4HCZA

Phf1 tudor in complex with h3k36me3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 1
molecule tags Transcription
source organism Homo sapiens
publication title Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
pubmed doi rcsb
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4hczA00
2JZ2A 5FRNA 3ASKA 1WGSA 4BD3A 3OYKA 3OYJA 3BDLA 2FHDA 3DB4A 4NS5A 4C5HA 3E9FA 3O8VA 3P8DA 3L2QA 4IURA 3QJ6A 5KE2A 2X4XA 3L42A 3MP8A 3E9GA 3S3MA 2QQRA 2BUDA 2M1HA 3FLGA 3QKJA 3F70A 4RG2A 4IUPA 2E5QA 3MO8A 2R57A 2R5MA 5IN1A 4Z02A 5J26A 5D6WA 5M9OA 4LD6A 3S3OA 2RI3A 5CIUA 5D6YA 2X4WA 2NLUA 4E7JA 2XDPA 3OYNA 5J39A 4FU6A 4E7LA 2QQSA 3OYAA 2GFAA 2X4YA 3PMTA 2RI2A 2EQUA 2B8AA 2LCCA 4UC4A 1OZ3A 4A4GA 5KH6A 4QQGA 2RHYA 4Q5WA 4QW2A 2GF7A 3OB9A 2L3RA 3FC3A 3SD4A 2RHUA 2P0KA 3OYFA 1XNIA 4GY5A 1WJQA 2F5KA 2X35A 3QBYA 4C5GA 4ZTJA 4BDZA 2BKDN 5KCHA 3OS2A 3Q1JA 3GOXA 3LGFA 4B9XA 4IUTA 3DLMA 3C4SA 3LX7A 3H8ZA 3FEOA 4A4EA 3OYEA 4HCZA 4IUQA 2O4XB 2R5AA 3LH0A 3LYIA 4N4GA 5KCOA 4BE1A 2JTFA 2LTOA 3OYIA 2CKKA 4BACA 2PQWA 3EAEA 3CEYA 2K3YA 2VYTA 4E7HA 3UWNA 5FRMA 3PMIA 1KHCA 1OZ2A 3PNWC 5IAYA 1OYXA 3OYMA 2EFIA 3S3NA 1WJRA 3H6ZA 1MHNA 3UT1A 2HQEA 3ZEHA 3MEUA 3OY9A 3L2WA 2WACA 2EQKA 2RHIA 2MWPA 2YRVA 4PLIA 4QQ6A 4A4HA 3NTKA 5C0MA 3OA6A 3L2UA 4IUVA 4B9WA 2XK0A 5C6SA 1WJSA 3MEAA 3M9QA 4E7IA 4QQDA 4QVZA 2DIQA 2LVMA 4CRIA 4EDUA 4BE0A 2G3RA 2LRQA 3P8HA 3MEVA 3OMCA 3MP6A 2RJCA 3META 2RHXA 3OS0A 3KUFA 4OVAA 4ZTFA 4PL6A 3ME9A 3MEWA 3LGLA 3DB3A 3PFSA 2RHZA 2IG0A 2MWOA 4N4HA 2BIVA 2RJEA 3L2VA 3OYBA 3NTIA 2RI5A 3FDRA 3LLRA 5FROA 2GFUA 2M0OA 4IKFA 2EKOA 2DAQA 3OYLA 4FL6A 4BDYA 3OYHA 2L8DA 4C5EA 5KE3A 1SSFA 2RJDA 2D9TA 2HQXA 4E7KA 4N4IA 3NTHA 3QIIA 1H3ZA 3MP1A 2R58A 4L59A 1G5VA 3L2RA 2LDMA 4II1A 2EQJA 4PLLA 2E6NA 4IUUA 4C5IA 4BE2A 5D6XA 1N27A 2O4XA 3OS1A 3OMGA 4A4FA 2RJFA 3OQ5A 3OYCA 3OYGA 1OI1A 2L89A 1RI0A 2K3XA 2DIGA 3S6WA 4X34A 3OYDA 2M16A 2RO0A 2EQMA
chains in the Genus database with same CATH superfamily
1NLPC 1YHQQ 4J5YA 3VS1A 1PG5B 2QK0A 3O8VA 1UTIA 1VIEA 2DBKA 2EPDA 1TWBA 2K9GA 2LX7A 4XU1A 2M9UA 1SG5A 4HKEA 2HKQB 1ZHIA 2COWA 2PZ1A 2X4WA 3JB9F 2B86A 2XKOC 3GNGA 2LCCA 2V8KA 2DTIA 4QQGA 2DTHA 1WFWA 1NLOC 3DKMA 3CCEA 4JRKA 2EW3A 2MF2A 4RTYA 2VGMA 1IHVA 3OS2A 1NJIC 2YUPA 1UEBA 3M0QA 3EFOA 5CO7A 4TVRA 2DETA 1AWXA 2ZPEB 1ZUUA 4DA4A 3OYMA 3CMEA 1KK7A 1Z9QA 1VQ7Q 4J9BA 4M7DC 2HL5C 1RI9A 4KGXB 4A4HA 2HD0A 4P5NA 1KC8C 4BE0A 2A08A 3QJYA 2O88A 3V7SA 1YIJT 2DE0X 1I07A 1RUWA 4EMHA 1K76A 2K4YA 3M5AA 9ATCB 1WYXA 3EG2A 1WQ7A 3PIOA 2AKLA 2D0QB 2QAZA 1BBZA 1N6AA 2D9TA 5I2MA 2YHTA 4E7KA 2KAFA 2LQWA 1GFDA 2KGTA 2IIMA 3VRYA 4PKCC 4L59A 3VU3C 4DEYA 3G71T 4AT1B 1VYUA 1OQKA 4ZNXA 2ED1A 4LUEA 1UGRB 1NPRA 2E64A 1C6VX 1OI1A 3QXEB 1YJWA 4XTZA 2LCSA 5FRNA 2XDBA 2CZ1B 2GGRA 4DBRA 1JEGA 2QTXA 4IURA 2A37A 1VQLT 1QWFA 4QVDA 5GMKm 1S72A 1OPLA 1VQ4T 1GBQA 3QYHB 2H3EB 2R5MA 1ARKA 2KT1A 2DBMA 1VYTA 3AT1B 2DVJA 1M3CA 4RG8A 4CC4B 5A2QE 3OB9A 1GCPA 2E12A 1LVKA 3HP9A 3QYGB 3FB9A 4DBFA 1RAFB 1B34A 2EYWA 3NGPA 2K2VA 1K9MU 2ATCB 2RM4A 3H8ZA 4OMQA 1I8FA 2O4XB 1K1ZA 4J6YA 4BACA 1A0NB 1LCKA 3VJPA 1YI2T 2HAXA 3PMIA 2CT4A 3BY7A 3H6ZA 4M75C 3VS7A 4R55A 1QCOA 1B07A 3PVLA 4A53A 3CXCA 1I5LA 1XQHA 1K0XA 2HCKA 1UJYA 1QLYA 2O9SA 1RAAB 2WSEE 5AT1B 2QEXT 2SEMA 3FRNA 1D0ZA 3JB9J 3HFOA 5GANg 2ECZA 2CH4A 2EVRA 4L6V5 2MWOA 2ZPFB 2JTEA 2DYIA 4M77D 1NEGA 1LOJA 5LJ5j 3JAME 2CP2A 3A8LB 4XTVA 3CCET 3QZ9B 3OYHA 3TCJA 3CCST 2YRCA 1VQKA 2E10A 1VQNA 4N4IA 2A7YA 3M55A 1UGPB 3OSVA 3VS0A 4XTUA 2P0QA 2YLBA 2NUPA 5FWBA 1HD3A 1KHIA 5GMKl 1P92A 2GNCA 2CREA 3CCRT 1WQWA 1GCQC 2XMFA 2DXCA 3H0HA 2Y4YA 1N5ZA 2ZGWA 2VXFA 4JPBW 1VQLA 2YWWA 1UE9A 3CCMT 2L2PA 4LUDA 2X51A 1D0YA 5D6YA 2FPFA 1PWTA 1I5OB 3SWNB 3CC2A 4A4GA 4M7AE 3C95A 1ZSZB 2CZ0B 2O31A 4O6JA 3X24B 4N0AA 4PJNA 1TUDA 3LGFA 2BZYA 4LE9A 2BE7D 3REAB 4JZ3A 2DPPB 4C0GA 1RADB 1SKUB 3RESA 2AIRB 1NYGA 2LQNA 4HVWA 4OMMA 3LWIA 4AFUC 2DIQA 4DOWA 2FZKB 1SF9A 3EGDB 1RAGB 4MMKA 3M0RA 4ANJA 2OTJT 3OS0A 2RMOA 1YHQA 3KUFA 1M1GA 4GLMA 1VQ8A 3JCMb 3JCMd 1D0XA 3DB3A 3CBMA 2AHJB 3RIRA 2EYZA 4C8QD 3CCQA 2QA4A 2VWFA 1M8MA 3SFMA 3MPUB 5I22A 1TH7A 1R8OB 4J7IA 2EKOA 1T3SA 2LNHB 1TXQA 1DJ7B 1HYOA 2RJDA 3M0UA 2JS2A 2K5LA 2FRYA 3V8JA 3CCJA 3CMAQ 5LJ5e 1NJIU 2FG0A 1IXDA 3LW5E 3SDZA 3CBPA 2DRMA 1UECA 1RAEB 3CC4Q 5A0GA 2DL5A 1JJ2P 4EMGA 4BE2A 3VRZA 1PSEA 3OMGA 3OQ5A 3GPLA 1TSFA 2O9VA 3FJPA 3CPWS 5GAN6 1HJDA 1RL2A 2ZPGB 4JJNK 3ASKA 4WF2A 1M27C 2FHDA 2J6FA 1T0HA 4JRIA 2RH2A 1PHTA 1R77A 4ELZC 1VQ7A 5HY6A 1JO8A 2L3PA 4NL3A 2H3JA 1YJNQ 5J39A 4FU6A 3ZBDA 3CMAA 1KIKA 2B8AA 2QTVA 3RKXA 2GF7A 2I0NA 2VB6A 4M75F 1LNXA 2HQHA 5GMKi 1VQPA 3M54A 5HK3A 2GQIA 3NHNA 3C4SA 3LX7A 4BE1A 2CP5A 4F17A 5KCOA 4FSXA 4MDXA 2LZ6B 2CZ7B 1EIFA 3HRSA 1WLPB 5LJ5f 3H41A 4IIOA 2ROTA 4QQDA 5GMKe 4JLGA 2KY9A 2J7IA 2MAMA 1ABOA 4PJOC 1PCXA 2RHZA 4J9FA 2QA4T 2IG0A 3JCMg 5GMKh 1ZSGA 1PM3A 2KROA 3L2ZA 1WI7A 4DBQA 2E70A 1PRLC 4C8QF 3SEMA 4HCCA 4PJOA 3M0PA 4V2SA 5GAN2 1Y07A 3CD6A 2ENMA 5IXBA 3PT9A 2LT4A 2KRNA 1WNLA 2DZ9A 5LJ3d 2YSQA 1RI0A 3JB9H 2DIGA 2EQMA 5IH2A 1RACB 4C92G 4M75D 1WGSA 7AT1B 2VGNA 1T0JA 1YIJA 2E6ZA 2DJQA 3UA7A 3X28B 4F7UE 2OI3A 2M1HA 4RG2A 4ZTJA 4IIMA 3VV0A 4CC3A 2RI3A 8AT1B 4UC4A 3OS5A 4QW2A 5KYXA 4J9DA 4C8QB 3TU4K 1ZA2B 1YCSB 4M7DF 3V7CA 5GAOq 3EG0A 2DXBA 2KXCA 3DLLA 1WPYA 3LH5A 2RA2A 3VUZA 4Z88A 3RKYA 3EAEA 1WHHA 2A28A 3QO3A 3CCMQ 1G3YA 2EFIA 4OGCA 2DMOA 5LJ5d 2DK3A 2A0FB 5KYUB 1E6HA 2HBWA 4B9WA 3JCMJ 1KG1A 3MJXA 1R0CB 4JS5A 4WTOB 5L23A 2K3BA 1M5Q1 1MGQA 1WHKA 3I5SA 4X9DA 2W0ZA 4M7DE 5FROA 3CXCP 1WHGA 1NZ9A 4OMFB 4FYVB 1K8AU 5KYWB 1UDLA 5DLQE 3G6ET 3EGUA 1JJ2A 4M7AC 3M4YA 2V26A 1IZ6A 2LJ3A 2VKNA 1KQ2A 1AT1B 3VS3A 2XIDA 1Q7YR 1S72Q 4M75A 2DL7A 2DERA 4N0AC 1IO6A 3J81E 4BY6C 4XTWA 1SEMA 1OX9A 2M16A 2RO0A 2JTMA 5IN1A 4M7AG 4KH1B 3R6NA 3OYJA 1U06A 5IHIA 2PVGB 3OW2P 2EAYA 4FT2A 3FLGA 4ESRA 1VQMQ 1K9MR 2MK5A 1AZGB 2QQSA 2RI2A 4FM4B 2KR3A 1TUCA 2YT6A 1UHFA 1CKAA 1MMAA 2EWNA 3RKWA 2E3IA 3CCRA 2RQRA 3RBBB 1Q7YU 2JUFA 2YUQA 4OMOA 1OU9A 2G6FX 4HCZA 4N4GA 4KULA 5FU7B 5LJ3f 1SRMA 1GBRA 4QT7A 1H8KA 2NYSA 4RTXA 3CCMA 4RTVA 2JT4A 3TREA 2W10A 3L2WA 1OPKA 3G1JA 2MPXC 1IREB 1U3OA 4BI3A 3MEAA 2C06A 4C92A 1BI0A 5LL6S 3CC2T 1PKTA 4OB3B 2C0OA 1AD5A 1EFNA 2NUPB 5GAN5 4PJOG 1QVFA 2KXDA 2L3QA 4ORZA 4FSSA 1XOVA 2QI2A 4OB1B 2DEUA 3QWXX 3MKDA 2HQXA 4M78B 2M02A 3OBWA 1VUBA 3THKA 3G7ZA 2NUZA 1M2OA 3JSCA 4F16A 2BZXA 4LDUA 5LJ3g 1M1FA 1Z9ZA 1H641 1PNJA 4AFSC 1QCNA 1X75C 5D6XA 4A4FA 1I4K1 4X34A 3RR6A 4CC2A 3OYKA 4PJOE 3BDLA 1VQOQ 5L8RE 3L42A 3CCRQ 4OMLA 4FYWB 3QKJA 4E7SA 1OV3A 3CCJT 4M78G 3CC2Q 1QVPA 3PIPA 