4HDAA

Crystal structure of human sirt5 in complex with fluor-de-lys peptide and resveratrol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
267
Chain Sequence
RPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacylase sirtuin-5, mitochondrial
publication title A molecular mechanism for direct sirtuin activation by resveratrol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 70
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4hdaA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4hdaA01
4UUBA 4BVBA 3IAEA 4V1CI 1PVDA 4K9NA 1QPBA 4HD8A 1YBHA 4BVGA 3GLSA 4F56A 2VBIA 4BUZA 3GLRA 5FYQA 2VBFA 2H4HA 5MF6A 1POWA 1V5FA 5IMSA 4X3OA 1UPAA 3RIYA 3CLRD 1Z8NA 1Y9DA 2OORC 2VK8A 5FEMA 2FRDC 4JT8A 4L3OA 4KGDA 2H2GA 3K35A 4ZP1A 3OE1A 1OVMA 4TWIA 4BVHA 1O97D 1BFDA 3JWPA 3CLUD 1PNQA 5EJ5A 4JSRA 2FWNA 2EZ9A 5BWOA 2QQFA 1XLTC 5EJ6A 4GM1A 4Y6QA 4V1CB 3FZNA 2Q27A 3F6EX 4G1CA 4V1CA 1V5EA 2JI7A 4FEEA 3PKJA 3D81A 1YHYA 1YI0A 4K9PA 3HWWA 1S5PA 1ZPDA 4D5EA 1M2NA 2IHVA 1N0HA 1HZZC 4Y6OA 3EA4A 4UTZA 4MZXA 2C31A 1JSCA 1OZFA 1YI1A 5DEIA 4GM0A 2EZ8A 1Q6ZA 3JR3A 2OD2A 1YTLA 2VK1A 4QPZA 2H59A 5AHKA 4JUDX 1PI3A 3HWX1 4UTXA 2HJHA 4HDAA 4BV3A 2VJYA 5DGDA 4JUBA 4J1TC 1U2GC 2NXWA 4JD5A 2IHUA 4L2IA 1YHZA 1SZCA 2H2DA 2FR8C 1SZDA 2H4FA 1M2GA 5MFPA 4BV2A 4UTNA 4QQ8A 2B4YA 4TWJA 1PNOA 1E3TA 4GG1A 5EJ4A 4RJJA 2PGNA 3D4BA 4MPJA 1OZGA 2EZ4A 2Q5QA 4MQ5A 2AG0A 1DJLA 2A1TR 3CLSD 4IG9A 1NM5C 4IAOA 1M2JA 2JLCA 4JUAA 1YNOA 3EYAA 3IAFA 4UTRA 2PGOA 5BWNA 2JI9A 2Q5LA 4IF6A 4MPPA 4R8MA 5MGNA 2H2IA 4JT9A 5K6RA 1YC5A 4JUFA 2BRUC 4GPEA 4JUCA 4FEGA 3FLMA 4GP9A 4COKA 2UZ1B 5MFZA 1ICIA 2FSVC 4O8ZA 3U3DA 4C7BA 4K9LA 2Q5OA 4UUAA 1T9BA 4I5IA 4JU9A 3U31A 1POXA 2FN3A 4RMHA 2EZUA 1PTJC 2JI6A 2WVAA 4JU8A 4BVFA 1U2DC 2OD9A 4RMGA 2W93A 5DGTA 2NYRA 2AG1A 2OO5C 5BWLA 5EJMA 2OD7A 1PT9A 2Q28A 2A1UA 2V3WA 2PANA 2JI8A 1PYDA 2X7JA 4GM4A 2JLAA 1EFPA 3GLTA 4UU7A 2Q5JA 4F4UA 1EFVA 4C78A 4FZ3A 2QQGA 1Q1AA 4KPUA 3D7KA 4K9OA 4D5GA 1V5GA 3ZGVA 1U28C 1YC2A 1T9DA 1J8FA 4RMJA 3ZG6A 2VBGA 2JIBA 3F6BX 5EJAA 1Q17A 4Q9DA 4X3PA 3FSJX 2WVHA 3CF4G 3PDHA 4RMIA 5EJ9A 4BN5A 4K9KA 5D7NA 4UU8A 1T9AA 1S7GA 4FVTA 4J16C 5K6TA 2DJIA 2IHTA 2H2FA 1U31A 1UPCA 4KXQA 4QELA 1Q14A 4ZZIA 1OZHA 5K2OA 1T9CA 1UPBA 1MA3A 4RJIA 2H2HA 3RIGA 3GLUA 4K9QA 2VK4A 3LQ1A 3E9YA 4RJKA 2WVGA 3EY9A 3CLTD 3ZGOA 4MPRA 1D4OA 5K3SA 1M2KA 4BN4A 1MCZA 1M2HA 4K9MA 2Q29A 2H4JA 5EJ8A 4UTVA 2UZ1A 4Y6LA 2EZTA 5EJ7A 1PO7A 4BVEA 1O96B 3PKIA
chains in the Genus database with same CATH superfamily
5JMOA 2J46A 1SVNA 3HXKA 1QHNA 1Z4KA 2BMAA 2K7ZA 3IHLA 5LMNB 3OZFA 5KDDA 2GZSA 2XXBA 4GX2A 5T3UA 3I5MA 5HF6A 3TM4A 2DPGA 3E0QA 3KT6A 3ZDEA 4IIBA 2FRDA 4CPDA 5DM1A 4B4UA 1AMUA 2NUTA 3VM6A 4PZZA 4YDSA 1TFUA 2I0FA 2Z83A 3TPCA 1ENZA 1D4ZA 5EMHA 4BUZA 3HJUA 5HPYB 4IJUA 4GZLA 5J2UA 3D6NB 2QD2A 1E69A 2NXCA 3DEJA 1K7FB 3LKBA 2J3IA 4JLDA 3DT6A 3E9NA 5H4HA 3TEMA 3WSVA 1IBCA 1VCOA 3T7CA 4BGIA 1IVNA 5M04A 2VZLA 4OIMA 3FWKA 4WNIA 3SC3A 1TYEB 2HNAA 1U9YA 2JD1A 2WC1A 1V0JA 1KZ7B 4HN2A 4OIFA 4NCIA 3WIUA 4K8RB 2P2YA 4AY5A 2UZ4A 2OK7A 4Q3KA 4MWGA 3HU1A 5KSYA 2WMYA 3AHIA 1E1QA 4PIVA 1DIBA 5AUNB 1JR6A 5FEMA 6Q21A 1PJQA 4YH1A 1XG5A 2P77A 3ZLVA 4PU0A 4XQEA 3VZDA 4FQ5A 5DTRA 4KWCA 1V4VA 3HG7A 4HFRA 1JV2B 4BNUA 3FETA 4DAEA 3OLQA 4Y6GB 4EI8A 3CVYA 5JJ5A 3IIMA 1UIMA 1Z17A 2WU4A 3K0CA 3MNFA 3R9KA 1CJVC 1L6RA 3NCHA 4GD3Q 3OFNA 4W8HA 1KQNA 1J06A 1BE0A 4X20B 2VF4X 4G37A 4EOGA 3TL6A 4MAFA 3HYLA 2NLOA 2EJTA 2HZ7A 2YW9A 4NBKA 4FS3A 1U4NA 3EXG2 3QTLA 1XDDA 3W7VA 3IALA 1D1SA 3R7NA 2HBYA 4HN4B 3WNVA 4L7QA 4HB3A 3GN1A 2CXNA 5CDHA 1IQUA 5IJ9A 1G5HA 4GKVA 2H1LA 3H8SA 3QYAA 4R6WA 3FB1A 1LWOA 1OXTA 3AUUA 4MKHA 2FWNA 2Q9BA 1KF0A 3HGTA 3A3OA 4K03A 4AP6A 2I91A 1F1JA 1QDLB 4Z8XA 3JD0A 5TQVA 1KJJA 3OIFA 4ZJUA 4Y6QA 2J6CA 3FLBA 3IL2A 2H7XA 5BUSA 1CUYA 1GQOA 4H1TA 2GWHA 3TOCA 3DAGA 1O5TA 5L3QB 1DAMA 2XKBA 1GN8A 3ZHUA 2DPYA 3RH0A 4MV3A 1JI3A 4MW0A 3HJNA 2E48A 2ZB8A 3BC1A 5TDHA 2IEZA 5C8YA 4BMZA 4PX5A 3UWKA 3EWAA 5BUZA 4ND6A 4RKQA 4BCCA 1RMTA 1M1UA 2K87A 4UNNA 2Q50A 3M3PA 5G1PA 2AOTB 2J3JA 4HLCA 3FAKA 4NONA 1CLUA 4KC0A 1KYTA 4ZZ1A 1M0EA 3CURA 3LECA 2B3TA 4NZYA 4ZQGA 1KI4A 3GGGA 1WEHA 1Z6PA 3MBOA 3ESXA 4A2QA 1KRXA 4QXAA 4YASA 4BGDA 2IZ1A 4HGQA 3TLAA 1FMTA 3Q6IA 4EB8A 2WDZA 3AB7A 1VLVA 3GGSA 1PDWA 3KEFA 3U7EB 1HG1A 1KJNA 3GEDA 1AURA 3L8CA 1JALA 3NBFA 4TQGA 4BMVA 3ZCPA 2XVYA 1P17A 4ZDWA 3O3MB 3I39X 2CXHA 2P67A 1C50A 3QLEA 2CD7A 1UFOA 5T57A 5KPDA 2D5AA 5K8CA 1QLJA 2Z3WA 4CIWA 3KKNA 1QS0B 1QXSA 3EPRA 4G97A 3OFND 2PD6A 4KUGA 4AQDA 3EJ6A 5TE9A 4B8YA 4K5QA 2N9UA 2FXIA 3IJ5A 1GDHA 2QZSA 4IS2A 1U8FO 5DB4A 3HSYA 2V7VA 2ZS7A 4AT1A 4OSPA 1YS9A 721PA 1TKBA 1VECA 3EVFA 1MXHA 3QBJA 3H6KA 3SKYA 2J3DA 3PSHA 3D9QX 4ND8A 2W2MA 3WK9A 2V7WA 2B3DA 3UAGA 4DV2B 1NR7A 2QL9A 2BHSA 4KQKA 3NEYA 2JFWA 2RARA 4I8DA 4CR7A 1Z5PA 4E3ZA 1SKMA 4KSCA 3ZW9A 4PYJA 4MHOA 4B84A 3LK7A 1ZRMA 3UH0A 3JXEA 5SZIA 2HJSA 1XF9A 4LF8B 5I3ZA 4A8HA 2QMOA 1Z0KA 4GGPA 2XUJA 5FTKA 4BO6A 2AFIE 4UBIA 1RPNA 5DHFA 5ERGB 5J3JA 4H7FA 2JFFA 5KKCA 2Z6AA 1WS6A 3ICEA 