4HDAA

Crystal structure of human sirt5 in complex with fluor-de-lys peptide and resveratrol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
267
Chain Sequence
b'RPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacylase sirtuin-5, mitochondrial
publication title A molecular mechanism for direct sirtuin activation by resveratrol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 70
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4hdaA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4hdaA01
4UTRA 2WVGA 1Z8NA 5IMSA 2EZ9A 2FR8C 1M2NA 1SZDA 1PVDA 4BN5A 4RMIA 4ZP1A 1YBHA 2H2DA 2H2GA 1YTLA 2JLCA 4COKA 1OZFA 4GM4A 4RJIA 1YI1A 4JU8A 5EJ5A 1ZPDA 2H4HA 4IG9A 3CLUD 4QPZA 1EFPA 2AG0A 2X7JA 4KPUA 2VK8A 3JR3A 4K9PA 1MA3A 3CLTD 5AHKA 3U31A 2VBFA 4MPPA 2H4FA 4MQ5A 3U3DA 2IHVA 3HWX1 3JWPA 4F4UA 1YNOA 3PKIA 4O8ZA 1SZCA 2EZ4A 1UPBA 4BVHA 1ICIA 3FZNA 1DJLA 2EZUA 2Q5LA 5K2OA 3D81A 4K9MA 5EJ6A 5DEIA 3EY9A 2VJYA 2HJHA 1E3TA 4FVTA 2UZ1A 4RMJA 4V1CB 5FYQA 2VK1A 5EJ8A 3RIYA 3GLRA 1T9CA 4IAOA 4GG1A 4C78A 3ZG6A 4JT8A 2NXWA 4GM0A 2Q29A 4D5GA 3CLRD 5DGDA 4I5IA 4UTVA 1U2DC 1YI0A 1BFDA 2JIBA 1NM5C 4JUAA 3F6EX 3GLTA 4GM1A 4RJKA 4Y6OA 1PNOA 1YC2A 3LQ1A 5EJMA 2OD2A 4V1CI 4BUZA 1O96B 5K6TA 4UTNA 4JUCA 4UTZA 2Q28A 5K6RA 4QQ8A 3GLSA 1YC5A 2AG1A 4RMGA 4C7BA 1YHYA 2JLAA 4JU9A 2EZTA 2IHUA 1Q1AA 2H59A 4J16C 4R8MA 4GPEA 2C31A 4UU8A 2VK4A 1D4OA 3EA4A 3FSJX 3E9YA 1HZZC 3F6BX 2FN3A 1M2KA 4TWIA 1V5GA 4X3OA 1M2JA 2UZ1B 2H4JA 4UU7A 4BVBA 4Y6QA 5EJ7A 2Q27A 2VBGA 1U31A 4KGDA 3D7KA 4MZXA 3ZGVA 3PDHA 1S7GA 2A1UA 2FSVC 4J1TC 2JI9A 1S5PA 1OZGA 2Q5QA 2H2IA 4UTXA 2OO5C 3OE1A 4K9QA 1O97D 5EJAA 2IHTA 4JD5A 2QQGA 1UPAA 2BRUC 4ZZIA 1EFVA 4TWJA 4K9NA 1Q17A 4BN4A 1PTJC 1POWA 2A1TR 4JUBA 1T9DA 1U28C 4JUFA 1PT9A 5FEMA 5EJ4A 4JUDX 4L2IA 4JT9A 3HWWA 1M2HA 2PGOA 4K9OA 4RJJA 5EJ9A 3FLMA 4BVFA 1T9BA 2FRDC 2JI6A 4L3OA 2JI7A 5BWOA 4MPJA 4K9KA 4UUAA 3D4BA 1Y9DA 2JI8A 4QELA 3ZGOA 5DGTA 4HD8A 4MPRA 2OD9A 2Q5OA 4JSRA 2Q5JA 5BWLA 3RIGA 1Q6ZA 3GLUA 1N0HA 5D7NA 4BVEA 2VBIA 3EYAA 2QQFA 4Y6LA 4KXQA 4UUBA 1PO7A 2OD7A 4BVGA 4BV3A 5K3SA 2FWNA 4X3PA 3IAFA 2NYRA 2B4YA 4BV2A 1PNQA 4G1CA 4FEEA 1POXA 2DJIA 1XLTC 5MGNA 5MFPA 1Q14A 1MCZA 2WVHA 4Q9DA 1M2GA 2V3WA 3IAEA 1OVMA 1OZHA 2EZ8A 4K9LA 1JSCA 2W93A 4FEGA 1T9AA 4HDAA 1YHZA 2H2HA 1V5EA 4F56A 1PI3A 3CLSD 5MF6A 5MFZA 1V5FA 4FZ3A 1PYDA 2PGNA 3PKJA 2H2FA 5BWNA 3K35A 2WVAA 1U2GC 4GP9A 2OORC 4IF6A 1J8FA 4V1CA 1UPCA 2PANA 3CF4G 4D5EA 4RMHA 1QPBA
chains in the Genus database with same CATH superfamily
1I9CA 1L5MA 5CBPB 2XBLA 5MN5A 3O9ZA 2ZJ7A 3HJAA 1M0TA 3EUFA 3HN2A 1PVDA 3PF8A 2NIPA 3RSFA 2D1TA 2E5WA 2QNRA 2NQ2C 5THKA 4G1UC 1MZVA 2Y1CA 3D8RA 1ZR2A 1FNDA 4O63O 4QXPA 3K0AB 2GJSA 4QDUA 4N0MA 3FF1A 3GU3A 1P6XA 1SELA 1A7KA 1XDGA 4O4HF 1BSVA 1P31A 3D2CA 3PQ4A 4FD2A 4NBNA 1U0TA 1YXMA 3DKRA 5K3FA 2CLEB 3O5AA 1L4EA 4Y2RA 2VP0A 3FETA 4U2CA 4V3CA 5JLJA 1H22A 4Z4CA 3DEYX 2ZRGA 1T8YA 5HKAA 4UZSA 2ZT7A 3MHTA 1LDYA 2OZVA 1T2DA 1JQLB 3I04A 2JLXA 4PAMA 2P75A 1IPHA 1DEHA 5I9MA 2Y1GA 5GY7A 3ICOA 2Y0PA 4GSKA 2UXCB 1QGDA 2IW1A 5TIIA 4MRVA 2GRAA 2WF8A 2AG0A 4PZUA 4DPKA 1Y48E 5C1OA 1J06A 4MI3A 1T2AA 2NSJA 3NWJA 3T0FA 3CLTD 1HT3A 3PIIA 3CT6A 6ADHA 1IXSB 3FF4A 4KXWA 1XB2A 4LXHA 2VT2A 5K8JB 3F71A 3OMLA 2OCAA 1IEVA 3VO8A 4NECA 2FE4A 4E1VA 3OCYA 4NOMA 2TMGA 3FBGA 4DWOA 1UUFA 3CNBA 5DT9A 4E4TA 1ESZA 2O1EA 5P8WA 3KKPA 3A9CA 4FMCB 2CVFA 4IIDA 1RRCA 2BGGA 3D7SA 3M81A 1NVWQ 1KI7A 1RI3A 4YJGA 3L4SO 5EERA 4E5MA 2Q2VA 5EXDA 1Z83A 