2EJ9A 2Y4XA 5DM7R 3CCEQ 2DA9A 2JM8A 4B9XA 1QKWA 3FJ5A 5IT9E 1M2VA 3FEOA 2YXYA 4C8QA 4MZPA 2PQWA 3A5ZB 4NOYA 4E7HA 1WHLA 1KHCA 2DRKA 4KBMB 3MEUA 2KBTA 3A98A 4C92D 4QQ6A 2PU9B 3SHWA 1GL5A 1PSFA 4XU0A 1YWOA 4M77B 1V29B 3OW2S 1X43A 1K4US 2RJCA 1JU5C 2RB6A 1VQKQ 1YI2Q 4ZTFA 4LDXA 2CT3A 2RQUA 2LC4A 1NM7A 2CSIA 4JJCA 1FMKA 2QYZA 2HDAA 2YUOA 2EGCA 4PJOB 1H92A 3QUIA 3C0CA 3BDUA 3CC7T 3JCMc 4EMKA 5GANe 4F7UG 2DD5A 1S72T 2ZPIB 1N9SA 2K5IA 1NBEB 1OX8A 2DFUA 3GLXA 3EHRA 1TU0B 2VUBA 3I35A 4VUBA 4R0KA 2XHCA 1D09B 2M51A 4BI8B 2EGAA 3V8LA 3BW1A 4PJLA 3E9FA 1UFFA 1TS9A 4EMKC 3L2QA 1I0CA 3S3MA 4AFQC 2H8HA 2DYBA 5GAOr 2E5QA 5M9OA 1UGQB 1SPKA 1RAHB 1KD1U 2V1RA 5CKHA 1EX4A 1QVGS 1WX6A 3EG3A 3JCMh 2P0KA 2RHUA 5GJVB 3OYFA 4RKUE 2P84A 4J9CA 5HCKA 3I55T 2BKDN 2DZCA 1T3LA 2FEIA 2O2OA 4A4EA 5KYWA 2LTOA 5CR2A 2CP7A 5FRMA 4E47A 3OBYA 1WJRA 3ZEHA 1VA7A 1YITA 2RHIA 4JJDA 1OEBA 2HSPA 1U1SA 2LVMA 3UF4A 2LRQA 4OB2B 1Y0MA 2JMCA 2P0PA 2ESWA 3OYYA 1K9AA 5HKCA 4N4HA 4YTLA 2RJEA 3NTIA 5GANd 4M75E 1K73R 2M0OA 4IKFA 2X4JA 1FMVA 1YWPA 2DLPA 1E6GA 1Q86U 1BYMA 2OTLT 1Q95G 1JBMA 3ZFJA 2R58A 2C0IA 2CGHA 2IVWA 2L3SA 2YDLA 4IUUA 2F2WA 4J9IA 2KE9A 4E2FB 5ECAA 4A4KA 4EPCA 3ZL7C 1H3HA 4B6MA 1JJ2S 4PK4A 1NJIR 3ULRB 4RTWA 1WHJA 2MI6A 3CCVA 1WHMA 1C1AA 1S1NA 4M78A 4BUGA 2EQIA 2CDTA 1X01A 2COZA 1X2KA 4ZGJB 3RMQA 3OSSC 2LMJA 1JRIA 1QKXA 2HZYA 2QDYB 4IUPA 2R57A 4Z02A 2EIFA 4XK8E 5FU6C 3EFRA 4CC7A 4E7LA 2XI9A 4JRQA 2JM9A 2HSEB 3JCMX 3CCVQ 3HL8A 2E41A 1BKBA 3FC3A 5GJWB 3TSWA 2DL3A 1VQ9Q 2K5FA 4RMOA 2CZ6B 3M57A 4BB7A 2J05A 4C92E 2LNVA 3JCMe 4M7DB 1U5SA 2K3YA 1W2BA 1VQLQ 1B7TA 5GAN8 4PNOA 1O9SA 1RLPC 3CXCS 5EG2A 3G6EQ 2CYZB 2DL8A 4PLIA 2L5QA 2OJ2A 2DL4A 3HPWA 3NTKA 4RTUA 2OTLQ 2DXTA 4C8QE 3OMCA 3WXMB 2I2LA 3E1SA 4HT8A 3EH2A 3G71A 4M78D 4PJMA 4ZN1A 3JCMV 2XDDA 4XU2A 3A8HB 3RUXA 1UUEA 4JLIA 3G6EA 4M7AB 2LJ1A 4C5EA 3HSBA 1VQOT 2V1QA 2FRWA 1WXBA 4C92F 1M1KR 2RK1A 1IB8A 5GAN4 1MNEA 1Q82C 1IHWA 2OAWA 3L2RA 1VQ4A 1AOJA 1TUGB 4PFZA 1YIJQ 2KNBB 3P8BB 1M8VA 5GAMh 1D3BB 1N27A 4J6WA 3OS1A 1I81A 1M2VB 1RABB 3CMAT 1W2BS 4M7DD 3KFVA 3UPUA 3FIFA 4R56A 4BY6B 3I56Q 2LT1A 1LPLA 3NMZC 4ZGEB 4XQ3A 4KUIA 1YBYA 5GAN7 5CKDA 1WXUA 2NLUA 3JB9I 1W2BP 1YNZA 1X69A 1QQJA 3OYAA 1BB9A 2OTJQ 3VUBA 1JB0E 2ZZDA 5I21A 1Q7YC 5IHNA 1XNIA 2LQ8A 2ED0A 2VASA 2KSSA 3GOXA 1ACMB 2F2VA 3WVEB 2QEXA 2HEQA 4IUQA 3VKIA 3LH0A 3OW2A 3I5RA 3CEYA 4ELYC 4XU3A 1QP2A 2VVKA 3C94A 4AG1C 3UWNA 1F1BB 1Y96B 3N5BB 1M4ZA 3BFMA 2WACA 3PGGA 4J6XA 1VQNT 5GAOl 2AKKA 2FVUA 5LJ5g 2RK2A 1W70A 3MP6A 1W4SA 1UGVA 1VQMT 3QPHA 2QA4Q 2BIVA 1BK2A 1BI1A 2J06A 2QXFA 2GFUA 3U23A 3LWHA 1YN8A 1TTHB 4FT4A 1XJWB 4XTXA 3QIIA 3H0IA 1YJWQ 2OAUA 3VS2A 4J83A 4HCBA 2EQJA 3GF5A 1K73U 5DY9A 1M90R 3QDFA 4F7UA 2E6NA 4M7DA 4OP0A 4KGZB 1EZZB 5LJ3h 2KYBA 1VQPQ 4E6RA 1ZSZA 1MUZA 1TG0A 3ER0A 4LN2A 2D6FA 1HXDA 2DEQA 3SWNA 3I9QA 4FIBA 4OB0B 4LDVA 1NPPA 4C0DC 3DB4A 5CQYA 4MMLA 2ZCFB 2C0TA 3VYHB 4C0DB 2F1LA 4Z8AA 2NUTA 1KQ1A 3JV3A 1WXTA 4LD6A 3S3OA 2RD1A 1JQQA 1ZSZC 3CCJQ 4D8DA 1YJ9A 5FU7C 2SRCA 1M90U 2DKGA 1ZBXA 4C5GA 4BDZA 2VV5A 1QMCA 4FCYA 3DLMA 2E1HA 2ROLA 4JUVA 3OYIA 2F2XA 1O75A 1WIEA 1QVGP 2KRMA 4XTYA 1BIBA 2RQTA 1M1KC 1CSKA 1Q82R 2E4HA 2EQKA 5GAMd 1FMWA 3TQ7P 1WJSA 3RERA 3TSZA 4QVCA 3META 4J9HA 3NPFA 4M77C 1Y7XA 2JMAA 2DTOA 2J6KA 3CMET 1VQ4Q 1X2QA 2KMTA 1N9RA 1VIFA 4MZMA 2DAQA 4FL6A 5FWCA 1LJOA 2D0NA 2K6DA 4OF1A 2RQWA 5KYUA 3G4ST 1K9MC 1PKSA 3CCLQ 4ZN3A 1KQSP 3GIBA 2F69A 4C0ZA 4MDWA 4LNPA 4J8OA 3X20B 3CD6Q 4JDSA 4HA8A 3CC4A 3CBOA 3JCMP 2E3HA 1BI3A 1QWEA 3HRTA 4AMCA 2JZ2A 1KQSS 1M90C 1RLQC 1FXXA 5CKEA 4C5HA 1ZA1B 3QG1A 1VQPT 3MCAB 2X4XA 3GBQA 1Q81R 3X26B 2CSQA 5D6WA 2AZSA 1FYNA 1AVZC 4E7JA 1G3WA 2GFAA 1VQ8Q 4PJOD 4M4ZA 1YJWT 1VQ5Q 2ZPHB 4Q5WA 4PFPA 3QZ5B 4DEXA 3V7RA 1WJQA 2D1XA 2F5KA 3VS4A 3A8MB 4NL2A 1VQ7T 2HMAA 1HSQA 2XU8A 1KQSA 2GBQA 2CP3A 2CKKA 2MOXA 1YJ9Q 1KFZA 2CP6A 4O5VA 1YITT 2QG9B 1VQ6A 1V1CA 3EHQA 3S3NA 1MHNA 1Q81U 1KJWA 3RDVA 4M7DG 5CQXA 1RAIB 4HT9A 2BE9B 3CCSQ 1JXMA 4LDYA 3R6OA 1PRMC 2AT1B 4PL6A 3CD6T 2FZCB 2XG8D 2K57A 1KC8R 1MMNA 4K11A 1K8AC 4DBHA 2VC8A 2YRDA 1AEYA 8ATCB 3D7SB 3EFOB 5GANh 5KE3A 3PTAA 1X6BA 4KUDK 3CCUA 4M7AA 4LXCA 3T9NA 4ME7A 2VXEA 2V8IA 2LDMA 4PLLA 1MNDA 2NUTB 2GTOA 1NYFA 3PE0A 4M78F 3CC4T 3AHUA 2FYKA 3PVQA 1CKBA 3CPFA 4ZGDB 3UA6A 3H9NA 4HXJA 3CCSA 1N8RC 4A54A 2JS0A 3WVDB 3CPWA 1NEBA 3OYDA 5EC7A 2P4RA 5IXFA 2KDSA 1TOVA 3C12A 2GTJA 1WA7A 2QGGA 2LCLA 2BTTA 1NE8A 3P8DA 2RN8A 5GAMf 2DX1A 4OMNA 3RNJA 2AK5A 2QQRA 5FU6B 2X3XD 5GAN3 4JS4A 2COYA 3CQTA 5D7UA 1YJNA 4C8QC 3M59A 1MV0B 2EGEA 1VOMA 5KH6A 3SB2A 1Y71A 3JB9D 2KQWA 4HVUA 1D1BA 1WDXA 1MV3A 4PJOF 3E2UA 2AZVA 2X9HA 1WZOA 2D8HA 2HBPA 2KVQG 4M77E 2K79A 1G2BA 1QVGA 4D8KA 2EYQA 3QDRB 1OULA 3MHXA 5IAYA 5CKFA 2HQEA 4X1VA 1X6OA 1QVFP 4FYYB 3J7AF 3OA6A 1SRLA 1AZEA 3M9QA 1Q86C 4CRIA 1SHGA 2HKNA 3X25B 1AHJB 4C92C 3CCUQ 4JRPA 2EJGA 3QWYA 3QSUA 4OVAA 2EYXA 3MEWA 3PFSA 2PUKB 3L1AA 3QHSA 3L2VA 3FDRA 1PC0A 3EGDA 4DOVA 2KYMA 4MZTA 1ZLMA 1X6GA 2K7AA 2EBPA 2FPEA 1FWZA 2PVOB 2RQVA 1Y57A 1VQ8T 3M0SA 1VQ5A 1H3ZA 1G5VA 2RNAA 4LDWA 3JCMQ 1BCMA 5FLXE 5A0LA 5GAMj 5CCAA 1KSWA 3TEEA 2A36A 2QASA 3OYGA 1G83A 2JVVA 1QW1A 4Z89A 4WCIA 4BD3A 4NS5A 1YP5A 3EGXA 2HL3A 5FW9A 1D3BA 2MIOA 3QJ6A 1U8RA 3I55A 2KT8A 3E9GA 1OU8A 1ZUYA 5J26A 1YJNT 4C8QG 5CIUA 3HKSA 4QKUA 2Y90A 1M9SA 3CCLT 4M77F 3V8KA 2L3RA 3INZA 3O5ZA 2MYSA 4GY5A 1KC8U 1YHQT 1ZUKA 1YCYA 3URGA 2LP5A 4IUTA 3TVTA 1QVFS 2GCXA 3CCQT 4L5GA 3SWNC 3OYEA 2R5AA 2Z0WA 2CH4W 2YUNA 2OX7A 4M75B 4C92B 4F14A 1AWOA 2VYTA 2HNIA 3PNWC 1OYXA 2EJFA 4XAXB 3HTRA 3I56T 4ATOA 1PD0A 4F7UF 3BE3A 3L2UA 5C6SA 2LQKA 1UGSB 1VQMA 4EDUA 2RPNA 2L0AA 1UHCA 2M0YA 4F7UB 3VS5A 2RF0A 3EGXB 2DM1A 1AWJA 2GQVA 2PTKA 4FYXB 3IQLA 3I55Q 1ABQA 4BDYA 1B3QA 1SSFA 1I1JA 2QQBA 2DJZA 3NTHA 5CK9A 4M78E 4OGEA 1JXOA 4OMPA 2FB7A 4HCKA 4Y91A 4II1A 1Q82U 2FO0A 2XICA 4AG2C 4KT0E 2DD4A 1G8XA 1U1TA 5KYYB 1UB4A 2O4XA 2DNUA 2CUBA 5A0DA 4M77A 2K3XA 1G3TA 3S6WA 3A8GB 1D1AA 3E19A 2P4TA 5GAMe 3GP8A 1VQOA 5KYXB 1IRXA 1M30A 4HVVA 3JCMf 2K2MA 1YITQ 2KRSA 1J3TA 2BUDA 3HFNA 1YJ9T 3F70A 4Y28E 3G4SA 4AFZC 2ZAEA 5GANf 1QCFA 3OYNA 1Y96A 2E65A 1BI2A 2KI7A 4X9CA 5IHKA 5KYYA 3CCLA 3M0TA 1ZBJA 2DXUA 1GRIA 4JJBA 2JOYA 3SD4A 1VQ9A 2IPOB 2DILA 4D6WA 1VQ5T 4F04B 1R0BG 3Q1JA 5GAOm 5CVIA 2JJ9A 2V8JA 4KRTA 2JTFA 4FW1A 1KD1R 1VQ6Q 1N8RU 1VQKT 2D8JA 1OZ2A 3CCQQ 3I56A 1BU1A 2LX9A 1BCOA 2QQAA 4M75G 2MWPA 4KGVB 3CPWP 5C0MA 4IUVA 4QVZA 2WSCE 2G3RA 3P8HA 5HK0A 2CP0A 2QQ9A 2MCNA 5GAOp 5I2SA 4M78C 2WSFE 1GCQA 3ME9A 3LGLA 2NWMA 2MMPA 2CS7A 2RI5A 4RCCA 3LLRA 2QEXQ 2ABLA 2KK4A 4DQ2A 5CKBA 3G4SQ 3OYLA 4A63B 3KXTA 