4J4BA 1RYHA 4JBWA 1KSGA 2QUKA 3C8ZA 4DNXA 1EVLA 1P7CA 2O2YA 3R1IA 4PLTA 4P3YA 4B6PA 1PL7A 2GZ1A 2PWAA 1K5PA 5EP4A 1N7HA 1O9HA 3H9BA 1N36B 1ADYA 4INZA 4MP8A 2C2GA 4ZI2A 2ESRA 4J1TC 3LDGA 1A95A 1JFLA 2NO4A 3EZ9A 4WK4B 1KNXA 1SO8A 3B3GA 3K1AB 4CKBA 3O4HA 1M66A 1XT6A 4E94A 5JISA 1APBA 2JHPA 5AW1A 1FCJA 2FVYA 3F0TA 5DSXA 4ZRNA 1TK2A 3GG2A 3FYDA 4Z0HO 3I52A 1W36C 5G4KB 4P3OA 1TT5B 1M2FA 1NP7A 2QJOA 4TXHA 1XI2A 5D5QA 4YN3A 4D7AA 4N3BA 4D44A 4W5TA 3QWIA 1TUGA 3TYXA 3DCIA 1I2ZA 3OZ7A 1YU6A 2HY7A 2ZPUA 3VOAA 1SZDA 4YJGA 1P1FA 1XU4A 2Q8PA 4JYAB 4DM3A 2J31A 5D7BA 3DT9A 1ICEA 4G3XA 4EQ6B 1KK1A 3DNPA 4PAWA 2VQEB 3KC2A 4NBUA 4Y9DA 3W3AH 2Z58A 3KLPX 1HTWA 2GNAA 1NN5A 1NLMA 4ARSA 5EIXA 4KBGA 1X7ZB 1H3FA 4Q7JB 4JH0A 3BJRA 1M0TA 3BJEA 4BTLA 3ONEA 3U6BA 2NZ2A 5JNWA 1UJ2A 3OJ0A 3DEIA 4DGSA 5JXGA 2GPJA 1RXCA 2H08A 2JIQA 3C7TA 4IIXA 4YRQA 1YE8A 2I6XA 4GR4A 1K1EA 3A1WA 1RHUA 3ENNA 3FYUA 4XOIA 1PF7E 3GAFA 1S3SA 3HCPA 3QBVA 4P4GA 5HK8A 4OHKA 4RIEA 3HO1A 4BNDB 2ZAOA 3M82A 2RG1A 4EUEA 4ENUA 1XMQB 2GAIA 2Y67A 4ZYZA 2DWPA 1Y5LA 3GFFA 1FFGA 2E55A 3SYTA 4AUKA 4DCUA 3RFTA 3I83A 1XMXA 2P6NA 4B5KA 2HSGA 4LNHA 1K89A 1KA9H 3K71B 4MIEA 4GH5A 3EVEA 3EIHA 1CY0A 4P84A 4RTJA 1NJSA 3OY2A 1WVIA 4UTRA 2B36A 4LXYA 5AKXA 1EP1B 4AJJA 1VIMA 3OLVA 1CRLA 1P44A 2EP7A 4HGZA 2IUEA 4KXYA 1N7IA 3A4VA 2ODNA 3PP8A 4LZPA 4I55F 5ALMA 2Q5LA 1DKUA 2BEUA 2JBAA 2ZUWA 1QYCA 3N8KA 4HYEA 1I24A 4RD1A 4BKRA 5CH5A 3LH5A 4M60A 1KY4A 3CVXA 4LDPA 1YQEA 1IM5A 1D3AA 1R6BX 4O4HF 4TUYB 1E9FA 4DUYB 4B6SA 4NBWA 1WB6A 1Y37A 4R1OA 4DLYA 5DYTA 2XWSA 1HDIA 1UXGA 5C7OO 3NP9A 3BORA 1QGAA 1Y9EA 3H19A 4TV8A 4BY9E 1DWQA 3AERB 5K0BA 3AB8A 2LXNA 1XJ5A 2D0IA 4B9AA 2FMHA 3NG1A 3N8IA 1S2GA 1B8PA 1UP6A 1YS4A 3R3JA 5LD2B 1FP4B 1PNVA 4DRXA 1XKLA 3LKDA 2R85A 4F5WA 3R2JA 3K2IA 1F6BA 1YS7A 3H1PA 4B2IA 2IOYA 2WUWE 1ZIPA 1ZC4A 1YKFA 2GHQA 2B8JA 4LYDA 2RB4A 3OO1A 4IJMA 5EJGA 2QU7A 5HE8A 1QYVA 2R8YA 4XR9A 4F3RA 2ZRBA 4KXFB 2R6JA 3Q3IA 4PCLA 1AUPA 2G28A 2E37A 3HCWA 4IGEA 3WLKX 2EGGA 3IEVA 1PS9A 1Z45A 3URMA 3DAPA 1H9BA 1NQVA 2V65A 1N8NA 2NPIA 2QN7A 5C31A 1LBTA 3HXOA 2H2AA 4F2DA 1YQ9A 3CMCO 4GC9A 1J2JA 5CM2Z 4YXFA 3KKPA 3C15C 3Q7IA 4OJNA 3A9SA 5FR2A 3H2KA 5CD9A 1BE6A 3GRRA 5KTPA 2NUPA 1N6PA 3G2MA 3ED5A 3JQBC 4KN8A 4NEHB 4S12A 5CXSA 2UKDA 3M5DA 2OY0A 2OTCA 4UDOA 3WSTA 5K0ZA 2Q2OA 3SEQA 3OEWA 3T7RA 4QLOA 2QG9A 3R5FA 4R5MA 3S68A 2R5FA 2P6UA 4JEMA 4G0WA 1JBQA 4UFPA 1I1NA 4U3JB 2QXTA 3AFOA 5JYEA 4FB5A 4F3YA 2V7QA 1GTMA 2IW1A 5CFQA 4ML3A 2M6RA 5T7BA 3KYDA 2NU7B 3TD6A 1G3QA 1RP1A 4FM9A 3DPIA 3UKDA 4HYQA 1EA7A 1UDWA 3DMPA 1KO4A 3OQIB 2Q0SA 1VCIA 4B35A 1HR0B 2G9VA 4IBOA 2TRSB 3EG5A 1QFSA 4QPPA 1NFFA 1UDBA 5FTMA 2WJAA 1L5HB 2E4UA 4HKTA 3TLYA 3AFIA 1RQLA 5J2UB 3QLVA 4MUBA 2B4AA 2IIPA 4PAMA 4AS1A 4IV0A 1KO1A 4LGCA 2V9PA 4FDMA 3ISVA 5I7FA 3PQ5A 3O90A 1RKVA 1Y8RB 5C4IA 1V16A 4A8PA 5JDCA 5LQRA 1KFJB 4IKOA 4R84A 2IPMA 1L5KA 1Z9BA 1QQBA 3QIVA 1J20A 3AWIA 3P20A 3TX6A 3Q8KA 3G0DA 2C9BA 2Z2ZA 3KFXA 1AX9A 1U5BA 1X1EA 2ZYAA 3GRCA 5I45A 5KVSA 3O9MA 4KCGA 5J63A 4X1YB 4AUNA 3B1XA 4BE9A 1IHPA 2MYTA 5FEUA 1COWD 1P2SA 4UDNA 3B8HA 2WV7A 1DQZA 4BBJA 3KJXA 1N2JA 1Z13A 4CJXA 3ZNPA 1MAAA 4ZMRA 3DBIA 5CLLA 3S8EA 1AT1A 1GN9A 1LQ2A 3X44A 1PV2A 5JV5A 2FAXA 1A4XA 1L7MA 2OR3A 3TCXB 3U7GA 4V0SA 1NN1A 5HBGA 1U2EA 1G5QA 2CDAA 2JD0A 1K97A 3DOHA 4LYHA 4BTEA 1WL8A 4D5GA 2VTKA 3DMTA 1RDFA 5FFNA 3RWOA 2J7PD 2WU8A 3PWTA 7GPBA 1Z7WA 1ULBA 3IP8A 3KSUA 3L7LA 5DLQC 2ZSBA 4FHCA 5IUKC 4B32A 1GFSA 3DE5X 3GG9A 4ZOLA 4NYJR 1SVMA 4TQUS 1SQGA 1TUEA 4LN1A 2VBGA 4NP6A 4AYXA 4C4SA 1W48A 5B2FA 2XRZA 3G9XA 3NTQA 3HVKA 3G5MA 3I53A 1ID8A 2EFHB 2RHMA 2QTCA 3EMDA 3CTMA 5AMXA 1TOAA 2HIAA 2WWYA 1KQFA 2WF7A 5CFNA 4IJVA 3PDHA 4X1IA 4C5BA 3D31A 2Z6UA 4KMRA 1IBMB 5A4KA 3FCSB 5F3DA 3C0KA 2OQIA 2CVFA 2OWDA 3D4OA 1GQYA 3IUBA 3NFYA 4WLEA 3LOQA 5IABA 4MLCA 4GVPA 1G1AA 2G4VA 1A8IA 2DJIA 5L7WA 4QT0A 1RLMA 1FP6A 1VFPA 2OAQ1 4CL2A 1NLYA 3LO5A 1CY2A 1CRWG 2IH2A 4XUDA 1XXHB 3LKVA 4CLXA 3ONNA 5LP6C 3IUMA 4EFLA 4M6WA 4O4LB 1AMNA 5DH9A 1JTVA 1XF1A 4C4XA 1E3JA 2B99A 4MGYR 1G20A 2JD2A 1P4HA 3HO8A 2HMSA 5E4TA 5C80A 2JAHA 2ZZMA 3TZHA 1UJ6A 2FJPA 2W6ID 5IF9A 5IT4A 4I6GA 4HB4A 3L7YA 2JGLA 3G13A 3I4CA 4M0KA 4OUKX 4RACA 5AI6A 5BPFA 3M8KA 1C2YA 1ZUHA 3RIGA 2QR3A 3CXUA 4S2EA 2NVUB 3FTQA 4DRZA 1Z7YA 3E23A 4KFRA 4OFWA 3QTBA 1VJ0A 3OJOA 2EHDA 5E2BA 3W34A 2Q99A 4EVRA 4RCZA 4S3MA 4EECA 4S05A 2OCXA 4F71A 1GXSA 3B8EA 1E3MA 2YYZA 4Y1EA 4MPRA 1G8SA 4LECA 1C5KA 3KQTA 4NZNA 5ECYA 1V8PA 2PY6A 1JN0A 1MFZA 5DHRA 5JO0A 4FR5A 2HA0A 3BX1A 3OHSX 2VA9A 1I1QB 3A4YA 2FDRA 2OV3A 4RIGA 1ULAA 3RRYA 3X43A 2GYWA 2XQGA 3MWFA 4C3VA 1XA4A 4BV9A 2WEKA 5CCBA 3GLGA 1WDWB 4ZVVA 1T13A 1NUQA 1Q1NA 3I28A 4B85A 1L7EA 4UPVA 1DMRA 2AXPA 2RE8A 5HQTA 1MRSA 2Q5CA 1P5HA 4MS4A 2E4AA 3HR4A 1LPSA 2H11A 4ODIA 2YYSA 3HFJA 4ND8B 4S2UA 5EJIA 3VX4A 4CLOA 1DARA 1LPOA 2CYAA 2D59A 3ODGA 1PO7A 1U0HC 2BUBA 2J0UA 4IXMA 2E4WA 1NPDA 1X1DA 2XD4A 1E2IA 1EM6A 1TW3A 2D3TA 2RJOA 3JQPA 2HRDA 4DMGA 2CDBA 2HIGA 4F2GA 3TTTA 5DNEA 3L84A 4BP8A 3DLBA 3UMVA 5GJVC 5CW2A 5JYDA 2ZYRA 4W5QA 