4HCZA

Phf1 tudor in complex with h3k36me3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 1
total genus 11
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4hczA00
2E6NA 2JTFA 3OMCA 3PMIA 3OS1A 4IURA 2RHIA 4PL6A 3DB4A 2XK0A 4PLIA 3O8VA 4C5HA 3DB3A 2K3XA 2RHZA 2RJEA 3QIIA 4NS5A 3OY9A 3OYGA 2LVMA 2X4XA 3OMGA 3OA6A 3OYDA 4IUVA 1XNIA 2L89A 3FEOA 4B9XA 5FRMA 3Q1JA 4E7IA 2NLUA 2XDPA 2RI3A 4LD6A 3L2VA 3FC3A 3OYCA 3MP6A 3OS2A 2R58A 4BDZA 4B9WA 1OYXA 4N4GA 2EKOA 5C6SA 2EFIA 4BE0A 2EQUA 1WGSA 4IUUA 4QW2A 3UT1A 2BUDA 4IUPA 3S6WA 1MHNA 3NTKA 3NTIA 2FHDA 3QKJA 4BE1A 2EQKA 3ZEHA 4E7JA 3KUFA 4IKFA 3MEAA 4IUQA 2RHYA 1OI1A 3BDLA 3L2UA 1WJRA 4BE2A 5D6YA 2L8DA 3P8HA 2CKKA 3OYIA 3LYIA 3EAEA 2PQWA 2R5MA 2L3RA 3PMTA 3L2RA 3S3OA 1H3ZA 4QVZA 2RO0A 3H6ZA 1SSFA 3OYEA 2EQMA 2RHUA 5IAYA 2O4XA 5KCHA 2HQEA 5FRNA 3MEUA 4BD3A 2G3RA 3OYMA 3OYFA 3MP1A 4BDYA 3QJ6A 4UC4A 5J39A 3P8DA 2M0OA 2P0KA 2VYTA 3LH0A 4A4FA 5M9OA 3OYLA 4N4IA 2IG0A 3OQ5A 3SD4A 5C0MA 2RHXA 2R57A 2LDMA 2MWPA 4PLLA 3FDRA 2O4XB 5D6XA 1RI0A 4QQ6A 1OZ3A 4FU6A 3F70A 4RG2A 2X4YA 4CRIA 3OYAA 3H8ZA 3LGLA 2LCCA 2BKDN 5CIUA 2RJDA 2WACA 4IUTA 3MO8A 2MWOA 4A4HA 4OVAA 4C5EA 5IN1A 3NTHA 4II1A 3ME9A 3C4SA 4E7LA 1KHCA 2HQXA 4BACA 3S3MA 2RJFA 5KE3A 4FL6A 4N4HA 4L59A 2RJCA 2D9TA 2QQSA 3L2QA 3META 3QBYA 4EDUA 4C5IA 3OYBA 2E5QA 2RI2A 5J26A 1G5VA 2DIQA 3OYHA 4ZTFA 3MEWA 2DIGA 5D6WA 2GF7A 3L2WA 1OZ2A 2DAQA 2M1HA 4GY5A 4Z02A 2BIVA 3GOXA 3PFSA 3E9GA 5FROA 4C5GA 1WJSA 4Q5WA 3FLGA 2M16A 4A4EA 2GFUA 3OYNA 2R5AA 3L42A 3OYJA 3OS0A 4E7KA 2LTOA 3OB9A 3M9QA 3E9FA 4QQDA 5KE2A 4QQGA 3LX7A 3OYKA 3DLMA 3MEVA 2X35A 2X4WA 3UWNA 2RI5A 4X34A 4E7HA 3CEYA 3S3NA 3LLRA 1WJQA 2QQRA 3LGFA 2JZ2A 2YRVA 3ASKA 4ZTJA 5KCOA 4HCZA 3MP8A 4A4GA 5KH6A 2B8AA 2F5KA 1N27A 2LRQA 2EQJA 2K3YA 3PNWC 2GFAA
chains in the Genus database with same CATH superfamily
2K6DA 2M0YA 4M78E 4C5HA 1N9SA 2RHZA 3DB3A 3JB9D 5A2QE 3SWNA 1PRLC 3ZFJA 1X27A 4IIOA 4C8QB 4E7IA 4JUVA 3QYGB 3L2VA 3VJPA 3MP6A 2EYYA 3PE0A 3VYHB 4B9WA 3I55T 1QVFP 3CCVA 1MHNA 2J6OA 5GAMd 1AWWA 1N8RC 4IKFA 2F5TX 1I5LA 2P0QA 2YT6A 4X9CA 2AK5A 4BE2A 2QI2A 2OJ2A 3LYIA 2RB6A 2NUPB 4L6V5 1RAAB 1VQPQ 4KGVB 2XD0A 5FRNA 1YJ9Q 2AKLA 3I55A 4UC4A 1WFWA 5J39A 3EGDA 4DEXA 2KBTA 4E2FB 5C0MA 2PUOB 3SWNC 3FDRA 2DRMA 4J6XA 4OP0A 5CKFA 4XAXB 2WACA 1ABOA 4OMNA 2FRWA 3MJXA 3RESA 2PNIA 1S72A 4CC3A 4J9FA 1I07A 3QDRB 3OYBA 2D8HA 2X51A 1N5ZA 3FRNA 5FU6C 2EPDA 3AHUA 4M7AC 5GAN7 1NYGA 3MHXA 1X6OA 3CC4Q 2DBMA 1X2KA 1WJSA 2M16A 4M7AG 2DNUA 2C0IA 2JMAA 2KT1A 2KVQG 3THKA 3UA6A 1WPYA 1KQSS 3KXTA 3LX7A 1WHHA 4X34A 2KXCA 2X9HA 2YRVA 3GNGA 2O9VA 2K2MA 1UGPB 5A0GA 1Q86C 2QA4T 1K8AU 4RMOA 8AT1B 4CC4B 4TVRA 1VUBA 2MK5A 3EFOA 3RBBB 1ZUUA 1M5Q1 4E47A 3RDVA 2DVEA 1IREB 1Q86U 1RI9A 5KYUA 1BI3A 2VV5A 3HSBA 2F2XA 4XTYA 3OS2A 4PFPA 5GMKh 4J83A 3UT1A 2RM4A 4V2SA 2ZCFB 2YRDA 1JB0E 3NTIA 3G6ET 3L1AA 2QASA 3KUFA 4KH0B 1RLQC 2KDSA 3CCLA 3L2UA 3VU3C 4M77A 3JCMh 4PJOE 3VS6A 2L3RA 1VQNA 3S3OA 4ATOA 2DMOA 3NFCA 3H6ZA 2EBPA 4JRQA 3CCMQ 1OQKA 9ATCB 1X2QA 1RL2A 3A8HB 3SWNB 1QWEA 1VQ6Q 4FSXA 2LCLA 2X3WD 4HVVA 3CPWA 3OYAA 2X4YA 3J80E 1MMGA 1I8FA 4C92G 2DL8A 3UA7A 4DQ2A 2GNCA 3E1SA 2DEQA 2HQXA 4LDVA 1FMVA 4N4HA 3JCMg 1YCSB 1ZQ1A 4NL3A 1VQ6A 2ENMA 3RKYA 3G71T 4ESRA 4CC2A 2YRCA 2DIGA 1QKXA 4DBFA 4A4EA 2IPOB 2YUQA 3CCRQ 3C94A 3E9FA 4A54A 1VQ7T 2DJQA 1PKTA 3TEEA 3CC2A 2L5QA 2EJGA 4E7HA 1QP2A 1WJQA 5KYXA 1UHFA 1QVGS 3EGUA 1BIAA 2ZPFB 3CXCS 2EQJA 4PL6A 3CBMA 1BIBA 1AZEA 1KQ1A 1OPLA 1RAIB 4OMFB 5GAOr 2DBKA 1KSWA 4PKCC 1NBEB 5GJWB 2ZPBB 4XU1A 4MZPA 1WHGA 2XDPA 3M53A 2K5FA 3FC3A 2K4YA 2MYSA 4BDZA 1YJNT 3I56Q 4BE1A 1AEYA 2DM1A 5CAIA 4N0AA 1VQPA 5I11A 1P92A 3GNFB 3OW2S 2V8KA 4B6MA 4M77B 2RHUA 4LNPA 4LN2A 4M75C 4A4FA 3OYLA 3EGXA 3JCMJ 3SDZA 1H8KA 4ME7A 4J9IA 4M77D 1M90U 3RERA 1PSFA 1KC8U 1PM3A 3QUIA 5KYUB 2L3QA 1V1CA 3VS4A 2KE9A 5CIUA 1VQ7Q 3EG0A 5GAN8 4II1A 1NJIR 4DOVA 1XQHA 5FU7C 1G3YA 4HA8A 2E5QA 2DYIA 3HFOA 4EMKC 1KK7A 2MI6A 1N8RR 2GF7A 1OZ2A 1Y71A 4Z8AA 2G6FX 3JAME 1TXQA 1LOJA 4OMPA 1VQNQ 2FPFA 2V1QA 2DTHA 3JCMe 3L42A 1YFNA 2LNHB 1BI2A 2VVKA 4LUEA 3OYKA 2JTEA 2HL5C 2VXFA 2X35A 3S3NA 3QZ5B 1U3OA 3CCQQ 4ZTJA 3ASKA 4HT9A 1NPRA 3HRTA 1Q7YR 2LP5A 2EWNA 1YJWA 1U1TA 3P8BB 3EG2A 2K57A 2PVOB 3CC2T 1PSEA 3JRZA 1WI7A 2V26A 1T0JA 2O2OA 1ZHIA 7AT1B 1OPKA 4MDXA 1Q81R 1D09B 4FT4A 5KYWA 3GLXA 3RMQA 4M7DF 3U23A 1E6HA 5LJ3f 3EG1A 2RHYA 2NUPA 4M77C 1KJWA 4BI4A 3OW2A 1X6BA 1ZUKA 4RTYA 1SSFA 2ZPHB 1PD1A 2EQMA 1N6AA 1O9SA 3KFVA 1TUDA 2FZCB 3EG9A 1JU5C 3QJ6A 1YITQ 2HQHA 2RQTA 2VC8A 2LNVA 3I5RA 2FL7A 1JRIA 1NEBA 3T9NA 2VASA 3REAB 3CD6A 4M7AA 4FU6A 3SHWA 1TH7A 2BKDN 2H3JA 3VRZA 1MGQA 2ESWA 2CYZB 3CCRT 4C0FA 1VA7A 4HCCA 2HEQA 2ZZDA 4FL6A 3UF4A 3QBYA 2WSEE 2K2VA 5CVIA 2JMCA 1G5VA 2DIQA 2DTIA 2QGGA 3R6NA 4HT8A 1NE8A 4L5GA 1YIJT 1ZBXA 3PFSA 3VRYA 1VQ7A 3CCLQ 4WF2A 3A1PA 2GFUA 3OYNA 1NG2A 3RR6A 2OTLA 2DLPA 2VB6A 2JOYA 1NM7A 3OS5A 3VUZA 2V1RA 3V7RA 1UFFA 1MMDA 1PNJA 3CCQT 4R56A 1VQMQ 2J05A 2DFUA 1X69A 2NUTA 4KRTA 2YLCA 4IURA 3NGPA 4A4KA 1Q82R 2J6FA 2FVUA 2FZGB 3RKWA 2A28A 2E3HA 4C92C 1ZA1B 4X9DA 1YIJA 4B9XA 3L2ZA 1FMKA 3Q1JA 4C0DC 3QDFA 1M8MA 2XDBA 3CCEA 2EKOA 3WVEB 2EQUA 2I0NA 4HVWA 4FCYA 4HCKA 2FHDA 5EC7A 1SPKA 2OTJQ 3OSSC 4OMOA 4QVCA 1W70A 4F17A 1FYNA 3VS7A 3CD6Q 5D6YA 3V7CA 1VQ9T 1M1GA 4MZTA 3G4SA 1H3ZA 4PJOA 5IAYA 1GL5A 2YSQA 1VQOT 2X3XD 4F04B 2L3PA 2P0KA 2VYTA 3LH0A 2DILA 2VGMA 1G2BA 5HCKA 1H3HA 2R57A 3JV3A 4PLLA 3M4YA 3CXCP 2O4XB 4FYXB 4ZN1A 1PHTA 4N0AC 4F16A 3VYGA 1M30A 4C5EA 1HJDA 2P4TA 5I21A 3JCMQ 1JBMA 1M2VA 1ZX6A 2K5IA 3CCEQ 4C5IA 1H641 1JXMA 1TSFA 5GANf 2COZA 2DXUA 1QVFS 4Y91A 3CCRA 1OEBA 2XMFA 1EFNA 5DY9A 4M7AB 2JS0A 4FYWB 2R5AA 3I5SA 3M0SA 3M56A 2LTOA 3OB9A 3I35A 2OX7A 5KE2A 1SHFA 2P0PA 1QVGP 3M5AA 4FYVB 4LXCA 1Y07A 2EAYA 4J6YA 1RAFB 5KCOA 4HCZA 1M8VA 1IGQA 5KH6A 4AFSC 3J81E 2XHCA 1K0XA 5FU6B 5GANg 1LCKA 1S72Q 1PRMC 3QIIA 4OF1A 2OTLQ 2VXEA 4XTWA 2QGFB 4KULA 1G3TA 3OSVA 1VQ8Q 1TUGB 3QHSA 3FEOA 5FRMA 3G71Q 4Y92A 2JT4A 5KYWB 4JZ3A 2CP7A 2LQNA 4AFUC 2CREA 1MNDA 4ANJA 2F2WA 1ACMB 2JXBA 2BTTA 3N5BB 1HSQA 1YJ9A 4JRPA 5LJ3j 4R0KA 1QCFA 3MEAA 1KD1U 2DL7A 2DTOA 5CKEA 2HDAA 3EH2A 3RUXA 1QLYA 2AZSA 2RNAA 1YP5A 4M7AF 3OYIA 1M90R 1ZA2B 3UATA 8ATCB 2A08A 2LT4A 2RPNA 4GBQA 4QKUA 2QTVA 1JJ2A 2KEAA 5M9OA 1UG1A 2IG0A 1F1BB 4PK4A 3JB9H 1XOVA 4M78A 3EHQA 1KC8C 2OTJT 2CS7A 4PJOD 2RJDA 1VQOA 4A4HA 2KSSA 1X43A 1BBZA 1AZGB 1M3BA 2RI2A 5J26A 1AT1B 1G8XA 2GBQA 1R8OB 4Y28E 3ER0A 2A3LA 4C8QE 2DAQA 1AOJA 2M1HA 4GY5A 2RQRA 1U1SA 4RCCA 1B3QA 1UGRB 3CCST 1K73C 1VQ8A 3OYJA 2EYZA 5I2MA 1ZSZA 4J9EA 4QQGA 3CCUQ 4J9HA 3CEYA 