2L8DA 1C0MA 1D1CA 1BIAA 3JB9G 1W1FA 5CAIA 2QDLA 5I11A 2DF6A 1N8RR 5J3BA 3CMEQ 3UDCA 1G3SA 2LJ0A 1VQ6T 4CI0C 4C5IA 1X27A 2JXBA 4PJJA 5LJ5h 2RJFA 2EYYA 3EFSA 5GANj 1SSHA 4RTZA 2FPDA 3NFCA 1UJ0A 1MMDA 4J9EA 1GFCA 1UG1A 4LD9K 1ZX6A 5KE2A 3MP8A 3CC7A 2FZGB 2ZPBB 5AYFA 3MO8A 4PFOA 2A3LA 1AWWA 3H0FA 4JZ4A 1IGUA 4EMKB 3GNFB 1QP3A 2XDPA 4BI4A 1V76A 4M77G 4E7ZA 2CUDA 3M4GA 2X4YA 2PUOB 3PMTA 2EQUA 3M56A 2QGFB 1OZ3A 3CCUT 2J6OA 2XD0A 2RHYA 1M1KU 2OTJA 1KD1C 1XTDA 2DO3A 4J9GA 4RCBA 4Y92A 3QBYA 2X35A 2F5TX 3M53A 2X3WD 1HK9A 5KCHA 3HRUA 2JNGA 1K73C 1K8AR 1M3AA 3LYIA 1VYVA 3M58A 4M7AF 1Q86R 3G71Q 3JCMW 1Q81C 3JRZA 3UATA 3UT1A 1B34B 2KEAA 3J80E 3OY9A 2E5KA 1GXIE 4M7AD 2YRVA 4C0FA 3EH1A 1FX7A 2OTLA 2XK0A 4E7IA 1M3BA 5GAMg 3MEVA 3EG9A 4GLKA 2RHXA 3RMSA 1W6XA 1E7OA 3REBB 3VS6A 4J7FA 5GMKj 2JN0A 3HHTB 3CC7Q 1K0SA 3OYBA 1ZQ1A 2EKHA 3KBGA 1PD1A 3EG9B 1IGQA 1VQ9T 4RTTA 3VYGA 3A1PA 2FL7A 2PNIA 2O01E 5GAOn 4KH0B 2DVEA 3CCVT 2YLCA 1MMGA 3A8OB 5LJ3e 1SHFA 2JW4A 3MP1A 5KYNA 4FW2A 1YFNA 4EIKA 2BZ8A 2PVDB 5LJ3j 4GBQA 3EG1A 3OYCA 5DLOA 1YI2A 1NG2A 2L89A 1OOTA 6AT1B 4RUGA 1VQNQ
chains in the Genus database with same CATH topology
4C92G 4M75D 2KDSA 1WGSA 2MI6A 4J5YA 3C12A 3CCVA 4M78A 2VGNA 4BUGA 2LCLA 1NE8A 3O8VA 1VIEA 3P8DA 1YIJA 2E6ZA 5GAMf 1X01A 4ZGJB 3RMQA 2QQRA 5FU6B 3OSSC 3X28B 4F7UE 5GAN3 2M1HA 1JRIA 2M9UA 4XU1A 2QDYB 4RG2A 4JS4A 4ZTJA 4IUPA 4HKEA 2R57A 4Z02A 2EIFA 3VV0A 2RI3A 1YJNA 1ZHIA 2X4WA 3JB9F 4XK8E 3M59A 5FU6C 4C8QC 3EFRA 4E7LA 2XKOC 3GNGA 2XI9A 4UC4A 2LCCA 5KH6A 4JRQA 2V8KA 2DTIA 3OS5A 4QQGA 3JCMX 2DTHA 4QW2A 3HL8A 1Y71A 3SB2A 2E41A 1BKBA 4C8QB 3FC3A 3DKMA 3TU4K 4M7DF 3CCEA 3V7CA 5GAOq 3JB9D 4JRKA 2KQWA 2DXBA 2MF2A 2VGMA 2K5FA 4RMOA 3OS2A 2CZ6B 3M57A 3DLLA 1WPYA 4PJOF 4BB7A 2RA2A 1NJIC 4C92E 1UEBA 3VUZA 5CO7A 4TVRA 2LNVA 3RKYA 3JCMe 2HBPA 2ZPEB 2KVQG 3EAEA 4M77E 4DA4A 4M7DB 1QVGA 3QO3A 2K3YA 2EYQA 3QDRB 1W2BA 3MHXA 5IAYA 3OYMA 5CKFA 1G3YA 2EFIA 3CMEA 4OGCA 2HQEA 5GAN8 4PNOA 1O9SA 4M7DC 1X6OA 3CXCS 5EG2A 5LJ5d 2CYZB 2DK3A 4PLIA 2L5QA 3HPWA 3NTKA 4A4HA 3OA6A 3J7AF 4B9WA 2DXTA 2HD0A 3M9QA 3JCMJ 4P5NA 1Q86C 4CRIA 4BE0A 1KC8C 1KG1A 3X25B 1AHJB 4C92C 3OMCA 4C8QE 3QJYA 4JRPA 4JS5A 2EJGA 3WXMB 2I2LA 1M5Q1 1MGQA 3E1SA 4OVAA 3V7SA 4HT8A 3QSUA 1YIJT 3G71A 3MEWA 4M78D 3PFSA 2PUKB 3L1AA 4ZN1A 3QHSA 3JCMV 3L2VA 2XDDA 4EMHA 3FDRA 4XU2A 4X9DA 2K4YA 3A8HB 3M5AA 3RUXA 4M7DE 5FROA 4JLIA 3G6EA 1NZ9A 4M7AB 4OMFB 1WQ7A 3PIOA 4DOVA 4C5EA 2D0QB 1K8AU 3HSBA 1VQOT 4MZTA 1N6AA 2D9TA 5DLQE 5I2MA 2YHTA 4E7KA 2KAFA 4C92F 3G6ET 1FWZA 2PVOB 1JJ2A 4M7AC 3M4YA 1VQ8T 2RK1A 5GAN4 1VQ5A 1IZ6A 1Q82C 1H3ZA 4PKCC 4L59A 3VU3C 3L2RA 1G5VA 3G71T 1KQ2A 4LDWA 3JCMQ 1VQ4A 2XIDA 3P8BB 1M8VA 4M75A 5FLXE 5A0LA 5GAMh 5GAMj 5CCAA 1D3BB 1UGRB 1NPRA 1N27A 2E64A 4J6WA 4N0AC 3TEEA 3OS1A 3OYGA 1I81A 1OI1A 3J81E 4BY6C 3QXEB 2JVVA 4XTWA 1QW1A 2M16A 2RO0A 2JTMA 5IN1A 1YJWA 3CMAT 1W2BS 4M7AG 4XTZA 5FRNA 3OYJA 2XDBA 2CZ1B 4BD3A 3UPUA 3FIFA 4M7DD 4R56A 4NS5A 4BY6B 2LT1A 2QTXA 4IURA 1VQLT 1D3BA 3QJ6A 1U8RA 4QVDA 4ZGEB 5GMKm 3E9GA 4XQ3A 3I55A 2PVGB 2EAYA 4FT2A 4KUIA 1S72A 3FLGA 1VQ4T 1YBYA 3QYHB 5J26A 2R5MA 5GAN7 5CKDA 1YJNT 4C8QG 5CIUA 3HKSA 2NLUA 3JB9I 2Y90A 1M9SA 2QQSA 3OYAA 3CCLT 2RI2A 4M77F 4RG8A 4FM4B 3VUBA 1JB0E 2EWNA 2ZZDA 3V8KA 5A2QE 5I21A 3OB9A 2L3RA 3INZA 3RKWA 1Q7YC 3CCRA 1XNIA 2LQ8A 4GY5A 1KC8U 2E12A 3HP9A 1YHQT 1Q7YU 3QYGB 1YCYA 3FB9A 3URGA 2JUFA 2KSSA 3GOXA 4IUTA 1B34A 1QVFS 2K2VA 1K9MU 3WVEB 2GCXA 2RM4A 2QEXA 3CCQT 4L5GA 3H8ZA 3SWNC 3OYEA 1I8FA 4HCZA 2O4XB 2R5AA 3LH0A 4IUQA 4J6YA 4KULA 4N4GA 5FU7B 3VKIA 3OW2A 5LJ3f 4BACA 3CEYA 4M75B 4XU3A 4C92B 1QP2A 4ELYC 3C94A 3CCMA 3VJPA 1YI2T 2VYTA 2HAXA 2HNIA 3UWNA 3PMIA 1Y96B 3PNWC 3N5BB 1M4ZA 1OYXA 2EJFA 3BFMA 3BY7A 3H6ZA 4XAXB 3TREA 3I56T 4M75C 4ATOA 3L2WA 4R55A 2WACA 4A53A 4F7UF 3CXCA 3PGGA 1I5LA 1XQHA 4J6XA 3L2UA 1IREB 1VQNT 5GAOl 2FVUA 4BI3A 5C6SA 3MEAA 5LJ5g 2LQKA 1UGSB 2RK2A 1VQMA 4EDUA 3MP6A 2WSEE 2QEXT 2C06A 1W4SA 4C92A 1BI0A 4F7UB 3FRNA 5LL6S 3CC2T 3JB9J 3HFOA 4OB3B 5GANg 1VQMT 3QPHA 4L6V5 2MWOA 2ZPFB 2BIVA 1BI1A 4M77D 2GQVA 2QXFA 1LOJA 5LJ5j 5GAN5 3JAME 4PJOG 1QVFA 2GFUA 3A8LB 4XTVA 1XOVA 3LWHA 2QI2A 3CCET 3QZ9B 4OB1B 3OYHA 3TCJA 3CCST 4BDYA 4FT4A 1SSFA 1VQKA 2E10A 2HQXA 2QQBA 4N4IA 4M78B 2A7YA 3M55A 2DJZA 1VQNA 1UGPB 3OSVA 3NTHA 4XTUA 2P0QA 3OBWA 3QIIA 2YLBA 4XTXA 5CK9A 4M78E 4OGEA 1VUBA 2OAUA 3G7ZA 4J83A 2FB7A 4Y91A 4II1A 4HCBA 2EQJA 3GF5A 3JSCA 5DY9A 1Q82U 2XICA 4LDUA 1K73U 4F7UA 5LJ3g 4KT0E 1M1FA 2E6NA 1KHIA 1H641 5GMKl 1P92A 4M7DA 4OP0A 2DD4A 1X75C 1U1TA 3CCRT 5D6XA 1UB4A 2O4XA 1WQWA 5LJ3h 4A4FA 1I4K1 5A0DA 4M77A 2K3XA 1G3TA 2DXCA 3S6WA 4X34A 3A8GB 3ER0A 2D6FA 3E19A 1HXDA 2Y4YA 2DEQA 2P4TA 3SWNA 3OYKA 4FIBA 4OB0B 4LDVA 4PJOE 5GAMe 2ZGWA 1NPPA 2VXFA 3BDLA 3DB4A 4C0DC 1VQLA 3GP8A 1VQOA 5CQYA 5L8RE 3L42A 4MMLA 3CCMT 2ZCFB 3JCMf 2BUDA 3HFNA 3VYHB 4C0DB 1YJ9T 3QKJA 3F70A 4Y28E 3G4SA 4M78G 1KQ1A 3CCJT 5GANf 4LD6A 3S3OA 2RD1A 5D6YA 3OYNA 1Y96A 2E65A 1BI2A 4X9CA 3SWNB 3CCLA 3CC2A 1QVPA 1YJ9A 5FU7C 2DXUA 4A4GA 3PIPA 4M7AE 2EJ9A 3C95A 1M90U 2JOYA 2CZ0B 2Y4XA 2DKGA 3SD4A 1ZBXA 1VQ9A 4O6JA 3X24B 5DM7R 4C5GA 4N0AA 4D6WA 1VQ5T 4BDZA 2VV5A 3Q1JA 3LGFA 4B9XA 3DLMA 2E1HA 5IT9E 5GAOm 2DPPB 3FEOA 5CVIA 2V8JA 4JUVA 4C0GA 4C8QA 4MZPA 2JTFA 3OYIA 2PQWA 1O75A 3A5ZB 4NOYA 4XTYA 4E7HA 1N8RU 1BIBA 1VQKT 1KHCA 1OZ2A 4KBMB 3RESA 1M1KC 3I56A 3MEUA 2LX9A 4C92D 2QQAA 2EQKA 4M75G 2MWPA 4QQ6A 2PU9B 5C0MA 5GAMd 4IUVA 1PSFA 4XU0A 3LWIA 4M77B 1WJSA 3RERA 4QVZA 1V29B 2DIQA 4DOWA 3OW2S 2WSCE 2G3RA 3P8HA 4MMKA 5HK0A 2OTJT 4QVCA 2RJCA 3META 2QQ9A 2RB6A 3OS0A 5GAOp 3KUFA 5I2SA 1YHQA 1M1GA 4M78C 1VQ8A 2WSFE 3JCMb 4M77C 3JCMd 4ZTFA 1Y7XA 3ME9A 4LDXA 3LGLA 3DB3A 3CBMA 2AHJB 3RIRA 4C8QD 3CCQA 2DTOA 2MMPA 2QA4A 3CMET 2CS7A 3SFMA 2RI5A 4RCCA 3LLRA 2KMTA 1TH7A 1N9RA 1R8OB 2KK4A 4DQ2A 1VIFA 5CKBA 4J7IA 4MZMA 2DAQA 2EKOA 2LC4A 3OYLA 4FL6A 3KXTA 1LJOA 2L8DA 1DJ7B 1BIAA 2RJDA 3JB9G 2K5LA 4OF1A 3V8JA 5CAIA 4PJOB 3G4ST 3CCJA 5LJ5e 1K9MC 1NJIU 4ZN3A 3QUIA 5J3BA 3BDUA 2F69A 3GIBA 3CC7T 3LW5E 3SDZA 3CBPA 3UDCA 1G3SA 4MDWA 3JCMc 4C0ZA 4EMKA 4J8OA 5GANe 1VQ6T 4F7UG 3X20B 2DD5A 1S72T 4JDSA 4CI0C 5A0GA 4HA8A 4EMGA 2ZPIB 3CC4A 3CBOA 2K5IA 1N9SA 4C5IA 5LJ5h 4BE2A 1PSEA 3JCMP 1BI3A 3OMGA 2RJFA 3OQ5A 3GPLA 3CPWS 3FJPA 3GLXA 3EFSA 5GAN6 3HRTA 2VUBA 5GANj 1RL2A 2JZ2A 2ZPGB 1KQSS 4VUBA 4JJNK 3NFCA 3ASKA 4WF2A 1M90C 2XHCA 1FXXA 5CKEA 4BI8B 2FHDA 3V8LA 4C5HA 3BW1A 4LD9K 3E9FA 3QG1A 4EMKC 3L2QA 1VQPT 5KE2A 3MCAB 2RH2A 2X4XA 3MP8A 4JRIA 3CC7A 4ELZC 3S3MA 1VQ7A 3X26B 2ZPBB 5HY6A 5GAOr 5AYFA 4NL3A 2E5QA 3MO8A 2H3JA 2A3LA 5M9OA 4EMKB 5D6WA 