3VDNB 1E2HA 3F67A 4EGFA 3ZU6A 1WXQA 3FRIA 4G6ZA 4ALIA 1CFJA 4ILKA 5A0FA 1Z38A 3KLOA 3OKPA 4HD8A 1ZITA 4V2UA 2VZ9A 1AHPA 1O0CA 4QDUA 3GV0A 3PQ7A 3AVTA 2GLTA 3F7MA 4BVGA 3V4PB 2D8AA 1H8HA 5D8DA 5DKFA 1AGYA 2OXCA 1J8QA 4K6KA 2HDHA 2ZYUX 5L3ZA 5HK9A 4KIUA 4J49A 2YXLA 1W76A 4ZTUB 1RP7A 1UINA 4IUYA 1ZRSA 2W8BA 3OTHA 4CMAA 5DLYA 2OHJA 3CIFA 4F4DA 1PYGA 4CG0A 1V39A 3R3WA 2C2ZA 3LP5A 4GWLA 3SQDA 4CM4A 4OYLA 3BJIC 5DZSA 4F2WA 2R8BA 2Y9MB 1QLWA 2O07A 3T7SA 5C1DA 2AEMA 4HAZA 2R0QC 2ZJ4A 2GEJA 2CHFA 4GHWA 1OD6A 1TVEA 3M6UA 1EHCA 2BKXA 2VZEA 1MOQA 4DEXA 3N87A 3EGDA 1JIJA 1U8TA 3QW4B 2WFAA 1WCXA 3GEEA 4LSMA 5CB4B 3K0FA 4GF5A 2ZCJA 2WYIA 4FYYA 2R2GA 5A6VA 4IJWA 1ZCBA 4UNQA 3Q87B 4FYJA 3RRJA 2QL7A 5K51A 5JARA 2EF1A 2FUNB 5KYXA 2JLZA 5EP2A 3FPSA 3BHMA 5FV4A 4PIMA 5SYMA 4C4TA 4IDOA 4GMXA 2GJ9A 2B61A 3LD9A 3NTOA 4TYMA 1PZFA 2ZDGA 3UT5B 4CF4A 3K0AA 4TVSA 1Z4PX 2IXTA 3B1JA 3NVAA 4LF6B 2Q49A 1F14A 1T29A 2YMQA 3BMCA 1XTPA 3C3JA 4I4TB 4RELA 3KJHA 4Z4FA 4GNRA 4WFKA 2HFJA 3S1LA 1ZOSA 4LRYA 4WKGA 3TEFA 5TMPA 2CFTA 1ZHOA 3N7AA 2NV2B 5IU6A 5JLJA 3N74A 4FYVA 2VJPA 3OZSA 1OLSA 4U00A 5LVAA 3WS7A 3O8CA 3AF1A 1S2IA 2G70A 2JC3A 2PH5A 4G5FA 2WNIA 3LHSA 3ROXA 3DAHA 3PC8A 1OLUA 4GZ3A 2J1LA 5AHXA 3DXZA 2AI3A 2OP0A 3IOCA 1UAAA 3DMRA 2YFQA 2X5OA 4AROA 2OYSA 3HXPA 3OZAA 4X95A 1E1DA 1RHMA 2WAYA 1SA0B 1VBMA 2XMPA 2ZSUA 3GDWA 3HADA 3KTDA 5AI0A 3UJHA 4C3UA 4WZ6A 3W6OA 2HTEA 5IJ0B 4FWBA 4DA4A 5DRYA 1ZQ9A 2P3LA 3QPUA 2JIZD 2BFOA 3VU1A 1V9CA 2QRGA 3CUVA 1C41A 3HP4A 3DBLA 2BEUB 5BVHA 4J1NA 2BCEA 4G1CA 1H8HD 2GSWA 2H3HA 4JQSA 3P9IA 3PTZA 4RZUA 3GNTA 4TRRA 3PX2A 1KMQA 1HOTA 4TWZA 2B2XA 2C84A 2AJDA 5IAGA 2D5LA 5H68A 4CHGA 2WT4A 1UADA 2AOVA 4FK8A 1FQKA 3PKJA 4HFJA 4KO4S 3M81A 3IAXA 3RU2A 3ESAA 4Y0NA 5FQOA 4XAQA 2VYCA 5AJUA 3D2BA 1NZDA 1E3IA 4E2WA 4REQA 1SC3A 1NULA 1SUFA 1S5PA 4PVDA 2XCIA 4WKCA 4KJZA 2Z56A 3U1VA 4IWYA 3NRBA 3JQAA 1M6NA 4JR2A 4Q4JB 4JXKA 4BMXA 2ZPTX 3AI2A 3LPDA 4PLYA 5LBUA 2VQFB 1MO3A 1R4MB 1PR3A 3D8NA 2ZT8A 2D1FA 4UTZA 5IYZF 1JZSA 3M33A 3MWEA 2BTOA 1ZGAA 3MUOA 1UFVA 3MLBA 3D5TA 5C32A 4G0VA 5K99A 1IXSB 2FG7C 5J2TA 2PX4A 4AZ0A 3OD1A 3NGMA 1NQ5A 4G5GA 4LMPA 1REQB 3RSGA 2XCQA 3MTGA 1O94C 4JNCA 2I2AA 3UIEA 4DQ0A 5KNCD 2AG5A 3DE0X 1LLUA 1J49A 3DD5A 3LLCA 2AI1A 3O4JA 4KQGA 2J48A 5EZYA 4CBVA 3KEQA 3DOCA 3VMMA 2HAEA 2NSYA 3U0BA 2IXBA 1E6LA 2NUPB 1XSEA 3RSFA 3W5VA 1TD9A 3W8DA 1JKJA 1O4WA 5ER6A 3PWZA 3TK1A 3DHNA 1XA3A 1XDSA 4Q7QA 1J4AA 2W4MA 5L45A 1MZPA 5BNIA 3DE6X 2PU5A 3IERA 3IQIX 5TMDA 3ANMA 1AUOA 5MN6A 2B8EA 1UM9B 3BD9A 1TJNA 3UMSA 1L4GA 2YICA 1JHMA 3VX3A 3RSQA 1T0PA 1PI3A 5BQPA 5TY0A 3AL3A 4HDNA 4QYSA 1XCGB 1E64A 1T25A 5BMOA 2FUG6 4JA0A 3WGIA 3STTA 3QTTA 3RM3A 3WMGA 5HW0A 5E95A 4WLFA 1D8AA 4MAMA 4FX5A 2VDQB 4G9EA 1BA3A 1BGXT 1S7CA 3EUEA 4QGAA 5LIRA 2UYQA 5LQMA 1ZD3A 4Q15A 1DKQA 3EIOA 2DC1A 2HK6A 2IOQA 3KPYA 4A1FA 1C3OA 4TTRA 2O2SA 2HU8A 4R1PA 1QG6A 5BSVA 2IUUA 1SXPA 5AKKA 3BWBA 4OXXA 3REOA 1IOWA 1C3LA 1GGHA 2ZLBA 4GXRA 1XWIA 3WQBA 1U5BB 1WW3A 4IPTA 4U1RA 2BBWA 2ZIXA 2VRWA 3I1FA 2QVGA 2AE1A 5FFMA 3DXXA 4CM3A 4MKXA 5KTTA 1EVJA 4AJ4A 3QBEA 1G9TA 4XWTA 5EE9A 5G53C 2HCFA 2R1TB 3R20A 1NI4A 2X58A 4HH0A 1A5SB 4R3NA 3AFHA 3JQAD 2OYRA 3C7AA 1ORIA 2QTFA 5DU2A 3TKYA 2WLTA 2DCMA 2M1ZA 4KUEA 3VTAA 2BM1A 1L4HA 2IYUA 2Z2KA 2HQOA 1ZU5A 4RD3A 3Q9LA 1OMOA 3QVGA 5G1NA 3RUIA 4Q4CA 1SKAA 5IHPA 3ZE0B 1S1MA 3KNZA 1ADBA 2GAOA 2DUUA 3HWSA 4CETA 3T3OA 1W96A 4YJ2F 1G6HA 3PU6A 3AU8A 3WK7A 1OF1A 3FA2A 1NP3A 1G63A 3EQ9A 3FLAA 3QE2A 4G09A 1P8AA 2NU9A 3EE6A 4I1YA 4WCVA 4LXGA 2RG7A 1BCRA 2G1KA 1U81A 3DE7X 3KZOA 4UEJA 2R1UA 4RVDA 3RVDA 1AKTA 1W1UA 3EQ6A 3U49A 1P60A 2ORVA 3PHJA 4MQ5A 4TWBA 1Q0TA 4Z3OA 2DVMA 1DTSA 4XLTA 1M2WA 1KYYA 2OV8A 3EB9A 3KOYA 4IG9A 2GS9A 3SQXA 2VYNA 1RIFA 4C7JA 3ZD8A 1MF7A 2IRWA 5TNXA 4OFBA 3TKAA 3OCWA 4Z3KA 3GVIA 3BSYA 5CDFE 1V2GA 1YL7A 3A10A 5I47A 3EBOA 3RHSA 2GD0A 2QI9F 4DXAA 2BFBA 4EJFA 2AL7A 1VPEA 3P0EA 4N12A 1RZ3A 1QIJA 2O9JA 3T5CA 3R24A 3H4MA 1ML4A 3IDSA 3PJDA 3DNFA 4KLNA 3AXTA 1JA9A 1CSEE 5BWNA 5JNUA 3NIWA 3FWPA 1HPLA 5IVKA 3WLAA 3E1GA 4MUFA 4FTWA 3BG5A 5EUMA 1L4BA 4MUJA 5CK4A 5KDLA 5JCPA 4K1LA 1DO8A 1FTYA 3K9HA 3HVHA 3P2OA 2ZRQA 4M8IA 4YRCA 4UXHA 4LC0A 3R7LA 3UXEA 4B3TB 2DKFA 4G0UA 4GICA 4CU2A 3CLKA 2GA8A 4NK5A 4GXNA 2IE8A 4RWZA 4C30A 4Q34A 1RYMA 1JS1X 1ZL2A 2BFPA 5CVTA 3UBTA 2D2VA 1ZI6A 2A0WA 5HUHA 3EC2A 1BAPA 3G2QA 1GXSB 3VGPA 1GNRA 5F3RA 3DFZA 1M75A 4EY4A 2J0QA 1SOWA 4H6PA 2OESA 3KT3A 4JUCA 3TQSA 3K9CA 2X41A 4IDFA 1SHLA 1XALA 2O7RA 3BMQB 3EFEA 1WSDA 2G25A 3F7OA 4RDCA 5SZKB 4CCWA 3QUAA 4CLHA 2XADA 3IMEA 2Q2WA 1LPNA 3MJVA 4IHAA 1D1TA 5HDBB 4AM8A 1A1VA 2I2FA 1E92A 1JSXA 2ZRGA 3IMCA 3O6VA 3GLGB 5H0IA 4F8YA 2A4MA 2JJ2A 4GP9A 4DSUA 1E18A 1BOOA 3D3QA 1R8QA 3TS1A 3T7JA 4UAUA 3OE4A 1E32A 1EU1A 2W11A 1HBJA 4TSRA 2WUGA 4WI1A 4UUQA 4E88A 2J9YB 4F4HA 2BGGA 1DZ3A 1C1DA 5M5BA 2PO5A 4FLMA 2KHZA 3VDRA 2DB3A 1FFEA 3T1TA 1KK3A 1QKKA 2W2OA 3R6TA 4QUGA 4E1VA 2LNDA 5BSTA 621PA 2BEJA 3ZU2A 4EM6A 3AR3A 1DTWA 1Z37A 2G1UA 3A28A 3AUSA 1Z25A 5LD2C 3U9LA 2AA3A 3Q40A 1JYEA 2WVAA 4OB7A 4ARVA 3A36A 