3D7SB 1VQ5Q 1KQSP 5GANd 1LPLA 2MF2A 3CMEQ 1YBYA 1GRIA 1K8AC 4D8KA 1UTIA 3OYYA 4GLMA 1KG1A 1I5OB 5GAOl 3QXEB 2VKNA 1M1KC 4IUVA 2KXDA 4LD6A 5GJVB 5GANe 2IVWA 3RMSA 3NTKA 4J7IA 2V8IA 2OAUA 1K9MC 2FO0A 2CDTA 4XU0A 3HHTB 2NYSA 4ELYC 2LJ0A 3JB9F 1OV3A 2E64A 1LJOA 1K9AA 4QVZA 1M2OA 4M75G 3HKSA 2DVJA 3M59A 4C8QF 1YHQA 1S72T 5GAOn 5CKDA 1PG5B 3CMEA 4M78C 4N4IA 2QQ9A 4OB0B 5CKHA 1WHJA 2KT8A 3M0RA 4M75F 4P5NA 1D3BA 3CPWS 4RG2A 4XTZA 2MIOA 4ZN3A 1YCYA 5IN1A 2I2LA 2DRKA 5GMKi 4BACA 4L59A 1G3WA 2RJCA 1SRLA 2K5LA 3L2QA 4J7FA 3CC4T 2DX1A 1WYXA 1SF9A 1JJ2P 1KHIA 3A8LB 2RH2A 2HBWA 2QG9B 1NYFA 2JUFA 4C92B 2KY9A 2GTOA 2RQVA 4E7SA 2GTJA 5IT9E 3DLMA 2O01E 2QTXA 1FWZA 4PJLA 3VS0A 2QQRA 3LGFA 1IHVA 1K0SA 1MMAA 3GF5A 3CC7T 2ECZA 1T0HA 1AHJB 4C8QD 2JTFA 3PMIA 1EX4A 3DKMA 2LJ1A 3DB4A 2ZGWA 2XK0A 3G6EA 3VS2A 4J9BA 2LVMA 4GLKA 2DZCA 1GFCA 1W2BP 2QDLA 5GMKe 2RI3A 3OBYA 1UDLA 5J3BA 4JZ4A 3OW2P 4JPBW 2AZVA 5GANh 4PJMA 1I0CA 1M3CA 4FIBA 5LJ5e 2BZXA 2QQBA 3EFOB 2RD1A 4O6JA 2D1XA 3CQTA 4F7UA 5CR2A 3X28B 2L8DA 1RUWA 1VIFA 3EAEA 2LQWA 4ELZC 1ARKA 1YJWQ 3A5ZB 2P84A 2X4JA 3INZA 3OQ5A 6AT1B 3SD4A 1VQMT 2MWPA 2PTKA 3FJ5A 1M4ZA 3A8OB 2J7IA 2QEXA 3LWHA 1QMCA 1JXOA 2RJFA 1FMWA 5HKCA 2ZPIB 4KUDK 4E6RA 1YI2A 3FIFA 3H41A 4CI0C 3MEWA 3VV0A 3QPHA 2DYBA 1VQ8T 3A8GB 1IHWA 1OULA 3WXMB 2DD4A 1VQLT 2B86A 4E7KA 4C0GA 3QSUA 1BCMA 4FM4B 1E6GA 3EGDB 2FPEA 5LL6S 5CQXA 1YI2Q 2DEUA 4M7DB 1K1ZA 1BCOA 4A4GA 2KR3A 3TSWA 1YJNA 3PNWC 3E2UA 2KRNA 2EJ9A 2A7YA 2L2PA 2DETA 3PVLA 2KYBA 5GANj 1G3SA 2VWFA 3CCJQ 3M0TA 1Q7YC 2DD5A 1Q82U 3J7AF 3GP8A 1IB8A 5GMKl 2JM9A 5FW9A 4J9CA 3JSCA 2DL4A 2NLUA 3TSZA 3CCVT 3ZBDA 2CGHA 1OYXA 2PUKB 4BE0A 1UE9A 4M75B 1D0XA 3HFNA 4C8QA 2D0NA 3GIBA 1SSHA 4BB7A 2BE7D 3SB2A 5LJ5h 2E10A 1JJ2S 5FU7B 4Z88A 2YUOA 3A8MB 3A98A 4RTZA 1R0BG 2PQWA 3PMTA 4KUIA 1D0YA 2O4XA 1MUZA 4HKEA 5KCHA 2FB7A 2DPPB 2P4RA 1VQ9Q 1SG5A 2RMOA 3MCAB 2Y4YA 2LDMA 2DL5A 3H9NA 4QQ6A 1ZSGA 5AYFA 3CC4A 2HD0A 2HAXA 3G4ST 1B34B 4XTXA 5DLQE 4ZTFA 1GXIE 5KYYB 2E6ZA 4M7DC 2CP2A 1NLPC 1GCPA 3QWYA 2OTLT 1DJ7B 1PD0A 2BZ8A 3WVDB 2F1LA 4AT1B 1R77A 2QA4Q 5D7UA 4F14A 4EMHA 1IO6A 1N8RU 3BE3A 5FLXE 1NJIC 1WHKA 2JW4A 1C6VX 1YITA 1VQ5A 3M57A 1KD1C 1JQQA 1VQLQ 4JRIA 3JB9J 4NS5A 5LJ5g 5LJ3h 1BI0A 3OYDA 1IGUA 2COYA 1GBRA 3QO3A 3CMAA 2R58A 1V76A 4DBQA 4C92F 1VQ9A 2ROTA 2SRCA 2EKHA 3I56T 2ED0A 4EIKA 2QK0A 1QVGA 2HMAA 3CBPA 2MCNA 2D8JA 1IRXA 4M77E 1K4US 4M75A 1YITT 5LJ5f 5GAN5 1RAEB 3MEUA 4OGCA 1VQ4Q 1AD5A 4A63B 2QEXQ 4JDSA 3JCMV 3EG9B 2EIFA 3HL8A 3H8ZA 3LGLA 5HK3A 3V8JA 4IUTA 4HXJA 2MWOA 2ROLA 1K73R 2L0AA 2YUPA 4M7DA 4M7DE 2E4HA 2KAFA 4M7DG 2K7AA 5GAMf 2MOXA 3G71A 2OTJA 5GAN2 3NHNA 1UGVA 2EJFA 2XI9A 5EG2A 2F69A 3HRSA 1WA7A 4M78F 2CH4A 2X4WA 2CZ6B 3LLRA 1PKSA 1QKWA 3QG1A 2EYXA 3CCUT 4RTUA 3VKIA 2GFAA 1TS9A 1ABQA 1U8RA 1VQOQ 2RJEA 4HCBA 3HP9A 2HSPA 3G7ZA 4JLIA 4EMKB 3JB9I 2RN8A 5IHIA 1OU8A 2ED1A 2CUBA 2XKOC 3LWIA 2QQAA 3IQLA 2DE0X 3NMZC 1B07A 4DBHA 3OYCA 4E7ZA 3ULRB 3X20B 3M0PA 1WGSA 1LVKA 4IUUA 1MV0B 1TUCA 3CCUA 1OI1A 4BUGA 1WXTA 1KQSA 2MMPA 5LJ3d 2EYQA 2O31A 3V8KA 3VS5A 5GAOm 2DL3A 2DJZA 3CCQA 3PVQA 1M90C 3EGXB 1I1JA 1JEGA 2LQKA 2RHXA 2F2VA 4ZGDB 1VQKQ 3M54A 4KH1B 1RI0A 1IZ6A 1HD3A 1D1BA 5AT1B 2QAZA 3V8LA 4FW2A 4OB2B 4JS5A 3CPFA 5LJ5d 2HKNA 2JTMA 3EHRA 2C06A 2D9TA 2CP5A 1UEBA 4MZMA 1Q86R 2JNGA 4EDUA 4PNOA 2DXBA 1HYOA 1NEGA 2ZAEA 1WXBA 3L2WA 2BZYA 3GOXA 5FROA 3E9GA 1QVFA 4PJOF 3QWXX 2PVGB 4OMQA 3OS0A 3CCSA 3M9QA 4QQDA 3GBQA 1W6XA 4M77F 4OGEA 1TU0B 2LCSA 1VQ5T 2YUNA 4XU2A 1Q81U 1YN8A 3URGA 1T3SA 4LD9K 2E6NA 3OS1A 5IHNA 2RHIA 1M1KR 4FSSA 1D3BB 4PLIA 2EGCA 2XDDA 1YJ9T 4M7AD 1KQ2A 1WZOA 5KYXB 2E12A 3REBB 4RTTA 1YJWT 1B34A 5IHKA 3OMGA 2E41A 2CP6A 1TOVA 3LH5A 3CMAT 2CZ0B 2EVRA 5FWCA 2DA9A 5GMKm 2C0TA 1Q7YU 1YWOA 3FB9A 1BKBA 2YHTA 2J06A 1E7OA 2O9SA 3PIOA 2COWA 1K73U 2DK3A 3C0CA 4OB3B 4IUPA 2LX9A 4E7JA 1WIEA 1XJWB 4PJOC 2HKQB 4IUQA 4PJJA 3M0QA 3MPUB 4LDWA 1EZZB 1VQ6T 5ECAA 3P8HA 2FRYA 3L2RA 2LZ6B 1YHQT 1Q95G 3LW5E 3OYFA 3MP1A 4BDYA 3JCMW 3NPFA 3TREA 3X25B 2KROA 1R0CB 3CMET 2RF0A 1M9SA 1H92A 2M9UA 3EFRA 3CC7Q 1OX9A 4JJNK 3DLLA 5D6XA 3F70A 3VUBA 4CRIA 4IIMA 2FPDA 4O5VA 3I9QA 2KK4A 4OVAA 4F7UF 5LJ3e 4BY6C 3NTHA 5I22A 3ME9A 1YJNQ 1VQ4A 1M3AA 1BYMA 2QQSA 1Y7XA 3JCMX 4C92D 4AFQC 5GAOq 3OYHA 2AKKA 2Y90A 5D6WA 1Y96A 5GAN6 2BIVA 2DZ9A 4CC7A 2RQUA 2LJ3A 3G4SQ 2D0QB 2NWMA 5GAMh 3G1JA 3RIRA 2EQIA 2ATCB 2EYWA 2RI5A 4J8OA 2JS2A 5GAMe 4MMLA 3GPLA 1QWFA 2WSFE 3MP8A 1N27A 1SKUB 4BI8B 2LRQA 2K3YA 1VQ4T 4OB1B 2QA4A 5CO7A 2EGAA 5HY6A 1SHGA 4J9DA 1WNLA 2X4XA 1VQLA 5LJ5j 5GMKj 2DXTA 4RTXA 1M1FA 3JCMb 4AG1C 2RA2A 1UUEA 2CZ1B 1S1NA 3QYHB 2EFIA 2FZKB 1BU1A 1AWXA 1UECA 3C95A 3M55A 3QKJA 3SFMA 1O75A 5CQYA 4RCBA 2LX7A 3EG3A 3V7SA 1RAGB 1AVZC 3TCJA 5KYNA 1RLPC 1FXXA 5GAMj 4LUDA 1A0NB 1Y0MA 4ZGEB 4KGXB 4XK8E 2R5MA 4M75E 1WDXA 1NPPA 4R55A 2H3EB 2KRSA 2KNBB 1UJ0A 4F7UB 2BE9B 1XTDA 2MPXC 1VQMA 3PTAA 1X01A 2KRMA 4QT7A 2RQWA 1ZBJA 5GAMg 3M4GA 4RKUE 1OZ3A 2CSIA 1YI2T 2Y4XA 3JCMP 3AT1B 3VS3A 4BY6B 1K9MR 1Y96B 2XIDA 4XQ3A 1AWOA 3C4SA 1N9RA 5GAOp 4C8QC 3I56A 2NUZA 2GGRA 2HL3A 1QW1A 1YNZA 3FLGA 3CC2Q 1Y57A 2V8JA 4LE9A 1KD1R 4DA4A 4C92A 1M2VB 1K9MU 2SEMA 2JZ2A 1MNEA 2YLBA 4PFZA 3SEMA 4OMLA 4HVUA 3E19A 4FYYB 2L3SA 5IXFA 3OMCA 2CUDA 3CCMT 4PJNA 3UPUA 3CCSQ 1D0ZA 3CCLT 1TWBA 1VYTA 1WHMA 4NL2A 1Z9QA 2HCKA 3CD6T 1XNIA 2L89A 2O88A 1SRMA 1CKAA 3M58A 3CBOA 4J6WA 2E65A 1WLPB 5IH2A 2DO3A 1PC0A 3CPWP 5C6SA 4JS4A 2DKGA 3HRUA 4QW2A 2IIMA 4Z89A 1UJYA 5GAN4 3UDCA 1VYVA 4LDYA 5DM7R 3C12A 2HBPA 2PU9B 3JCMd 2HSEB 1M27C 2GCXA 3TU4K 1X75C 3BDLA 1WJRA 1D1CA 3JCMf 2CKKA 2HNIA 1IXDA 3KBGA 2RO0A 4WCIA 2FYKA 1OX8A 2HQEA 4BD3A 2HZYA 1CKBA 1VQPT 3P8DA 2M0OA 4M77G 4RUGA 1NZ9A 1QCNA 3JCMc 4FW1A 4PJOG 2AHJB 1K8AR 1OOTA 2PZ1A 3EH1A 4J9GA 5I2SA 1W1FA 3QJYA 2NUTB 1RAHB 4XU3A 3S3MA 4VUBA 2GQVA 1D1AA 1MMNA 3PT9A 5DLOA 2DF6A 1J3TA 1AWJA 2OI3A 2E1HA 3MKDA 2DXCA 3BY7A 1X6GA 1I81A 2JN0A 1ZSZB 3ZL7C 1CSKA 5FWBA 1G83A 2EGEA 4DOWA 1QP3A 2QEXT 4MDWA 2DERA 1WX6A 4JJCA 2OAWA 2K3BA 1QVPA 2CP0A 1KC8R 3O8VA 1HXDA 2XU8A 2K3XA 1WQ7A 3OY9A 4M78D 2VGNA 1MV3A 4BI3A 4M7AE 1ZUYA 1NJIU 5IXBA 4MMKA 3OA6A 4LDUA 1RADB 2RK2A 2LQ8A 3TVTA 2M51A 1M1KU 4M78B 2A0FB 1Q81C 2BUDA 3S6WA 4M4ZA 3X26B 3RNJA 3BW1A 5A0LA 4C0ZA 4EMKA 3I55Q 2EQKA 4AFZC 4NOYA 3H0HA 3QZ9B 2LC4A 1NLOC 2AT1B 4M75D 1KIKA 4KGZB 3X24B 1U06A 1PCXA 2EW3A 2JM8A 3PGGA 2K79A 1VOMA 2G3RA 2XICA 3OYMA 5CKBA 1GCQA 2CSQA 1YHQQ 4AG2C 1OU9A 1FX7A 4M78G 1V29B 1I4K1 4XTVA 4ZNXA 1SEMA 2CZ7B 2ABLA 4JLGA 2M02A 1BI1A 4WTOB 1W2BA 2KYMA 1T3LA 4ZGJB 2LCCA 3BDUA 3MO8A 2QXFA 1W2BS 5KE3A 4DBRA 4M7DD 1WQWA 1YWPA 