3P19A 1W52X 1RJGA 1S3FA 3DDUA 3WV5A 4F4UA 1E2IA 1YNOA 2PWYA 1XUOA 1RW4A 1Q3HA 2XBUA 3IEIA 3PNMA 3PKIA 2VYNA 3E7FA 1SQ0A 3EK2A 3EZYA 4JQCA 3CZMA 5BN5B 3CR3C 4GMXA 3MINB 4HNHA 2CGEA 1SZCA 5AHOA 5DBHX 5FL7A 4BBZA 4BFVA 2CL6X 1UBCA 3EBLA 2A9RA 5EIFA 2J3KA 3D8NA 1PR5A 1QFJA 5EMKA 3I83A 4FKMA 5FA6A 5GAJA 3T9CA 1IYZA 3CUYA 1S2DA 4GX5A 3WGTA 1SVMA 1P91A 2Y4NA 4G0VA 3GLHB 1CCWA 4W5TA 3EQ8A 4HNUA 3C87A 1YB1A 1RWBA 1Q92A 2EBHX 5CVJA 4ENQA 4HV4A 5DK4A 3U0BA 3A05A 3VQTA 2ZVPX 3OHPA 1ZOSA 4O1HA 4CMGA 5AD1A 2CFCA 4BGUA 1MN6A 1UBMS 2HBZA 1LB1B 3GDFA 3LRPA 1G5TA 3AF0A 2D5AA 4TRJA 5I9SA 2BEUA 5G1NA 1IQ0A 1ZGAA 5E0OA 4CLOB 5IVHA 5IZ4A 5ALNA 1RYMA 3OCWA 1AHIA 3BHMA 4EHFA 4EKGA 1RYDA 4FE7A 2J0UB 3UGKA 3O8RA 3R5XA 3HLYA 2ETXA 4NV3A 1N6PA 4M46A 2R6HA 4LCBA 1NT2A 1X74A 1WX1A 3WWEA 5CB0A 1JR4A 2NV0A 5KX5B 3SXJA 4EMTA 3RANA 4ENRA 4O29A 4QRIA 1CUGA 3PRYA 1IN8A 1KJQA 4TMXA 4BNLA 3ZVMA 2ZJBA 3GJQA 4WEOA 2B6HA 1V95A 3KCNA 1E1DA 1H2EA 1AKMA 1OHHA 2CFIA 2C3PA 4IJ5A 3TRFA 1RRPA 1L7OA 3QV2A 4DLPA 3C3MA 1EFRD 4KAAA 2IDZA 4XYEA 1DEOA 1XZFA 1JXOA 2PGJA 2Z2XA 4YMHA 2NT4A 4BKUA 2VDMB 4QOEA 2PWZA 2QUZA 3NI2A 4HWRA 4BC0A 4AJ4A 1P7YA 3O91A 5KC9A 2QB5A 1P9NA 2FPIB 3V8BA 2QD2A 1EUDA 5EHIA 1ZLYA 2IEIA 5B7QA 1ILEA 4D4GA 2EGUA 3ZLTA 3LL4A 1OI7A 1TAGA 2O5VA 1H8EA 5F52A 2AL7A 1J8DA 1R88A 4YONB 4JJ8A 3T15A 2JGDB 1LKZA 4YI5A 3TQQA 3F6EX 1IATA 4TQUS 3HI6A 4Y0AA 4Y9UA 3A1DA 2CNDA 4Q3NA 2XOXA 3V8NA 2WAMA 2W4MA 3L8HA 1TU0A 2QBYB 4I50F 4PNHA 1DJNA 3P20A 5T8KC 2VHCA 4WOCA 1CB7A 3GRZA 4RD2A 2BR5A 4HEA1 3UTDA 1A50B 3W9YA 1KKUA 3O0TA 2IPNA 2CMKA 1UJNA 4HDSB 1CJUC 2ZRMA 4RHYA 4UTOA 5CT5A 1JTFA 4BNDA 2FEXA 1P1IA 2XA9A 1R6VA 1OROA 1TRHA 5GIPE 2RBGA 2VAPA 4R84A 5GVRA 3AETA 2ENUA 3A8TA 4JJGA 2QEQA 1FVFA 1TJYA 3GRCA 1LSSA 1OQAA 1R0WA 3GRYA 4QVIA 2WJWA 4EG5A 2G7MC 2V6IA 3G0IA 3O26A 4QWMA 3MOSA 5FO1A 2P9HA 1OXVA 2Q1TA 4D4HA 3CS3A 1O5OA 1GGNA 3UZUA 2AG5A 3D5QA 2Q0HA 3AIIA 2PKQO 3DCYA 2HHLA 3MW8A 3OZGA 4O8CA 5FPHA 1J33A 5G0WA 2FE1A 3PVZA 3WP0A 1RQRA 5BR8B 1PEKE 4UBJA 1XZNA 3AR3A 2HDHA 4OK6A 3BRSA 3BCSA 2C1EA 1KKMA 4BO6A 4QGAA 4LXUA 2GEFA 4P33A 1E4EB 4X8LA 4XTRA 2J87A 4B8ZA 3LGAA 1YJ5A 2ONZA 3KKOA 4XUGB 5LBIA 4AJKA 5IH7A 1M5UA 3F46A 3PEFA 1LDNA 1XDWA 1EFHA 1I7LA 1KC1A 3FHJA 4CIVA 4DA9A 5IG2A 1E2QA 1LZKA 1N2IA 2RB5A 1NUAA 1NLMA 2VN8A 1NY6A 1NXQA 1PSDA 3T3PB 1N77A 4RFLA 5FOSA 1PTKA 3THWB 4B3TB 1V5GA 4HGNA 4JLNA 2WY2D 4CEIB 1INLA 1XA4A 3IBYA 4BBPA 1L5QA 4ND8B 3EMBA 1CZHA 2GZRA 3DTYA 1D2AA 2H1IA 3SDZA 2F64A 3F7TA 1LJLA 2D0OB 2Q1WA 3VYWA 2FJPA 1QLJA 2FR8A 4YRFA 5JS6A 3HVIA 1P60A 4M88A 1F3LA 2PZMA 4BQEA 2UVDA 1BYIA 1EDDA 4J0HA 5EIAA 4ZJYA 1GKLA 4S1VA 5AJTA 3EUEA 1PDVA 2R6JA 1TM7E 4DCMA 1OH6A 5CXSA 1G21B 2C58A 3FYSA 2CNWA 1U99A 4PN7A 4TKVA 3H0CA 1R8JA 4KGXA 3OKPA 5CITA 2MYUA 4EVQA 3H5AA 5B1YA 2HCTA 4IGKA 4O2BA 1Y7IA 2EJVA 2W2LD 1MV8A 5DX8A 3HVHA 2IX9A 4DBZA 3GJSA 5EI5A 2HIAA 2P0YA 2R2GA 1C7FA 1Q1EA 2BKEA 4C06A 4QE3A 4J1TC 1MVNA 3SZRA 1QP8A 4R8KA 3DMDA 1U2RA 2WG0A 4GIBA 4E70A 4RTNA 4MVYA 2B78A 3ZN2A 1SIUA 2QENA 1JDBC 1SOMA 3ZE8A 5JJCA 4UVHA 3VA7A 5COBA 3KBBA 1KH1A 1I7DA 2AEEA 1W4LA 5IVPA 4O4LF 2C0PA 1PFKA 1K5PA 1I14A 4ZVLA 4LK2A 4NMHA 3GO4A 3T8YA 1QYCA 1SCIA 1GDHA 1KZ6A 1YBMA 1LWOA 2V8OA 4G0NA 3LCMA 1B26A 8ADHA 2GM9A 3H2HA 1E6KA 4JXZA 1CUBA 1SUSA 3DAGA 3F67A 2VDOB 2ZIVB 4TXLA 2WD7A 1EFVA 1WVGA 2I2AA 3TFQA 1KMHA 4A8JA 2ZM6B 1E9VA 5FBHA 2D06A 4ZAGA 1TQ6A 3FNBA 1P44A 1YRYE 4ZN6A 1SPBS 1HYQA 3VV3A 1NP6A 4DJJA 1P62B 2FW9A 2P68A 3N2GA 4N3BA 1UDRA 3WIDA 4AJLA 