3GNFB 4E7JA 1QP3A 1UGQB 1G3WA 2XDPA 4BI4A 5J39A 4FU6A 4M77G 3M4GA 2GFAA 2X4YA 2PUOB 3ZBDA 3PMTA 4PJOD 2EQUA 3CMAA 3M56A 2B8AA 1YJWT 1OZ3A 3CCUT 1KD1U 5CKHA 2XD0A 2ZPHB 2RHYA 4Q5WA 3RKXA 1M1KU 1QVGS 2OTJA 2GF7A 1KD1C 1XTDA 2DO3A 2P0KA 2RHUA 3QZ5B 4M75F 4RCBA 3JCMh 3V7RA 1LNXA 1WJQA 2F5KA 2X35A 3QBYA 4RKUE 2F5TX 5GMKi 3I55T 2BKDN 3M53A 5KCHA 1HK9A 1VQPA 2DZCA 3HRUA 3M54A 5HK3A 3A8MB 3C4SA 4NL2A 1VQ7T 2JNGA 1K73C 3LX7A 4A4EA 4BE1A 2XU8A 3LYIA 5KCOA 1KQSA 2LTOA 4FSXA 2CKKA 3M58A 5CR2A 4M7AF 4MDXA 4O5VA 1YITT 2CZ7B 1EIFA 3HRSA 5FRMA 3JCMW 1VQ6A 1Q81C 4E47A 3JRZA 3OBYA 1WJRA 3ZEHA 1MHNA 3UT1A 3S3NA 1B34B 3J80E 1Q81U 3OY9A 5LJ5f 1GXIE 4M7AD 2YRVA 2RHIA 1YITA 4M7DG 5CQXA 4C0FA 4HT9A 1FX7A 2OTLA 2XK0A 4E7IA 1U1SA 4QQDA 5GMKe 2LVMA 4JLGA 2LRQA 4OB2B 5GAMg 3MEVA 2KY9A 4GLKA 2RHXA 4LDYA 3R6OA 2MAMA 2P0PA 3RMSA 4PJOC 3OYFA 3OYYA 4PL6A 3CD6T 2RHZA 5HKCA 2QA4T 2XG8D 2IG0A 4N4HA 4J7FA 4YTLA 3JCMg 2JN0A 2RJEA 3HHTB 5GMKj 3OYBA 2K57A 1ZQ1A 3NTIA 5GMKh 5GANd 4M75E 3KBGA 2M0OA 3L2ZA 1K8AC 2X4JA 4IKFA 2VC8A 1VQ9T 3VYGA 5GANh 2E70A 5KE3A 2FL7A 3PTAA 1Q86U 2O01E 1BYMA 5GAOn 2OTLT 4C8QF 3CCUA 4KUDK 4M7AA 3CCVT 2DVEA 1JBMA 2YLCA 4HCCA 3A8OB 3T9NA 5LJ3e 3ZFJA 4PJOA 4ME7A 2VXEA 4V2SA 3MP1A 2R58A 2V8IA 5GAN2 1Y07A 2LDMA 4PLLA 3CD6A 2CGHA 2IVWA 2PVDB 3PT9A 4M78F 2LT4A 3CC4T 3AHUA 2FYKA 1WNLA 2DZ9A 4IUUA 5LJ3j 4ZGDB 3CPFA 5LJ3d 3OYCA 5DLOA 4A4KA 4EPCA 2L89A 4A54A 3CCSA 1RI0A 3WVDB 1YI2A 3CPWA 2DIGA 1N8RC 1JJ2S 3JB9H 3OYDA 2EQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZ2 A;  5FRN A;  3ASK A;  1WGS A;  4BD3 A;  3OYK A;  3OYJ A;  3BDL A;  2FHD A;  3DB4 A;  4NS5 A;  4C5H A;  3E9F A;  3O8V A;  3P8D A;  3L2Q A;  4IUR A;  3QJ6 A;  5KE2 A;  2X4X A;  3L42 A;  3MP8 A;  3E9G A;  3S3M A;  2QQR A;  2BUD A;  2M1H A;  3FLG A;  3QKJ A;  3F70 A;  4RG2 A;  4IUP A;  2E5Q A;  3MO8 A;  2R57 A;  2R5M A;  5IN1 A;  4Z02 A;  5J26 A;  5D6W A;  5M9O A;  4LD6 A;  3S3O A;  2RI3 A;  5CIU A;  5D6Y A;  2X4W A;  2NLU A;  4E7J A;  2XDP A;  3OYN A;  5J39 A;  4FU6 A;  4E7L A;  2QQS A;  3OYA A;  2GFA A;  2X4Y A;  3PMT A;  2RI2 A;  2EQU A;  2B8A A;  2LCC A;  4UC4 A;  1OZ3 A;  4A4G A;  5KH6 A;  4QQG A;  2RHY A;  4Q5W A;  4QW2 A;  2GF7 A;  3OB9 A;  2L3R A;  3FC3 A;  3SD4 A;  2RHU A;  2P0K A;  3OYF A;  1XNI A;  4GY5 A;  1WJQ A;  2F5K A;  2X35 A;  3QBY A;  4C5G A;  4ZTJ A;  4BDZ A;  2BKD N;  5KCH A;  3OS2 A;  3Q1J A;  3GOX A;  3LGF A;  4B9X A;  4IUT A;  3DLM A;  3C4S A;  3LX7 A;  3H8Z A;  3FEO A;  4A4E A;  3OYE A;  4HCZ A;  4IUQ A;  2O4X B;  2R5A A;  3LH0 A;  3LYI A;  4N4G A;  5KCO A;  4BE1 A;  2JTF A;  2LTO A;  3OYI A;  2CKK A;  4BAC A;  2PQW A;  3EAE A;  3CEY A;  2K3Y A;  2VYT A;  4E7H A;  3UWN A;  5FRM A;  3PMI A;  1KHC A;  1OZ2 A;  3PNW C;  5IAY A;  1OYX A;  3OYM A;  2EFI A;  3S3N A;  1WJR A;  3H6Z A;  1MHN A;  3UT1 A;  2HQE A;  3ZEH A;  3MEU A;  3OY9 A;  3L2W A;  2WAC A;  2EQK A;  2RHI A;  2MWP A;  2YRV A;  4PLI A;  4QQ6 A;  4A4H A;  3NTK A;  5C0M A;  3OA6 A;  3L2U A;  4IUV A;  4B9W A;  2XK0 A;  5C6S A;  1WJS A;  3MEA A;  3M9Q A;  4E7I A;  4QQD A;  4QVZ A;  2DIQ A;  2LVM A;  4CRI A;  4EDU A;  4BE0 A;  2G3R A;  2LRQ A;  3P8H A;  3MEV A;  3OMC A;  3MP6 A;  2RJC A;  3MET A;  2RHX A;  3OS0 A;  3KUF A;  4OVA A;  4ZTF A;  4PL6 A;  3ME9 A;  3MEW A;  3LGL A;  3DB3 A;  3PFS A;  2RHZ A;  2IG0 A;  2MWO A;  4N4H A;  2BIV A;  2RJE A;  3L2V A;  3OYB A;  3NTI A;  2RI5 A;  3FDR A;  3LLR A;  5FRO A;  2GFU A;  2M0O A;  4IKF A;  2EKO A;  2DAQ A;  3OYL A;  4FL6 A;  4BDY A;  3OYH A;  2L8D A;  4C5E A;  5KE3 A;  1SSF A;  2RJD A;  2D9T A;  2HQX A;  4E7K A;  4N4I A;  3NTH A;  3QII A;  1H3Z A;  3MP1 A;  2R58 A;  4L59 A;  1G5V A;  3L2R A;  2LDM A;  4II1 A;  2EQJ A;  4PLL A;  2E6N A;  4IUU A;  4C5I A;  4BE2 A;  5D6X A;  1N27 A;  2O4X A;  3OS1 A;  3OMG A;  4A4F A;  2RJF A;  3OQ5 A;  3OYC A;  3OYG A;  1OI1 A;  2L89 A;  1RI0 A;  2K3X A;  2DIG A;  3S6W A;  4X34 A;  3OYD A;  2M16 A;  2RO0 A;  2EQM A; 
#chains in the Genus database with same CATH topology
 1NLP C;  1YHQ Q;  4J5Y A;  3VS1 A;  1PG5 B;  2QK0 A;  3O8V A;  1UTI A;  1VIE A;  2DBK A;  2EPD A;  1TWB A;  2K9G A;  2LX7 A;  4XU1 A;  2M9U A;  1SG5 A;  4HKE A;  2HKQ B;  1ZHI A;  2COW A;  2PZ1 A;  2X4W A;  3JB9 F;  2B86 A;  2XKO C;  3GNG A;  2LCC A;  2V8K A;  2DTI A;  4QQG A;  2DTH A;  1WFW A;  1NLO C;  3DKM A;  3CCE A;  4JRK A;  2EW3 A;  2MF2 A;  4RTY A;  2VGM A;  1IHV A;  3OS2 A;  1NJI C;  2YUP A;  1UEB A;  3M0Q A;  3EFO A;  5CO7 A;  4TVR A;  2DET A;  1AWX A;  2ZPE B;  1ZUU A;  4DA4 A;  3OYM A;  3CME A;  1KK7 A;  1Z9Q A;  1VQ7 Q;  4J9B A;  4M7D C;  2HL5 C;  1RI9 A;  4KGX B;  4A4H A;  2HD0 A;  4P5N A;  1KC8 C;  4BE0 A;  2A08 A;  3QJY A;  2O88 A;  3V7S A;  1YIJ T;  2DE0 X;  1I07 A;  1RUW A;  4EMH A;  1K76 A;  2K4Y A;  3M5A A;  9ATC B;  1WYX A;  3EG2 A;  1WQ7 A;  3PIO A;  2AKL A;  2D0Q B;  2QAZ A;  1BBZ A;  1N6A A;  2D9T A;  5I2M A;  2YHT A;  4E7K A;  2KAF A;  2LQW A;  1GFD A;  2KGT A;  2IIM A;  3VRY A;  4PKC C;  4L59 A;  3VU3 C;  4DEY A;  3G71 T;  4AT1 B;  1VYU A;  1OQK A;  4ZNX A;  2ED1 A;  4LUE A;  1UGR B;  1NPR A;  2E64 A;  1C6V X;  1OI1 A;  3QXE B;  1YJW A;  4XTZ A;  2LCS A;  5FRN A;  2XDB A;  2CZ1 B;  2GGR A;  4DBR A;  1JEG A;  2QTX A;  4IUR A;  2A37 A;  1VQL T;  1QWF A;  4QVD A;  5GMK m;  1S72 A;  1OPL A;  1VQ4 T;  1GBQ A;  3QYH B;  2H3E B;  2R5M A;  1ARK A;  2KT1 A;  2DBM A;  1VYT A;  3AT1 B;  2DVJ A;  1M3C A;  4RG8 A;  4CC4 B;  5A2Q E;  3OB9 A;  1GCP A;  2E12 A;  1LVK A;  3HP9 A;  3QYG B;  3FB9 A;  4DBF A;  1RAF B;  1B34 A;  2EYW A;  3NGP A;  2K2V A;  1K9M U;  2ATC B;  2RM4 A;  3H8Z A;  4OMQ A;  1I8F A;  2O4X B;  1K1Z A;  4J6Y A;  4BAC A;  1A0N B;  1LCK A;  3VJP A;  1YI2 T;  2HAX A;  3PMI A;  2CT4 A;  3BY7 A;  3H6Z A;  4M75 C;  3VS7 A;  4R55 A;  1QCO A;  1B07 A;  3PVL A;  4A53 A;  3CXC A;  1I5L A;  1XQH A;  1K0X A;  2HCK A;  1UJY A;  1QLY A;  2O9S A;  1RAA B;  2WSE E;  5AT1 B;  2QEX T;  2SEM A;  3FRN A;  1D0Z A;  3JB9 J;  3HFO A;  5GAN g;  2ECZ A;  2CH4 A;  2EVR A;  4L6V 5;  2MWO A;  2ZPF B;  2JTE A;  2DYI A;  4M77 D;  1NEG A;  1LOJ A;  5LJ5 j;  3JAM E;  2CP2 A;  3A8L B;  4XTV A;  3CCE T;  3QZ9 B;  3OYH A;  3TCJ A;  3CCS T;  2YRC A;  1VQK A;  2E10 A;  1VQN A;  4N4I A;  2A7Y A;  3M55 A;  1UGP B;  3OSV A;  3VS0 A;  4XTU A;  2P0Q A;  2YLB A;  2NUP A;  5FWB A;  1HD3 A;  1KHI A;  5GMK l;  1P92 A;  2GNC A;  2CRE A;  3CCR T;  1WQW A;  1GCQ C;  2XMF A;  2DXC A;  3H0H A;  2Y4Y A;  1N5Z A;  2ZGW A;  2VXF A;  4JPB W;  1VQL A;  2YWW A;  1UE9 A;  3CCM T;  2L2P A;  4LUD A;  2X51 A;  1D0Y A;  5D6Y A;  