2W0ZA 3CCVQ 2D6FA 1B7TA 1C1AA 4EMGA 3CCMA 1RABB 3CMAQ 1ZLMA 4Z02A 3HTRA 3CCJT 4JJBA 4Q5WA 4JJDA 2QDYB 2Z0WA 3CC7A 1UGQB 3MEVA 3UWNA 1VQKA 2C0OA 2RK1A 1KFZA 1GBQA 2LT1A 1Q82C 1WHLA 3PIPA 4D6WA 2F5KA 2FG0A 4RG8A 1C0MA 4DEYA 1VIEA 2JVVA 3OBWA 4LDXA 2H8HA 4PFOA 3OYGA 1YIJQ 5HK0A 1U5SA 1Z9ZA 2MAMA 2CT3A 1K76A 3CCJA 3CCET 4F7UG 4FT2A 2WSCE 4N4GA 2CT4A 4A53A 4C0DB 4KT0E 3HPWA 2ZPGB 1TTHB 3ZEHA 4RTVA 5CK9A 5L8RE 4JRKA 1VQKT 2A36A 2KQWA 4F7UE 2PVDB 3M0UA 4PJOB 1LNXA 1PWTA 1GCQC 2FEIA 2GQIA 3OYEA 4D8DA 2E5KA 2YDLA 2CP3A 2YXYA 3FJPA 4X1VA 5L23A 1HK9A 1TG0A 2QYZA 1ZSZC 3H0FA 5CCAA 2CH4W 1W4SA 3G6EQ 3VS1A 3CXCA 2LMJA 1EIFA 5KYYA 4E7LA 1KHCA 2XG8D 1VQNT 2KGTA 2E3IA 1QQJA 2KI7A 3META 2AIRB 2JJ9A 3R6OA 5GAN3 3RKXA 2J6KA 4OMMA 4C8QG 3O5ZA 4KBMB 4AMCA 2E70A 4RTWA 4C5GA 2KMTA 1RACB 3JB9G 3H0IA 1UB4A 1BK2A 1WXUA 2YWWA 4YTLA 5A0DA 1QCOA 2VUBA 1UHCA 2W10A 4J5YA 2ZPEB 1VYUA 2A37A 1UGSB 4C92E 4ORZA 4XTUA 3EFSA 4EPCA 2K9GA 1GFDA 1BB9A 4QVDA 3BFMA 2B8AA 4K11A 3TQ7P 1JO8A 5LJ3g
chains in the Genus database with same CATH topology
2EJ9A 2A7YA 1VQ4T 4IURA 4OB1B 4A4KA 4M78E 4C5HA 5GANj 2QA4A 1N9SA 2RHZA 1G3SA 3DB3A 5CO7A 3JB9D 5HY6A 1Q7YC 2FVUA 1WNLA 2X4XA 5A2QE 2DD5A 1Q82U 3J7AF 3RKWA 3GP8A 3SWNA 5LJ5j 5GMKj 3ZFJA 5GMKl 1VQLA 4C92C 2DXTA 4C8QB 4X9DA 1YIJA 3JSCA 4B9XA 3L2ZA 3Q1JA 4E7IA 4JUVA 1M1FA 2NLUA 3QYGB 4C0DC 3JCMb 3L2VA 3CCVT 2RA2A 3MP6A 3VJPA 3ZBDA 2CZ1B 3VYHB 2CGHA 3QYHB 1OYXA 4B9WA 3CCEA 2EKOA 2PUKB 2EFIA 3I55T 4BE0A 4M75B 3WVEB 2EQUA 3HFNA 3C95A 3M55A 4C8QA 3CCVA 1MHNA 3GIBA 2FHDA 3QKJA 5GAMd 4BB7A 3SFMA 3SB2A 5LJ5h 1O75A 2E10A 1N8RC 5CQYA 1JJ2S 4RCBA 5FU7B 2F5TX 3OSSC 3V7SA 1I5LA 4QVCA 2P0QA 4M7DD 3TCJA 4X9CA 4BE2A 5D6YA 1FXXA 2QI2A 3V7CA 5GAMj 3A8MB 1VQ9T 4ZGEB 3LYIA 2PQWA 1M1GA 2R5MA 2RB6A 3PMTA 4KUIA 4M75E 1NPPA 4MZTA 4XK8E 3G4SA 4R55A 4L6V5 3RERA 4PJOA 5IAYA 2O4XA 5KCHA 4HKEA 2XD0A 2FB7A 5FRNA 4F7UB 2DPPB 1XTDA 3I55A 1VQOT 4UC4A 5J39A 2P0KA 2VYTA 3LH0A 1VQMA 3PTAA 3MCAB 1X01A 2VGMA 5C0MA 2Y4YA 2PUOB 3SWNC 2R57A 2LDMA 4PLLA 5GAMg 3M4YA 3FDRA 2O4XB 3M4GA 4J6XA 4QQ6A 4RKUE 1OZ3A 4OP0A 5CKFA 1YI2T 2Y4XA 3JCMP 4ZN1A 4BY6B 5AYFA 1Y96B 2XIDA 2WACA 4N0AC 4XAXB 2HD0A 4XQ3A 3CC4A 3VYGA 4C5EA 2P4TA 5I21A 3JCMQ 3C4SA 2HAXA 3G4ST 1JBMA 1N9RA 3RESA 1B34B 4XTXA 1S72A 5GAOp 2K5IA 5DLQE 3QDRB 4C5IA 4C8QC 3OYBA 3I56A 1H641 5GANf 4ZTFA 1GXIE 3FRNA 5FU6C 3AHUA 2E6ZA 2DXUA 1QVFS 4M7DC 4M7AC 5GAN7 4Y91A 3CCRA 3MHXA 1QW1A 1X6OA 5DY9A 2LRQA 4M7AB 2OTLT 1WJSA 1DJ7B 3FLGA 2M16A 4M7AG 2V8JA 2R5AA 3M56A 3WVDB 2KVQG 2LTOA 3OB9A 5KE2A 1WPYA 2P0PA 4EMHA 3KXTA 3LX7A 1KQSS 3M5AA 4DA4A 4C92A 4X34A 1K9MU 1N8RU 1Y07A 5FLXE 1NJIC 2EAYA 2JZ2A 2YRVA 4J6YA 2YLBA 3GNGA 5KCOA 4HCZA 1M8VA 5KH6A 1UGPB 5A0GA 1YITA 3J81E 1Q86C 2XHCA 3E19A 2QA4T 1VQ5A 3OMCA 3M57A 3CCMT 1K8AU 4RMOA 5FU6B 3UPUA 1KD1C 5GANg 4JRIA 4TVRA 4NS5A 3QIIA 4OF1A 3JB9J 3CCLT 1VUBA 2VXEA 5LJ5g 4XTWA 1M5Q1 4NL2A 5LJ3h 4E47A 4KULA 1G3TA 1BI0A 3OSVA 3OYDA 3QHSA 1XNIA 2L89A 2DVEA 3FEOA 1IREB 1Q86U 3CD6T 5FRMA 3M58A 3CBOA 4J6WA 3QO3A 2VV5A 1BI3A 2E65A 3CMAA 3OS2A 4XTYA 3HSBA 2R58A 2DO3A 5C6SA 4C92F 4JS4A 1VQ9A 5GMKh 2DKGA 3HRUA 3N5BB 4J83A 4QW2A 3UT1A 3I56T 2RM4A 4V2SA 2ZCFB 1JB0E 3NTIA 3G6ET 1YJ9A 3L1AA 4JRPA 1QVGA 5GAN4 3UDCA 3KUFA 5LJ3j 3CBPA 3MEAA 4LDYA 5DM7R 1KD1U 2KDSA 3C12A 2HBPA 2PU9B 2DTOA 3JCMd 5CKEA 2GCXA 4M77E 3TU4K 3CCLA 1X75C 3BDLA 3L2UA 3VU3C 1WJRA 4M77A 3RUXA 3JCMf 3JCMh 4M75A 2CKKA 4PJOE 4M7AF 2HNIA 3OYIA 2L3RA 1VQNA 3KBGA 3S3OA 4ATOA 1YITT 2RO0A 3H6ZA 3NFCA 5LJ5f 4JRQA 2FYKA 2LT4A 5GAN5 2HQEA 3MEUA 4OGCA 4BD3A 5LJ3g 1VQPT 1JJ2A 3P8DA 2M0OA 4M77G 5M9OA 1RL2A 3A8HB 3SWNB 1NZ9A 2IG0A 4FSXA 4JDSA 3JCMc 2LCLA 3JB9H 3JCMV 1XOVA 4PJOG 2EIFA 2AHJB 4M78A 1KC8C 3HL8A 2OTJT 3CPWA 3OYAA 2CS7A 2X4YA 5I2SA 3H8ZA 3LGLA 4PJOD 5HK3A 3J80E 2RJDA 3V8JA 1VQOA 4IUTA 1I8FA 4C92G 3QJYA 2MWOA 4A4HA 2KSSA 4XU3A 4DQ2A 3E1SA 2DEQA 2HQXA 4LDVA 4VUBA 3S3MA 3JCMg 4N4HA 2GQVA 2XDBA 4M7DA 1ZQ1A 4NL3A 1VQ6A 4M7DE 3RKYA 2RI2A 5J26A 3G71T 2KAFA 3PT9A 4M7DG 1R8OB 4Y28E 3ER0A 2DIGA 2A3LA 4C8QE 5DLOA 5GAMf 2DAQA 2M1HA 4GY5A 3G71A 1U1SA 4RCCA 1UGRB 3CCST 1K73C 2E1HA 4A4EA 5GAN2 1VQ8A 2OTJA 2XI9A 2EJFA 5EG2A 3OYJA 2DXCA 3BY7A 3C94A 5I2MA 2F69A 3HRSA 1I81A 4M78F 3E9FA 2JN0A 4A54A 1VQ7T 4QQGA 3TEEA 3CC2A 2L5QA 2EJGA 2X4WA 4E7HA 3CEYA 2CZ6B 1QP2A 3LLRA 1WJQA 1QVGS 3QG1A 4DOWA 5GANd 1QP3A 1BIAA 2ZPFB 2QEXT 4MDWA 3CCUT 2MF2A 3CXCS 2EQJA 1YBYA 3VKIA 2GFAA 1QVPA 1U8RA 4PL6A 1K8AC 3CBMA 1BIBA 1KQ1A 1HXDA 2XU8A 3O8VA 2K3XA 1WQ7A 2RJEA 3OYYA 4OMFB 3OY9A 5GAOr 4HCBA 4M78D 3HP9A 2VGNA 3G7ZA 4BI3A 4M7AE 4PKCC 1H3ZA 5GAOl 4JLIA 4EMKB 1NJIU 3QXEB 3JB9I 4MMKA 1M1KC 2ZPBB 3OA6A 4XU1A 4IUVA 4MZPA 4LDUA 2XKOC 3LWIA 2QQAA 2RK2A 2XDPA 3M53A 2K5FA 4LD6A 2LQ8A 3FC3A 3OYCA 2K4YA 4BDZA 4M78B 1M1KU 3X20B 5GANe 1YJNT 2IVWA 1WGSA 4IUUA 1Q81C 2BUDA 3RMSA 3S6WA 3X26B 3NTKA 4J7IA 3BW1A 2V8IA 4C0ZA 4EMKA 5A0LA 2EQKA 4BE1A 4NOYA 5CAIA 2OAUA 4N0AA 1K9MC 1VQPA 1P92A 3CCUA 1OI1A 4XU0A 4BUGA 3QZ9B 1KQSA 2LC4A 2MMPA 3HHTB 4ELYC 4M75D 3GNFB 3JB9F 5LJ3d 2EYQA 3V8KA 2V8KA 3X24B 2E64A 1LJOA 3OW2S 1KG1A 4QVZA 4M77B 5GAOm 3PGGA 2RHUA 4M75G 3HKSA 3M59A 4C8QF 1YHQA 2DJZA 2G3RA 2XICA 4M75C 5CKBA 5GAOn 3OYMA 3CCQA 5CKDA 3CMEA 1S72T 4M78C 1M90C 4A4FA 1FX7A 3OYLA 4M78G 1V29B 4N4IA 3JCMJ 3SDZA 2QQ9A 4OB0B 2LQKA 1I4K1 2RHXA 4XTVA 2CZ7B 4ME7A 5CKHA 4ZGDB 4JLGA 4M77D 3M54A 1BI1A 1W2BA 4M75F 1RI0A 1PSFA 1D3BA 1IZ6A 4P5NA 4RG2A 3QUIA 4XTZA 3CPWS 1KC8U 4ZGJB 2LCCA 5CIUA 3V8LA 4ZN3A 3BDUA 3MO8A 4OB2B 1YCYA 5GAN8 4JS5A 3CPFA 5IN1A 4II1A 5LJ5d 2QXFA 2I2LA 4DOVA 2JTMA 1XQHA 1W2BS 4BACA 5GMKi 5KE3A 5FU7C 4L59A 1G3WA 2RJCA 2C06A 1G3YA 2D9TA 1WQWA 2K5LA 4J7FA 1UEBA 4MZMA 3L2QA 3CC4T 2JNGA 4EDUA 4PNOA 2D6FA 4HA8A 1KHIA 2E5QA 2DXBA 3HFOA 4EMKC 4EMGA 2MI6A 3CCMA 3A8LB 2GF7A 3L2WA 1OZ2A 1Y71A 4Z02A 2RH2A 3GOXA 3JAME 5FROA 3E9GA 1LOJA 3CCJT 4Q5WA 1QVFA 4PJOF 2DTHA 3JCMe 3L42A 2JUFA 4C92B 2PVGB 2KY9A 3OS0A 3CCSA 2QDYB 3M9QA 4QQDA 1BI2A 4M77F 4OGEA 1UGQB 3CC7A 3OYKA 2VXFA 5IT9E 3DLMA 3MEVA 2X35A 3UWNA 2O01E 2RK1A 1VQKA 2QTXA 3S3NA 1FWZA 2LT1A 3QZ5B 1VQ5T 2QQRA 3LGFA 1Q82C 4ZTJA 3ASKA 4HT9A 1NPRA 3GF5A 3CC7T 4XU2A 3PIPA 4D6WA 2F5KA 3HRTA 1Q81U 1AHJB 2EWNA 4C8QD 1YJWA 3URGA 1U1TA 3P8BB 4LD9K 2E6NA 2JTFA 3PMIA 3OS1A 4RG8A 4IKFA 3DKMA 2K57A 2RHIA 2PVOB 2ZGWA 1VIEA 1D3BB 2XK0A 3DB4A 4PLIA 2XDDA 3G6EA 1YJ9T 3CC2T 1PSEA 4M7AD 1KQ2A 2JVVA 3OBWA 4LDXA 3JRZA 2E12A 1YJWT 1B34A 3OYGA 2LVMA 3OMGA 2DZCA 4GLKA 2E41A 5HK0A 1ZHIA 2CZ0B 3CMAT 2MAMA 4MDXA 5GMKm 1Q7YU 3CCJA 5GMKe 3FB9A 2RI3A 1BKBA 2YHTA 4FT4A 3OBYA 3CCET 5J3BA 4F7UG 3PIOA 4FT2A 3GLXA 