4XGKA 2BT4A 1NZFA 2VHUA 3IOBA 3KFLA 2VPWA 1POWA 5ESRA 4F5YA 4IVPA 1MO5A 2W58A 4ZZ2A 3CF6R 2X8JA 2PBRA 2Q4EA 4ZQFA 2VDWB 3WC4A 1PT9A 4LRYA 5GQSA 1SAYA 5FTLA 1U0BB 1T5OA 1WZ2A 1DTWA 4P3XA 3LV8A 2PXHA 3EXHB 3L7BA 2RCNA 3W3AD 1QAQA 1N5OX 1QZ3A 2PZJA 4P92A 4IMJB 5CPBA 2QK4A 1DNPA 1ZK2A 2TMKA 3H87A 3LRXA 2HEIA 2QP4A 3FFXA 3HA2A 3SIPA 5BWMA 4IIXA 3N3BC 3F6RA 2BFEA 1N2BA 1XVAA 1NJ8A 1M75A 3KWLA 1Z39A 3CLRC 1XN1A 3RUDA 3M4NA 1HY3A 4B35A 3AF2A 2XE7A 3CVOA 4K9OA 4KWTA 1AS0A 4R68A 3JPWA 3CEHA 1MDFA 4KSYA 4FHCA 2WWIA 1H1TA 3D31A 1TK2A 4EPRA 4WV3A 1P4SA 1P3DA 2VDVE 5BWOA 2Z4SA 1GDDA 3LIIA 1A4RA 1IZ9A 3FKSA 3I64A 3A2NA 2QTNA 2GFQA 4WLUA 3RPEA 5BSEA 1Q74A 1XCLA 4YJ2B 1QE3A 1LPOA 3OCJA 2WYIA 4YV7A 4B87A 1ORTA 1BVRA 2R85A 3HA5A 4PHCA 4C5BA 5KWVA 3AR4A 2PS3A 2WABA 1AH2A 2GN8A 1IXZA 2BL4A 2J45A 2ZSHA 1GPMA 3M6XA 3R44A 4LJKA 5D3MB 5CDUA 3LK6A 2PKXA 1C14A 1T2FA 3GNTA 4KVGA 2O8BB 1H0SA 5E7IA 1NONA 4BNVA 4EUKA 3TF5A 2H65A 5JAPA 3C5CA 1SA0B 1QQ5A 4NOJA 4WZAB 5AFSA 4O2RA 3QKRB 3DTVD 4BNGA 2VCHA 3UHPA 4HNTA 2CHEA 2NZJA 1SEVA 2EFGA 3EGXA 5GJBA 1NBMA 2FFRA 4BLSA 4DC9A 3TL3A 3D7RA 4UC0A 4WCDA 3MWYW 4FFMA 2XMPA 3ZX5A 4DXDA 2D62A 4PLFA 4YPVA 2AWNA 3AVOA 1FUYB 3FTQA 4TQ9A 2JC3A 5ER6A 3K30A 3MM4A 3NHUA 5D7NA 4BLPA 2WD9A 4Z9FA 4QZVA 3U49A 3ZV5A 3EMVA 4X20B 2GX6A 4DTIA 3G59A 4OREX 4OLFA 1YBFA 4EKYA 4CR6A 1U1DA 3PVSA 4ZMBA 3T3DA 2HYIC 3K70B 3HXTA 2DUJA 4Y6LA 4KXQA 1A71A 1NLFA 1QCCA 1YDGA 2MR5A 2ZJ1A 3B3QA 4RK7A 5FBWB 4A9AA 5SICE 4BO3A 1A8HA 3UPTA 1SQ6A 2L17A 4PRYA 2PG3A 3W0LB 1JIVA 1SUWA 3I62A 2AB0A 2NO7A 3LDFA 4OQZA 1PWYE 2GO1A 2IBSA 2R8ZA 4V2IA 3UA4A 1UWKA 3QTLA 3KDSE 1P1BA 4RDHA 1JN0A 1K8YB 1FL9A 3DTNA 2GDZA 2VPZA 1U8FO 4R1SA 3TI9A 4Y6GB 3MJHA 3RJMA 4IIJB 5LQUA 2C5FA 3BXOA 5LWQA 4AY3A 2JD2A 2G77B 4YMLA 3UK1A 2EF1A 4UBLA 3IJ5A 2WM2A 3FHLA 4FDVA 5L95A 3DYIA 1UBEA 3FMPB 4B4VA 5L4SA 2QG6A 5KYUA 1P7VA 2G06A 1CX9B 1SIOA 1TM1E 4MR8A 4MRRA 4OBXA 5CH5A 3FZQA 2YQZA 1OD6A 4F8EA 1LDGA 3D8SA 3OURA 2Q3DA 3SK0A 1ZNQO 5EEGA 1XRLA 3ORFA 1W2HA 3RKRA 1C7EA 2UYQA 2BAGA 3D4PA 4I5DA 5LXTF 3WYGA 4R5HA 1JEOA 2HPZA 2O8NA 2WVHA 4MEAA 4AWAA 3DMTC 2BF4A 2ZSAA 4HX9A 2O54A 1PZHA 4OJTA 3NZEA 1DEAA 4MRMA 1GYRA 4TSKA 3UJDA 1Y5RA 2R1TA 2A57A 2Q8NA 4B3JA 1JLMA 3OMXA 1EB9A 2OB1A 2WKWA 3DOOA 5GJVC 1QNFA 1RI1A 4AUNA 2XVXA 1L7DA 4LQDA 2ZRPA 1NW9B 1JSCA 4RKQA 5DLYA 4NEQA 4CM5A 2E37A 2NW6A 4CTMA 1QRRA 4HVCA 5M04A 4NPCA 4IM7A 4MAFA 1R5BA 4KUEA 2RH4A 4M83A 2OGWA 2FZLA 3H2SA 2OWDA 3C8DA 3V2GA 5LA6B 3JAWA 2FWMX 3VR2A 1G8AA 4UNRA 2BMAA 5BPHA 2BFDA 3CZ4A 2QDXA 2I62A 4IVRA 1JTEA 4XDHA 5TEWA 2ECQA 4IV5A 1V5EA 3IELA 3TKAA 2FPRA 4WT7A 1E9RA 4YYEA 2YDXA 4HFJA 4ERNA 4I4LA 2GILA 4UULA 5CT9A 1PYDA 4BLVA 1EXDA 4MI9A 3ZY3A 3WYBA 3R20A 1NKTA 2YWFA 1SXJA 5A2QA 1GZ4A 4KFTA 3GQBA 1YZTA 1JBEA 4KLCA 5FTWA 1GNSA 4FOLA 2TMDA 4LX8A 1XO1A 1YZYA 2B69A 4S0XA 5CX1B 2OMEA 3JQ7A 5IUNC 4WZBE 1Q84A 4UDOA 1Z4JA 1KOGA 2JJ2D 2WU1A 2CVHA 4MVJI 4FYYA 5K3FB 2PBFA 1G3MA 3EE6A 3GAMA 4TTQA 3ITKA 5IKEA 3BH7A 2IDMA 1FJXA 1BO6A 2OORC 4ZRDA 1PX0A 4ZANA 3D3KA 5F76A 2P1RA 1PJTA 1TZMA 1U5BB 2OXTA 5K8IA 2QVCA 1U2QA 3HJTA 3N39C 2QUHA 1OBHA 2QVZX 2ZVQX 3K5IA 5SY6A 3GLFE 2ZUSA 4U2BA 1DIGA 4ILEA 4RMHA 3FRHA 4NP6A 2QW1A 3IVAA 3PC4A 5AI5A 3VMFA 5AHWA 3ZWVA 4EY7A 5KNCD 3TGPA 2WPNA 3VAYA 4MYCA 4QXOA 2PKWA 4UHFA 1XTUA 4RSGA 2HIHA 2GDJA 4UNQA 3LIPA 4RHFA 2EZ9A 1M2NA 1G6HA 4PLCA 3ZKWA 5CYGA 2IS6A 1MQ9A 4E13A 2W11A 5A7FA 5HM6A 4IH9A 2QZ4A 3IQEA 2RI1A 1HA3A 4KP7A 1QV9A 2WUGA 3UT5A 3P32A 2Y1OA 2YMQA 5JADA 