2FPF A;  1PWT A;  1I5O B;  3SWN B;  3CC2 A;  4A4G A;  4M7A E;  3C95 A;  1ZSZ B;  2CZ0 B;  2O31 A;  4O6J A;  3X24 B;  4N0A A;  4PJN A;  1TUD A;  3LGF A;  2BZY A;  4LE9 A;  2BE7 D;  3REA B;  4JZ3 A;  2DPP B;  4C0G A;  1RAD B;  1SKU B;  3RES A;  2AIR B;  1NYG A;  2LQN A;  4HVW A;  4OMM A;  3LWI A;  4AFU C;  2DIQ A;  4DOW A;  2FZK B;  1SF9 A;  3EGD B;  1RAG B;  4MMK A;  3M0R A;  4ANJ A;  2OTJ T;  3OS0 A;  2RMO A;  1YHQ A;  3KUF A;  1M1G A;  4GLM A;  1VQ8 A;  3JCM b;  3JCM d;  1D0X A;  3DB3 A;  3CBM A;  2AHJ B;  3RIR A;  2EYZ A;  4C8Q D;  3CCQ A;  2QA4 A;  2VWF A;  1M8M A;  3SFM A;  3MPU B;  5I22 A;  1TH7 A;  1R8O B;  4J7I A;  2EKO A;  1T3S A;  2LNH B;  1TXQ A;  1DJ7 B;  1HYO A;  2RJD A;  3M0U A;  2JS2 A;  2K5L A;  2FRY A;  3V8J A;  3CCJ A;  3CMA Q;  5LJ5 e;  1NJI U;  2FG0 A;  1IXD A;  3LW5 E;  3SDZ A;  3CBP A;  2DRM A;  1UEC A;  1RAE B;  3CC4 Q;  5A0G A;  2DL5 A;  1JJ2 P;  4EMG A;  4BE2 A;  3VRZ A;  1PSE A;  3OMG A;  3OQ5 A;  3GPL A;  1TSF A;  2O9V A;  3FJP A;  3CPW S;  5GAN 6;  1HJD A;  1RL2 A;  2ZPG B;  4JJN K;  3ASK A;  4WF2 A;  1M27 C;  2FHD A;  2J6F A;  1T0H A;  4JRI A;  2RH2 A;  1PHT A;  1R77 A;  4ELZ C;  1VQ7 A;  5HY6 A;  1JO8 A;  2L3P A;  4NL3 A;  2H3J A;  1YJN Q;  5J39 A;  4FU6 A;  3ZBD A;  3CMA A;  1KIK A;  2B8A A;  2QTV A;  3RKX A;  2GF7 A;  2I0N A;  2VB6 A;  4M75 F;  1LNX A;  2HQH A;  5GMK i;  1VQP A;  3M54 A;  5HK3 A;  2GQI A;  3NHN A;  3C4S A;  3LX7 A;  4BE1 A;  2CP5 A;  4F17 A;  5KCO A;  4FSX A;  4MDX A;  2LZ6 B;  2CZ7 B;  1EIF A;  3HRS A;  1WLP B;  5LJ5 f;  3H41 A;  4IIO A;  2ROT A;  4QQD A;  5GMK e;  4JLG A;  2KY9 A;  2J7I A;  2MAM A;  1ABO A;  4PJO C;  1PCX A;  2RHZ A;  4J9F A;  2QA4 T;  2IG0 A;  3JCM g;  5GMK h;  1ZSG A;  1PM3 A;  2KRO A;  3L2Z A;  1WI7 A;  4DBQ A;  2E70 A;  1PRL C;  4C8Q F;  3SEM A;  4HCC A;  4PJO A;  3M0P A;  4V2S A;  5GAN 2;  1Y07 A;  3CD6 A;  2ENM A;  5IXB A;  3PT9 A;  2LT4 A;  2KRN A;  1WNL A;  2DZ9 A;  5LJ3 d;  2YSQ A;  1RI0 A;  3JB9 H;  2DIG A;  2EQM A;  5IH2 A;  1RAC B;  4C92 G;  4M75 D;  1WGS A;  7AT1 B;  2VGN A;  1T0J A;  1YIJ A;  2E6Z A;  2DJQ A;  3UA7 A;  3X28 B;  4F7U E;  2OI3 A;  2M1H A;  4RG2 A;  4ZTJ A;  4IIM A;  3VV0 A;  4CC3 A;  2RI3 A;  8AT1 B;  4UC4 A;  3OS5 A;  4QW2 A;  5KYX A;  4J9D A;  4C8Q B;  3TU4 K;  1ZA2 B;  1YCS B;  4M7D F;  3V7C A;  5GAO q;  3EG0 A;  2DXB A;  2KXC A;  3DLL A;  1WPY A;  3LH5 A;  2RA2 A;  3VUZ A;  4Z88 A;  3RKY A;  3EAE A;  1WHH A;  2A28 A;  3QO3 A;  3CCM Q;  1G3Y A;  2EFI A;  4OGC A;  2DMO A;  5LJ5 d;  2DK3 A;  2A0F B;  5KYU B;  1E6H A;  2HBW A;  4B9W A;  3JCM J;  1KG1 A;  3MJX A;  1R0C B;  4JS5 A;  4WTO B;  5L23 A;  2K3B A;  1M5Q 1;  1MGQ A;  1WHK A;  3I5S A;  4X9D A;  2W0Z A;  4M7D E;  5FRO A;  3CXC P;  1WHG A;  1NZ9 A;  4OMF B;  4FYV B;  1K8A U;  5KYW B;  1UDL A;  5DLQ E;  3G6E T;  3EGU A;  1JJ2 A;  4M7A C;  3M4Y A;  2V26 A;  1IZ6 A;  2LJ3 A;  2VKN A;  1KQ2 A;  1AT1 B;  3VS3 A;  2XID A;  1Q7Y R;  1S72 Q;  4M75 A;  2DL7 A;  2DER A;  4N0A C;  1IO6 A;  3J81 E;  4BY6 C;  4XTW A;  1SEM A;  1OX9 A;  2M16 A;  2RO0 A;  2JTM A;  5IN1 A;  4M7A G;  4KH1 B;  3R6N A;  3OYJ A;  1U06 A;  5IHI A;  2PVG B;  3OW2 P;  2EAY A;  4FT2 A;  3FLG A;  4ESR A;  1VQM Q;  1K9M R;  2MK5 A;  1AZG B;  2QQS A;  2RI2 A;  4FM4 B;  2KR3 A;  1TUC A;  2YT6 A;  1UHF A;  1CKA A;  1MMA A;  2EWN A;  3RKW A;  2E3I A;  3CCR A;  2RQR A;  3RBB B;  1Q7Y U;  2JUF A;  2YUQ A;  4OMO A;  1OU9 A;  2G6F X;  4HCZ A;  4N4G A;  4KUL A;  5FU7 B;  5LJ3 f;  1SRM A;  1GBR A;  4QT7 A;  1H8K A;  2NYS A;  4RTX A;  3CCM A;  4RTV A;  2JT4 A;  3TRE A;  2W10 A;  3L2W A;  1OPK A;  3G1J A;  2MPX C;  1IRE B;  1U3O A;  4BI3 A;  3MEA A;  2C06 A;  4C92 A;  1BI0 A;  5LL6 S;  3CC2 T;  1PKT A;  4OB3 B;  2C0O A;  1AD5 A;  1EFN A;  2NUP B;  5GAN 5;  4PJO G;  1QVF A;  2KXD A;  2L3Q A;  4ORZ A;  4FSS A;  1XOV A;  2QI2 A;  4OB1 B;  2DEU A;  3QWX X;  3MKD A;  2HQX A;  4M78 B;  2M02 A;  3OBW A;  1VUB A;  3THK A;  3G7Z A;  2NUZ A;  1M2O A;  3JSC A;  4F16 A;  2BZX A;  4LDU A;  5LJ3 g;  1M1F A;  1Z9Z A;  1H64 1;  1PNJ A;  4AFS C;  1QCN A;  1X75 C;  5D6X A;  4A4F A;  1I4K 1;  4X34 A;  3RR6 A;  4CC2 A;  3OYK A;  4PJO E;  3BDL A;  1VQO Q;  5L8R E;  3L42 A;  3CCR Q;  4OML A;  4FYW B;  3QKJ A;  4E7S A;  1OV3 A;  3CCJ T;  4M78 G;  3CC2 Q;  1QVP A;  3PIP A;  2EJ9 A;  2Y4X A;  5DM7 R;  3CCE Q;  2DA9 A;  2JM8 A;  4B9X A;  1QKW A;  3FJ5 A;  5IT9 E;  1M2V A;  3FEO A;  2YXY A;  4C8Q A;  4MZP A;  2PQW A;  3A5Z B;  4NOY A;  4E7H A;  1WHL A;  1KHC A;  2DRK A;  4KBM B;  3MEU A;  2KBT A;  3A98 A;  4C92 D;  4QQ6 A;  2PU9 B;  3SHW A;  1GL5 A;  1PSF A;  4XU0 A;  1YWO A;  4M77 B;  1V29 B;  3OW2 S;  1X43 A;  1K4U S;  2RJC A;  1JU5 C;  2RB6 A;  1VQK Q;  1YI2 Q;  4ZTF A;  4LDX A;  2CT3 A;  2RQU A;  2LC4 A;  1NM7 A;  2CSI A;  4JJC A;  1FMK A;  2QYZ A;  2HDA A;  2YUO A;  2EGC A;  4PJO B;  1H92 A;  3QUI A;  3C0C A;  3BDU A;  3CC7 T;  3JCM c;  4EMK A;  5GAN e;  4F7U G;  2DD5 A;  1S72 T;  2ZPI B;  1N9S A;  2K5I A;  1NBE B;  1OX8 A;  2DFU A;  3GLX A;  3EHR A;  1TU0 B;  2VUB A;  3I35 A;  4VUB A;  4R0K A;  2XHC A;  1D09 B;  2M51 A;  4BI8 B;  2EGA A;  3V8L A;  3BW1 A;  4PJL A;  3E9F A;  1UFF A;  1TS9 A;  4EMK C;  3L2Q A;  1I0C A;  3S3M A;  4AFQ C;  2H8H A;  2DYB A;  5GAO r;  2E5Q A;  5M9O A;  1UGQ B;  1SPK A;  1RAH B;  1KD1 U;  2V1R A;  5CKH A;  1EX4 A;  1QVG S;  1WX6 A;  3EG3 A;  3JCM h;  2P0K A;  2RHU A;  5GJV B;  3OYF A;  4RKU E;  2P84 A;  4J9C A;  5HCK A;  3I55 T;  2BKD N;  2DZC A;  1T3L A;  2FEI A;  2O2O A;  4A4E A;  5KYW A;  2LTO A;  5CR2 A;  2CP7 A;  5FRM A;  4E47 A;  3OBY A;  1WJR A;  3ZEH A;  1VA7 A;  1YIT A;  2RHI A;  4JJD A;  1OEB A;  2HSP A;  1U1S A;  2LVM A;  3UF4 A;  2LRQ A;  4OB2 B;  1Y0M A;  2JMC A;  2P0P A;  2ESW A;  3OYY A;  1K9A A;  5HKC A;  4N4H A;  4YTL A;  2RJE A;  3NTI A;  5GAN d;  4M75 E;  1K73 R;  2M0O A;  4IKF A;  2X4J A;  1FMV A;  1YWP A;  2DLP A;  1E6G A;  1Q86 U;  1BYM A;  2OTL T;  1Q95 G;  1JBM A;  3ZFJ A;  2R58 A;  2C0I A;  2CGH A;  2IVW A;  2L3S A;  2YDL A;  4IUU A;  2F2W A;  4J9I A;  2KE9 A;  4E2F B;  5ECA A;  4A4K A;  4EPC A;  3ZL7 C;  1H3H A;  4B6M A;  1JJ2 S;  4PK4 A;  1NJI R;  3ULR B;  4RTW A;  1WHJ A;  2MI6 A;  3CCV A;  1WHM A;  1C1A A;  1S1N A;  4M78 A;  4BUG A;  2EQI A;  2CDT A;  1X01 A;  2COZ A;  1X2K A;  4ZGJ B;  3RMQ A;  3OSS C;  2LMJ A;  1JRI A;  1QKX A;  2HZY A;  2QDY B;  4IUP A;  2R57 A;  4Z02 A;  2EIF A;  4XK8 E;  5FU6 C;  3EFR A;  4CC7 A;  4E7L A;  2XI9 A;  4JRQ A;  2JM9 A;  2HSE B;  3JCM X;  3CCV Q;  3HL8 A;  2E41 A;  1BKB A;  3FC3 A;  5GJW B;  3TSW