2WSCE 4N4GA 1K73U 5GANh 2DK3A 3RMQA 4A53A 4OB3B 4IUPA 4KT0E 4C0DB 4M7DF 3HPWA 2ZPGB 4FIBA 5LJ5e 2LX9A 3ZEHA 4E7JA 2QQBA 5LJ3f 2RD1A 5CK9A 4O6JA 5L8RE 4F7UA 4JRKA 4PJOC 1VQKT 2KQWA 4IUQA 2RHYA 5CR2A 4F7UE 2PVDB 4LDWA 1VQ6T 4PJOB 4M77C 3X28B 1LNXA 2L8DA 3P8HA 1M90U 1VIFA 4BI4A 3EAEA 3L2RA 3OW2A 4ELZC 1YHQT 1SSFA 2ZPHB 2EQMA 3A5ZB 1N6AA 1O9SA 3OYEA 3LW5E 2X4JA 3OYFA 3MP1A 4BDYA 3QJ6A 3JCMW 2VC8A 3TREA 3FJPA 3X25B 2LNVA 1HK9A 3CMET 2FL7A 3INZA 1JRIA 3OQ5A 1M9SA 3SD4A 2M9UA 3EFRA 3T9NA 1VQMT 4JJNK 2MWPA 3DLLA 3CD6A 4M7AA 5D6XA 5CCAA 1M4ZA 4FU6A 3F70A 3VUBA 3A8OB 4CRIA 1W4SA 1TH7A 2BKDN 2H3JA 4O5VA 1MGQA 2KK4A 3CXCA 4OVAA 2QEXA 1EIFA 4F7UF 5LJ3e 2CYZB 4BY6C 3NTHA 3LWHA 3ME9A 3CCRT 4E7LA 1KHCA 4C0FA 2XG8D 4HCCA 1VQNT 2ZZDA 2RJFA 1VQ4A 4FL6A 1BYMA 2QQSA 5HKCA 1Y7XA 3JCMX 3META 3QBYA 2WSEE 2K2VA 2ZPIB 4C92D 3R6OA 5CVIA 5GAOq 4KUDK 5GAN3 3RKXA 2DIQA 2DTIA 3OYHA 3FIFA 1YI2A 1G5VA 4CI0C 4HT8A 3MEWA 3VV0A 1NE8A 3QPHA 1VQ8T 2Y90A 3A8GB 5D6WA 1Y96A 4C8QG 4KBMB 4L5GA 5GAN6 2E70A 2BIVA 1YIJT 3WXMB 1ZBXA 2DZ9A 3PFSA 1VQ7A 4WF2A 4C5GA 2KMTA 2DD4A 2D0QB 2GFUA 3JB9G 1VQLT 3OYNA 5GAMh 1UB4A 4E7KA 2OTLA 4YTLA 4C0GA 5A0DA 3QSUA 4FM4B 2JOYA 2VUBA 3OS5A 3RIRA 3VUZA 5LL6S 5CQXA 3V7RA 4J5YA 2RI5A 4J8OA 4M7DB 5GAMe 2ZPEB 4MMLA 3CCQT 4C92E 1UGSB 4XTUA 4R56A 3EFSA 4EPCA 3GPLA 4QVDA 3BFMA 2WSFE 3MP8A 4A4GA 2B8AA 1N27A 4BI8B 2YLCA 1YJNA 2K3YA 3PNWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6N A;  2JTF A;  3OMC A;  3PMI A;  3OS1 A;  4IUR A;  2RHI A;  4PL6 A;  3DB4 A;  2XK0 A;  4PLI A;  3O8V A;  4C5H A;  3DB3 A;  2K3X A;  2RHZ A;  2RJE A;  3QII A;  4NS5 A;  3OY9 A;  3OYG A;  2LVM A;  2X4X A;  3OMG A;  3OA6 A;  3OYD A;  4IUV A;  1XNI A;  2L89 A;  3FEO A;  4B9X A;  5FRM A;  3Q1J A;  4E7I A;  2NLU A;  2XDP A;  2RI3 A;  4LD6 A;  3L2V A;  3FC3 A;  3OYC A;  3MP6 A;  3OS2 A;  2R58 A;  4BDZ A;  4B9W A;  1OYX A;  4N4G A;  2EKO A;  5C6S A;  2EFI A;  4BE0 A;  2EQU A;  1WGS A;  4IUU A;  4QW2 A;  3UT1 A;  2BUD A;  4IUP A;  3S6W A;  1MHN A;  3NTK A;  3NTI A;  2FHD A;  3QKJ A;  4BE1 A;  2EQK A;  3ZEH A;  4E7J A;  3KUF A;  4IKF A;  3MEA A;  4IUQ A;  2RHY A;  1OI1 A;  3BDL A;  3L2U A;  1WJR A;  4BE2 A;  5D6Y A;  2L8D A;  3P8H A;  2CKK A;  3OYI A;  3LYI A;  3EAE A;  2PQW A;  2R5M A;  2L3R A;  3PMT A;  3L2R A;  3S3O A;  1H3Z A;  4QVZ A;  2RO0 A;  3H6Z A;  1SSF A;  3OYE A;  2EQM A;  2RHU A;  5IAY A;  2O4X A;  5KCH A;  2HQE A;  5FRN A;  3MEU A;  4BD3 A;  2G3R A;  3OYM A;  3OYF A;  3MP1 A;  4BDY A;  3QJ6 A;  4UC4 A;  5J39 A;  3P8D A;  2M0O A;  2P0K A;  2VYT A;  3LH0 A;  4A4F A;  5M9O A;  3OYL A;  4N4I A;  2IG0 A;  3OQ5 A;  3SD4 A;  5C0M A;  2RHX A;  2R57 A;  2LDM A;  2MWP A;  4PLL A;  3FDR A;  2O4X B;  5D6X A;  1RI0 A;  4QQ6 A;  1OZ3 A;  4FU6 A;  3F70 A;  4RG2 A;  2X4Y A;  4CRI A;  3OYA A;  3H8Z A;  3LGL A;  2LCC A;  2BKD N;  5CIU A;  2RJD A;  2WAC A;  4IUT A;  3MO8 A;  2MWO A;  4A4H A;  4OVA A;  4C5E A;  5IN1 A;  3NTH A;  4II1 A;  3ME9 A;  3C4S A;  4E7L A;  1KHC A;  2HQX A;  4BAC A;  3S3M A;  2RJF A;  5KE3 A;  4FL6 A;  4N4H A;  4L59 A;  2RJC A;  2D9T A;  2QQS A;  3L2Q A;  3MET A;  3QBY A;  4EDU A;  4C5I A;  3OYB A;  2E5Q A;  2RI2 A;  5J26 A;  1G5V A;  2DIQ A;  3OYH A;  4ZTF A;  3MEW A;  2DIG A;  5D6W A;  2GF7 A;  3L2W A;  1OZ2 A;  2DAQ A;  2M1H A;  4GY5 A;  4Z02 A;  2BIV A;  3GOX A;  3PFS A;  3E9G A;  5FRO A;  4C5G A;  1WJS A;  4Q5W A;  3FLG A;  2M16 A;  4A4E A;  2GFU A;  3OYN A;  2R5A A;  3L42 A;  3OYJ A;  3OS0 A;  4E7K A;  2LTO A;  3OB9 A;  3M9Q A;  3E9F A;  4QQD A;  5KE2 A;  4QQG A;  3LX7 A;  3OYK A;  3DLM A;  3MEV A;  2X35 A;  2X4W A;  3UWN A;  2RI5 A;  4X34 A;  4E7H A;  3CEY A;  3S3N A;  3LLR A;  1WJQ A;  2QQR A;  3LGF A;  2JZ2 A;  2YRV A;  3ASK A;  4ZTJ A;  5KCO A;  4HCZ A;  3MP8 A;  4A4G A;  5KH6 A;  2B8A A;  2F5K A;  1N27 A;  2LRQ A;  2EQJ A;  2K3Y A;  3PNW C;  2GFA A; 
#chains in the Genus database with same CATH topology
 2K6D A;  2M0Y A;  4M78 E;  4C5H A;  1N9S A;  2RHZ A;  3DB3 A;  3JB9 D;  5A2Q E;  3SWN A;  1PRL C;  3ZFJ A;  1X27 A;  4IIO A;  4C8Q B;  4E7I A;  4JUV A;  3QYG B;  3L2V A;  3VJP A;  3MP6 A;  2EYY A;  3PE0 A;  3VYH B;  4B9W A;  3I55 T;  1QVF P;  3CCV A;  1MHN A;  2J6O A;  5GAM d;  1AWW A;  1N8R C;  4IKF A;  2F5T X;  1I5L A;  2P0Q A;  2YT6 A;  4X9C A;  2AK5 A;  4BE2 A;  2QI2 A;  2OJ2 A;  3LYI A;  2RB6 A;  2NUP B;  4L6V 5;  1RAA B;  1VQP Q;  4KGV B;  2XD0 A;  5FRN A;  1YJ9 Q;  2AKL A;  3I55 A;  4UC4 A;  1WFW A;  5J39 A;  3EGD A;  4DEX A;  2KBT A;  4E2F B;  5C0M A;  2PUO B;  3SWN C;  3FDR A;  2DRM A;  4J6X A;  4OP0 A;  5CKF A;  4XAX B;  2WAC A;  1ABO A;  4OMN A;  2FRW A;  3MJX A;  3RES A;  2PNI A;  1S72 A;  4CC3 A;  4J9F A;  1I07 A;  3QDR B;  3OYB A;  2D8H A;  2X51 A;  1N5Z A;  3FRN A;  5FU6 C;  2EPD A;  3AHU A;  4M7A C;  5GAN 7;  1NYG A;  3MHX A;  1X6O A;  3CC4 Q;  2DBM A;  1X2K A;  1WJS A;  2M16 A;  4M7A G;  2DNU A;  2C0I A;  2JMA A;  2KT1 A;  2KVQ G;  3THK A;  3UA6 A;  1WPY A;  1KQS S;  3KXT A;  3LX7 A;  1WHH A;  4X34 A;  2KXC A;  2X9H A;  2YRV A;  3GNG A;  2O9V A;  2K2M A;  1UGP B;  5A0G A;  1Q86 C;  2QA4 T;  1K8A U;  4RMO A;  8AT1 B;  4CC4 B;  4TVR A;  1VUB A;  2MK5 A;  3EFO A;  3RBB B;  1ZUU A;  1M5Q 1;  4E47 A;  3RDV A;  2DVE A;  1IRE B;  1Q86 U;  1RI9 A;  5KYU A;  1BI3 A;  2VV5 A;  3HSB A;  2F2X A;  4XTY A;  3OS2 A;  4PFP A;  5GMK h;  4J83 A;  3UT1 A;  2RM4 A;  4V2S A;  2ZCF B;  2YRD A;  1JB0 E;  3NTI A;  3G6E T;  3L1A A;  2QAS A;  3KUF A;  4KH0 B;  1RLQ C;  2KDS A;  3CCL A;  3L2U A;  3VU3 C;  4M77 A;  3JCM h;  4PJO E;  3VS6 A;  2L3R A;  1VQN A;  3S3O A;  4ATO A;  2DMO A;  3NFC A;  3H6Z A;  2EBP A;  4JRQ A;  3CCM Q;  1OQK A;  9ATC B;  1X2Q A;  1RL2 A;  3A8H B;  3SWN B;  1QWE A;  1VQ6 Q;  4FSX A;  2LCL A;  2X3W D;  4HVV A;  3CPW A;  3OYA A;  2X4Y A;  3J80 E;  1MMG A;  1I8F A;  4C92 G;  2DL8 A;  3UA7 A;  4DQ2 A;  2GNC A;  3E1S A;  2DEQ A;  2HQX A;  4LDV A;  1FMV A;  4N4H A;  3JCM g;  1YCS B;  1ZQ1 A;  4NL3 A;  1VQ6 A;  2ENM A;  3RKY A;  3G71 T;  4ESR A;  4CC2 A;  2YRC A;  2DIG A;  1QKX A;  4DBF A;  4A4E A;  2IPO B;  2YUQ A;  3CCR Q;  3C94 A;  3E9F A;  4A54 A;  1VQ7 T;  2DJQ A;  1PKT A;  3TEE A;  3CC2 A;  2L5Q A;  2EJG A;  4E7H A;  1QP2 A;  1WJQ A;  5KYX A;  1UHF A;  1QVG S;  3EGU A;  1BIA A;  2ZPF B;  3CXC S;  2EQJ A;  4PL6 A;  3CBM A;  1BIB A;  1AZE A;  1KQ1 A;  1OPL A;  1RAI B;  4OMF B;  5GAO r;  2DBK A;  1KSW A;  4PKC C;  1NBE B;  5GJW B;  2ZPB B;  4XU1 A;  4MZP A;  1WHG A;  2XDP A;  3M53 A;  2K5F A;  3FC3 A;  2K4Y A;  2MYS A;  4BDZ A;  1YJN T;  3I56 Q;  4BE1 