1PZXA 1V6AA 2XRMA 2P9JA 4JVSB 4X45A 5DVZA 3R7WA 1PGOA 1J0BA 5E4YA 5HZMA 1ZZGA 1W4AA 5T64A 1JIIA 3HBFA 4KFCA 1U1EA 1J42A 1KL7A 1IOLA 2LKDA 3OEHD 2Z3WA 4FFNA 2ZRFA 4LN1A 4XIIA 4DYVA 3VOTA 1BRMA 3H13A 1GTMA 4HWGA 3ZZUA 3ETDA 3QOYA 5FPSA 3GRVA 4DSTA 3L82B 1G8MA 3DPSA 4RPCA 4YJHB 4JJ7A 2D2FA 3RNLA 1D8AA 1IHDA 1F0NA 1A72A 2Q5EA 1AG9A 2FPPB 3A1EA 4X1YA 5CLGA 1PJLA 4KLZA 1SC6A 2WPDA 2Z83A 3RTDA 3CA8A 4RHXA 4XD7D 3IE1A 5B3LA 4KPUA 1K08A 2YRFA 3V9AA 1Q11A 3DC7A 2H7YA 1P75A 4K9PA 3OETA 1P0QA 1TZ2A 5KYXA 2RHBA 1RFGE 3SJAA 4MV1A 4XLLA 2DOKA 3D6TB 2NYVA 2YZGA 1KWKA 4NMLA 4B73A 2C2KA 1UKBA 3JWGA 1KQOA 3RVQA 5F3WB 4MV8A 3E3MA 3TDKA 3MAJA 3TDNA 1VHQA 1PJQA 3KAQA 3R8FA 1QHHB 1AKYA 1VI6A 2JDIA 4WI1A 5TV2A 3IUMA 3OLVA 1Y6JA 3V48A 2JRCA 3LX8A 1B8UA 3WBJA 3TUJC 1HGXA 2BEUB 3PUHA 4KWCA 2WJZB 2YXNA 3GEGA 1R5JA 5DW3A 4XI9A 3WGOA 4GYJA 2YIJA 2GJ8A 4RKYA 2IYEA 4FM9A 1E6WA 2CXPA 3J7TA 1E0JA 1LRJA 4JVOA 4DJAA 4O4JB 3B51X 3QFHA 2R7AA 5K8VA 1QMPA 4IFIA 5KTSA 3T3IA 3D6JA 2JLUA 1FLVA 2JG3A 4LYHA 1JHUA 3LM8A 2NU8A 1D9ZA 3TRKA 1KFEB 3P9NA 3V1UA 1ISGA 1E2KA 4NHOA 4K8OA 3OVMA 1L5YA 1RZVA 2QQ5A 3ENNA 3A31A 1MX9A 2HF7A 2X8AA 4IVNA 3WJ1A 3WK4A 3ZR4B 5FRDA 1WW2A 1KJ8A 3P2KA 1VHLA 1QHNA 5JDIA 1LBHA 1N1GA 2IU3A 2VZ0A 3W8EA 4JVMA 5TGZA 5JYEA 1EUDB 1QVWA 1THMA 4UOQA 5AR1A 2R2AA 4ME6A 3S1LA 4RMJA 2AMLA 4IYRA 4YREA 2CSXA 1ECPA 1K92A 2DFKB 1TL7C 2FN7A 4OSOA 2PH7A 3AR8A 3KJIA 1TFUA 2A88A 1PJAA 1VLMA 2VK1A 2WJGA 4PLPA 4DR7B 1ZJZA 3OJ0A 4IJWA 1OR8A 2DERA 4HB4A 3GMIA 3O83A 1M34A 3TZEA 1OPXA 4GG1A 2O05A 3LBNA 2ID9A 1H9CA 1CUYA 1KFKB 1WXWA 4E07A 1EINA 2E85A 1YU6A 2QE7A 3GB9A 3HDYA 4RCZA 4WJZA 2HWKA 3EMKA 4KC0A 4EGJA 2YH2A 4AQYB 4L73A 1J0EA 2IOYA 3ZDYB 4AYXA 3ZZ0A 2C4HA 4KPEC 3N28A 2RGUA 1CF2O 4KNVA 4LZWA 4LAFA 4M9RA 4QGHA 3RRJA 3RUEA 4BDSA 2JLWA 4MJ3A 3E48A 1K2WA 4O0LA 4U7HA 4BNDB 5T4HA 2Q29A 3PQ3A 1FSSA 1V2HE 2HUNA 4X8OA 2ZJZA 1JFRA 2BUAA 2VYCA 3RU3A 3SZLA 5C9ZA 4ITRC 4IR7A 5KQGA 4X85A 4QGFA 3ZGYA 5C3UA 1X8LA 4L22A 4ITVA 2OCGA 2QD5A 4PC2A 2WP8J 3ND7A 5K45A 2ISCA 5CFMA 3I05A 1NN0A 3RVSA 1RLUA 1XF1A 4BQFA 5C81A 4BKRA 1T6YA 1MTOA 4XDYA 3F3YA 3WLNA 2ZZMA 3UPDA 2RHOA 4MGYR 4GLLA 1PP4A 2PSSA 4JUAA 1RXYA 3VVMA 3EASA 2BRUA 4ASUD 4PBTA 1RC8A 4V2UA 4WY8A 4KN5A 5D3ZA 4YUVA 3TCKA 5FNVA 3ECAA 1RYZA 1PX2A 3K5HA 2A0KA 3IERA 3OPXA 4Y2PA 4YFVA 4HZGA 5FBQB 5AK6A 1QHXA 2IU4A 4OUDA 3NM6B 4NARA 1JHRA 2DSNA 3U7RA 1PJRA 1RIFA 3TZLA 4K5QA 3WTBA 2WB2A 4D3ZA 3NDBB 2GAIA 4E88A 2GTIA 3PRKE 4KRGA 4HXEB 3GAZA 2G4LA 2QAGC 2YWRA 3BREA 3DZCA 3JZMA 3GZNB 4P34A 4ZO8A 5GJWC 3GLSA 2WHPA 4E5DA 5BWBA 3ZCXA 2QRGA 2DBRA 5JNVA 4LF8B 1ABBA 1IN1A 4PLVA 1P4GA 3TQHA 2NLOA 4RD6A 1AB6A 2QUJA 2PFSA 4X8HA 1MAVA 4YV0A 4LE0A 2LP4Y 4ZU3A 5C8ZA 2M6SA 2G9UA 1WMEA 3W9UA 1YS1X 4HAVA 2XCSB 1YHNA 4CF5A 3PUXA 3MMXA 4HQRA 3K9LA 4GPEA 1SOVA 3M1IA 1R6AA 3HJRA 1DU4A 5KU1A 2NGRA 3BFKA 1ADYA 1PFVA 3DXFA 1H4SA 3HN7A 1XYGA 3BGSA 2B5WA 2FKNA 2UZAA 3FWYA 3K9CA 4H4EA 4YFYA 4ZVRA 2XYGA 3FCEA 3HYCA 4TLDA 3UBMA 5BR7A 3IOCA 3UYKA 5L8VA 3W1VA 3EGEA 4AZWA 1T8TA 3ESYA 2QORA 2P91A 2I4OA 4Y98A 3PGA1 3DVQX 1K7SN 4CIWA 3B1XA 4BWFB 4EX6A 2I4TA 1Z29A 3GHYA 4GW3A 5IN4A 1R8YA 4WPGA 4D0LB 1YO6A 2FPMA 2YX1A 2XH8A 5EUMA 3FUWA 2EU8A 3RB8A 2TMYA 4K28A 3DFUA 2WD7B 1EFVB 3HZOA 3PUVA 3ZDQA 1KMHB 1GKIA 4I99A 4ZGWA 1QS0A 4KGDA 3JARA 2NO0A 1KPIA 4OHMA 3ERCA 2K7ZA 1G3QA 3JD0A 3VKFA 5B6JA 2ZZNA 2EWMA 3X2EA 3SMVA 1DDOA 2IKQA 2HB6A 5F51A 1XT6A 2DMRA 5DP1A 3JRWA 3PDHA 1YQDA 2PX6A 3MT0A 3LBAA 5JVDB 1LF0A 4ZJPA 3ZJ5A 1VL8A 1V3QE 