3PQFA 1B73A 2WHRA 2NQ2C 3D2AA 4OHWA 1T5LA 2WHPB 3HSKA 3OD5A 2OD9A 4Q6WA 3IVAA 3G79A 1FFCA 1QX3A 4V0RA 3Q1KA 3JQ7B 1Y3CE 4MVJH 1WXGA 1GTG1 4F8JA 4WZZA 4DVGA 2A1UB 2IZ7A 5NULA 4BB0A 1EUCB 1PZEA 3RLFA 1SUDA 5F7OA 5FPKA 3IQHX 1JSRA 2OZPA 1E3EA 2ZSKA 4BKOA 1RWNA 2HTFA 3WIOA 1Z06A 1WB9A 4X8MA 1Z83A 3B6MA 1FLVA 3J81k 4KEAA 1EE1A 1RC1A 4X8HA 4M46A 2OCGA 5GM2A 2X7JA 1J0CA 1RXIA 2PUWA 3MMNA 5D5PA 1JDNA 5I6DA 1EQUA 5A3QA 4ALLA 2DECA 1HRDA 5AI5A 3ZWYA 3V48A 1U0RA 3IXMA 1ZH4A 1RXSA 2PZ8A 1T8TA 1ZH6A 3KV3O 4ZVKA 1LDYA 3T34A 4ARZA 2QAGB 4XW2A 2J3QA 1AHIA 1J2YA 2ZEJA 4E4TA 2Q8NA 4NYIR 2ZSIA 5IFKA 3WGLA 4CIVA 5INTA 1UKEA 1XYGA 4DXDA 4TLMB 4J16A 1XDBA 3A9WA 4BFXA 1QV7A 1V5GA 1EP2B 4F6RB 4WZAB 4Q3NA 3N6VA 1D0IA 1QRRA 2QXUA 1B00A 2QKYA 3AKYA 5GY7A 5BY2A 5DYNA 1N2ZA 2JJ2D 2PS1A 1O9GA 3BAZA 5FWNA 2PMFA 4G4IA 4O1HA 2KMLA 2O2DA 2XOKD 1NRJB 2IEBA 4MVJE 1X7YA 4N3NA 1OKKA 2B1IA 2ODBA 3AZPA 4R1NA 4R16A 1OLUB 2G7MC 5GONA 5BSMA 2JLVA 2VJKA 1GKIA 2IWRA 1SHUX 1TJ4A 1ZH8A 1FF9A 2GZMA 1Q0QA 2DJ5A 4NOMA 4W9MC 3JQ8A 4NOJA 3HVIA 1BROA 1YR3A 4N0MA 5I7SA 2OFPA 1I7NA 3JRNA 3FNIA 5LP1A 3EGVA 4KI0A 5KI6A 3NTXA 1XLUA 1XROA 1NG9A 2IBMA 3HDVA 1JPVA 1LI4A 2GETA 2QN6A 4LZZA 2GPBA 4NC9A 4P1ZA 2H2FA 5IVIA 2ZBEA 1ABBA 1OTYA 2KX7A 5T64A 4X54A 2GYYA 2AVDA 1U31A 2JBHA 2PYDA 3C98A 3WSWA 2H5JA 3ZWOA 4A6XA 5ADUS 4NYMQ 2RGRA 2GMWA 1B6TA 1YFKA 2NZVG 2L42A 1T6ZA 1V6AA 3AG6A 4PO1A 5K2OA 1DPFA 1WG8A 1IIBA 5E1DA 1ZA2A 4RY2A 1XMPA 1JVBA 3VYVA 2HHCA 3QMMA 1ND6A 2EKPA 4H6WA 5F7JA 4F2PA 5IF3A 3QITA 4M37A 1M67A 5AIAA 1GJRA 1LA2A 1BDMA 3IDQA 3OWXA 1M1YE 2V7BA 3GK3A 1AZSC 3GYBA 3L49A 4K9QA 3ZK8A 4RTLA 4B3BA 5I8WA 2WMDA 1SQFA 3OMXA 3JQAB 3R4VA 4M7PA 4M53A 1FVFA 5H9WA 5KNBD 4FYXA 4ZQIA 5JSHA 3USCS 4F92B 2V1XA 1D0VA 2SKDA 4JVSB 4LTNA 2PMEA 8ADHA 2FEOA 3NZEA 1S8OA 4XUEA 2R6R1 5DTJA 3REGA 1KJWA 3WRXC 3ZV4A 4E7OA 4AMVA 2O5CA 4JR0A 4ZODA 1ZOIA 2ET6A 3VBCA 4K6FA 3KOXA 1CUAA 1PJ4A 3QVUA 4XLZA 4KLZA 4CI9A 4DA7A 1WABA 5LOVB 1XD2B 1HXHA 1TM3E 2VEDA 2I2CA 5BSEA 4Y2SA 1KSJA 4FDTA 3U17A 4X62B 4G0PA 4X94A 3ZX5A 4FW9A 3VPAA 3AEQA 4LDZA 4H1UA 3WADA 1ACLA 2H92A 4GQBA 4PO9A 2G0AA 5EL0A 3ZY3A 2Q1XA 2Y1KA 1BHJA 1GITA 5DNAA 5CB0A 2J07A 2NSDA 1RQXA 4I1IA 3ITNA 3SX4A 2IK8A 3OEEA 2EKDA 2JGEA 1VJDA 1W5SA 2IIVA 2WJVA 3FR7A 3TMYA 3URKA 5K0FA 2A3RA 3DEAA 3MWDA 3QELA 4HRAA 3INYA 3N8HA 1TIBA 4ADSG 4JKYA 2QRHA 1ZCAA 2X22A 5FI3A 1T9KA 3ZS9A 4QDKA 4V1CI 5DWQA 3FNQA 3PGLA 2ADOA 2R5NA 3CZ9A 4L07A 3U39A 1SHKA 3WO1A 4I9FA 1QPBA 4TLEA 4MRAA 5JC1A 4ABTA 5KUTA 3ZBTA 2WG0A 1J5PA 2XWBF 4PG4A 3VBEA 1NIJA 4PC6A 2HR1A 1YB2A 4QX6A 4Q4LA 2GN8A 4QXMA 4X0EA 4IVPA 3ZCTA 3GLRA 3GLIB 1KXZA 1LSOA 3W5IA 2C4TA 1J99A 2PGDA 3GFVA 3I8XA 2EJVA 3AB3A 3JW8A 4N7RA 2IZZA 2D0PB 3OJWA 4Q3EA 4BC1A 1KAMA 2J5BA 1X0XA 4P2GA 4EY6A 2QN3A 3BXGA 3QX8A 4I2NA 2BGIA 4IFIA 3GNQA 2F3UA 4QQRA 4QXQA 3C8HA 3E9MA 3L07A 3RIYA 3RE1A 3W2FA 5KWSA 3SVLA 1KZGB 2ZIXB 1E77A 4F9TA 5IM4A 2XE7A 1WQ1R 2M32A 5ALEA 4TTIA 2KM1A 2VJMA 1XZQA 4FBLA 5EQJB 1PR6A 5ULLA 2P4HX 2VG8A 5BRJA 1FUUA 4R9VA 3R8XA 1VPVA 3CH6A 1F9EA 2VDWB 1MAUA 3ANYB 3CX8A 3EBLA 1J0XO 1QP7A 4BQNA 3HA5A 3C5WP 3U4GA 2FPOA 1KQPA 1FU7A 4LOJA 5AW9A 4HJRA 1YFZA 4E07A 2CDCA 5T3YA 1UEJA 3ER6A 1LS1A 4U7FA 3I5YA 3MD0A 1FQOA 4PLHA 4TMVA 2A67A 2V4UA 2HU7A 2AKAB 3DJYA 3QWAA 3FPAA 3B3QA 1BWPA 3V6LA 4XQCA 4DDVA 4DIBA 1BDBA 1EK6A 4IILA 4C06A 1BJRE 2XZLA 1BCRB 4IUCS 4D3YA 3ICCA 2E6KA 4TWIA 2Y6VA 3ZQKA 4BX9A 2VPYA 1RABA 2F9LA 3BIOA 1V37A 5E6SA 3BXPA 5JIBA 3KAKA 1KVUA 5ICEA 2I2WA 1UWVA 1W93A 2CFOA 3GJXC 1YXMA 4HAIA 16PKA 3CN9A 4LHWA 2C8JA 3QV2A 5C5EA 4TT3A 3UQYS 4EPTA 4N76A 4NXMB 2P0EA 1V48A 4FEYA 5EN4A 2WQZA 1B1CA 3STYA 3GN2A 4IF4A 3D8TA 3KZVA 5JQGF 4FFLA 1HLGA 1TMGE 3BILA 4DJFC 1ZK1A 1AUVA 2ORIA 4ATNA 2K2QB 1GZUA 3A6HA 3ZTYA 1KMIY 2B8TA 2QU8A 1YAJA 3QI7A 2PBZA 2VNAA 2WILA 1NUHA 4JQZA 4F4CA 3ROKA 1KY2A 1Y7PA 4WBNA 3VKHA 4G84A 2GN9A 3WFJA 2HUPA 2R4TA 4BRWA 2W2KB 5DXJA 5A9RA 3UUFA 3H9EO 3F6EX 1VI5A 1EWRA 4FW8A 1KSFX 2ZATA 3IMGA 3OJXA 4V0ME 3KXIA 2CEKA 1MG5A 2JI7A 4UMEA 3DDZX 4YS6A 1YFLA 2ZBGA 2WU1A 1OFVA 2MWMA 4PTZA 3CB4A 1YB7A 4AMYA 1VA4A 4LHXA 2BOVA 4L3WA 1ISPA 3TG8A 3AQIA 4A6PA 1E9AA 3TSZA 2PUJA 1ZM7A 1A77A 1KOFA 1ZW6A 3AEYA 2PLFA 1I7QB 1T2VA 1CRZA 1ZEMA 3QRWA 3NIDB 2Q5EA 4AG3A 1VPLA 2P2LA 1UBEA 2L0XA 3G23A 4Q19A 1QYRA 1Z3CA 2O3SA 3NJRA 3V34A 4C43A 3QHQA 2OXTA 3CT6A 2VPIA 1B43A 3QMVA 1Q57A 3DDSA 4D81A 4EX7A 1DQNA 3E58A 3K32A 4FHZA 1FTWA 4PPYA 2BLLA 4MW4A 1R0XA 1UBSB 1KU6A 1Z6QA 1UP4A 1KORA 1Z39A 2BPOA 4O29A 5DBIA 1YI1A 3TMAA 4F7DA 2LDXA 2F1OA 2WJIA 1IY8A 4PVCA 1E8NA 4YQFA 5JSKA 1R0BA 2UV8A 2ZBPA 1WULS 3S2UA 4RETA 2G4CA 3H1EA 4ZAFA 4EH1A 4BWVA 3JR3A 4BQOA 2XRFA 1J5EB 3AIKA 4DDHA 3P0FA 1YTLA 1TCCA 4DLPA 4JL5A 3E7WA 3NRCA 1ESNA 1I6MA 1T5IA 1W44A 2FETA 3FBGA 4FMDB 5CNMA 521PA 3V7UA 3DVQX 1UT8A 5E9AA 2ZR9A 1R6UA 1IJEA 4N18A 1TAUA 1FE8A 5B1IA 4PLFA 1ND5A 4QULA 2P9FA 1DTWB 1TCBA 4LF7B 4C7OB 4B76A 1CUEA 3ONWA 2CD9A 3W8EA 4ZKEA 1OCEA 3N7TA 1OWPA 4P6VF 2G5TA 3QUBA 4RESA 1W0JD 1OYYA 3NU1A 4IO1A 5CURA 1RFGE 1PS8A 2PR7A 4UVGA 3O9ZA 1F6DA 2H1OA 