A;  1AEY A;  2DM1 A;  5CAI A;  4N0A A;  1VQP A;  5I11 A;  1P92 A;  3GNF B;  3OW2 S;  2V8K A;  4B6M A;  4M77 B;  2RHU A;  4LNP A;  4LN2 A;  4M75 C;  4A4F A;  3OYL A;  3EGX A;  3JCM J;  3SDZ A;  1H8K A;  4ME7 A;  4J9I A;  4M77 D;  1M90 U;  3RER A;  1PSF A;  1KC8 U;  1PM3 A;  3QUI A;  5KYU B;  2L3Q A;  1V1C A;  3VS4 A;  2KE9 A;  5CIU A;  1VQ7 Q;  3EG0 A;  5GAN 8;  4II1 A;  1NJI R;  4DOV A;  1XQH A;  5FU7 C;  1G3Y A;  4HA8 A;  2E5Q A;  2DYI A;  3HFO A;  4EMK C;  1KK7 A;  2MI6 A;  1N8R R;  2GF7 A;  1OZ2 A;  1Y71 A;  4Z8A A;  2G6F X;  3JAM E;  1TXQ A;  1LOJ A;  4OMP A;  1VQN Q;  2FPF A;  2V1Q A;  2DTH A;  3JCM e;  3L42 A;  1YFN A;  2LNH B;  1BI2 A;  2VVK A;  4LUE A;  3OYK A;  2JTE A;  2HL5 C;  2VXF A;  2X35 A;  3S3N A;  3QZ5 B;  1U3O A;  3CCQ Q;  4ZTJ A;  3ASK A;  4HT9 A;  1NPR A;  3HRT A;  1Q7Y R;  2LP5 A;  2EWN A;  1YJW A;  1U1T A;  3P8B B;  3EG2 A;  2K57 A;  2PVO B;  3CC2 T;  1PSE A;  3JRZ A;  1WI7 A;  2V26 A;  1T0J A;  2O2O A;  1ZHI A;  7AT1 B;  1OPK A;  4MDX A;  1Q81 R;  1D09 B;  4FT4 A;  5KYW A;  3GLX A;  3RMQ A;  4M7D F;  3U23 A;  1E6H A;  5LJ3 f;  3EG1 A;  2RHY A;  2NUP A;  4M77 C;  1KJW A;  4BI4 A;  3OW2 A;  1X6B A;  1ZUK A;  4RTY A;  1SSF A;  2ZPH B;  1PD1 A;  2EQM A;  1N6A A;  1O9S A;  3KFV A;  1TUD A;  2FZC B;  3EG9 A;  1JU5 C;  3QJ6 A;  1YIT Q;  2HQH A;  2RQT A;  2VC8 A;  2LNV A;  3I5R A;  2FL7 A;  1JRI A;  1NEB A;  3T9N A;  2VAS A;  3REA B;  3CD6 A;  4M7A A;  4FU6 A;  3SHW A;  1TH7 A;  2BKD N;  2H3J A;  3VRZ A;  1MGQ A;  2ESW A;  2CYZ B;  3CCR T;  4C0F A;  1VA7 A;  4HCC A;  2HEQ A;  2ZZD A;  4FL6 A;  3UF4 A;  3QBY A;  2WSE E;  2K2V A;  5CVI A;  2JMC A;  1G5V A;  2DIQ A;  2DTI A;  2QGG A;  3R6N A;  4HT8 A;  1NE8 A;  4L5G A;  1YIJ T;  1ZBX A;  3PFS A;  3VRY A;  1VQ7 A;  3CCL Q;  4WF2 A;  3A1P A;  2GFU A;  3OYN A;  1NG2 A;  3RR6 A;  2OTL A;  2DLP A;  2VB6 A;  2JOY A;  1NM7 A;  3OS5 A;  3VUZ A;  2V1R A;  3V7R A;  1UFF A;  1MMD A;  1PNJ A;  3CCQ T;  4R56 A;  1VQM Q;  2J05 A;  2DFU A;  1X69 A;  2NUT A;  4KRT A;  2YLC A;  4IUR A;  3NGP A;  4A4K A;  1Q82 R;  2J6F A;  2FVU A;  2FZG B;  3RKW A;  2A28 A;  2E3H A;  4C92 C;  1ZA1 B;  4X9D A;  1YIJ A;  4B9X A;  3L2Z A;  1FMK A;  3Q1J A;  4C0D C;  3QDF A;  1M8M A;  2XDB A;  3CCE A;  2EKO A;  3WVE B;  2EQU A;  2I0N A;  4HVW A;  4FCY A;  4HCK A;  2FHD A;  5EC7 A;  1SPK A;  2OTJ Q;  3OSS C;  4OMO A;  4QVC A;  1W70 A;  4F17 A;  1FYN A;  3VS7 A;  3CD6 Q;  5D6Y A;  3V7C A;  1VQ9 T;  1M1G A;  4MZT A;  3G4S A;  1H3Z A;  4PJO A;  5IAY A;  1GL5 A;  2YSQ A;  1VQO T;  2X3X D;  4F04 B;  2L3P A;  2P0K A;  2VYT A;  3LH0 A;  2DIL A;  2VGM A;  1G2B A;  5HCK A;  1H3H A;  2R57 A;  3JV3 A;  4PLL A;  3M4Y A;  3CXC P;  2O4X B;  4FYX B;  4ZN1 A;  1PHT A;  4N0A C;  4F16 A;  3VYG A;  1M30 A;  4C5E A;  1HJD A;  2P4T A;  5I21 A;  3JCM Q;  1JBM A;  1M2V A;  1ZX6 A;  2K5I A;  3CCE Q;  4C5I A;  1H64 1;  1JXM A;  1TSF A;  5GAN f;  2COZ A;  2DXU A;  1QVF S;  4Y91 A;  3CCR A;  1OEB A;  2XMF A;  1EFN A;  5DY9 A;  4M7A B;  2JS0 A;  4FYW B;  2R5A A;  3I5S A;  3M0S A;  3M56 A;  2LTO A;  3OB9 A;  3I35 A;  2OX7 A;  5KE2 A;  1SHF A;  2P0P A;  1QVG P;  3M5A A;  4FYV B;  4LXC A;  1Y07 A;  2EAY A;  4J6Y A;  1RAF B;  5KCO A;  4HCZ A;  1M8V A;  1IGQ A;  5KH6 A;  4AFS C;  3J81 E;  2XHC A;  1K0X A;  5FU6 B;  5GAN g;  1LCK A;  1S72 Q;  1PRM C;  3QII A;  4OF1 A;  2OTL Q;  2VXE A;  4XTW A;  2QGF B;  4KUL A;  1G3T A;  3OSV A;  1VQ8 Q;  1TUG B;  3QHS A;  3FEO A;  5FRM A;  3G71 Q;  4Y92 A;  2JT4 A;  5KYW B;  4JZ3 A;  2CP7 A;  2LQN A;  4AFU C;  2CRE A;  1MND A;  4ANJ A;  2F2W A;  1ACM B;  2JXB A;  2BTT A;  3N5B B;  1HSQ A;  1YJ9 A;  4JRP A;  5LJ3 j;  4R0K A;  1QCF A;  3MEA A;  1KD1 U;  2DL7 A;  2DTO A;  5CKE A;  2HDA A;  3EH2 A;  3RUX A;  1QLY A;  2AZS A;  2RNA A;  1YP5 A;  4M7A F;  3OYI A;  1M90 R;  1ZA2 B;  3UAT A;  8ATC B;  2A08 A;  2LT4 A;  2RPN A;  4GBQ A;  4QKU A;  2QTV A;  1JJ2 A;  2KEA A;  5M9O A;  1UG1 A;  2IG0 A;  1F1B B;  4PK4 A;  3JB9 H;  1XOV A;  4M78 A;  3EHQ A;  1KC8 C;  2OTJ T;  2CS7 A;  4PJO D;  2RJD A;  1VQO A;  4A4H A;  2KSS A;  1X43 A;  1BBZ A;  1AZG B;  1M3B A;  2RI2 A;  5J26 A;  1AT1 B;  1G8X A;  2GBQ A;  1R8O B;  4Y28 E;  3ER0 A;  2A3L A;  4C8Q E;  2DAQ A;  1AOJ A;  2M1H A;  4GY5 A;  2RQR A;  1U1S A;  4RCC A;  1B3Q A;  1UGR B;  3CCS T;  1K73 C;  1VQ8 A;  3OYJ A;  2EYZ A;  5I2M A;  1ZSZ A;  4J9E A;  4QQG A;  3CCU Q;  4J9H A;  3CEY A;  3D7S B;  1VQ5 Q;  1KQS P;  5GAN d;  1LPL A;  2MF2 A;  3CME Q;  1YBY A;  1GRI A;  1K8A C;  4D8K A;  1UTI A;  3OYY A;  4GLM A;  1KG1 A;  1I5O B;  5GAO l;  3QXE B;  2VKN A;  1M1K C;  4IUV A;  2KXD A;  4LD6 A;  5GJV B;  5GAN e;  2IVW A;  3RMS A;  3NTK A;  4J7I A;  2V8I A;  2OAU A;  1K9M C;  2FO0 A;  2CDT A;  4XU0 A;  3HHT B;  2NYS A;  4ELY C;  2LJ0 A;  3JB9 F;  1OV3 A;  2E64 A;  1LJO A;  1K9A A;  4QVZ A;  1M2O A;  4M75 G;  3HKS A;  2DVJ A;  3M59 A;  4C8Q F;  1YHQ A;  1S72 T;  5GAO n;  5CKD A;  1PG5 B;  3CME A;  4M78 C;  4N4I A;  2QQ9 A;  4OB0 B;  5CKH A;  1WHJ A;  2KT8 A;  3M0R A;  4M75 F;  4P5N A;  1D3B A;  3CPW S;  4RG2 A;  4XTZ A;  2MIO A;  4ZN3 A;  1YCY A;  5IN1 A;  2I2L A;  2DRK A;  5GMK i;  4BAC A;  4L59 A;  1G3W A;  2RJC A;  1SRL A;  2K5L A;  3L2Q A;  4J7F A;  3CC4 T;  2DX1 A;  1WYX A;  1SF9 A;  1JJ2 P;  1KHI A;  3A8L B;  2RH2 A;  2HBW A;  2QG9 B;  1NYF A;  2JUF A;  4C92 B;  2KY9 A;  2GTO A;  2RQV A;  4E7S A;  2GTJ A;  5IT9 E;  3DLM A;  2O01 E;  2QTX A;  1FWZ A;  4PJL A;  3VS0 A;  2QQR A;  3LGF A;  1IHV A;  1K0S A;  1MMA A;  3GF5 A;  3CC7 T;  2ECZ A;  1T0H A;  1AHJ B;  4C8Q D;  2JTF A;  3PMI A;  1EX4 A;  3DKM A;  2LJ1 A;  3DB4 A;  2ZGW A;  2XK0 A;  3G6E A;  3VS2 A;  4J9B A;  2LVM A;  4GLK A;  2DZC A;  1GFC A;  1W2B P;  2QDL A;  5GMK e;  2RI3 A;  3OBY A;  1UDL A;  5J3B A;  4JZ4 A;  3OW2 P;  4JPB W;  2AZV A;  5GAN h;  4PJM A;  1I0C A;  1M3C A;  4FIB A;  5LJ5 e;  2BZX A;  2QQB A;  3EFO B;  2RD1 A;  4O6J A;  2D1X A;  3CQT A;  4F7U A;  5CR2 A;  3X28 B;  2L8D A;  1RUW A;  1VIF A;  3EAE A;  2LQW A;  4ELZ C;  1ARK A;  1YJW Q;  3A5Z B;  2P84 A;  2X4J A;  3INZ A;  3OQ5 A;  6AT1 B;  3SD4 A;  1VQM T;  2MWP A;  2PTK A;  3FJ5 A;  1M4Z A;  3A8O B;  2J7I A;  2QEX A;  3LWH A;  1QMC A;  1JXO A;  2RJF A;  1FMW A;  5HKC A;  2ZPI B;  4KUD K;  4E6R A;  1YI2 A;  3FIF A;  3H41 A;  4CI0 C;  3MEW A;  3VV0 A;  3QPH A;  2DYB A;  1VQ8 T;  3A8G B;  1IHW A;  1OUL A;  3WXM B;  2DD4 A;  1VQL T;  2B86 A;  4E7K A;  4C0G A;  3QSU A;  1BCM A;  4FM4 B;  1E6G A;  3EGD B;  2FPE A;  5LL6 S;  5CQX A;  1YI2 Q;  2DEU A;  4M7D B;  1K1Z A;  