4DM3A 4URUR 1DTWB 4BCCA 5JMTA 3VJRA 3C7CB 1GU7A 2ZLBA 4DBVO 4UTXA 3O8OA 3OAAA 3VRHA 1KU6A 1I6LA 3IQZA 1ORIA 2ZTHA 3IJRA 2A1IA 3SEZA 5IWCA 4RVCA 3AUYA 3TAXA 2WILA 4IMPA 4M8SA 1XVVA 3PFHA 1B0UA 4QJIA 2PKCA 5IHXA 3J81k 3QKUA 1BGWA 1A5AB 3N0WA 1H8HA 5DTIA 3DOEA 2BHRA 3DAPA 2AI1A 1RQGA 2J1LA 4MCIA 4WBNA 3UHJA 5HQJA 1WLSA 2VXYA 4PONA 1BS2A 1BS1A 2I4RA 2VHYA 3U9SA 3M5PA 3EGDA 4DQXA 4ZYYA 3R5KA 1DPFA 2P79A 1K97A 3Q7RA 2BKAA 1RP1A 1HE5A 1OA0A 3ESXA 4M22A 4U39A 5FPQA 1UJ6A 1X19A 2XEDA 3FWHA 4G09A 4IKEA 5C8YB 1I13A 1N2OA 3JQFC 1RYEA 2VVTA 5K0GA 1JA0A 1B23P 3CRZA 4LRSB 4RZSA 2X6RA 1SB9A 4BNTA 2R62A 4OQNA 3OE4A 2BVNA 3C3JA 4ZPXA 1HFKA 1K4KA 1EB8A 5ICSA 2V0CA 4ZVUA 1DELA 3I2KA 1L5WA 4LXIA 4QULA 2ZE5A 3UJPA 3ZE7A 2JHCA 1XPUA 2IYTA 2NVWA 3SSNA 3V1MA 4D3FA 3A3NA 3I8XA 1ZH0A 1AZWA 3JQAA 2PXCA 2FWPA 1SRQA 2QRQA 2X9VA 3EIWA 4MO2A 3PJGA 4JP8A 3DJYA 3FJ1A 4BBJA 3CXUA 4BFUA 1O95C 1ZQ1A 2PYZA 2ZRQA 5ARDA 3LE8A 3CY6A 5CXUA 2AJBA 3ZLJA 2XTJA 1NNI1 2EEZA 5DBEX 4B3RB 4IV0A 4F92B 1YF3A 4AS3A 2C7GA 4NATA 3SCZA 2Q3EA 3EQ2A 3C41J 3NASA 1QIFA 2YJNA 1VL5A 1TT5B 1XQYA 4IJKA 4BFYA 3GLVA 4EG4A 3MUNA 2HLDD 3U44A 1KK0A 3LO5A 4ZI5A 1WCV1 1DDGA 1JU9A 2P4UA 5DCLA 5TQVA 1BGXT 3VKVA 1TK3A 1BRTA 1M1XB 3B7PA 4AXBA 2QT0A 2I2FA 4JBIA 3WOVA 1Z45A 4DCCA 4XLZA 4B40A 2GA8A 5A3QA 1QFYA 3TKYA 1OBFO 2HV9A 4EGCB 3LWDA 3B2EA 1QZXA 2VP9A 3NYWA 1ODSA 1CKEA 3IKLA 3N86A 4NQRA 4RX1A 2XJ9A 5EY5B 3HDGA 3B20A 4NAHA 1BDJA 1H4QA 2PN1A 1I0LA 5SY9A 5HQ3A 2P4HX 4JZKA 1VLLA 4M9ZA 3HO1A 1ESMA 1GILA 1VG9B 2GO7A 4P84A 5JNLA 1XLWA 3UGJA 2NP6A 2WU8A 3K5WA 5LL6P 3PL5A 4OB8A 2Q07A 2PL9A 4DRZA 1EJ6A 3ICCA 2FMXA 3EG9A 2AQKA 1YBVA 3NJ4A 4KMOA 4LWQA 2YNMC 4Y2UA 4DMHA 1V3VA 2YINC 3MJEA 4R40A 2H1OA 5KYUB 5A4KA 2D2EA 5IANA 1M8JA 5K0EA 4ZHQA 1R4NB 3M6AA 2WYWA 2FPSA 4UNPA 4CCAA 3O2NA 1U3TA 1Q19A 2X4IA 2HK9A 4CTJA 1XP5A 4RMNA 2G4CA 4XWWA 3PXGA 2LBPA 4J7XA 4RA9A 1P0IA 3BK1A 1F48A 1QJCA 1UMBA 1GAWA 2GYWA 3CJQA 3OCUA 3QMWA 3PXEA 4L5YA 3W8RA 1DAKA 1G3RA 3D4IA 3I3SR 4TS3A 3W5UA 2PSJA 2Y0CA 3FVVA 4MVJM 5KTNA 4HYEA 3O8CA 5DXAA 4PYOA 4O3FA 1TQHA 2C5BA 3HJBA 3NBQA 2H06A 2QZSA 3HB4X 5CHYA 5CDTA 1V8OA 1W1UA 2WF6A 4I46A 1J5PA 4KO2S 5ALUA 1UZMA 3OZEA 3JAWB 1GPUA 3EOZA 1WPXA 2ORIA 4PC3A 5EEHA 1ZI9A 1P2TA 1EM6A 1XU4A 1XZAA 2VKTA 4HS9A 4YCAA 3IQXA 2PUHA 4BNYA 3ZJUA 3Q3IA 4B31A 2JAUA 4I8IA 4BMCA 4Q24A 1BFKA 1JDJA 1UXKA 3LGXA 3Q98A 4LWPA 4A0SA 5CB4F 3DDNA 3QMMA 5MFPA 1U9IA 3UXMA 1N6LA 4C0WA 1ZXLA 1JJBA 1SXJB 3AL3A 4Y9RA 2VNHA 2N0SA 4IZHA 1BJRE 2FZWA 4QOJA 1NVXQ 2QUAA 3DBRB 3DYBA 4MKGA 3WGLA 1WL8A 2OXEA 2JJQA 3JALA 3THOA 1Y9ZA 1MGPA 1EWYA 3FMGA 2EEPA 2Y8EA 3BHNA 5AW5A 3VC7A 4F11A 5KCZA 3MJDA 4FT2A 3GDHA 4GZMA 5T57A 2PUJA 1KZHA 3VNBA 1RWOA 4MVWA 2O20A 1T6XA 1JVBA 4Y2XA 5EUCA 4YCLA 1IWBB 1QKJA 1BHQ1 2Q7XA 1FW8A 5BUCA 1G8HA 2YHUA 5EG5A 2WZQA 3F6PA 4JB3A 4OPMA 4BX0A 4CKBA 2BZ0A 1NJGA 5C52B 4X0EA 3COZA 1PU2A 5SYAA 4V03A 1ESEA 5EMJA 4BO0A 3ADBA 3P2EA 3QKIA 4XKJA 4XWYA 4BMYA 3ZKWB 5HQ3B 2PGNA 2JATA 2H2FA 4E21A 2ZTVA 2GAJA 4IHJB 3TM4A 3U6KA 3V4FA 5BWNA 1RWVA 1TM4E 2GZSA 1OZ0A 5KKCA 1XZIA 4J8PA 2EC5A 3ZV6A 2JI4A 3UT5B 3FWNA 1RZUA 3V00A 3VHQA 1K75A 3DL0A 1FRFS 3H9GA 3R7WB 4AECA 2V3CC 4YCBA 4QPJC 3WB2A 2HQOA 3VC3A 4D97A 2D8AA 1CZRA 1FS5A 1KJNA 1S3GA 1QLHA 3K53A 5H59A 1QAMA 1VHWA 1B1CA 2UVPA 3H1BA 2RI6A 2WICA 3EGWA 2WIGA 4ABTA 1E1QD 5JYCA 4OBBA 4JYAB 2W83A 3R6GA 4YCMA 3F4BA 3I73A 3WAGA 2PUFA 1Y1KE 1VCOA 3AM3A 1M2FA 1O94A 4M36A 2QD3A 4P31A 3K09A 4X1YB 4ZYVA 3KUCA 1XTSA 1R12A 4KIWA 2DBYA 