2NZUG 5EQDA 4DNPA 4E7PA 1BJTA 1EKXA 1VZ2A 3KTAB 3RSLA 5C8DA 4WNAA 4GOKA 3QFFA 4A23A 5F1KA 2HJHA 1M8JA 1E2PA 3QNUA 2C0PA 3IR5A 2P41A 4RKRA 3DTVA 3G88A 5AFSA 1I0LA 4YUZA 4URVR 5C8VA 1T4DA 3R5SA 1T36B 3UAXA 4W1SA 4BX8A 4L5JA 3T5AA 2G0NA 3MAGA 1G8YA 5DYIA 1SNYA 4HWSA 2EBWA 2NXWA 4I8XA 3PXXA 3RGGA 1YVRA 1P7ZA 4LVCA 1ATIA 3K8ZA 4HSEA 4NK4A 4ALJA 1GRRA 2HIHA 4XLLA 3RBXA 1XRJA 4K1XA 5A6SB 3RJZA 3WWZA 4AS2A 1SK8A 2XA1A 3TWOA 1SZCA 4PRLA 5LBTA 2BISA 3BEOA 1IFXA 2VWGA 1K9VF 2FW1A 4J0IA 3FNGA 1MIHA 2QTBA 3F8TA 1XZKA 4ZOBA 2FR8C 1ZO8A 3KQWA 2P9TA 5TEVA 3IQEA 1RXVA 3KD2A 1GU1A 3MMSA 3EHDA 2H4FA 1HNZB 1U0LA 1T3GA 2HKIA 2PZMA 4ZWNA 3WP0A 3ZDZB 2VXYA 1MDFA 4C2BA 1A2KC 1QOPB 1OILA 2JA2A 3H9UA 2W2LA 3D7NA 3TRKA 5FUMA 1PNOA 1F3LA 3O92A 3VTKA 2OCIA 3GELA 4R0MA 2YXBA 4GG1A 4ZHQF 2IDZA 2AC7A 4E22A 5LA6F 1G21B 4N40A 4EA6A 2QUHA 4FIZA 4RE6A 4K6HA 3MCWA 1X7YB 1AQ6A 3G2PA 1B0UA 4HLUC 5GONB 2LBPA 4UEOA 4NTZA 5B6PA 5FUYA 1EP9A 1SCUA 4MPDA 1JDJA 1XRMA 5H9VA 4DARA 1P0PA 4I9UA 5B7QA 1ISGA 1O5IA 3EBPA 1IXYA 4HAWA 4DQKA 2GCIA 4LCBA 1DWUA 2WD9A 2ZUVA 4ZV9A 4CKWB 1LU9A 1MIOB 4Y6SA 5DYGA 1FNBA 2JGAA 2MR5A 2ZI7A 3OCZA 5TV2A 3CZ5A 2ID4A 1JRLA 3HFSA 2OGWA 3ABQB 2G1PA 1EGAA 3EGXA 3K5PA 3L6DA 2PWYA 1XKXA 2G6TA 4PLCA 1WWKA 3CX6A 3HFRA 1NW8A 3D5QA 4MTCA 2WF6A 2ZR0A 4TTQA 4CDRA 4DCJA 1KPGA 4IH4A 4Q39A 3TLBA 5IM5A 4EA9A 1NVDA 3ISTA 4YMUA 4UQLA 1I3OA 2WYVA 5H70A 1QF9A 3UY4A 1OJ7A 2WF8A 4MKIA 1BCSB 3HUFA 3DEYX 1QGUA 4QLBA 1T43A 4EGAA 1D9ZA 4YI3A 3QW2A 3R3ZA 1EESA 2C2MA 4B6EA 5F2KA 5JSQA 4RF3A 3DONA 3TDMA 4II7A 4PYQA 1CQPA 2P75A 3BGIA 4L5YA 3OICA 1EWKA 5I8ZA 5TT0A 1NOKA 2AUMA 4NZ9A 4TKZA 4CR6A 2A0YA 1SZJG 1EUQA 1S2OA 2R7NA 1PSDA 3LQFA 1XRNA 2YN0A 1J8DA 2AQKA 2XUQA 1TM4E 2QTVB 3R7WB 1FVOA 5CRIA 3LOPA 3EH2A 3MCTA 1SKYB 4ESOA 5LQKA 1OI7A 5LQDA 4C04A 5F2OA 5CFRA 4RSRA 3UTDA 1L5RA 2BEVB 3G9UA 1YIDA 2PS0A 1A9QA 1UOPA 2RHWA 1M1ZA 4D0LB 1OU0A 1VE6A 1JTEA 1X13A 3JYHA 3P94A 1RM3A 3EF3A 2QAJA 4GXQA 4K7JA 1I32A 2AZTA 4EKYA 5FPYA 1GZ7A 2GM9A 1NOIA 4BDSA 3E15A 4H4DA 2YIDA 3BQNB 4HGRA 4P7KA 1N75A 2A86A 1RKQA 1XVVA 1RKXA 2D5CA 3D7SA 3DDUA 3OPXA 4LSZA 4RQUA 1PWZA 1U3CA 1YI8A 1YA4A 5FJJA 1D2HA 3ZZ0A 2K6GA 2FK7A 4C4YA 1OFUX 2ODPA 3IJRA 3IAUA 2X2OA 1VLQA 4K9LA 1E8MA 4ZO6A 1RQPA 2PD4A 3MTEA 1E2GA 1ZNWA 3HU3A 1H6BA 5CCEA 4MS1B 5JNVA 3L4BC 3QKTA 4JAVC 3W9UA 3X2SA 5AJTA 3QA9A 2GEFA 3MWDB 2QQ5A 3HJBA 1SC1A 2C7BA 1YR8A 4OXKA 4WVLA 4U7HA 4C0JA 1UBUS 1TEVA 3FMOB 3E1SA 4BFVA 2GEVA 3RS3A 3ELYA 3RC9A 3ZHTA 1JPJA 1PTJC 2QM3A 4L15A 2BP7A 2I8LA 4B4KA 1QVZA 3N2NA 4QECA 1KI8A 1EFUA 1GRNA 5EWLB 4B43A 2I22A 4CM8A 4KFSA 4RLSA 3KXDA 5EINA 1XO1A 4FMCF 4KW7A 4IXTA 2XYHA 3BL5A 1J21A 4JJAA 4R4JA 4WBXC 3WMEA 2WZDA 2XAUA 1I3NA 1AGXA 2V6IA 4E13A 1ZK4A 1EWVA 3QQ5A 5FT9A 4BAZA 4Z7OB 2GD1O 3W77A 2C58A 2QRVA 4IRUB 4ES6A 5LN1A 4ZT6A 1XVLA 5ERYA 4GRAA 2UUCB 3SLGA 4ISBA 1E96A 3GGJA 4JYBA 2X0IA 4KO8A 4PCVA 5FUBA 2XMRA 4AIIA 2F90A 5SY6A 5LSAA 2LW7A 2KBFA 2BC9A 4CUJA 2UUPA 3ITDA 3WBJA 4ZMBA 4DWJA 5IX8A 1NONA 1AKNA 2IPXA 3BICA 3EDMA 3V1TC 4CF6A 2PJRA 4M9SA 3KZMA 5SV2A 1NFQA 1U3VA 2I4OA 1A2BA 3D7KA 3I2KA 5DCYA 4HZUA 4K05A 3SQOA 1FUEA 4K9OA 4BXOB 4QPDA 1GL7A 5LXTF 3NRJA 1YR7A 2XA9A 2OC4A 2KW5A 2WABA 3DE3X 4PGMA 1H8EA 4AUEA 4F3CA 2YHUA 3PGMA 1NBOA 2ROQA 1F5SA 4E32A 1CDOA 3T95A 1R37A 1ZRHA 1H6CA 4OP1A 1NKSA 2ENWA 3INNA 1M5UA 3WK8A 4AJ1A 1D2MA 3WYEA 1AKMA 5BW6B 3ZYCA 1PFWA 1KH2A 1ODLA 4GLOA 5EJAA 3MA0A 1U7WA 1Z68A 3FDFA 4TLAA 1BX1A 4PNZA 1ORRA 3TRHA 2VT7A 1Y5IA 1F8XA 1ZCJA 1JAZA 5BSHA 1E98A 2IPAB 3V2IA 4OLAA 4V3BA 2HSJA 1NY5A 2D00A 2DHRA 3HYSA 3T15A 4AXXA 4F1KA 4L8YA 5KYNA 1KZ4A 4KR7A 2NTNA 1N8KA 2O8EA 1JMVA 1UM8A 1GWNA 4ILEA 1ONOA 2I7CA 1CT9A 4MGIR 1V7QA 3S70A 4GKKB 4TZ0A 1JWAB 1TUBA 2O7SA 3GHHA 1IJBA 1OXSC 1WXIA 1ZSNA 4QYIA 2QAGC 4LW8A 4PFKA 4PO3X 4JI8B 1U7TA 1Z3IX 1NVKA 2OB2A 2WSBA 4LRTB 4O4HA 2BVNA 2B5WA 2XRYA 3ETHA 1RRPA 5KNLA 3TF5A 3DAYA 5ALYA 1Q2UA 4O0LA 4GQIA 2GK4A 2CC2A 1G6KA 4O2BF 2V8BA 1VDMA 4OU5A 5B12A 1SCQA 4QREA 5ALGA 2WUVA 3VXKA 4AYWA 3WWOA 1Y98A 3VZSA 5A4DA 3QM1A 5BPHA 1PR1A 2R2AA 3FKQA 3MJTA 1H23A 1GV0A 1BXGA 2GBGA 1KETA 2XHZA 4TTAA 2B7BA 4TLLB 4YCBA 5D86A 5K3CA 3WIEA 3W6PA 3MRXA 5K6AC 1M1NA 1XCOA 2QBYB 4AS3A 5I7OA 2Q4OA 1XFAA 1L5OA 3VQTA 2QLMA 1GAXA 3FXAA 3NAZA 1KAHA 3AEZA 1QH1A 1U2PA 1UZAA 3UJPA 4CGYA 4QOFA 1PGNA 1A2OA 1NLUA 3LOUA 1XDWA 2BEWA 2W2QA 4NHEA 1PIWA 4TKUA 3PEWA 2R5WA 1SB9A 5AJZA 4NOLA 2BKLA 1SOAA 4DIMA 2B9VA 4KE8A 2LP4Y 4YJ3A 3L9XA 4H7PA 3VPCA 5CT5A 5AXDA 1IHYA 4CIXA 2ZANA 3PV0A 1G3IA 1ZDMA 1SU4A 4H7EA 3RSCA 3KQMA 2DSNA 2PRKA 3AVVA 4LYYA 3CINA 4KWEA 4F7WA 1WD7A 1U9CA 3E8SA 2DY0A 1E2LA 1H8ED 2EZTA 2IUFA 1NLFA 5GOTA 3TTWA 4GR5A 2H7CA 4MLZA 1P73A 5EESA 3GGOA 4MJXA 2BZGA 2QZPA 1UCFA 4MHSA 1A9TA 3HBLA 1SHJA 1DBQA 2R65A 3VKUA 5HG0A 5AK0A 5HP4A 4L74A 2AD5A 4EO9A 1PYOA 5JATA 2J9ZB 3H5RA 3E48A 4NZPA 3AL0C 1ML3A 2Y2UA 3E5MA 3L1IA 5ICFA 5DBGA 4N3CA 1Z5ZA 2EYQA 1E4EA 1KFKB 1G8HA 1EAYA 5I8PA 2X9LA 2NWQA 3B6IA 5HS6A 3ZOKA 1F8GA 1JQBA 2ZBUA 4IO0A 2XUAA 4NH0A 1F51E 2FZGA 4XI9A 5ERXA 4M0MA 2C7VA 3RUAA 3HFGA 4PSCA 1SULA 