1BCO A;  4A4G A;  2KR3 A;  3TSW A;  1YJN A;  3PNW C;  3E2U A;  2KRN A;  2EJ9 A;  2A7Y A;  2L2P A;  2DET A;  3PVL A;  2KYB A;  5GAN j;  1G3S A;  2VWF A;  3CCJ Q;  3M0T A;  1Q7Y C;  2DD5 A;  1Q82 U;  3J7A F;  3GP8 A;  1IB8 A;  5GMK l;  2JM9 A;  5FW9 A;  4J9C A;  3JSC A;  2DL4 A;  2NLU A;  3TSZ A;  3CCV T;  3ZBD A;  2CGH A;  1OYX A;  2PUK B;  4BE0 A;  1UE9 A;  4M75 B;  1D0X A;  3HFN A;  4C8Q A;  2D0N A;  3GIB A;  1SSH A;  4BB7 A;  2BE7 D;  3SB2 A;  5LJ5 h;  2E10 A;  1JJ2 S;  5FU7 B;  4Z88 A;  2YUO A;  3A8M B;  3A98 A;  4RTZ A;  1R0B G;  2PQW A;  3PMT A;  4KUI A;  1D0Y A;  2O4X A;  1MUZ A;  4HKE A;  5KCH A;  2FB7 A;  2DPP B;  2P4R A;  1VQ9 Q;  1SG5 A;  2RMO A;  3MCA B;  2Y4Y A;  2LDM A;  2DL5 A;  3H9N A;  4QQ6 A;  1ZSG A;  5AYF A;  3CC4 A;  2HD0 A;  2HAX A;  3G4S T;  1B34 B;  4XTX A;  5DLQ E;  4ZTF A;  1GXI E;  5KYY B;  2E6Z A;  4M7D C;  2CP2 A;  1NLP C;  1GCP A;  3QWY A;  2OTL T;  1DJ7 B;  1PD0 A;  2BZ8 A;  3WVD B;  2F1L A;  4AT1 B;  1R77 A;  2QA4 Q;  5D7U A;  4F14 A;  4EMH A;  1IO6 A;  1N8R U;  3BE3 A;  5FLX E;  1NJI C;  1WHK A;  2JW4 A;  1C6V X;  1YIT A;  1VQ5 A;  3M57 A;  1KD1 C;  1JQQ A;  1VQL Q;  4JRI A;  3JB9 J;  4NS5 A;  5LJ5 g;  5LJ3 h;  1BI0 A;  3OYD A;  1IGU A;  2COY A;  1GBR A;  3QO3 A;  3CMA A;  2R58 A;  1V76 A;  4DBQ A;  4C92 F;  1VQ9 A;  2ROT A;  2SRC A;  2EKH A;  3I56 T;  2ED0 A;  4EIK A;  2QK0 A;  1QVG A;  2HMA A;  3CBP A;  2MCN A;  2D8J A;  1IRX A;  4M77 E;  1K4U S;  4M75 A;  1YIT T;  5LJ5 f;  5GAN 5;  1RAE B;  3MEU A;  4OGC A;  1VQ4 Q;  1AD5 A;  4A63 B;  2QEX Q;  4JDS A;  3JCM V;  3EG9 B;  2EIF A;  3HL8 A;  3H8Z A;  3LGL A;  5HK3 A;  3V8J A;  4IUT A;  4HXJ A;  2MWO A;  2ROL A;  1K73 R;  2L0A A;  2YUP A;  4M7D A;  4M7D E;  2E4H A;  2KAF A;  4M7D G;  2K7A A;  5GAM f;  2MOX A;  3G71 A;  2OTJ A;  5GAN 2;  3NHN A;  1UGV A;  2EJF A;  2XI9 A;  5EG2 A;  2F69 A;  3HRS A;  1WA7 A;  4M78 F;  2CH4 A;  2X4W A;  2CZ6 B;  3LLR A;  1PKS A;  1QKW A;  3QG1 A;  2EYX A;  3CCU T;  4RTU A;  3VKI A;  2GFA A;  1TS9 A;  1ABQ A;  1U8R A;  1VQO Q;  2RJE A;  4HCB A;  3HP9 A;  2HSP A;  3G7Z A;  4JLI A;  4EMK B;  3JB9 I;  2RN8 A;  5IHI A;  1OU8 A;  2ED1 A;  2CUB A;  2XKO C;  3LWI A;  2QQA A;  3IQL A;  2DE0 X;  3NMZ C;  1B07 A;  4DBH A;  3OYC A;  4E7Z A;  3ULR B;  3X20 B;  3M0P A;  1WGS A;  1LVK A;  4IUU A;  1MV0 B;  1TUC A;  3CCU A;  1OI1 A;  4BUG A;  1WXT A;  1KQS A;  2MMP A;  5LJ3 d;  2EYQ A;  2O31 A;  3V8K A;  3VS5 A;  5GAO m;  2DL3 A;  2DJZ A;  3CCQ A;  3PVQ A;  1M90 C;  3EGX B;  1I1J A;  1JEG A;  2LQK A;  2RHX A;  2F2V A;  4ZGD B;  1VQK Q;  3M54 A;  4KH1 B;  1RI0 A;  1IZ6 A;  1HD3 A;  1D1B A;  5AT1 B;  2QAZ A;  3V8L A;  4FW2 A;  4OB2 B;  4JS5 A;  3CPF A;  5LJ5 d;  2HKN A;  2JTM A;  3EHR A;  2C06 A;  2D9T A;  2CP5 A;  1UEB A;  4MZM A;  1Q86 R;  2JNG A;  4EDU A;  4PNO A;  2DXB A;  1HYO A;  1NEG A;  2ZAE A;  1WXB A;  3L2W A;  2BZY A;  3GOX A;  5FRO A;  3E9G A;  1QVF A;  4PJO F;  3QWX X;  2PVG B;  4OMQ A;  3OS0 A;  3CCS A;  3M9Q A;  4QQD A;  3GBQ A;  1W6X A;  4M77 F;  4OGE A;  1TU0 B;  2LCS A;  1VQ5 T;  2YUN A;  4XU2 A;  1Q81 U;  1YN8 A;  3URG A;  1T3S A;  4LD9 K;  2E6N A;  3OS1 A;  5IHN A;  2RHI A;  1M1K R;  4FSS A;  1D3B B;  4PLI A;  2EGC A;  2XDD A;  1YJ9 T;  4M7A D;  1KQ2 A;  1WZO A;  5KYX B;  2E12 A;  3REB B;  4RTT A;  1YJW T;  1B34 A;  5IHK A;  3OMG A;  2E41 A;  2CP6 A;  1TOV A;  3LH5 A;  3CMA T;  2CZ0 B;  2EVR A;  5FWC A;  2DA9 A;  5GMK m;  2C0T A;  1Q7Y U;  1YWO A;  3FB9 A;  1BKB A;  2YHT A;  2J06 A;  1E7O A;  2O9S A;  3PIO A;  2COW A;  1K73 U;  2DK3 A;  3C0C A;  4OB3 B;  4IUP A;  2LX9 A;  4E7J A;  1WIE A;  1XJW B;  4PJO C;  2HKQ B;  4IUQ A;  4PJJ A;  3M0Q A;  3MPU B;  4LDW A;  1EZZ B;  1VQ6 T;  5ECA A;  3P8H A;  2FRY A;  3L2R A;  2LZ6 B;  1YHQ T;  1Q95 G;  3LW5 E;  3OYF A;  3MP1 A;  4BDY A;  3JCM W;  3NPF A;  3TRE A;  3X25 B;  2KRO A;  1R0C B;  3CME T;  2RF0 A;  1M9S A;  1H92 A;  2M9U A;  3EFR A;  3CC7 Q;  1OX9 A;  4JJN K;  3DLL A;  5D6X A;  3F70 A;  3VUB A;  4CRI A;  4IIM A;  2FPD A;  4O5V A;  3I9Q A;  2KK4 A;  4OVA A;  4F7U F;  5LJ3 e;  4BY6 C;  3NTH A;  5I22 A;  3ME9 A;  1YJN Q;  1VQ4 A;  1M3A A;  1BYM A;  2QQS A;  1Y7X A;  3JCM X;  4C92 D;  4AFQ C;  5GAO q;  3OYH A;  2AKK A;  2Y90 A;  5D6W A;  1Y96 A;  5GAN 6;  2BIV A;  2DZ9 A;  4CC7 A;  2RQU A;  2LJ3 A;  3G4S Q;  2D0Q B;  2NWM A;  5GAM h;  3G1J A;  3RIR A;  2EQI A;  2ATC B;  2EYW A;  2RI5 A;  4J8O A;  2JS2 A;  5GAM e;  4MML A;  3GPL A;  1QWF A;  2WSF E;  3MP8 A;  1N27 A;  1SKU B;  4BI8 B;  2LRQ A;  2K3Y A;  1VQ4 T;  4OB1 B;  2QA4 A;  5CO7 A;  2EGA A;  5HY6 A;  1SHG A;  4J9D A;  1WNL A;  2X4X A;  1VQL A;  5LJ5 j;  5GMK j;  2DXT A;  4RTX A;  1M1F A;  3JCM b;  4AG1 C;  2RA2 A;  1UUE A;  2CZ1 B;  1S1N A;  3QYH B;  2EFI A;  2FZK B;  1BU1 A;  1AWX A;  1UEC A;  3C95 A;  3M55 A;  3QKJ A;  3SFM A;  1O75 A;  5CQY A;  4RCB A;  2LX7 A;  3EG3 A;  3V7S A;  1RAG B;  1AVZ C;  3TCJ A;  5KYN A;  1RLP C;  1FXX A;  5GAM j;  4LUD A;  1A0N B;  1Y0M A;  4ZGE B;  4KGX B;  4XK8 E;  2R5M A;  4M75 E;  1WDX A;  1NPP A;  4R55 A;  2H3E B;  2KRS A;  2KNB B;  1UJ0 A;  4F7U B;  2BE9 B;  1XTD A;  2MPX C;  1VQM A;  3PTA A;  1X01 A;  2KRM A;  4QT7 A;  2RQW A;  1ZBJ A;  5GAM g;  3M4G A;  4RKU E;  1OZ3 A;  2CSI A;  1YI2 T;  2Y4X A;  3JCM P;  3AT1 B;  3VS3 A;  4BY6 B;  1K9M R;  1Y96 B;  2XID A;  4XQ3 A;  1AWO A;  3C4S A;  1N9R A;  5GAO p;  4C8Q C;  3I56 A;  2NUZ A;  2GGR A;  2HL3 A;  1QW1 A;  1YNZ A;  3FLG A;  3CC2 Q;  1Y57 A;  2V8J A;  4LE9 A;  1KD1 R;  4DA4 A;  4C92 A;  1M2V B;  1K9M U;  2SEM A;  2JZ2 A;  1MNE A;  2YLB A;  4PFZ A;  3SEM A;  4OML A;  4HVU A;  3E19 A;  4FYY B;  2L3S A;  5IXF A;  3OMC A;  2CUD A;  3CCM T;  4PJN A;  3UPU A;  3CCS Q;  1D0Z A;  3CCL T;  1TWB A;  1VYT A;  1WHM A;  4NL2 A;  1Z9Q A;  2HCK A;  3CD6 T;  1XNI A;  2L89 A;  2O88 A;  1SRM A;  1CKA A;  3M58 A;  3CBO A;  4J6W A;  2E65 A;  1WLP B;  5IH2 A;  2DO3 A;  1PC0 A;  3CPW P;  5C6S A;  4JS4 A;  2DKG A;  3HRU A;  4QW2 A;  2IIM A;  4Z89 A;  1UJY A;  5GAN 4;  3UDC A;  1VYV A;  4LDY A;  5DM7 R;  3C12 A;  2HBP A;  2PU9 B;  3JCM d;  2HSE B;  1M27 C;  2GCX A;  3TU4 K;  1X75 C;  3BDL A;  1WJR A;  1D1C A;  3JCM f;  2CKK A;  2HNI A;  1IXD A;  3KBG A;  2RO0 A;  4WCI A;  2FYK A;  1OX8 A;  2HQE A;  4BD3 A;  2HZY A;  1CKB A;  1VQP T;  3P8D A;  2M0O A;  4M77 G;  4RUG A;  1NZ9 A;  1QCN A;  3JCM c;  4FW1 A;  4PJO G;  2AHJ B;  1K8A R;  1OOT A;  2PZ1 A;  3EH1 A;  4J9G A;  5I2S A;  1W1F A;  3QJY A;  2NUT B;  1RAH B;  4XU3 A;  3S3M A;  4VUB A;  2GQV A;  1D1A A;  1MMN A;  3PT9 