3A27A 3OIYA 3D1VA 2I6FA 3K0FB 1T1IA 3NNDA 4FCVA 1S89A 4KXVA 4KPUB 4OV6B 4UUOA 3LVQE 2ZUTA 4DCJA 3MTQA 4ZVTA 3VO9A 1Y8CA 1CQIA 3CSDA 3PTZA 4HEJA 4JJZA 5T41A 5KYXB 3G3EA 4KRYA 5F4BA 3VPBA 4ZP1A 1FZTA 4B47A 2JGAA 4V38A 4M8IA 5DT2A 1OXBB 1XZMA 2IZ7A 3NRCA 5J58A 3IBCA 3UWMA 4A1OA 3SQMA 3L7DA 5DHSA 4KREA 1R8SA 4ER5A 3OF5A 2GZ3A 2RFLA 2WJ3A 1OZFA 1UPFA 1TLLA 3OIUA 1FZQA 4GM4A 3ZIAA 1Q0HA 2SHKA 3CIFA 5LB4A 4A0RA 1XCJA 4RJIA 4QO7A 1GL7A 1K8RA 3IR7A 1BHJA 2R9VA 3ABOB 2PX8A 2ORWA 2QMUA 4U9IS 3FWZA 1ODJA 3ZCVA 3VYSB 3O8QA 2Z0MA 4HFRA 3QENA 4U8GA 1QHYA 2EERA 2HRDA 3NPMA 2SICE 1DBPA 3LYHA 4FK8A 4G67A 3PHBE 5F5LA 3WV4A 1E0DA 2QS9A 5I48A 2GWHA 4HK4A 4KR7A 5IS2A 1DAEA 2NU8B 1JI0A 3IHLA 3WXMA 2OQVA 3IQGX 1YS2X 2QY9A 4IJQA 2ZRKA 2NT3A 1XELA 3OKAA 3AFIA 2FXIA 1NJSA 3A4VA 4IDNA 2JLYA 3TB6A 4IIHA 2BUBA 1TXGA 1UCFA 2GARA 2O0LA 5LQSA 3C5EA 2BIFA 3T4PA 2DTXA 4AY4A 4WA7A 1KZ9A 1YRBA 4CTOA 2GBGA 4M1WA 5FF9A 3RRXA 2E6UX 2QJOA 3LX4A 3QXXA 4XPIB 1F5SA 1N0WA 2DWOA 2PV7A 3BRCA 4B80A 2C98A 1ISRA 4OVKA 4C5CA 1KTIA 1DVRA 1G16A 4IDCA 3HB1A 2JIRA 4IFEA 4WKPA 2PSHA 2XCOA 3WSWA 4MWBA 3ZQUA 4AMYA 5CRIA 3ZY4A 2H1VA 2NYUA 1M34B 2O07A 5DN6A 3KZCA 4B7ZA 3IIKA 5JAMA 5LP6A 1MPTA 4KQGA 3WLIA 1QU3A 5JBNA 1HUQA 2ZUFA 1QWOA 3C43A 4XQ9A 5E7QA 4CZ2A 2W2PA 4CF3A 5CNIA 3NDPA 1DDIA 3T3HA 1JIXA 1G63A 2VSYA 2I4MA 3KE9A 1EI9A 4J4HA 5KPDA 3KL4A 2Z1MA 2Q2QA 1Z56C 4TXNA 4ZREA 1UBRS 2CB0A 1CULC 5EMMA 3WGHA 3HZHA 4BC1A 2FOXA 2VHVA 1IUPA 1UJCA 3DWFA 1BE6A 2YJGA 5CTJA 5REQA 1N3YA 3NYQA 4DAEA 2ISQA 4BQIA 5K0ZA 3E5MA 1WEHA 1DG9A 1GLGA 1PT6A 2AOVA 2LV8A 4V1CB 1E3LA 1B73A 1R18A 3FI9A 5IT5A 3IVMA 4GE0A 3VI4B 1DRJA 4C1BA 1UEXC 4CGZA 1O97C 2FMFA 5HA5A 2NPIA 4F96A 3G6WA 1F51E 4XFKA 1TJ3A 2O2YA 1GVNB 3H4VA 4Q16A 3CH4B 2R6CA 1EP9A 3D3WA 5IJZA 3WRVA 1WBBA 1CF4A 1SFRA 3ENZA 3FVWA 2HPVA 3I1YA 4MUKA 3B89A 4S24A 1SEPA 2QGNA 4WFKA 1G8SA 4X1KA 1TKRA 5FBRB 3NRJA 5JANA 1TMOA 3DZFA 5FNVB 1AKEA 3LHDA 4Q4HB 1PJSA 1IULA 4E32A 4YAIA 4Q4JA 4CCWA 3QIVA 5LNK1 2ZYIA 3UGQA 4JDUA 3BD6A 3IJEB 4CQLA 1YB7A 4WMLA 4OUDB 1ACMA 1V5WA 2BGMA 3GN2A 4Q47A 1C0KA 3H7IA 1FTNA 2VC2B 2YHBA 3C14C 3QLJA 3PP8A 4DLTA 1G7TA 4YDRA 1QXSA 5DGDA 4PQGA 4JKIA 3FROA 3R7BA 3SBDA 1GUBA 3A1VA 1WBDA 1Y7HA 1M5TA 3P96A 1Z34A 3L8DA 3ZDFA 2WHPB 2X5OA 3EOAI 3GA7A 4CKWB 4TV9A 1BFDA 4Q05A 3VOSA 3PBKA 2C77A 2G7ZA 4EOGA 4ZQBA 2EW8A 5DGHA 3BWDD 3B48A 1B41A 1DBVO 4Y9DA 3USZA 4NCIA 1NULA 4O2AF 2JBHA 1R16A 2E1PA 5EQTA 3C3PA 3WKCA 1K7FB 4BJ1A 4DG8A 5ADWA 4RCYA 2P4EA 5FHRA 2ACKA 2J3QA 2O2DA 4L07A 1ZOLA 2NACA 3BQMB 3I58A 4QO8A 3T1VA 1VL1A 4J9UE 4MV7A 3ZBQA 4YCSA 2ZS9A 5JLAA 5FWAA 2GF2A 1PJ8A 1HDZA 1XAJA 2YXEA 1YC2A 4GLBA 1RPZA 3GYBA 3HFSA 2GRJA 3I12A 4E22A 1II8B 2B1JA 2P2DA 3ESRA 3S2YA 4D45A 4TQGA 5HF6A 2RH5A 3AHJA 1RAFA 2G6BA 2Y1FA 4GOND 4RU1A 5KC8A 1LX7A 4JJFA 1CY4A 3HKDB 1K89A 3MSCA 2XCLA 4JUCA 4WQMA 3LYLA 4YMUA 3CZCA 1FTWA 3OFJA 3P94A 1GZSA 4WTOA 4BGDA 2ON6A 3BMQB 3DEFA 3I1JA 1SCUA 1P6UA 2MU1A 1FSGA 4FI3C 4WAUA 1R4ZA 3PGKA 4W1QA 3WLHA 4BX3A 2O7VA 3OIWA 1CUSA 3WB9A 4XFDA 2IHNA 1QP0A 2ZJYA 4RJTA 3CTMA 1DFHA 3GJRA 4R3WA 1U3GA 1RAHA 4A0FA 4BLOA 1ZITA 4LJ7A 4B8WA 1ATIA 3AFGA 1L5RA 3F4LA 1EGVB 3E27A 3I23A 3AT1A 2R87A 4QJBA 1QS0B 2IYFA 3ZVLA 4A8TA 1MB0A 4BO4A 1YRQA 5LNK6 1N2EA 3AG5A 4I9GA 1D4OA 1X1SA 2OV2A 3ANTA 3I9FA 2Q5CA 2AXPA 2WSLA 1ULAA 2OESA 5I7AA 2HXYA 3CEAA 3R09A 4BS9A 4F6RA 1PT7A 1GL3A 4IV8A 4EKEA 3EEOA 4DV0B 5JWRA 4ZTBA 3WGGA 2J07A 5JCPA 1E2PA 1L1RA 4QQFA 1WMFA 3EGIA 2H5EA 4BIMA 4M2LA 1EAYA 1E9EA 4HJXA 3O8OB 