5K0LA 2O8DA 1Y42X 4YO8A 2RHTA 1QR6A 4YVFA 3WBFA 3GXBA 4W9NA 1VBNA 3PFGA 1DXQA 4C4OA 2WWTA 5TB5A 5L4SA 3LG2A 4BB9A 4F56A 3UVEA 2XIJA 1RJFA 4OI0A 1VRWA 2BGNA 1O97C 3ADPA 3DWIA 3K72B 5FL7A 4CMGA 3KUKA 2WAOA 1TADA 2SCUB 3G0IA 4DLVA 2WJYA 3FVQA 2KLBA 2RBGA 1ULUA 3LVQE 4WNCA 4DW8A 1G3UA 4DYHA 4ZGWA 3WNCA 4GKBA 2C78A 4F72A 1ZUD1 3BB3A 3X1YA 5CFOA 1ODSA 2CVZA 3R6DA 1K5DA 4OVKA 4EFMA 3QPBA 4B0PA 4US1R 1C8BA 4HQKA 2FWIA 5T67A 2OORC 3WOVA 2HLDA 4QPCA 1I2MA 2IYQA 1AQUA 4P31A 3DBRB 1DG1G 4AO7A 4BFWA 2QV7A 4NDAA 5LC1A 1NF9A 1JLRA 1GARA 1YMUA 3ACCA 4HC4A 1AM4D 2FW8A 4R1LA 2AJTA 3ECCA 2XWPA 5HZMA 5IKEA 1ZCZA 3V9PA 4B80A 3FG9A 3FMGA 3E3OA 5BWBA 2EBUA 3QF4A 2CMHA 4MKRA 2IS4A 4RMNA 4LXUA 5KO2A 1XK6A 3E7XA 3KM0A 1JX6A 1N4DA 3EF0A 3LW7A 3H2SA 2X3FA 4JHLA 3VHLB 2MMCA 3F47A 1O5OA 2K4MA 1P91A 3NHBA 4XIGS 4WOKA 4DOMA 2OBFA 1JU9A 1TVKA 4YGXB 5DSTA 4N5HX 2G08A 1IG3A 3F97A 4BJHB 2CDRA 1WSAA 3OAAA 1W4RA 3C5CA 4MUIA 1SBHA 5JQWA 2PUFA 1CR1A 2WT9A 1F60A 4AKIA 1UC9A 2GBIA 4WVFA 1LX6A 2JAPA 5I7EA 1EZ4A 5ALOA 1PFUA 3ES9A 1HE2A 4H4EA 4I1UA 2PUDA 3VV2A 3QPCA 1DV2A 4I5DA 4YLEA 3CLUD 4BATA 4FR2A 3LBFA 4K2HA 1QZTA 1XWWA 4AJKA 5SY9A 1I7SB 3L8MA 1RBZA 2WYOA 3EEIA 2JG3A 1TXGA 3MF4A 2YFYA 5J23A 2VVTA 3UGQA 1G3RA 3DO6A 3QVVA 5ES3A 2B82A 2C5EA 4XM1A 3MVEA 1OOEA 2OK8A 2C3YA 4FFBA 4GE3A 2VEOA 4RQBA 4GL2A 4RFSA 4L27A 5CLHA 1XYVA 3IMKA 3M6WA 1N5RA 2PPVA 2P2CA 1I4EB 2QWXA 2VP2A 3FPEA 4QIHA 4ZTZB 3JASB 3V42A 2VL7A 2R00A 4GIBA 4FDVA 3IKMB 1PDOA 1OBCA 4S04A 1EUDA 4Z9BA 2XEDA 4CTKA 2LR0A 4BJ6A 1MB4A 1Z74A 1HDZA 4XYBA 3DDWA 2GJ8A 1G66A 3EARA 4YV1A 1ADCA 4GGMX 1UT6A 4P92A 3RRFA 4IICA 3TL2A 1ZPDA 2FZWA 3P9SA 2FGJA 4B3XA 2BH9A 3PUVA 1N0HA 3H6HA 2DYKA 4ZI7F 5ITZB 1CD5A 1FL9A 3MAAC 4UPDA 6ABPA 3WLQA 2GX6A 4D9HA 1WD5A 3OSZA 3NBQA 5TGZA 5H83A 3AY7A 2VNSA 2FX3A 3DHWC 3RBVA 1DWOA 4GSLA 3NM4A 5FLYA 5ABPA 4TV9F 1MHTA 4C5AA 3LHFA 3VR4A 5JAIA 2ILVA 3NKLA 4IDPA 4OYHA 3IRVA 4WT7A 4ZK2A 4BGEA 1R0SA 2CUKA 3BH7A 2VAVA 3IOEA 2OZVA 3I9KA 1E5QA 3EQZA 1EE9A 3B3FA 1Q6ZA 2SKEA 3MS2A 5DWDA 5TQ0A 1GPDG 3NO4A 2RGWA 4FKZA 1O77A 2P8SA 5IKOA 4DN6A 3JYQA 3SZUA 4DDUA 3IP1A 2XF2A 5AJYA 3OAAD 5DMXA 1SC4A 5BT8A 1RHJA 1V11A 1JMYA 4JXZA 4QPZA 5FAKA 3MN1A 4C2TA 3DO8A 3ZWQA 1XXHE 1SQ5A 3B1ZA 4M9ZA 4PG8A 4AQ7A 5CEEA 1TYAE 2F55A 5IJZA 5J58A 3QSYA 3HKCA 4MI9A 5CCXA 4LWOA 1BMTA 3O3CA 4MGZR 3OZIA 4ZQBA 4D46A 1H69A 4W7HA 1Z75A 3TB4A 2PYZA 3L04A 3IXLA 1T8PA 3WGNA 4ECEA 5KTKA 4U5XA 3K16A 4F60A 4OBEA 4UNPA 1C9YA 2Q9CA 2I1WA 1L5MA 1GCGA 3UCEA 2QTTA 4N6GA 1L5YA 4HDAA 1PG5A 4YAJA 5FWAA 4BV8A 1R8XA 5KSPA 1E6MA 1SCJA 2JFZA 2WSSA 3F90A 3QY0A 2PK3A 5EXTA 3SX2A 4KGVA 1HZJA 3GJ4A 1YZQA 1FJHA 4JLVA 1ZD2P 2RCYA 4RAQA 2DRIA 2PA0A 3GLFA 5JFTA 1VLLA 1ADJA 4OJMX 4XEHA 1Q92A 4JLNA 4WIAA 2FEMA 3KKZA 4NU0A 2VUTA 4CDMA 3EEBA 3EAFA 1LRJA 1Y80A 4ETIA 4RS3A 1W9HA 4M1EA 4IMPA 1KEKA 2GRUA 1B14A 5HM8A 1M34E 4LV8B 4GKJB 4YQEA 4HOYA 2DF8A 2H2WA 1B6GA 1WMAA 2A5GA 2PNFA 4J91A 1Y3FE 3O0TA 4NMXB 3UUGA 2QF7A 1Y7TA 4QEKA 3V8NA 5ARBA 3HMQA 3U4DA 3FPCA 3WLSA 1A27A 1T3ZA 3NB0A 5IP5A 4A8JC 2CV0A 2FUCA 1T5DX 1DQPA 3VR4D 3R3XA 3ROPA 2RMKA 3CWCA 1L2TA 1CERA 4JJ6A 4X6LA 5I7AA 5JD6A 1W5BA 3KKMA 4M7WA 1E8DA 1Z12A 1GYPA 4WW0A 4RJJA 3MGKA 1NTOA 1RHQA 2H8KA 1ZICA 2ZAIA 2I2XB 4RVSA 2IYLD 4UCQA 3E9QA 4XYLA 4YFVA 4NMLA 1XJCA 1E1MA 3SEAA 1ORDA 3KWFA 4RIFA 1KYVA 1PR9A 5LDGA 5LR6A 2RI1A 2B4QA 2Q4BA 1CJCA 2FUG1 3CLSD 4OY3A 3R9IA 4F85A 5EGNA 1RRCA 1C9JA 2BONA 4KTTE 2DLDA 2JKVA 4BN0A 3UO8B 4JT4A 4O2AA 3F73A 1NKTA 5FNZA 1JAHA 1T5OA 4U7TB 2F48A 1W85B 1L3IA 3JVIA 3WOHA 3RS5A 3GGDA 4G0MA 1JR4A 4KL8S 2A9FA 2BFWA 4CMEA 5AI4A 1ZU4A 2AR7A 1GGFA 3IKVA 1RSZA 3B7WA 2AFHE 3H18A 4IJQA 3O8QB 2R8ZA 4CFSA 1IYZA 3SE7A 2R6CA 4HRXA 3BJMA 4LZAA 2PX3A 4HLNA 4KLRA 4MB6A 2HCTA 2GK3A 5LQNA 1N6IA 2WSSD 4YR7A 1C3XA 4IDCA 1PJAA 4GE0A 3NC1C 4OG2A 1NQTA 6REQA 4MSUA 4KRFA 2H2IA 2XW6A 4Q1CA 3CV3A 4EPYA 5AHWA 4XDGA 1XCBA 5E2IA 3KLBA 1M1NB 3C41J 1M7GA 4N9WA 4WA7A 5MN5A 4HVLA 3U16A 3UPTA 1V45E 2W4IA 4FE4A 5TARA 1TVMA 5IYZA 1U80A 2HWXA 2Z5GA 3TVTA 4CT5A 3MOGA 1YB1A 4TKUB 2RHHA 3K1TA 4GLLA 1NXOA 1Z36A 4GC5A 4PGHA 1IWBB 1K27A 2H0AA 4U7JA 1E2EA 4US2R 2BV3A 3QUCA 1DMSA 1I01A 1JQKA 5JRDS 3CF4A 1HV8A 2DT8A 4WZBB 2CXOA 2QGZA 4KU4A 5ESDA 3WB0A 4YJ3B 4B71A 1HGXA 2C8LA 3L4EA 1V8OA 5JAZA 3DCYA 2O20A 5IASA 1WZUA 2YMMA 3P4YA 2FZKA 4NQRA 4Q93A 1DHTA 3TIIA 4HS4A 4DQLA 2D06A 2GPSA 3LT0A 3WLPA 1B8VA 1E61A 3BVPA 2XCUA 3KVRA 2AJBA 5E1OA 1S0UA 2AQHA 1W5EA 2ZB7A 3OOEA 4LX8A 4YDHB 1IUPA 5FO1A 4CMKA 3EMKA 4PNHA 1WXFA 2X4IA 2JL1A 1S96A 1Z4IA 5D3KA 3BREA 2XV1A 3OQBA 4I9GA 4N8EA 1R4ZA 1BDIA 3G68A 2JFUA 3ETGA 1Z08A 3OX3A 3NTVA 5FHRA 3KZNA 3MD9A 3A58B 4OQMA 1AXGA 3TXYA 4ZU1X 3ZW8A 2ZUDA 1BMQA 2CVQA 3VSAA 3VO1A 1A7KA 3AZQA 3U31A 4NAHA 1POXA 1UK6A 3CCCA 2W6OA 3O93A 2BZ1A 2ASVA 2QUBA 4AZ3B 1DOZA 1L8XA 5CA1F 2A9RA 1RLOA 5BRAA 2ES4A 1YQUA 3STVA 3WAGA 1Z2NX 2FFBA 1H2YA 2O3TA 1CUCA 4I5EA 3JVEA 3V1YA 2ZOSA 1U2DC 3GLHA 4XARA 4PAOA 1RRKA 5EE1A 3MILA 3NJ4A 3G59A 4HI0E 2YFKA 5DGTA 4ZCIA 4PZDA 2HWWA 5FBHA 3NHZA 2W6CX 3DP7A 3TVDA 3E35A 3KSZO 1RPAA 3IBSA 