A;  5DLO A;  2DF6 A;  1J3T A;  1AWJ A;  2OI3 A;  2E1H A;  3MKD A;  2DXC A;  3BY7 A;  1X6G A;  1I81 A;  2JN0 A;  1ZSZ B;  3ZL7 C;  1CSK A;  5FWB A;  1G83 A;  2EGE A;  4DOW A;  1QP3 A;  2QEX T;  4MDW A;  2DER A;  1WX6 A;  4JJC A;  2OAW A;  2K3B A;  1QVP A;  2CP0 A;  1KC8 R;  3O8V A;  1HXD A;  2XU8 A;  2K3X A;  1WQ7 A;  3OY9 A;  4M78 D;  2VGN A;  1MV3 A;  4BI3 A;  4M7A E;  1ZUY A;  1NJI U;  5IXB A;  4MMK A;  3OA6 A;  4LDU A;  1RAD B;  2RK2 A;  2LQ8 A;  3TVT A;  2M51 A;  1M1K U;  4M78 B;  2A0F B;  1Q81 C;  2BUD A;  3S6W A;  4M4Z A;  3X26 B;  3RNJ A;  3BW1 A;  5A0L A;  4C0Z A;  4EMK A;  3I55 Q;  2EQK A;  4AFZ C;  4NOY A;  3H0H A;  3QZ9 B;  2LC4 A;  1NLO C;  2AT1 B;  4M75 D;  1KIK A;  4KGZ B;  3X24 B;  1U06 A;  1PCX A;  2EW3 A;  2JM8 A;  3PGG A;  2K79 A;  1VOM A;  2G3R A;  2XIC A;  3OYM A;  5CKB A;  1GCQ A;  2CSQ A;  1YHQ Q;  4AG2 C;  1OU9 A;  1FX7 A;  4M78 G;  1V29 B;  1I4K 1;  4XTV A;  4ZNX A;  1SEM A;  2CZ7 B;  2ABL A;  4JLG A;  2M02 A;  1BI1 A;  4WTO B;  1W2B A;  2KYM A;  1T3L A;  4ZGJ B;  2LCC A;  3BDU A;  3MO8 A;  2QXF A;  1W2B S;  5KE3 A;  4DBR A;  4M7D D;  1WQW A;  1YWP A;  2W0Z A;  3CCV Q;  2D6F A;  1B7T A;  1C1A A;  4EMG A;  3CCM A;  1RAB B;  3CMA Q;  1ZLM A;  4Z02 A;  3HTR A;  3CCJ T;  4JJB A;  4Q5W A;  4JJD A;  2QDY B;  2Z0W A;  3CC7 A;  1UGQ B;  3MEV A;  3UWN A;  1VQK A;  2C0O A;  2RK1 A;  1KFZ A;  1GBQ A;  2LT1 A;  1Q82 C;  1WHL A;  3PIP A;  4D6W A;  2F5K A;  2FG0 A;  4RG8 A;  1C0M A;  4DEY A;  1VIE A;  2JVV A;  3OBW A;  4LDX A;  2H8H A;  4PFO A;  3OYG A;  1YIJ Q;  5HK0 A;  1U5S A;  1Z9Z A;  2MAM A;  2CT3 A;  1K76 A;  3CCJ A;  3CCE T;  4F7U G;  4FT2 A;  2WSC E;  4N4G A;  2CT4 A;  4A53 A;  4C0D B;  4KT0 E;  3HPW A;  2ZPG B;  1TTH B;  3ZEH A;  4RTV A;  5CK9 A;  5L8R E;  4JRK A;  1VQK T;  2A36 A;  2KQW A;  4F7U E;  2PVD B;  3M0U A;  4PJO B;  1LNX A;  1PWT A;  1GCQ C;  2FEI A;  2GQI A;  3OYE A;  4D8D A;  2E5K A;  2YDL A;  2CP3 A;  2YXY A;  3FJP A;  4X1V A;  5L23 A;  1HK9 A;  1TG0 A;  2QYZ A;  1ZSZ C;  3H0F A;  5CCA A;  2CH4 W;  1W4S A;  3G6E Q;  3VS1 A;  3CXC A;  2LMJ A;  1EIF A;  5KYY A;  4E7L A;  1KHC A;  2XG8 D;  1VQN T;  2KGT A;  2E3I A;  1QQJ A;  2KI7 A;  3MET A;  2AIR B;  2JJ9 A;  3R6O A;  5GAN 3;  3RKX A;  2J6K A;  4OMM A;  4C8Q G;  3O5Z A;  4KBM B;  4AMC A;  2E70 A;  4RTW A;  4C5G A;  2KMT A;  1RAC B;  3JB9 G;  3H0I A;  1UB4 A;  1BK2 A;  1WXU A;  2YWW A;  4YTL A;  5A0D A;  1QCO A;  2VUB A;  1UHC A;  2W10 A;  4J5Y A;  2ZPE B;  1VYU A;  2A37 A;  1UGS B;  4C92 E;  4ORZ A;  4XTU A;  3EFS A;  4EPC A;  2K9G A;  1GFD A;  1BB9 A;  4QVD A;  3BFM A;  2B8A A;  4K11 A;  3TQ7 P;  1JO8 A;  5LJ3 g; 
#chains in the Genus database with same CATH homology
 2EJ9 A;  2A7Y A;  1VQ4 T;  4IUR A;  4OB1 B;  4A4K A;  4M78 E;  4C5H A;  5GAN j;  2QA4 A;  1N9S A;  2RHZ A;  1G3S A;  3DB3 A;  5CO7 A;  3JB9 D;  5HY6 A;  1Q7Y C;  2FVU A;  1WNL A;  2X4X A;  5A2Q E;  2DD5 A;  1Q82 U;  3J7A F;  3RKW A;  3GP8 A;  3SWN A;  5LJ5 j;  5GMK j;  3ZFJ A;  5GMK l;  1VQL A;  4C92 C;  2DXT A;  4C8Q B;  4X9D A;  1YIJ A;  3JSC A;  4B9X A;  3L2Z A;  3Q1J A;  4E7I A;  4JUV A;  1M1F A;  2NLU A;  3QYG B;  4C0D C;  3JCM b;  3L2V A;  3CCV T;  2RA2 A;  3MP6 A;  3VJP A;  3ZBD A;  2CZ1 B;  3VYH B;  2CGH A;  3QYH B;  1OYX A;  4B9W A;  3CCE A;  2EKO A;  2PUK B;  2EFI A;  3I55 T;  4BE0 A;  4M75 B;  3WVE B;  2EQU A;  3HFN A;  3C95 A;  3M55 A;  4C8Q A;  3CCV A;  1MHN A;  3GIB A;  2FHD A;  3QKJ A;  5GAM d;  4BB7 A;  3SFM A;  3SB2 A;  5LJ5 h;  1O75 A;  2E10 A;  1N8R C;  5CQY A;  1JJ2 S;  4RCB A;  5FU7 B;  2F5T X;  3OSS C;  3V7S A;  1I5L A;  4QVC A;  2P0Q A;  4M7D D;  3TCJ A;  4X9C A;  4BE2 A;  5D6Y A;  1FXX A;  2QI2 A;  3V7C A;  5GAM j;  3A8M B;  1VQ9 T;  4ZGE B;  3LYI A;  2PQW A;  1M1G A;  2R5M A;  2RB6 A;  3PMT A;  4KUI A;  4M75 E;  1NPP A;  4MZT A;  4XK8 E;  3G4S A;  4R55 A;  4L6V 5;  3RER A;  4PJO A;  5IAY A;  2O4X A;  5KCH A;  4HKE A;  2XD0 A;  2FB7 A;  5FRN A;  4F7U B;  2DPP B;  1XTD A;  3I55 A;  1VQO T;  4UC4 A;  5J39 A;  2P0K A;  2VYT A;  3LH0 A;  1VQM A;  3PTA A;  3MCA B;  1X01 A;  2VGM A;  5C0M A;  2Y4Y A;  2PUO B;  3SWN C;  2R57 A;  2LDM A;  4PLL A;  5GAM g;  3M4Y A;  3FDR A;  2O4X B;  3M4G A;  4J6X A;  4QQ6 A;  4RKU E;  1OZ3 A;  4OP0 A;  5CKF A;  1YI2 T;  2Y4X A;  3JCM P;  4ZN1 A;  4BY6 B;  5AYF A;  1Y96 B;  2XID A;  2WAC A;  4N0A C;  4XAX B;  2HD0 A;  4XQ3 A;  3CC4 A;  3VYG A;  4C5E A;  2P4T A;  5I21 A;  3JCM Q;  3C4S A;  2HAX A;  3G4S T;  1JBM A;  1N9R A;  3RES A;  1B34 B;  4XTX A;  1S72 A;  5GAO p;  2K5I A;  5DLQ E;  3QDR B;  4C5I A;  4C8Q C;  3OYB A;  3I56 A;  1H64 1;  5GAN f;  4ZTF A;  1GXI E;  3FRN A;  5FU6 C;  3AHU A;  2E6Z A;  2DXU A;  1QVF S;  4M7D C;  4M7A C;  5GAN 7;  4Y91 A;  3CCR A;  3MHX A;  1QW1 A;  1X6O A;  5DY9 A;  2LRQ A;  4M7A B;  2OTL T;  1WJS A;  1DJ7 B;  3FLG A;  2M16 A;  4M7A G;  2V8J A;  2R5A A;  3M56 A;  3WVD B;  2KVQ G;  2LTO A;  3OB9 A;  5KE2 A;  1WPY A;  2P0P A;  4EMH A;  3KXT A;  3LX7 A;  1KQS S;  3M5A A;  4DA4 A;  4C92 A;  4X34 A;  1K9M U;  1N8R U;  1Y07 A;  5FLX E;  1NJI C;  2EAY A;  2JZ2 A;  2YRV A;  4J6Y A;  2YLB A;  3GNG A;  5KCO A;  4HCZ A;  1M8V A;  5KH6 A;  1UGP B;  5A0G A;  1YIT A;  3J81 E;  1Q86 C;  2XHC A;  3E19 A;  2QA4 T;  1VQ5 A;  3OMC A;  3M57 A;  3CCM T;  1K8A U;  4RMO A;  5FU6 B;  3UPU A;  1KD1 C;  5GAN g;  4JRI A;  4TVR A;  4NS5 A;  3QII A;  4OF1 A;  3JB9 J;  3CCL T;  1VUB A;  2VXE A;  5LJ5 g;  4XTW A;  1M5Q 1;  4NL2 A;  5LJ3 h;  4E47 A;  4KUL A;  1G3T A;  1BI0 A;  3OSV A;  3OYD A;  3QHS A;  1XNI A;  2L89 A;  2DVE A;  3FEO A;  1IRE B;  1Q86 U;  3CD6 T;  5FRM A;  3M58 A;  3CBO A;  4J6W A;  3QO3 A;  2VV5 A;  1BI3 A;  2E65 A;  3CMA A;  3OS2 A;  4XTY A;  3HSB A;  2R58 A;  2DO3 A;  5C6S A;  4C92 F;  4JS4 A;  1VQ9 A;  5GMK h;  2DKG A;  3HRU A;  3N5B B;  4J83 A;  4QW2 A;  3UT1 A;  3I56 T;  2RM4 A;  4V2S A;  2ZCF B;  1JB0 E;  3NTI A;  3G6E T;  1YJ9 A;  3L1A A;  4JRP A;  1QVG A;  5GAN 4;  3UDC A;  3KUF A;  5LJ3 j;  3CBP A;  3MEA A;  4LDY A;  5DM7 R;  1KD1 U;  2KDS A;  3C12 A;  2HBP A;  2PU9 B;  2DTO A;  3JCM d;  5CKE A;  2GCX A;  4M77 E;  3TU4 K;  3CCL A;  1X75 C;  3BDL A;  3L2U A;  3VU3 C;  1WJR A;  4M77 A;  3RUX A;  3JCM f;  3JCM h;  4M75 A;  2CKK A;  4PJO E;  4M7A F;  2HNI A;  3OYI A;  2L3R A;  1VQN A;  3KBG A;  3S3O A;  4ATO A;  1YIT T;  2RO0 A;  3H6Z A;  3NFC A;  5LJ5 f;  4JRQ A;  2FYK A;  2LT4 A;  5GAN 5;  2HQE A;  3MEU A;  4OGC A;  4BD3 A;  5LJ3 g;  1VQP T;  1JJ2 A;  3P8D A;  2M0O A;  4M77 G;  5M9O A;  1RL2 A;  3A8H B;  3SWN B;  1NZ9 A;  