1GKUB 3OO0A 1XOIA 1JSZA 1MB4A 1Q57A 3GP5A 2B2CA 4UE2A 1C2YA 1UK9A 3DOIA 5DW0A 3Q6IA 3PWZA 2ZIAA 1CE8A 2YOHA 4TMWA 4U7TB 1GXSB 1TRKA 3UH0A 2JJ8A 1LNZA 3NDJA 3V7UA 1ZWLA 1Z82A 1CP3A 1SKYE 1RQXA 1R5OA 1YE3A 1QIIA 3P9KA 4EG1A 3A6DA 4PZPA 4AW9A 4WBNB 2A7QA 2YC2C 3RUCA 2VSOA 1P81A 3LA8A 3EGDB 3RASA 1M6YA 4RY0A 1SG9A 2BSXA 3QNMA 4Y7DA 5CT6A 1B1AA 1XE3A 3L7JA 3N9IA 3A1UA 3R7AA 3SFZA 4MMYB 4JI8B 3O9MA 4TTTS 1R6TA 4EEXA 2CV0A 1M72A 1GPDG 4JYPA 4BQNA 1E9DA 3BXXA 2OCLA 1S5PA 1NE2A 2R00C 5GOTA 5AJWA 3DQZA 2YWBA 1NJ1A 2MWMA 1KNXA 5CK5A 5M7EA 2IPXA 3C7AA 5DHQA 2I6QA 1BYUA 2QX7A 3FY4A 2DLDA 2HCFA 3MT8A 3CF0A 4FONA 4LE1A 3UMCA 1RTKA 3VI3B 3FJYA 1NT4A 2XWPA 3M0EA 4BPRA 2VWHA 3HK2A 1P7CA 4AM8A 2EKPA 4KGVA 4CKEA 3FOEC 4D0RA 4KG7A 1OFIA 4UAVA 1ECFA 5CNMA 4GBJA 1AZLA 3H65A 4Z53A 4TWJA 1JVSA 3M6UA 1Q17A 2BUCA 2OV6A 1I1QB 4I4TF 4YDQA 1CR1A 2Q9BA 1PWXA 3RGGA 5E6UA 5B7NA 5CNJA 2R1VA 1WU8A 2Q0SA 3JQBC 3DV9A 4U7DA 4NFHA 3ED1A 4BN4A 1IZ7A 3FCOA 3U44B 4GYKA 2NTJA 4HL6A 3WGIA 2ZJ8A 3CVVA 2ZUVA 4K6OA 3KLNA 4O4IA 2QT9A 4CIXA 5F73A 2B0CA 3E2MA 3LWZA 5L3SA 2IS2A 2ZYSA 4DR4B 1NGSA 3X1ZA 3CNEA 1I24A 5E6SB 4DQ0A 1ZR4A 1UEIA 4RPLA 4UQOA 1WVIA 5DULA 3X1KA 2ES4A 4HB3A 4KE7A 2PSFA 4RZ3A 5KCMA 3VPHA 3UMSA 4B4OA 4BB9A 5CFQA 2FSHA 2Q49A 3TNLA 2IZ6A 4OM7A 1USKA 1ZU4A 2H54A 2I8LA 4GI7A 3GFBA 1NNLA 2QL6A 4W1SA 2ZSFA 3NIDB 2FPLA 1IUOA 4QUEA 4KL8S 2EFYA 2C9ZA 3DZBA 2C0CA 3FVTA 4Q4DA 4RJJA 4L5AA 4JLPA 1F8UA 1MB3A 3L8YA 3UANA 2D00A 2H4YA 3E9QA 4K26A 2C4KA 1T9BA 1E2FA 1DIRA 5FO0A 1UJMA 1BXGA 2RGRA 4FFVA 1TCVA 3U7QA 1KI8A 1SOAA 2W98A 1MX1A 1KSJA 2X4LA 3PICA 3G2MA 4XIFA 3SICE 3VHRA 3RSSA 5L3QB 2DEUA 4ZHQB 3EIHA 3BWYA 1RXEA 2ZYHA 1SQFA 2V1UA 4C2UA 2RH8A 1WA5A 5HRAA 1TECE 1Z13A 3OZVA 2JI8A 2F1KA 1M0SA 2XMBA 2YV1A 2JEOA 4NLLA 5EINA 2ZE7A 3OY2A 1GQSA 3UJ9A 2C29D 1NXXA 4RA9B 3V97A 3ZWXA 4BKQA 1OU0A 3N2KA 5B30A 1YI8A 3IBSA 1V5IA 2VP6A 4M21A 1NX6A 4GEGA 4RKFA 3W7VA 4MB6A 1NASA 2HW8A 5IZCC 1X8JA 3NUQA 2Q5OA 4JSRA 3BKXA 3GVCA 4ER7A 3ORQA 3QK7A 4I14A 3EWSA 5F2NA 4P0PB 1SCKA 3D4OA 1GGJA 1RP7A 3W3AH 4Z6KA 4RTOA 3CVUA 5CDGA 4LV6A 1W44A 5AKIA 4PXSA 4UARA 1JRLA 2XGOA 2KMLA 3ZWCA 1ZRHA 1J24A 3PWTA 2PLFA 4BGEA 4B2IA 2QL7A 2DU8A 4P22A 4F71A 4BFCA 2C2XA 2II6A 3L0ZA 4Q3LA 3OX4A 2PX4A 5IARA 2D7JA 5G1OA 5ENVA 3ZTYA 5I7HA 3E9NA 2JKVA 1E5TA 4L16A 1DX4A 1VG0B 1R2QA 3N7UA 1Z4QA 3N2YA 3USES 1C9KA 4DLKA 4H59A 3EMDA 5KHOC 4ZO9A 4EHIA 3ZHZA 4OB6A 3V4RA 2XLCA 2IBTA 3QVLA 4YBRA 3C3XA 1Z47A 5EUQB 2R8EA 4OOFA 2G5CA 5EWMA 1SWVA 1CUXA 2GYVA 2ZR8A 4C87A 3JZIA 3JALB 1MHTA 4BFXA 5ENDA 4ZCTA 2H29A 1QSGA 1AXGA 1B6RA 1P4JA 3MYRA 2WTEA 2E4UA 2IY9A 4XB2A 3SN6A 1E7MA 2FEKA 4M76B 5DSXA 5C8VA 2ADOA 2Y9MB 1RYBA 1MH1A 2XDQA 1H93A 2JLSA 4NNOA 4L6AA 4KQWA 1IVYA 5EHZA 4L5IA 4PYLA 1ZCAA 2GPYA 4YT8A 4MCJA 1QGOA 1KOLA 4R5MA 4X7MA 1BGVA 1QCDA 4MOWA 2VXCA 4CKBB 2RC6A 1MO6A 1ZGHA 2IYQA 1NVVR 2R84A 4JLVA 1LA2A 2IV3A 3UJCA 4E15A 2WYOA 2PT6A 4G86A 1M6WA 4NI5A 4OJQA 1RSZA 2QU7A 4AMGA 4D41A 4D25A 2IKSA 5J5AA 5EMNA 5BPFA 4UFOA 5HJEA 1T4GA 2VA8A 1G5HA 2RMKA 3WP1B 5DBOA 5IYZB 3CH5A 4ML3A 1LTQA 5KHLB 3EIFA 1ZVVA 4S1PA 1E1MA 1N0IA 1ZUIA 5ERXA 4LZNA 3W2IA 3MT7A 1HDEA 2R5WA 5F4ZA 3KD3A 3Q3EA 1CEXA 5JCOC 3CURA 1J0XO 1QBGA 1XMXA 4HDQB 1OMOA 1Y34E 3VO1A 2WW8A 3RLIA 5I7VA 1Z0KA 4I8XA 3PDJA 1J9EA 1DI0A 3CW9A 2NXNA 4C01A 1NSYA 1FTGA 3DM9B 3FAZA 5EA2A 4BWYA 5K0CA 3SIWA 3LHIA 3UAZA 2XTMA 3VXKA 2IEYA 2AX3A 1NYLA 1ZJ4A 2CHGA 3WDSA 4D79A 5EXEA 3OZXA 5IHPA 1JEYB 1RZRA 1KMMA 5IWAB 3P0HA 5DGIA 5BRAA 1FDTA 