2YIJA 5D3MA 3QVWA 3X3HA 5CFMA 4DCVA 1EVEA 2QD1A 3OQ1A 2GZ2A 2YJTD 4K2AA 5CH8A 4X8LA 2JF0A 3U6KA 3Q5DA 1NJGA 1ZS9A 5FLXA 4HMPA 3JWHA 5KYXB 1NMYA 2ZU0C 3W2TA 3OF3A 2GHTA 3COZA 4C07A 3G1TA 4CIAA 1N32B 3MG9A 4Y7CA 2J6BA 1KE2A 3VJLA 2C4NA 1C8KA 2A30A 2F8LA 4MIKA 3T4UA 4A10A 1I4TD 5J4LA 2P6RA 2W6NA 2GOYA 2QGNA 3TR6A 3GLTA 2E0IA 4GLJA 2HWKA 4KX3A 2YWCA 1W4BA 4UMFA 5CTJA 4JQYA 1GNQA 5EFOA 2QQGA 1JJ7A 1DRWA 2M6SA 3E0XA 4YJ2A 1YZHA 2QLTA 2REQB 3P9PA 3NOXA 3B2NA 3QKRB 1FUKA 1XQ1A 4U8HA 4LSWA 4FEAA 2MSKA 1TZCA 3CMMA 3PFFA 5LIPA 1JVNA 3OZWA 2OQ2A 3ZGVA 2WJZB 2RI6A 1TKAA 4G01B 1TVKB 1K2WA 3SF8B 1G3MA 1OH7A 1OH8A 4BQFA 3CUYA 4HXEB 3AVUA 4OUDB 3RUDA 4MQ4A 2XQVA 1NVVR 3HV2A 2P27A 4RTOA 1YRQA 2XCRB 4JX9A 1XUOA 5I5GA 1MC8A 2EJUA 3NH9A 3A0RB 4FFVA 4DUGD 3U7QA 1NVXQ 1TCAA 1B6RA 3I5AA 2WPDA 2XXAA 4EF6A 3CH7A 5EQTA 1CVIA 4Z1OA 4JI5B 4AC9A 2IYWA 4BN5A 1GQRA 1TQ2A 3JRXA 2K7FA 1SD5A 3ZHRA 3HC7A 1E0JA 4B0OA 3CUWA 2C3UA 2XDYA 1NW4A 2G88A 2A9QA 3IEXA 2DAPA 4NICA 1V7ZA 3H16A 4QFBA 4B4DA 4FMBB 1PFVA 1XOIA 3FJOA 4Q1EA 5LQCA 3THXB 3AR6A 1YVEI 2D5BA 3ZQUA 4QJ4A 1VHWA 1ZK3A 5FOSA 4AX4A 2XGJA 4C0XA 5JDIA 1BYUA 2PUHA 3UXMA 1D9XA 1CNFA 2ZWMA 2L82A 3IYLW 3LX8A 1EUDB 1M6VB 2I1VB 1KJYA 1LPMA 3AEXA 1V71A 3FVVA 3WLHA 1I1HA 3C39A 2I66A 3B9PA 1A98A 2GBLA 3G8DA 1NT2A 3ZDQA 4IEFB 1GFIA 4DYVA 1XN1A 1IZ9A 3LSYA 3LQ1A 3W5DA 1L3CA 1QU3A 1SIOA 5LWHA 4M0UA 4JBHA 5SZHB 1U3TA 2Q2QA 3KDSE 3ZWPA 4AI6A 1TZKA 1N2CB 3AOEC 4LNUA 2GCGA 3U9TA 1LF5A 2ZB4A 1PD0A 4FUQA 1OT3A 2OXRA 4NS4A 2VHQA 5CYOA 3KQVA 4PM4A 3L6EA 3HDGA 4WK0B 5CFPA 4BZQA 3A3NA 4LHEA 4YROA 1W49A 4UMVA 4EYSA 1DEAA 4LGVA 1JIQA 1GSHA 4DJ5X 1BG6A 1IEXA 3FPJA 1RJDA 3WIVA 2LPMA 2CHVA 1ZIYA 1PZGA 1O6CA 5EG5A 2XGOA 1YNSA 4AB1A 1TYCA 3PWKA 3PUWA 1DFHA 5EJFA 3O2QB 2ODQA 2G5GX 1M76A 2OENG 3FUCA 2EJCA 3UATA 3R3YA 2YV5A 2FQYA 3E6AA 1UIRA 1I14A 2I5PO 1WP9A 2EW8A 1V11B 4PSKA 4ZANA 2CXSA 1A88A 2IYPA 3S40A 3ZCRA 4BUCA 5K0GA 4PHFA 3BH0A 2OILA 1EUYA 1QK5A 4PZCA 4HNGA 3L7BA 4OK6A 3ZK7A 2DLNA 5D87A 3SHFA 5KVAA 1RI3A 5MDHA 1RQGA 3CZ4A 4IX9A 1BS2A 2YXPX 4L6IA 5PNTA 2XT6A 1RYDA 4E5NA 2WPDD 4MRNA 4DR5B 3DLPX 2XYGA 1M9NA 2OCPA 4BVBA 4B31A 4ND3A 3U7FB 1S02A 1W73A 1CRQA 1F0KA 1O96A 3AY6A 4TN5A 3ZHBA 3E7PA 1RPTA 3OOHA 4QRIA 2AXEA 1WXDA 2B4RO 4DIFA 1DTEA 1YQQA 2Q2NA 1HEIA 3II6X 4XCXA 1B2RA 3S0JA 1NWHA 2B7LA 4EHAA 1ZIOA 3CRVA 3AP2A 3JQ6A 4LQCA 5JC8A 2VNHA 3CNHA 3NAGA 1KO7A 4ZIRB 3RAGA 5F77A 1E2UA 4Z0TA 2B92A 4MEAA 5CGZA 2WD8A 5FHQA 1XTQA 4W8OA 1N5DA 3VO9A 2C4MA 4BASA 4KXLA 1IPFA 2JRCA 4QOEA 1L8OA 1OPXA 5GMOA 3SN6A 4Q7KA 4ASUA 1Z8NA 2CNDA 1Q19A 2YHIA 4Y1RB 1Z22A 1QIKA 3NBMA 3LWZA 4F96A 4HPXB 4IRMA 3CU5A 1G38A 2IYVA 1KMMA 4ZQFA 1EE2A 3QX3A 1D6JA 2EDCA 3ET5A 2FFRA 2ZIAA 2VF2A 4HEJA 1OFHA 1DJMA 3GDGA 2JHAA 5LYJA 3W3AA 1II0A 2VPQA 1LB1B 3WLRA 3IUQA 3B70A 5AD1A 2G04A 5DP1A 1XL0A 4H7HA 1QONA 2XUKA 2IL1A 4KK4A 1ZXBA 2QSJA 2ON6A 5HZHA 3HA3A 3CW9A 3PC2A 5J59A 5C34B 4Q4HA 2FUKA 1R88A 2PSFA 5DTQA 2ISQA 1OVMA 1T26A 5KNCH 3P2KA 1PDVA 4NDZA 4CM1A 4QHTA 4JL6A 2GF2A 2F1JA 4RHYA 4DC1A 1E9BA 3UGTA 5EHXA 1MB9A 4J4TA 2QYTA 4LXHA 2P5SA 2VQDA 1NNI1 1L1QA 5HF9A 3V4VB 3GYGA 2Q5FA 2G82A 4DLUA 1K75A 3NP7A 4N9QA 2I1LA 5EKDA 3H9GA 2OC9A 5JT1A 1EDOA 1KIFA 4NNPA 4RZ3A 1QDEA 1EK5A 1T4CB 2IZOA 5F4ZA 4BQPA 1T10A 1TPYA 5M3BA 5EY5B 4NFHA 5CXUA 5HZKA 2TECE 1EPUA 3NONA 1KVRA 4UHKA 1HT1E 2Q4RA 4U2GA 1MT3A 2FN4A 1BVHA 2VI5A 1ZZGA 2XYVA 1G1MA 3EGIA 2OCLA 2XNKA 1HO3A 4ITUA 5HFJA 3KSRA 2WY2D 1JFFB 4AURA 3OZVA 4N7MA 4WADA 3WX0A 4CT4B 4B3HA 3IIEA 3QV1A 1NW3A 3B7GA 3IP6A 2DZDA 1ILWA 4J0EA 3KKOA 4HUQB 4QOIA 5DNYB 1V5EA 2NU6A 2Y1FA 4I9HA 3FCEA 5A9SB 1AQNA 3QXGA 2X86A 1FP7A 1NBIA 1AGPA 2GM5A 1GAWA 4KODA 4LC1A 2DPXA 1C29B 5EIBC 5KTNA 1DCFA 2PBRA 2CXPA 3PNYA 3Q98A 3RS0A 1F2UB 2DWUA 2GN6A 1THMA 2LTAA 4CTOA 2WKSA 1BXZA 5DGCA 4XPZA 1A4UA 3UHOA 5K9ZA 2OM2A 3F4BA 3HCDA 4QWMA 3W8RA 2RJ3A 1VMAA 4YUVA 4DILA 3Q10A 5KOHB 2FSGA 1DDIA 2ZM5A 1W4AA 1BC5A 1KEVA 5EMMA 2ERCA 1P9WA 3JTEA 3LS2A 5C4GB 2AEEA 1LH0A 3MW8A 2G63A 3MJSA 2W2NA 2C98A 3K1YA 2DHDA 1P19A 4MW9A 4BEBA 4MLDA 2EGHA 4ISCA 4E09A 3TNJA 1K5GA 1JAIA 1Z4JA 3GVXA 3HUTA 1DE0A 1RLJA 1V4BA 3OCCA 5TPWA 4CKXA 2C8VA 3FDZB 4E14A 3CW8X 3HEMA 1C30A 4L1KA 2VJOA 4Q1DA 2FSFA 4RPLA 2YDYA 4ZO8A 3CUKA 1NBAA 2O7VA 3DZHA 1OHHD 3CUTA 3HABA 3WNBA 1E5DA 3KCNA 4KBYA 3MERA 1EK1A 2VS1A 1L9KA 1GDTA 5F78A 3AR8A 3NORA 5KYWA 1XTKA 4OLJA 4GMFA 3V1NA 3NWEA 5IC5A 5EUBA 1JMKC 2OD2A 1YACA 3L77A 4P58A 4D02A 2YC2C 3QNWA 4QTYA 5IJWA 4RXMA 3ZVRA 5KTMA 2ZRPA 1U7ZA 3Q8WA 3MYYA 4F1WA 3IE1A 2VK1A 4YRMA 1WLSA 2B30A 3FSRA 1OXKB 3BDIA 2CXUA 5CIQA 4MEBA 4YRRA 3ICWA 4YPFA 2GCPA 3GZ4A 3OUTA 4F4JA 5D00A 2FPUA 3HU5A 1UZNA 5KQSA 1VLMA 3FNEA 3GUCA 1D1PA 3H3JA 2YWRA 4Z4HA 1Y4DE 3CRW1 4K0RA 3ZD6A 4MWZA 4KYIB 3M9LA 2BFAA 3V8EA 1II9A 1OR8A 2HYDA 3Q5EA 2YW2A 1LDGA 4U9IS 4Z2YA 2R8PA 3VHXA 4D74A 2QSZA 4UUOA 1Y3DE 4NJOA 1J6UA 3ENKA 3R5XA 5CNJA 3T06B 3X1DA 2V96A 2SECE 4KQ9A 4R2MA 4CUKA 2ICAA 2C7QA 3D7RA 2OHHA 4IQ8A 5B6IA 1HOXA 1QRSA 1QRUA 3BZBA 5F9FA 4B6JA 2WM3A 3HP1A 1NRWA 1XZGA 3ZWAA 1H1LB 1TIKA 2JJ8A 3K0BA 