2IG0 A;  4FSX A;  4JDS A;  3JCM c;  2LCL A;  3JB9 H;  3JCM V;  1XOV A;  4PJO G;  2EIF A;  2AHJ B;  4M78 A;  1KC8 C;  3HL8 A;  2OTJ T;  3CPW A;  3OYA A;  2CS7 A;  2X4Y A;  5I2S A;  3H8Z A;  3LGL A;  4PJO D;  5HK3 A;  3J80 E;  2RJD A;  3V8J A;  1VQO A;  4IUT A;  1I8F A;  4C92 G;  3QJY A;  2MWO A;  4A4H A;  2KSS A;  4XU3 A;  4DQ2 A;  3E1S A;  2DEQ A;  2HQX A;  4LDV A;  4VUB A;  3S3M A;  3JCM g;  4N4H A;  2GQV A;  2XDB A;  4M7D A;  1ZQ1 A;  4NL3 A;  1VQ6 A;  4M7D E;  3RKY A;  2RI2 A;  5J26 A;  3G71 T;  2KAF A;  3PT9 A;  4M7D G;  1R8O B;  4Y28 E;  3ER0 A;  2DIG A;  2A3L A;  4C8Q E;  5DLO A;  5GAM f;  2DAQ A;  2M1H A;  4GY5 A;  3G71 A;  1U1S A;  4RCC A;  1UGR B;  3CCS T;  1K73 C;  2E1H A;  4A4E A;  5GAN 2;  1VQ8 A;  2OTJ A;  2XI9 A;  2EJF A;  5EG2 A;  3OYJ A;  2DXC A;  3BY7 A;  3C94 A;  5I2M A;  2F69 A;  3HRS A;  1I81 A;  4M78 F;  3E9F A;  2JN0 A;  4A54 A;  1VQ7 T;  4QQG A;  3TEE A;  3CC2 A;  2L5Q A;  2EJG A;  2X4W A;  4E7H A;  3CEY A;  2CZ6 B;  1QP2 A;  3LLR A;  1WJQ A;  1QVG S;  3QG1 A;  4DOW A;  5GAN d;  1QP3 A;  1BIA A;  2ZPF B;  2QEX T;  4MDW A;  3CCU T;  2MF2 A;  3CXC S;  2EQJ A;  1YBY A;  3VKI A;  2GFA A;  1QVP A;  1U8R A;  4PL6 A;  1K8A C;  3CBM A;  1BIB A;  1KQ1 A;  1HXD A;  2XU8 A;  3O8V A;  2K3X A;  1WQ7 A;  2RJE A;  3OYY A;  4OMF B;  3OY9 A;  5GAO r;  4HCB A;  4M78 D;  3HP9 A;  2VGN A;  3G7Z A;  4BI3 A;  4M7A E;  4PKC C;  1H3Z A;  5GAO l;  4JLI A;  4EMK B;  1NJI U;  3QXE B;  3JB9 I;  4MMK A;  1M1K C;  2ZPB B;  3OA6 A;  4XU1 A;  4IUV A;  4MZP A;  4LDU A;  2XKO C;  3LWI A;  2QQA A;  2RK2 A;  2XDP A;  3M53 A;  2K5F A;  4LD6 A;  2LQ8 A;  3FC3 A;  3OYC A;  2K4Y A;  4BDZ A;  4M78 B;  1M1K U;  3X20 B;  5GAN e;  1YJN T;  2IVW A;  1WGS A;  4IUU A;  1Q81 C;  2BUD A;  3RMS A;  3S6W A;  3X26 B;  3NTK A;  4J7I A;  3BW1 A;  2V8I A;  4C0Z A;  4EMK A;  5A0L A;  2EQK A;  4BE1 A;  4NOY A;  5CAI A;  2OAU A;  4N0A A;  1K9M C;  1VQP A;  1P92 A;  3CCU A;  1OI1 A;  4XU0 A;  4BUG A;  3QZ9 B;  1KQS A;  2LC4 A;  2MMP A;  3HHT B;  4ELY C;  4M75 D;  3GNF B;  3JB9 F;  5LJ3 d;  2EYQ A;  3V8K A;  2V8K A;  3X24 B;  2E64 A;  1LJO A;  3OW2 S;  1KG1 A;  4QVZ A;  4M77 B;  5GAO m;  3PGG A;  2RHU A;  4M75 G;  3HKS A;  3M59 A;  4C8Q F;  1YHQ A;  2DJZ A;  2G3R A;  2XIC A;  4M75 C;  5CKB A;  5GAO n;  3OYM A;  3CCQ A;  5CKD A;  3CME A;  1S72 T;  4M78 C;  1M90 C;  4A4F A;  1FX7 A;  3OYL A;  4M78 G;  1V29 B;  4N4I A;  3JCM J;  3SDZ A;  2QQ9 A;  4OB0 B;  2LQK A;  1I4K 1;  2RHX A;  4XTV A;  2CZ7 B;  4ME7 A;  5CKH A;  4ZGD B;  4JLG A;  4M77 D;  3M54 A;  1BI1 A;  1W2B A;  4M75 F;  1RI0 A;  1PSF A;  1D3B A;  1IZ6 A;  4P5N A;  4RG2 A;  3QUI A;  4XTZ A;  3CPW S;  1KC8 U;  4ZGJ B;  2LCC A;  5CIU A;  3V8L A;  4ZN3 A;  3BDU A;  3MO8 A;  4OB2 B;  1YCY A;  5GAN 8;  4JS5 A;  3CPF A;  5IN1 A;  4II1 A;  5LJ5 d;  2QXF A;  2I2L A;  4DOV A;  2JTM A;  1XQH A;  1W2B S;  4BAC A;  5GMK i;  5KE3 A;  5FU7 C;  4L59 A;  1G3W A;  2RJC A;  2C06 A;  1G3Y A;  2D9T A;  1WQW A;  2K5L A;  4J7F A;  1UEB A;  4MZM A;  3L2Q A;  3CC4 T;  2JNG A;  4EDU A;  4PNO A;  2D6F A;  4HA8 A;  1KHI A;  2E5Q A;  2DXB A;  3HFO A;  4EMK C;  4EMG A;  2MI6 A;  3CCM A;  3A8L B;  2GF7 A;  3L2W A;  1OZ2 A;  1Y71 A;  4Z02 A;  2RH2 A;  3GOX A;  3JAM E;  5FRO A;  3E9G A;  1LOJ A;  3CCJ T;  4Q5W A;  1QVF A;  4PJO F;  2DTH A;  3JCM e;  3L42 A;  2JUF A;  4C92 B;  2PVG B;  2KY9 A;  3OS0 A;  3CCS A;  2QDY B;  3M9Q A;  4QQD A;  1BI2 A;  4M77 F;  4OGE A;  1UGQ B;  3CC7 A;  3OYK A;  2VXF A;  5IT9 E;  3DLM A;  3MEV A;  2X35 A;  3UWN A;  2O01 E;  2RK1 A;  1VQK A;  2QTX A;  3S3N A;  1FWZ A;  2LT1 A;  3QZ5 B;  1VQ5 T;  2QQR A;  3LGF A;  1Q82 C;  4ZTJ A;  3ASK A;  4HT9 A;  1NPR A;  3GF5 A;  3CC7 T;  4XU2 A;  3PIP A;  4D6W A;  2F5K A;  3HRT A;  1Q81 U;  1AHJ B;  2EWN A;  4C8Q D;  1YJW A;  3URG A;  1U1T A;  3P8B B;  4LD9 K;  2E6N A;  2JTF A;  3PMI A;  3OS1 A;  4RG8 A;  4IKF A;  3DKM A;  2K57 A;  2RHI A;  2PVO B;  2ZGW A;  1VIE A;  1D3B B;  2XK0 A;  3DB4 A;  4PLI A;  2XDD A;  3G6E A;  1YJ9 T;  3CC2 T;  1PSE A;  4M7A D;  1KQ2 A;  2JVV A;  3OBW A;  4LDX A;  3JRZ A;  2E12 A;  1YJW T;  1B34 A;  3OYG A;  2LVM A;  3OMG A;  2DZC A;  4GLK A;  2E41 A;  5HK0 A;  1ZHI A;  2CZ0 B;  3CMA T;  2MAM A;  4MDX A;  5GMK m;  1Q7Y U;  3CCJ A;  5GMK e;  3FB9 A;  2RI3 A;  1BKB A;  2YHT A;  4FT4 A;  3OBY A;  3CCE T;  5J3B A;  4F7U G;  3PIO A;  4FT2 A;  3GLX A;  2WSC E;  4N4G A;  1K73 U;  5GAN h;  2DK3 A;  3RMQ A;  4A53 A;  4OB3 B;  4IUP A;  4KT0 E;  4C0D B;  4M7D F;  3HPW A;  2ZPG B;  4FIB A;  5LJ5 e;  2LX9 A;  3ZEH A;  4E7J A;  2QQB A;  5LJ3 f;  2RD1 A;  5CK9 A;  4O6J A;  5L8R E;  4F7U A;  4JRK A;  4PJO C;  1VQK T;  2KQW A;  4IUQ A;  2RHY A;  5CR2 A;  4F7U E;  2PVD B;  4LDW A;  1VQ6 T;  4PJO B;  4M77 C;  3X28 B;  1LNX A;  2L8D A;  3P8H A;  1M90 U;  1VIF A;  4BI4 A;  3EAE A;  3L2R A;  3OW2 A;  4ELZ C;  1YHQ T;  1SSF A;  2ZPH B;  2EQM A;  3A5Z B;  1N6A A;  1O9S A;  3OYE A;  3LW5 E;  2X4J A;  3OYF A;  3MP1 A;  4BDY A;  3QJ6 A;  3JCM W;  2VC8 A;  3TRE A;  3FJP A;  3X25 B;  2LNV A;  1HK9 A;  3CME T;  2FL7 A;  3INZ A;  1JRI A;  3OQ5 A;  1M9S A;  3SD4 A;  2M9U A;  3EFR A;  3T9N A;  1VQM T;  4JJN K;  2MWP A;  3DLL A;  3CD6 A;  4M7A A;  5D6X A;  5CCA A;  1M4Z A;  4FU6 A;  3F70 A;  3VUB A;  3A8O B;  4CRI A;  1W4S A;  1TH7 A;  2BKD N;  2H3J A;  4O5V A;  1MGQ A;  2KK4 A;  3CXC A;  4OVA A;  2QEX A;  1EIF A;  4F7U F;  5LJ3 e;  2CYZ B;  4BY6 C;  3NTH A;  3LWH A;  3ME9 A;  3CCR T;  4E7L A;  1KHC A;  4C0F A;  2XG8 D;  4HCC A;  1VQN T;  2ZZD A;  2RJF A;  1VQ4 A;  4FL6 A;  1BYM A;  2QQS A;  5HKC A;  1Y7X A;  3JCM X;  3MET A;  3QBY A;  2WSE E;  2K2V A;  2ZPI B;  4C92 D;  3R6O A;  5CVI A;  5GAO q;  4KUD K;  5GAN 3;  3RKX A;  2DIQ A;  2DTI A;  3OYH A;  3FIF A;  1YI2 A;  1G5V A;  4CI0 C;  4HT8 A;  3MEW A;  3VV0 A;  1NE8 A;  3QPH A;  1VQ8 T;  2Y90 A;  3A8G B;  5D6W A;  1Y96 A;  4C8Q G;  4KBM B;  4L5G A;  5GAN 6;  2E70 A;  2BIV A;  1YIJ T;  3WXM B;  1ZBX A;  2DZ9 A;  3PFS A;  1VQ7 A;  4WF2 A;  4C5G A;  2KMT A;  2DD4 A;  2D0Q B;  2GFU A;  3JB9 G;  1VQL T;  3OYN A;  5GAM h;  1UB4 A;  4E7K A;  2OTL A;  4YTL A;  4C0G A;  5A0D A;  3QSU A;  4FM4 B;  2JOY A;  2VUB A;  3OS5 A;  3RIR A;  3VUZ A;  5LL6 S;  5CQX A;  3V7R A;  4J5Y A;  2RI5 A;  4J8O A;  4M7D B;  5GAM e;  2ZPE B;  4MML A;  3CCQ T;  4C92 E;  1UGS B;  4XTU A;  4R56 A;  3EFS A;  4EPC A;  3GPL A;  4QVD A;  3BFM A;  2WSF E;  3MP8 A;  4A4G A;  2B8A A;  1N27 A;  4BI8 B;  2YLC A;  1YJN A;  2K3Y A;  3PNW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...