2WSF E;  3UPU A;  4XQ3 A;  2P0Q A;  2X4X A;  4RG2 A;  4TVR A;  2DZC A;  4QVD A;  2JOY A;  3LWH A;  3SWN A;  5LJ3 d;  3RIR A;  1VQ4 A;  3JB9 I;  4JLG A;  4ZGE B;  4PJO F;  2K3Y A;  4RMO A;  4M75 E;  2MF2 A;  4F7U A;  3G4S A;  1KC8 C;  5GAN 6;  2DO3 A;  1I4K 1;  1OYX A;  3KUF A;  3DB4 A;  4FU6 A;  1PSE A;  3X26 B;  4M78 D;  3CCV A;  1NJI U;  4XTZ A;  1VQL A;  2Y4X A;  2X4W A;  2JZ2 A;  2ZCF B;  1BIB A;  1YJN T;  3SFM A;  5A0G A;  5GAM j;  5FRM A;  1M1G A;  3VYH B;  1VQN A;  2XG8 D;  3OYN A;  3PGG A;  2ZPF B;  4L6V 5;  2X4J A;  4DOW A;  4M7D E;  2IG0 A;  1B34 B;  2EQU A;  3QDR B;  3QG1 A;  4CI0 C;  3L1A A;  5GAM e;  4BI3 A;  3M57 A;  5FU7 C;  3ME9 A;  4OB3 B;  3V8J A;  3JB9 G;  1YJN A;  2LNV A;  1M1K U;  1M1K C;  4FT2 A;  4ZGJ B;  4PLI A;  4LDX A;  4II1 A;  4XTW A;  3VV0 A;  4OB0 B;  2R5A A;  4PNO A;  3RMQ A;  4GLK A;  3FLG A;  3HKS A;  3Q1J A;  1U1T A;  1JBM A;  3TRE A;  3C94 A;  4N0A C;  4J8O A;  3NTI A;  3JCM b;  3OA6 A;  1NPP A;  4M77 D;  4RKU E;  4XAX B;  3PIP A;  2R5M A;  3HRT A;  4PLL A;  5FU6 B;  4EDU A;  4M77 E;  4M77 B;  1Q7Y C;  3DB3 A;  2KMT A;  2ZPG B;  5HK3 A;  4MZT A;  3RMS A;  3GOX A;  2ZGW A;  3GNG A;  1I5L A;  4M77 F;  4OGE A;  3QO3 A;  2QQ9 A;  2BIV A;  2JVV A;  2MMP A;  4M78 E;  1JJ2 A;  2V8J A;  1YIT T;  2EAY A;  2P4T A;  3A8O B;  5GAO q;  2DPP B;  2FHD A;  1D3B A;  2RHI A;  5GAN 8;  4HT8 A;  5D6X A;  3L2R A;  1X75 C;  3LH0 A;  5A0L A;  5CQY A;  1H3Z A;  2XIC A;  4BUG A;  3JB9 H;  3DKM A;  3MHX A;  4NL2 A;  2RJD A;  3JCM h;  1VQM A;  3JCM e;  2QEX T;  3PTA A;  3CCR A;  2PVG B;  4M78 A;  3T9N A;  3CC2 T;  4M7D D;  5I21 A;  4R55 A;  3I56 A;  4ZN3 A;  3QZ5 B;  2AHJ B;  2E65 A;  1Q82 U;  1FX7 A;  2RK2 A;  2JTF A;  3LGL A;  3CCU A;  4R56 A;  3LGF A;  2DTH A;  4IUQ A;  3OW2 S;  2M1H A;  2RJF A;  3E9F A;  5GMK j;  3RKX A;  3OYB A;  2WSC E;  5FU6 C;  2V8I A;  3OYG A;  4JRP A;  3FC3 A;  3E9G A;  1LJO A;  4JRQ A;  1HXD A;  2E64 A;  2F5K A;  4IKF A;  5GMK m;  1K73 U;  1K73 C;  3I55 T;  5FRN A;  5GAM f;  1UGR B;  5J39 A;  2A3L A;  4M75 D;  1M8V A;  3M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...