A;  2DL3 A;  1VQ9 Q;  2K5F A;  4RMO A;  2CZ6 B;  3M57 A;  4BB7 A;  2J05 A;  4C92 E;  2LNV A;  3JCM e;  4M7D B;  1U5S A;  2K3Y A;  1W2B A;  1VQL Q;  1B7T A;  5GAN 8;  4PNO A;  1O9S A;  1RLP C;  3CXC S;  5EG2 A;  3G6E Q;  2CYZ B;  2DL8 A;  4PLI A;  2L5Q A;  2OJ2 A;  2DL4 A;  3HPW A;  3NTK A;  4RTU A;  2OTL Q;  2DXT A;  4C8Q E;  3OMC A;  3WXM B;  2I2L A;  3E1S A;  4HT8 A;  3EH2 A;  3G71 A;  4M78 D;  4PJM A;  4ZN1 A;  3JCM V;  2XDD A;  4XU2 A;  3A8H B;  3RUX A;  1UUE A;  4JLI A;  3G6E A;  4M7A B;  2LJ1 A;  4C5E A;  3HSB A;  1VQO T;  2V1Q A;  2FRW A;  1WXB A;  4C92 F;  1M1K R;  2RK1 A;  1IB8 A;  5GAN 4;  1MNE A;  1Q82 C;  1IHW A;  2OAW A;  3L2R A;  1VQ4 A;  1AOJ A;  1TUG B;  4PFZ A;  1YIJ Q;  2KNB B;  3P8B B;  1M8V A;  5GAM h;  1D3B B;  1N27 A;  4J6W A;  3OS1 A;  1I81 A;  1M2V B;  1RAB B;  3CMA T;  1W2B S;  4M7D D;  3KFV A;  3UPU A;  3FIF A;  4R56 A;  4BY6 B;  3I56 Q;  2LT1 A;  1LPL A;  3NMZ C;  4ZGE B;  4XQ3 A;  4KUI A;  1YBY A;  5GAN 7;  5CKD A;  1WXU A;  2NLU A;  3JB9 I;  1W2B P;  1YNZ A;  1X69 A;  1QQJ A;  3OYA A;  1BB9 A;  2OTJ Q;  3VUB A;  1JB0 E;  2ZZD A;  5I21 A;  1Q7Y C;  5IHN A;  1XNI A;  2LQ8 A;  2ED0 A;  2VAS A;  2KSS A;  3GOX A;  1ACM B;  2F2V A;  3WVE B;  2QEX A;  2HEQ A;  4IUQ A;  3VKI A;  3LH0 A;  3OW2 A;  3I5R A;  3CEY A;  4ELY C;  4XU3 A;  1QP2 A;  2VVK A;  3C94 A;  4AG1 C;  3UWN A;  1F1B B;  1Y96 B;  3N5B B;  1M4Z A;  3BFM A;  2WAC A;  3PGG A;  4J6X A;  1VQN T;  5GAO l;  2AKK A;  2FVU A;  5LJ5 g;  2RK2 A;  1W70 A;  3MP6 A;  1W4S A;  1UGV A;  1VQM T;  3QPH A;  2QA4 Q;  2BIV A;  1BK2 A;  1BI1 A;  2J06 A;  2QXF A;  2GFU A;  3U23 A;  3LWH A;  1YN8 A;  1TTH B;  4FT4 A;  1XJW B;  4XTX A;  3QII A;  3H0I A;  1YJW Q;  2OAU A;  3VS2 A;  4J83 A;  4HCB A;  2EQJ A;  3GF5 A;  1K73 U;  5DY9 A;  1M90 R;  3QDF A;  4F7U A;  2E6N A;  4M7D A;  4OP0 A;  4KGZ B;  1EZZ B;  5LJ3 h;  2KYB A;  1VQP Q;  4E6R A;  1ZSZ A;  1MUZ A;  1TG0 A;  3ER0 A;  4LN2 A;  2D6F A;  1HXD A;  2DEQ A;  3SWN A;  3I9Q A;  4FIB A;  4OB0 B;  4LDV A;  1NPP A;  4C0D C;  3DB4 A;  5CQY A;  4MML A;  2ZCF B;  2C0T A;  3VYH B;  4C0D B;  2F1L A;  4Z8A A;  2NUT A;  1KQ1 A;  3JV3 A;  1WXT A;  4LD6 A;  3S3O A;  2RD1 A;  1JQQ A;  1ZSZ C;  3CCJ Q;  4D8D A;  1YJ9 A;  5FU7 C;  2SRC A;  1M90 U;  2DKG A;  1ZBX A;  4C5G A;  4BDZ A;  2VV5 A;  1QMC A;  4FCY A;  3DLM A;  2E1H A;  2ROL A;  4JUV A;  3OYI A;  2F2X A;  1O75 A;  1WIE A;  1QVG P;  2KRM A;  4XTY A;  1BIB A;  2RQT A;  1M1K C;  1CSK A;  1Q82 R;  2E4H A;  2EQK A;  5GAM d;  1FMW A;  3TQ7 P;  1WJS A;  3RER A;  3TSZ A;  4QVC A;  3MET A;  4J9H A;  3NPF A;  4M77 C;  1Y7X A;  2JMA A;  2DTO A;  2J6K A;  3CME T;  1VQ4 Q;  1X2Q A;  2KMT A;  1N9R A;  1VIF A;  4MZM A;  2DAQ A;  4FL6 A;  5FWC A;  1LJO A;  2D0N A;  2K6D A;  4OF1 A;  2RQW A;  5KYU A;  3G4S T;  1K9M C;  1PKS A;  3CCL Q;  4ZN3 A;  1KQS P;  3GIB A;  2F69 A;  4C0Z A;  4MDW A;  4LNP A;  4J8O A;  3X20 B;  3CD6 Q;  4JDS A;  4HA8 A;  3CC4 A;  3CBO A;  3JCM P;  2E3H A;  1BI3 A;  1QWE A;  3HRT A;  4AMC A;  2JZ2 A;  1KQS S;  1M90 C;  1RLQ C;  1FXX A;  5CKE A;  4C5H A;  1ZA1 B;  3QG1 A;  1VQP T;  3MCA B;  2X4X A;  3GBQ A;  1Q81 R;  3X26 B;  2CSQ A;  5D6W A;  2AZS A;  1FYN A;  1AVZ C;  4E7J A;  1G3W A;  2GFA A;  1VQ8 Q;  4PJO D;  4M4Z A;  1YJW T;  1VQ5 Q;  2ZPH B;  4Q5W A;  4PFP A;  3QZ5 B;  4DEX A;  3V7R A;  1WJQ A;  2D1X A;  2F5K A;  3VS4 A;  3A8M B;  4NL2 A;  1VQ7 T;  2HMA A;  1HSQ A;  2XU8 A;  1KQS A;  2GBQ A;  2CP3 A;  2CKK A;  2MOX A;  1YJ9 Q;  1KFZ A;  2CP6 A;  4O5V A;  1YIT T;  2QG9 B;  1VQ6 A;  1V1C A;  3EHQ A;  3S3N A;  1MHN A;  1Q81 U;  1KJW A;  3RDV A;  4M7D G;  5CQX A;  1RAI B;  4HT9 A;  2BE9 B;  3CCS Q;  1JXM A;  4LDY A;  3R6O A;  1PRM C;  2AT1 B;  4PL6 A;  3CD6 T;  2FZC B;  2XG8 D;  2K57 A;  1KC8 R;  1MMN A;  4K11 A;  1K8A C;  4DBH A;  2VC8 A;  2YRD A;  1AEY A;  8ATC B;  3D7S B;  3EFO B;  5GAN h;  5KE3 A;  3PTA A;  1X6B A;  4KUD K;  3CCU A;  4M7A A;  4LXC A;  3T9N A;  4ME7 A;  2VXE A;  2V8I A;  2LDM A;  4PLL A;  1MND A;  2NUT B;  2GTO A;  1NYF A;  3PE0 A;  4M78 F;  3CC4 T;  3AHU A;  2FYK A;  3PVQ A;  1CKB A;  3CPF A;  4ZGD B;  3UA6 A;  3H9N A;  4HXJ A;  3CCS A;  1N8R C;  4A54 A;  2JS0 A;  3WVD B;  3CPW A;  1NEB A;  3OYD A;  5EC7 A;  2P4R A;  5IXF A;  2KDS A;  1TOV A;  3C12 A;  2GTJ A;  1WA7 A;  2QGG A;  2LCL A;  2BTT A;  1NE8 A;  3P8D A;  2RN8 A;  5GAM f;  2DX1 A;  4OMN A;  3RNJ A;  2AK5 A;  2QQR A;  5FU6 B;  2X3X D;  5GAN 3;  4JS4 A;  2COY A;  3CQT A;  5D7U A;  1YJN A;  4C8Q C;  3M59 A;  1MV0 B;  2EGE A;  1VOM A;  5KH6 A;  3SB2 A;  1Y71 A;  3JB9 D;  2KQW A;  4HVU A;  1D1B A;  1WDX A;  1MV3 A;  4PJO F;  3E2U A;  2AZV A;  2X9H A;  1WZO A;  2D8H A;  2HBP A;  2KVQ G;  4M77 E;  2K79 A;  1G2B A;  1QVG A;  4D8K A;  2EYQ A;  3QDR B;  1OUL A;  3MHX A;  5IAY A;  5CKF A;  2HQE A;  4X1V A;  1X6O A;  1QVF P;  4FYY B;  3J7A F;  3OA6 A;  1SRL A;  1AZE A;  3M9Q A;  1Q86 C;  4CRI A;  1SHG A;  2HKN A;  3X25 B;  1AHJ B;  4C92 C;  3CCU Q;  4JRP A;  2EJG A;  3QWY A;  3QSU A;  4OVA A;  2EYX A;  3MEW A;  3PFS A;  2PUK B;  3L1A A;  3QHS A;  3L2V A;  3FDR A;  1PC0 A;  3EGD A;  4DOV A;  2KYM A;  4MZT A;  1ZLM A;  1X6G A;  2K7A A;  2EBP A;  2FPE A;  1FWZ A;  2PVO B;  2RQV A;  1Y57 A;  1VQ8 T;  3M0S A;  1VQ5 A;  1H3Z A;  1G5V A;  2RNA A;  4LDW A;  3JCM Q;  1BCM A;  5FLX E;  5A0L A;  5GAM j;  5CCA A;  1KSW A;  3TEE A;  2A36 A;  2QAS A;  3OYG A;  1G83 A;  2JVV A;  1QW1 A;  4Z89 A;  4WCI A;  4BD3 A;  4NS5 A;  1YP5 A;  3EGX A;  2HL3 A;  5FW9 A;  1D3B A;  2MIO A;  3QJ6 A;  1U8R A;  3I55 A;  2KT8 A;  3E9G A;  1OU8 A;  1ZUY A;  5J26 A;  1YJN T;  4C8Q G;  5CIU A;  3HKS A;  4QKU A;  2Y90 A;  1M9S A;  3CCL T;  4M77 F;  3V8K A;  2L3R A;  3INZ A;  3O5Z A;  2MYS A;  4GY5 A;  1KC8 U;  1YHQ T;  1ZUK A;  1YCY A;  3URG A;  2LP5 A;  4IUT A;  3TVT A;  1QVF S;  2GCX A;  3CCQ T;  4L5G A;  3SWN C;  3OYE A;  2R5A A;  2Z0W A;  2CH4 W;  2YUN A;  2OX7 A;  4M75 B;  4C92 B;  4F14 A;  1AWO A;  2VYT A;  2HNI A;  3PNW C;  1OYX A;  2EJF A;  4XAX B;  3HTR A;  3I56 T;  4ATO A;  1PD0 A;  4F7U F;  3BE3 A;  3L2U A;  5C6S A;  2LQK A;  1UGS B;  1VQM A;  4EDU A;  2RPN A;  2L0A A;  1UHC A;  2M0Y A;  4F7U B;  3VS5 A;  2RF0 A;  3EGX B;  2DM1 A;  1AWJ A;  2GQV A;  2PTK A;  4FYX B;  3IQL A;  3I55 Q;  1ABQ A;  4BDY A;  1B3Q A;  1SSF A;  1I1J A;  2QQB A;  2DJZ A;  3NTH A;  5CK9 A;  4M78 E;  4OGE A;  1JXO A;  4OMP A;  2FB7 A;  4HCK A;  4Y91 A;  4II1 A;  1Q82 U;  2FO0 A;  2XIC A;  4AG2 C;  4KT0 E;  2DD4 A;  1G8X A;  1U1T A;  5KYY B;  1UB4 A;  2O4X A;  2DNU A;  2CUB A;  5A0D A;  