2BSAA 2ORWA 3P0JA 4AU1A 1XZ8A 3IHKA 3P9YA 4MIOA 4BLWA 1N7GA 2RAFA 2R8EA 4ZQHA 3BGWA 4MW5A 3G0HA 4ZVMA 4K3VA 4L2IA 1N6RA 1OJLA 3T5GA 4M1YA 1EX9A 2NV0A 1L7VC 3T3HA 3A0UA 1D1QA 3HO6A 3LY8A 3M6XA 1X1RA 5J2UF 1TIPA 1NVAA 1PHPA 1XAIA 2I99A 1I10A 4JP5A 2HEIA 4UZFA 5DHAA 1AKQA 1EINA 1MJNA 2EFGA 2IZ0A 4UBNA 1KSHA 3WGVA 1I1OA 4OSOA 2DCUA 1EWQA 3DEHA 1NX6A 3HYCA 4RM2A 1XZNA 3QG5A 4FR0A 1RFLA 2FJ0A 4UTNA 4R3WA 4RPHA 3CVWA 1IEVA 3SJAA 1Y8CA 3M1YA 3P45A 1NXWA 1DAFA 4MXDA 3FDXA 2FF7A 3DYBA 1PQ4A 1R5JA 2BFFA 1V25A 1EK0A 2D7CA 2P9CA 3MIIA 2OO3A 3DWGA 3SM3A 4F9EA 1JB1A 2Y9PB 5ALNA 5FLKA 1T8YA 2XT9A 4TVBA 3CF2A 4UUNA 3U09A 4J0GA 1IOLA 2VSXA 3KJGA 4JLJA 3BGOS 4B6RA 3I5XA 1KI3A 5JQGA 5K09A 5C3UA 1JEOA 3WB2A 3QKUA 4BAGA 1FFDA 5DHSA 3FD8A 1HQDA 3ISJA 3NTUA 2FYTA 1YS2X 4N8DA 5DFAA 3U7QB 4BIIA 4Z7JA 2OB1A 3EXHB 4MR8A 3PIIA 1RWQA 4IAOA 3GLIE 1QPGA 3AZOA 3GF4A 1KO5A 1D0SA 1E0AA 3TQHA 1YRBA 2VK2A 3NDJA 1VKOA 1ZONA 5J5VA 2ADFA 4Z49A 5AOCA 4KACA 4GLFA 3ZY5A 5JSZA 2EC5A 2GKOA 3IAFA 4EA8A 1O7JA 2CJWB 4H7IA 4EP1A 3T9BA 3O4VA 1NXVA 3S55A 1GUDA 3GEPA 1K6XA 2ZSFA 4RFVA 4DMHA 2BMFA 4Z8YA 4B8ZA 5KNDD 4D9MA 3I6ZA 1RWOA 5TVGA 3KSMA 1BSVA 3LUBA 4BLPA 3TX2A 5A4FS 5JEEA 4TPKA 1TAHA 4FHDA 4XUGB 2RH4A 3OQJA 4CTMA 3VVMA 1YE3A 4Y30A 1PFYA 2WINI 4GUDA 4QGGA 5COQA 1P3DA 3NWJA 4B5LA 1OAOC 3KX2A 2OG2A 1YVDA 1SBTA 4LMRA 1WZCA 3MHTA 4DV0B 5AESA 3EPLA 4JT9A 1PW5A 1ZGHA 1PL8A 2AFIB 1K7YA 4O4LF 5FD8A 4E46A 3HHEA 4PX2A 3G2NA 1HEUA 3DLTA 1EZZA 2X9VA 4P3NA 1P0MA 4RVCA 4ALKA 4D3XA 4NZMA 1ZA1A 3AI7A 3ZKWA 1QOQB 1BFKA 1IG0A 3HJAA 3WLTA 4EJ2A 3A6ZA 4DWVA 4U0KA 2QAIA 3TAXA 3UH1A 2FR0A 3A4IA 1ZEJA 4TRJA 1N1DA 2W2PA 4QFCA 1OZ0A 4A5SA 4XRGA 1RADA 3RYCB 2XHEA 1GTVA 4R2HA 1YUMA 2JGDA 4IWXA 2COKA 4N7BA 5DRTA 2FSSA 3NEPX 2OFFA 1YGYA 4E5KA 4WBSA 3UN1A 121PA 2PSEA 2QENA 2G36A 5HGJA 4RK6A 2ADMA 3UMJA 3TRFA 2LCQA 1KY5A 3NHUA 3EVDA 4DCCA 3ZWNA 1BDHA 3IVCA 1UPUA 4YPOA 3FNRA 3MJFA 4XTCS 5FI5A 2CYBA 2YMPA 3VZRA 5BSGA 3LWNA 4LJ4A 1DSSG 3BEDA 5ALXA 4D96A 1IBLB 3HM9A 5ENDA 2CSUA 2JHGA 2BKEA 3DZCA 3SG0A 3W1EA 3B3JA 1E6KA 1QLHA 3DFIA 3GFQA 3PK0A 4MR9A 3U44A 1Y3AA 5CPBA 1W5FA 1NJ2A 2V4MA 3IFSA 3FKJA 1W0CA 1ZX1A 5COAA 5DTEA 1ODFA 2RBEA 3H65A 5IJAA 3PA8A 4MIYA 3SY8A 5HQ3B 5KYTA 2Z1MA 3G7SA 2ZI9A 5I9MA 2XCTB 3PGVA 3UPUA 1J39A 4YAWA 1P4SA 1QIHA 1JECA 2BTQA 1GYQA 4OB6A 3VR0A 3GX1A 3PDUA 2CEAA 2H5EA 3TGPA 2Y0BA 2QY9A 2LV8A 1CY4A 1EZ1A 3O31A 5JWHA 1PJCA 5IBCA 2VH2A 2NM0A 3DL4A 4IIGA 4LNAA 4OQNA 1WBBA 1Q1ZA 2ZU6A 4AWXA 3BFPA 1KAGA 1LI5A 1YJXA 3NPMA 4Q9JA 3SC6A 4AQYB 4EDFA 1VCNA 1FPQA 2YHIB 3FOWA 3CLUC 2H06A 1MO2A 2VH5R 4R2JA 4PFSA 1J0AA 3S4YA 4C6RA 1QBKC 4RK5A 1Y1KE 2Q3MA 1JF8A 1YDWA 2BF4A 1M2EA 4E6EA 3ZN2A 5I7RA 5CA0B 1Q7EA 2XVAA 4IV5A 5KNBH 5C7LO 4PONA 1EFVA 3YASA 1HFEL 3ABRB 1CXZA 2C61A 3ORYA 5LYJB 2HT1A 4HNTA 4BDTA 3L06A 5FULA 3RF6A 1KERA 3NFRA 1HX7A 4TTJA 4CM9A 3LMKA 1RMQA 1W6UA 1YUBA 5A0VA 1CZNA 2X1VA 1N0VC 5K4AA 2ISCA 3WQRA 1CG6A 3B38A 3I37X 5F2NA 3L4KA 1JW9B 1K3UB 1R8JA 1VL6A 3T4PA 1HE4A 2AWNA 5IC4A 1CQIB 3LVFO 4P5PA 2QLLA 3WHIA 4F3TA 1NBME 1KQ3A 3N3AC 1UKZA 4JDUA 4QA9A 3VNAA 4JN6B 1N3LA 1TYZA 3IUPA 4IH1A 1BMFD 3V97A 2FMIA 2ZTSA 3COPA 2KI5A 4UNRA 3GJ7A 4X65B 4H0NA 2IS6A 3KLMX 3LPMA 1SXIA 2E4ZA 2IODA 4I4TF 1H42A 4RMIA 1C0LA 3EEFA 2WRZA 1W87A 1NPTO 4RQAA 1PUJA 5FTJA 4ABYA 1VSQA 2AEFA 3VUEA 4D4IA 4RTKA 2GM4A 5ALZA 1DJPA 421PA 2FQWA 1U02A 1EA5A 1WEKA 3HI4A 2OT3B 3M3DA 4COOA 1Z0JA 1HE8B 2BUAA 3AI1A 3ODPA 2CL0X 3W2HA 1HEYA 2AVNA 1VLJA 5GIOE 3PWSA 3JSAA 4OGGA 3O73A 1BD3A 5AVXA 1TPZA 3PE3A 2F8MA 2UZ0A 4IVQA 2BDUA 4RPGA 3OM0A 1BW9A 3LQ4A 1G59A 2FPGB 1DEKA 3HCAA 4QELA 4EHLA 1KOGA 3OM8A 4G5HA 2I71A 1RM0A 1UL1X 1XAHA 1ZM3A 2VYVA 2ZWPA 4TMTA 2R47A 2SKCA 5IXSA 3NJ8A 1E3WB 4WERA 2ZM6B 3FBTA 3CKYA 1O8BA 1VL1A 5EZSA 4KAXA 1C8VB 3VPSA 1ARZA 1BYIA 1YK0A 3GH1A 2A3NA 2PVSA 4FGWA 4N6NA 4RYDA 3WV5A 3EXEA 2HL6A 4C01A 4RORA 2RH5A 3RT1A 4BZPA 4D8XA 3Q8MA 4FZJA 2PCLA 3PX7A 3UHAA 3IO5A 2Z57A 4C03A 3L41A 5DDIP 2OBYA 2WVGA 2DFPA 2QX6A 4AJHA 1SWVA 2RIPA 4KDFA 4ZICA 2WJPA 1L7XA 3DFFA 3IBCA 1G21E 1ISHA 3MINA 1QH8A 5E38A 3K0HA 3VVCA 4RGBA 1XCJA 4PXAA 4UQOA 3WDLA 6CHYA 1CEXA 4TV8F 3H2HA 4EHNA 3OM1A 4CFYA 3O7WA 1E79D 4FGZA 2TMYA 5FNVB 4YRLA 1OX5A 2PX8A 4YAIA 2NO9A 3G5AA 1X7GA 4U2EA 4BNTA 3ONDA 5DF1A 4D9EA 1NX9A 4BE4A 1CQJA 2XXJA 1E7QA 2A0KA 1HNWB 4WACA 1S1CA 5REQB 4H1WA 2Q4TA 1A8PA 5AH0A 4Z99A 2ZBQA 3UOGA 4YJFB 1CTQA 1E1RD 2VP6A 2V0CA 2ZR7A 3D3WB 1A4IA 1C81A 3M4XA 4MCJA 2PO7A 4CQLA 4NYJQ 5CR9A 2GWRA 5K0CA 4P7BA 2FPWA 3AUFA 5DGHA 1N33B 3GJ3A 4DA8A 5CD1A 4YAEA 1CIPA 5DM70 4FHGA 1JEQB 1Q0PA 3IAHA 1CB0A 1AS3A 1JEEA 1UKAA 2I4RA 4L0CA 5JNRA 1ZD5A 5EMLA 2J3LA 3FROA 4X1KA 4CW7A 5BORA 3KQKA 1NFRA 3TMKA 2Q21A 1RQ2A 5GADl 1Q91A 2P68A 3G7NA 5K03A 4RTPA 4EK9A 2EQBA 1SZPA 4W5RA 3RWMB 2BJHA 4LDNA 4J90A 3CG4A 4HUJA 5KSWB 4K6GA 4CKCA 2B0JA 3SKVA 3U62A 3NEAA 4IOLA 4JWKA 4HFMA 4OQXA 3VU0A 4TRMA 2MR6A 1C1YA 2VBIA 3T5MA 3TSYA 1M8FA 4FJ0A 3CKKA 3B2QA 4G56A 3WL4A 4P81A 2JGFA 4LJ9A 4A0QA 1SKYE 2PKWA 1Q84A 2D1SA 2O23A 4AF8A 5MF6A 1W29A 4PC3A 1ONSA 5TMEA 3E8XA 1V5FA