4M77 A;  2K3X A;  1G3T A;  3S6W A;  3A8G B;  1D1A A;  3E19 A;  2P4T A;  5GAM e;  3GP8 A;  1VQO A;  5KYX B;  1IRX A;  1M30 A;  4HVV A;  3JCM f;  2K2M A;  1YIT Q;  2KRS A;  1J3T A;  2BUD A;  3HFN A;  1YJ9 T;  3F70 A;  4Y28 E;  3G4S A;  4AFZ C;  2ZAE A;  5GAN f;  1QCF A;  3OYN A;  1Y96 A;  2E65 A;  1BI2 A;  2KI7 A;  4X9C A;  5IHK A;  5KYY A;  3CCL A;  3M0T A;  1ZBJ A;  2DXU A;  1GRI A;  4JJB A;  2JOY A;  3SD4 A;  1VQ9 A;  2IPO B;  2DIL A;  4D6W A;  1VQ5 T;  4F04 B;  1R0B G;  3Q1J A;  5GAO m;  5CVI A;  2JJ9 A;  2V8J A;  4KRT A;  2JTF A;  4FW1 A;  1KD1 R;  1VQ6 Q;  1N8R U;  1VQK T;  2D8J A;  1OZ2 A;  3CCQ Q;  3I56 A;  1BU1 A;  2LX9 A;  1BCO A;  2QQA A;  4M75 G;  2MWP A;  4KGV B;  3CPW P;  5C0M A;  4IUV A;  4QVZ A;  2WSC E;  2G3R A;  3P8H A;  5HK0 A;  2CP0 A;  2QQ9 A;  2MCN A;  5GAO p;  5I2S A;  4M78 C;  2WSF E;  1GCQ A;  3ME9 A;  3LGL A;  2NWM A;  2MMP A;  2CS7 A;  2RI5 A;  4RCC A;  3LLR A;  2QEX Q;  2ABL A;  2KK4 A;  4DQ2 A;  5CKB A;  3G4S Q;  3OYL A;  4A63 B;  3KXT A;  2L8D A;  1C0M A;  1D1C A;  1BIA A;  3JB9 G;  1W1F A;  5CAI A;  2QDL A;  5I11 A;  2DF6 A;  1N8R R;  5J3B A;  3CME Q;  3UDC A;  1G3S A;  2LJ0 A;  1VQ6 T;  4CI0 C;  4C5I A;  1X27 A;  2JXB A;  4PJJ A;  5LJ5 h;  2RJF A;  2EYY A;  3EFS A;  5GAN j;  1SSH A;  4RTZ A;  2FPD A;  3NFC A;  1UJ0 A;  1MMD A;  4J9E A;  1GFC A;  1UG1 A;  4LD9 K;  1ZX6 A;  5KE2 A;  3MP8 A;  3CC7 A;  2FZG B;  2ZPB B;  5AYF A;  3MO8 A;  4PFO A;  2A3L A;  1AWW A;  3H0F A;  4JZ4 A;  1IGU A;  4EMK B;  3GNF B;  1QP3 A;  2XDP A;  4BI4 A;  1V76 A;  4M77 G;  4E7Z A;  2CUD A;  3M4G A;  2X4Y A;  2PUO B;  3PMT A;  2EQU A;  3M56 A;  2QGF B;  1OZ3 A;  3CCU T;  2J6O A;  2XD0 A;  2RHY A;  1M1K U;  2OTJ A;  1KD1 C;  1XTD A;  2DO3 A;  4J9G A;  4RCB A;  4Y92 A;  3QBY A;  2X35 A;  2F5T X;  3M53 A;  2X3W D;  1HK9 A;  5KCH A;  3HRU A;  2JNG A;  1K73 C;  1K8A R;  1M3A A;  3LYI A;  1VYV A;  3M58 A;  4M7A F;  1Q86 R;  3G71 Q;  3JCM W;  1Q81 C;  3JRZ A;  3UAT A;  3UT1 A;  1B34 B;  2KEA A;  3J80 E;  3OY9 A;  2E5K A;  1GXI E;  4M7A D;  2YRV A;  4C0F A;  3EH1 A;  1FX7 A;  2OTL A;  2XK0 A;  4E7I A;  1M3B A;  5GAM g;  3MEV A;  3EG9 A;  4GLK A;  2RHX A;  3RMS A;  1W6X A;  1E7O A;  3REB B;  3VS6 A;  4J7F A;  5GMK j;  2JN0 A;  3HHT B;  3CC7 Q;  1K0S A;  3OYB A;  1ZQ1 A;  2EKH A;  3KBG A;  1PD1 A;  3EG9 B;  1IGQ A;  1VQ9 T;  4RTT A;  3VYG A;  3A1P A;  2FL7 A;  2PNI A;  2O01 E;  5GAO n;  4KH0 B;  2DVE A;  3CCV T;  2YLC A;  1MMG A;  3A8O B;  5LJ3 e;  1SHF A;  2JW4 A;  3MP1 A;  5KYN A;  4FW2 A;  1YFN A;  4EIK A;  2BZ8 A;  2PVD B;  5LJ3 j;  4GBQ A;  3EG1 A;  3OYC A;  5DLO A;  1YI2 A;  1NG2 A;  2L89 A;  1OOT A;  6AT1 B;  4RUG A;  1VQN Q; 
#chains in the Genus database with same CATH homology
 4C92 G;  4M75 D;  2KDS A;  1WGS A;  2MI6 A;  4J5Y A;  3C12 A;  3CCV A;  4M78 A;  2VGN A;  4BUG A;  2LCL A;  1NE8 A;  3O8V A;  1VIE A;  3P8D A;  1YIJ A;  2E6Z A;  5GAM f;  1X01 A;  4ZGJ B;  3RMQ A;  2QQR A;  5FU6 B;  3OSS C;  3X28 B;  4F7U E;  5GAN 3;  2M1H A;  1JRI A;  2M9U A;  4XU1 A;  2QDY B;  4RG2 A;  4JS4 A;  4ZTJ A;  4IUP A;  4HKE A;  2R57 A;  4Z02 A;  2EIF A;  3VV0 A;  2RI3 A;  1YJN A;  1ZHI A;  2X4W A;  3JB9 F;  4XK8 E;  3M59 A;  5FU6 C;  4C8Q C;  3EFR A;  4E7L A;  2XKO C;  3GNG A;  2XI9 A;  4UC4 A;  2LCC A;  5KH6 A;  4JRQ A;  2V8K A;  2DTI A;  3OS5 A;  4QQG A;  3JCM X;  2DTH A;  4QW2 A;  3HL8 A;  1Y71 A;  3SB2 A;  2E41 A;  1BKB A;  4C8Q B;  3FC3 A;  3DKM A;  3TU4 K;  4M7D F;  3CCE A;  3V7C A;  5GAO q;  3JB9 D;  4JRK A;  2KQW A;  2DXB A;  2MF2 A;  2VGM A;  2K5F A;  4RMO A;  3OS2 A;  2CZ6 B;  3M57 A;  3DLL A;  1WPY A;  4PJO F;  4BB7 A;  2RA2 A;  1NJI C;  4C92 E;  1UEB A;  3VUZ A;  5CO7 A;  4TVR A;  2LNV A;  3RKY A;  3JCM e;  2HBP A;  2ZPE B;  2KVQ G;  3EAE A;  4M77 E;  4DA4 A;  4M7D B;  1QVG A;  3QO3 A;  2K3Y A;  2EYQ A;  3QDR B;  1W2B A;  3MHX A;  5IAY A;  3OYM A;  5CKF A;  1G3Y A;  2EFI A;  3CME A;  4OGC A;  2HQE A;  5GAN 8;  4PNO A;  1O9S A;  4M7D C;  1X6O A;  3CXC S;  5EG2 A;  5LJ5 d;  2CYZ B;  2DK3 A;  4PLI A;  2L5Q A;  3HPW A;  3NTK A;  4A4H A;  3OA6 A;  3J7A F;  4B9W A;  2DXT A;  2HD0 A;  3M9Q A;  3JCM J;  4P5N A;  1Q86 C;  4CRI A;  4BE0 A;  1KC8 C;  1KG1 A;  3X25 B;  1AHJ B;  4C92 C;  3OMC A;  4C8Q E;  3QJY A;  4JRP A;  4JS5 A;  2EJG A;  3WXM B;  2I2L A;  1M5Q 1;  1MGQ A;  3E1S A;  4OVA A;  3V7S A;  4HT8 A;  3QSU A;  1YIJ T;  3G71 A;  3MEW A;  4M78 D;  3PFS A;  2PUK B;  3L1A A;  4ZN1 A;  3QHS A;  3JCM V;  3L2V A;  2XDD A;  4EMH A;  3FDR A;  4XU2 A;  4X9D A;  2K4Y A;  3A8H B;  3M5A A;  3RUX A;  4M7D E;  5FRO A;  4JLI A;  3G6E A;  1NZ9 A;  4M7A B;  4OMF B;  1WQ7 A;  3PIO A;  4DOV A;  4C5E A;  2D0Q B;  1K8A U;  3HSB A;  1VQO T;  4MZT A;  1N6A A;  2D9T A;  5DLQ E;  5I2M A;  2YHT A;  4E7K A;  2KAF A;  4C92 F;  3G6E T;  1FWZ A;  2PVO B;  1JJ2 A;  4M7A C;  3M4Y A;  1VQ8 T;  2RK1 A;  5GAN 4;  1VQ5 A;  1IZ6 A;  1Q82 C;  1H3Z A;  4PKC C;  4L59 A;  3VU3 C;  3L2R A;  1G5V A;  3G71 T;  1KQ2 A;  4LDW A;  3JCM Q;  1VQ4 A;  2XID A;  3P8B B;  1M8V A;  4M75 A;  5FLX E;  5A0L A;  5GAM h;  5GAM j;  5CCA A;  1D3B B;  1UGR B;  1NPR A;  1N27 A;  2E64 A;  4J6W A;  4N0A C;  3TEE A;  3OS1 A;  3OYG A;  1I81 A;  1OI1 A;  3J81 E;  4BY6 C;  3QXE B;  2JVV A;  4XTW A;  1QW1 A;  2M16 A;  2RO0 A;  2JTM A;  5IN1 A;  1YJW A;  3CMA T;  1W2B S;  4M7A G;  4XTZ A;  5FRN A;  3OYJ A;  2XDB A;  2CZ1 B;  4BD3 A;  3UPU A;  3FIF A;  4M7D D;  4R56 A;  4NS5 A;  4BY6 B;  2LT1 A;  2QTX A;  4IUR A;  1VQL T;  1D3B A;  3QJ6 A;  1U8R A;  4QVD A;  4ZGE B;  5GMK m;  3E9G A;  4XQ3 A;  3I55 A;  2PVG B;  2EAY A;  4FT2 A;  4KUI A;  1S72 A;  3FLG A;  1VQ4 T;  1YBY A;  3QYH B;  5J26 A;  2R5M A;  5GAN 7;  5CKD A;  1YJN T;  4C8Q G;  5CIU A;  3HKS A;  2NLU A;  3JB9 I;  2Y90 A;  1M9S A;  2QQS A;  3OYA A;  3CCL T;  2RI2 A;  4M77 F;  4RG8 A;  4FM4 B;  3VUB A;  1JB0 E;  2EWN A;  2ZZD A;  3V8K A;  5A2Q E;  5I21 A;  3OB9 A;  2L3R A;  3INZ A;  3RKW A;  1Q7Y C;  3CCR A;  1XNI A;  2LQ8 A;  4GY5 A;  1KC8 U;  2E12 A;  3HP9 A;  1YHQ T;  1Q7Y U;  3QYG B;  1YCY A;  3FB9 A;  3URG A;  2JUF A;  2KSS A;  3GOX A;  4IUT A;  1B34 A;  1QVF S;  2K2V A;  1K9M U;  3WVE B;  2GCX A;  2RM4 A;  2QEX A;  3CCQ T;  4L5G A;  3H8Z A;  3SWN C;  3OYE A;  1I8F A;  4HCZ A;  2O4X B;  2R5A A;  3LH0 A;  4IUQ A;  4J6Y A;  4KUL A;  4N4G A;  5FU7 B;  3VKI A;  3OW2 A;  5LJ3 f;  4BAC A;  3CEY A;  4M75 B;  4XU3 A;  4C92 B;  1QP2 A;  4ELY C;  3C94 A;  3CCM A;  3VJP A;  1YI2 T;  2VYT A;  2HAX A;  2HNI A;  3UWN A;  3PMI A;  1Y96 B;  3PNW C;  3N5B B;  1M4Z A;  1OYX A;  2EJF A;  3BFM A;  3BY7 A;  3H6Z A;  4XAX B;  3TRE A;  3I56 T;  4M75 C;  4ATO A;  3L2W A;  4R55 A;  2WAC A;  4A53 A;  4F7U F;  3CXC A;  3PGG A;  1I5L A;  1XQH A;  4J6X A;  3L2U A;  1IRE B;  1VQN T;  5GAO l;  2FVU A;  4BI3 A;  5C6S A;  3MEA A;  5LJ5 g;  2LQK A;  1UGS B;  2RK2 A;  1VQM A;  4EDU A;  3MP6 A;  2WSE E;  2QEX T;  2C06 A;  1W4S A;  4C92 A;  1BI0 A;  4F7U B;  3FRN A;  5LL6 S;  3CC2 T;  3JB9 J;  3HFO A;  4OB3 B;  5GAN g;  1VQM T;  3QPH A;  4L6V 5;  2MWO A;  2ZPF B;  2BIV A;  1BI1 A;  4M77 D;  2GQV A;  2QXF A;  1LOJ A;  5LJ5 j;  5GAN 5;  3JAM E;  4PJO G;  1QVF A;  2GFU A;  3A8L B;  4XTV A;  1XOV A;  3LWH A;  2QI2 A;  3CCE T;  3QZ9 B;  4OB1 B;  3OYH A;  3TCJ A;  3CCS T;  4BDY A;  4FT4 A;  1SSF A;  1VQK A;  2E10 A;  2HQX A;  2QQB A;  4N4I A;  4M78 B;  2A7Y A;  3M55 A;  2DJZ A;  1VQN A;  1UGP B;  3OSV A;  3NTH A;  4XTU A;  2P0Q A;  3OBW A;  3QII A;  2YLB A;  4XTX A;  5CK9 A;  4M78 E;  4OGE A;  1VUB A;  2OAU A;  3G7Z A;  4J83 A;  2FB7 A;  4Y91 A;  4II1 A;  4HCB A;  2EQJ A;  3GF5 A;  3JSC A;  5DY9 A;  1Q82 U;  2XIC A;  4LDU A;  1K73 U;  4F7U A;  5LJ3 g;  4KT0 E;  1M1F A;  2E6N A;  1KHI A;  1H64 1;  5GMK l;  1P92 A;  4M7D A;  4OP0 A;  2DD4 A;  1X75 C;  1U1T A;  3CCR T;  5D6X A;  1UB4 A;  2O4X A;  1WQW A;  5LJ3 h;  4A4F A;  1I4K 1;  5A0D A;  4M77 A;  2K3X A;  1G3T A;  2DXC A;  3S6W A;  4X34 A;  3A8G B;  3ER0 A;  2D6F A;  3E19 A;  1HXD A;  2Y4Y A;  2DEQ A;  2P4T A;  3SWN A;  3OYK A;  4FIB A;  4OB0 B;  4LDV A;  4PJO E;  5GAM e;  2ZGW A;  1NPP A;  2VXF A;  3BDL A;  3DB4 A;  4C0D C;  1VQL A;  3GP8 A;  1VQO A;  5CQY A;  5L8R E;  3L42 A;  4MML A;  3CCM T;  2ZCF B;  3JCM f;  2BUD A;  3HFN A;  3VYH B;  4C0D B;  1YJ9 T;  3QKJ A;  3F70 A;  4Y28 E;  3G4S A;  4M78 G;  1KQ1 A;  3CCJ T;  5GAN f;  4LD6 A;  3S3O A;  2RD1 A;  5D6Y A;  3OYN A;  1Y96 A;  2E65 A;  1BI2 A;  4X9C A;  3SWN B;  3CCL A;  3CC2 A;  1QVP A;  1YJ9 A;  5FU7 C;  2DXU A;  4A4G A;  3PIP A;  4M7A E;  2EJ9 A;  3C95 A;  1M90 U;  2JOY A;  2CZ0 B;  2Y4X A;  2DKG A;  3SD4 A;  1ZBX A;  1VQ9 A;  4O6J A;  3X24 B;  5DM7 R;  4C5G A;  4N0A A;  4D6W A;  1VQ5 T;  4BDZ A;  2VV5 A;  3Q1J A;  3LGF A;  4B9X A;  3DLM A;  2E1H A;  5IT9 E;  5GAO m;  2DPP B;  3FEO A;  5CVI A;  2V8J A;  4JUV A;  4C0G A;  4C8Q A;  4MZP A;  2JTF A;  3OYI A;  2PQW A;  1O75 A;  3A5Z B;  4NOY A;  4XTY A;  4E7H A;  1N8R U;  1BIB A;  1VQK T;  1KHC A;  1OZ2 A;  4KBM B;  3RES A;  1M1K C;  3I56 A;  3MEU A;  2LX9 A;  4C92 D;  2QQA A;  2EQK A;  4M75 G;  2MWP A;  4QQ6 A;  2PU9 B;  5C0M A;  5GAM d;  4IUV A;  1PSF A;  4XU0 A;  3LWI A;  4M77 B;  1WJS A;  3RER A;  4QVZ A;  1V29 B;  2DIQ A;  4DOW A;  3OW2 S;  2WSC E;  2G3R A;  3P8H A;  4MMK A;  5HK0 A;  2OTJ T;  4QVC A;  2RJC A;  3MET A;  2QQ9 A;  2RB6 A;  3OS0 A;  5GAO p;  3KUF A;  5I2S A;  1YHQ A;  1M1G A;  4M78 C;  1VQ8 A;  2WSF E;  3JCM b;  4M77 C;  3JCM d;  4ZTF A;  1Y7X A;  3ME9 A;  4LDX A;  3LGL A;  3DB3 A;  3CBM A;  2AHJ B;  3RIR A;  4C8Q D;  3CCQ A;  2DTO A;  2MMP A;  2QA4 A;  3CME T;  2CS7 A;  3SFM A;  2RI5 A;  4RCC A;  3LLR A;  2KMT A;  1TH7 A;  1N9R A;  1R8O B;  2KK4 A;  4DQ2 A;  1VIF A;  5CKB A;  4J7I A;  4MZM A;  2DAQ A;  2EKO A;  2LC4 A;  3OYL A;  4FL6 A;  3KXT A;  1LJO A;  2L8D A;  1DJ7 B;  1BIA A;  2RJD A;  3JB9 G;  2K5L A;  4OF1 A;  3V8J A;  5CAI A;  4PJO B;  3G4S T;  3CCJ A;  5LJ5 e;  1K9M C;  1NJI U;  4ZN3 A;  3QUI A;  5J3B A;  3BDU A;  2F69 A;  3GIB A;  3CC7 T;  3LW5 E;  3SDZ A;  3CBP A;  3UDC A;  1G3S A;  4MDW A;  3JCM c;  4C0Z A;  4EMK A;  4J8O A;  5GAN e;  1VQ6 T;  4F7U G;  3X20 B;  2DD5 A;  1S72 T;  4JDS A;  4CI0 C;  5A0G A;  4HA8 A;  4EMG A;  2ZPI B;  3CC4 A;  3CBO A;  2K5I A;  1N9S A;  4C5I A;  5LJ5 h;  4BE2 A;  1PSE A;  3JCM P;  1BI3 A;  3OMG A;  2RJF A;  3OQ5 A;  3GPL A;  3CPW S;  3FJP A;  3GLX A;  3EFS A;  5GAN 6;  3HRT A;  2VUB A;  5GAN j;  1RL2 A;  2JZ2 A;  2ZPG B;  1KQS S;  4VUB A;  4JJN K;  3NFC A;  3ASK A;  4WF2 A;  1M90 C;  2XHC A;  1FXX A;  5CKE A;  4BI8 B;  2FHD A;  3V8L A;  4C5H A;  3BW1 A;  4LD9 K;  3E9F A;  3QG1 A;  4EMK C;  3L2Q A;  1VQP T;  5KE2 A;  3MCA B;  2RH2 A;  2X4X A;  3MP8 A;  4JRI A;  3CC7 A;  4ELZ C;  3S3M A;  1VQ7 A;  3X26 B;  2ZPB B;  5HY6 A;  5GAO r;  5AYF A;  4NL3 A;  2E5Q A;  3MO8 A;  2H3J A;  2A3L A;  5M9O A;  4EMK B;  5D6W A;  3GNF B;  4E7J A;  1QP3 A;  1UGQ B;  1G3W A;  2XDP A;  4BI4 A;  5J39 A;  4FU6 A;  4M77 G;  3M4G A;  2GFA A;  2X4Y A;  2PUO B;  3ZBD A;  3PMT A;  4PJO D;  2EQU A;  3CMA A;  3M56 A;  2B8A A;  1YJW T;  1OZ3 A;  3CCU T;  1KD1 U;  5CKH A;  2XD0 A;  2ZPH B;  2RHY A;  4Q5W A;  3RKX A;  1M1K U;  1QVG S;  2OTJ A;  2GF7 A;  1KD1 C;  1XTD A;  2DO3 A;  2P0K A;  2RHU A;  3QZ5 B;  4M75 F;  4RCB A;  3JCM h;  3V7R A;  1LNX A;  1WJQ A;  2F5K A;  2X35 A;  3QBY A;  4RKU E;  2F5T X;  5GMK i;  3I55 T;  2BKD N;  3M53 A;  5KCH A;  1HK9 A;  1VQP A;  2DZC A;  3HRU A;  3M54 A;  5HK3 A;  3A8M B;  3C4S A;  4NL2 A;  1VQ7 T;  2JNG A;  1K73 C;  3LX7 A;  4A4E A;  4BE1 A;  2XU8 A;  3LYI A;  5KCO A;  1KQS A;  2LTO A;  4FSX A;  2CKK A;  3M58 A;  5CR2 A;  4M7A F;  4MDX A;  4O5V A;  1YIT T;  2CZ7 B;  1EIF A;  3HRS A;  5FRM A;  3JCM W;  1VQ6 A;  1Q81 C;  4E47 A;  3JRZ A;  3OBY A;  1WJR A;  3ZEH A;  1MHN A;  3UT1 A;  3S3N A;  1B34 B;  3J80 E;  1Q81 U;  3OY9 A;  5LJ5 f;  1GXI E;  4M7A D;  2YRV A;  2RHI A;  1YIT A;  4M7D G;  5CQX A;  4C0F A;  4HT9 A;  1FX7 A;  2OTL A;  2XK0 A;  4E7I A;  1U1S A;  4QQD A;  5GMK e;  2LVM A;  4JLG A;  2LRQ A;  4OB2 B;  5GAM g;  3MEV A;  2KY9 A;  4GLK A;  2RHX A;  4LDY A;  3R6O A;  2MAM A;  2P0P A;  3RMS A;  4PJO C;  3OYF A;  3OYY A;  4PL6 A;  3CD6 T;  2RHZ A;  5HKC A;  2QA4 T;  2XG8 D;  2IG0 A;  4N4H A;  4J7F A;  4YTL A;  3JCM g;  2JN0 A;  2RJE A;  3HHT B;  5GMK j;  3OYB A;  2K57 A;  1ZQ1 A;  3NTI A;  5GMK h;  5GAN d;  4M75 E;  3KBG A;  2M0O A;  3L2Z A;  1K8A C;  2X4J A;  4IKF A;  2VC8 A;  1VQ9 T;  3VYG A;  5GAN h;  2E70 A;  5KE3 A;  2FL7 A;  3PTA A;  1Q86 U;  2O01 E;  1BYM A;  5GAO n;  2OTL T;  4C8Q F;  3CCU A;  4KUD K;  4M7A A;  3CCV T;  2DVE A;  1JBM A;  2YLC A;  4HCC A;  3A8O B;  3T9N A;  5LJ3 e;  3ZFJ A;  4PJO A;  4ME7 A;  2VXE A;  4V2S A;  3MP1 A;  2R58 A;  2V8I A;  5GAN 2;  1Y07 A;  2LDM A;  4PLL A;  3CD6 A;  2CGH A;  2IVW A;  2PVD B;  3PT9 A;  4M78 F;  2LT4 A;  3CC4 T;  3AHU A;  2FYK A;  1WNL A;  2DZ9 A;  4IUU A;  5LJ3 j;  4ZGD B;  3CPF A;  5LJ3 d;  3OYC A;  5DLO A;  4A4K A;  4EPC A;  2L89 A;  4A54 A;  3CCS A;  1RI0 A;  3WVD B;  1YI2 A;  3CPW A;  2DIG A;  1N8R C;  1JJ2 S;  3JB9 H;  3OYD A;  2EQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...