2X14A 3RBAA 5B3KA 1OSNA 5HBRA 1J0AA 1RBQA 2I6XA 1Z7EA 3OQIA 4F7WA 3ZHTA 3FW1A 3JTEA 3E1GA 4DIOA 3O1JC 4C2AA 5LIPA 4DBLE 1KY3A 3M1LA 3PHCA 1NMXA 3IUQA 1T3GA 2H1RA 3DWGA 4TYNA 4JC8A 1GITA 1R64A 1EA5A 3ABRB 1O9HA 4QLBA 1IRXA 4AKHA 4ZT7A 4ZI7F 3ONNA 2CW5A 4YCNA 2LR0A 3CJRA 3EWAA 3WWPA 1P8AA 2NMVA 2ECOA 5JTUA 1CJBA 2JFXA 5EOVA 4Q7KA 3KVOA 4TLCA 2P9GA 1NVUQ 1NZDA 3GUHA 3ZE2B 3AV3A 3T5PA 3BGDA 4EHLA 1LBEA 1Q77A 2YWHA 3KQHA 3TDMA 2BF7A 4IOKA 3IT2A 2AEFA 2NUTA 4LK3A 3IO3A 4RTPA 3L18A 4ASUA 5I7FA 1BD4A 2ZIXA 4DLWA 4LC1A 1H0RA 4FDLA 1AKWA 1VKZA 2CUKA 2NAFA 3LC0A 3ZX4A 1QHFA 1FX0A 4D99A 4FE3A 5BMVF 3FHOA 5CLQA 3FCAA 4D6PA 1YZQA 3CLHA 4GMGA 4I08A 4Q3BA 2JLCA 5B3JA 3T3MB 3DQQA 2P77A 3ZOKA 4COKA 5F9FA 4GGPA 4OU5A 1T25A 5J2TF 4UFPA 4RSHA 5ESWA 1US8A 5ISMA 1U2DA 1DAFA 4ZICA 4EB3A 1P9RA 2FP4A 2XSZD 2YNMD 3HQ4O 5FXMA 4CV0A 1VGVA 1V71A 5JYBA 2PEYA 1EZZA 3D6AA 5LP6B 4L76A 1ZIPA 3H9EO 1JT2A 3ZH2A 4WVFA 2DHQA 4EY3A 4FFSA 2A9QA 1H9AA 3P26A 4DV1B 4QPZA 2EW1A 2VG8A 3ZWQA 4MQFB 3T1TA 4FC6A 2QTRA 2QUBA 1QHSA 1MA3A 1G291 2D4HA 2W7TA 2XCQA 3GJTA 3HB7A 2FQ1A 2PFKA 4HN9A 4HQFA 5B4TA 1OYWA 3F7MA 1RR6A 2ZYDA 4HEQA 4YMVA 1JWBB 4XYGA 1C81A 1F8GA 1RMQA 2XAUA 2ZB2A 2DWQA 1J5XA 2XWBF 1UADA 5REQB 5AM2A 3D64A 4J6FA 4L0QA 1CUEA 1GTZA 5TMBA 4TRMA 2MSDB 3U3DA 1WAMA 1EX7A 4LHWA 2PKQP 1W1WA 4MKZA 3CB2A 3U60B 2GKOA 3DS8A 3K0BA 1ISSA 3T41A 2CXTA 3H0EA 3JWPA 4QOFA 1KI2A 3GFVA 3QXCA 4JJ6A 4JYMA 4B6GA 5ALOA 3NP7A 3FBTA 3ZNPA 2ZR7A 2G67A 4EGFA 1QUEA 2QRNA 4RV4A 1VE6A 1XD8A 2YMMA 4HDOB 4X1KB 1GA4A 4CM4B 1IMOA 2FZEA 2DJ5A 1CDZA 1M3SA 2ABWA 3W4JA 5BSTA 5JH7A 5U1PA 3T7JA 4YR9A 4TS4A 1S8AA 3Q6MA 3BCHA 4F1KA 1U9JA 2HDWA 3CKKA 2HHJA 1ORVA 1WUHS 2GETA 2QOEA 4NMMA 3O8DA 3K16A 3OIFA 2CWWA 3UTCA 2TSYB 4AF6A 4IILA 2ACWA 4JDPA 4EJFA 2I4NA 1TAUA 1JQAA 4TMKA 4ALIA 2YZMA 2GVNA 2JANA 3L6UA 1E2LA 1AD2A 2C9CA 3HDVA 3TLMA 4BEWA 3QX3A 2IS1A 3HKEA 3GDWA 4OA5A 4Z4IA 3QYPA 4W1PA 3PC8A 1E3TA 4HWTA 3IA7A 2Q7DA 1PK8A 1NVGA 4X84A 3KVYA 4X7PA 4XVCA 1VBKA 1UBOS 1TUEA 1M10A 1MJNA 3UUWA 4OMUA 4Q3OA 1VKOA 2V4UA 3CO5A 2J7PA 1AOXA 1G9XA 2ILVA 1HPLA 2R4QA 2RE8A 3HLKA 3OJLA 1QTIA 2UYCA 2HWUA 2PNJA 2MT9A 4EDHA 1WTAA 1M6EX 2I9KA 3AVTA 2H7VA 3C45A 2AFHE 3MILA 1ZQ9A 3BKWA 4IX1A 3DOHA 2LCQA 4C4RA 1JWAB 3WYFA 1ENOA 1MUUA 1X1BA 2Z9CA 2PE5A 2J31A 5EVJA 5AVOA 1AHHA 1ZSNA 3MJ4A 1N2GA 4GM0A 4D44A 2GVZC 4RV5A 2EJTA 4KR3A 4I9UA 3TLYA 5JOQA 1O89A 2J4DA 3PF9A 5WRFA 1IQPA 3AM1A 1OUMA 2CLCX 1OGYA 4IQ8A 5EKTA 1VSTA 3FB1A 1JBQA 4OD0A 1H6CA 4RW0A 4I5IA 4QWWA 3HBLA 1ZESA 1AV6A 2Y27A 3LW7A 2PA3A 4C29A 1SCUB 4P2BA 1E2GA 5TX7A 3IIIA 2I2CA 2DB3A 4KRFA 5FUVA 3JQ9A 3UWPA 4IWYA 5DGCA 2FWAA 3BGOS 4K46A 4G2NA 1JQDA 3V6MA 1E1RD 1YVDA 3R9XA 3UB3A 1QANA 6ABPA 1NVBA 1D2NA 4OXQA 3ETHA 2OY0A 3ISJA 2QE6A 2W6JD 1AURA 1Z6PA 1EGHA 2WJAA 2XD9A 2KWIA 4PZAA 3Q2OA 4Y6OA 4C14A 1KIAA 5CH3A 2CNLA 3RSZA 1TZBA 1NOJA 1XHFA 2OFPA 3R3UA 5F77A 4D1YA 2J5BA 4GVLA 4AK9A 4FW8A 2P3OA 3BWMA 4HLUC 4MDHA 1FYDA 3OEED 1X7YB 4BVLA 5B2EA 2GZHA 3H1GA 1XRJA 3INRA 4MYSA 4KK3A 4N9QA 4P7BA 4WX2B 5JYDA 4GMDA 4HADA 4AJ1A 1YZ3A 3N7AA 2FVXA 5LBTA 1B8PA 2H5LA 2NM0A 4I5FA 2XQJA 2G83A 4UM9D 4C4SA 4CN8A 5JJLA 1QK5A 4NWIA 2HADA 1M1NB 1X7DA 3KETA 2A1TS 4JP3A 4J7CA 1JYSA 2VAVA 4O4HB 4URWR 5E7JA 1OFHA 2EAUA 1CE8B 1M1YE 3CBGA 1QRAA 1UP6A 4IF4A 5L53A 2VNAA 1CUIA 1F06A 4X92A 1L8XA 2C5GA 4AQDA 2EZTA 4M49A 3R3HA 4K6MA 5LQRA 2H59A 2ZI7A 2D54A 2ZRBA 3S99A 5KJ1A 3TR6A 2AV6A 2QR3A 2A9PA 4A2QA 4BRWA 5F64A 1QZZA 1RXIA 4UU8A 1IE3A 4CHGA 2PGIA 2WHEA 2PL1A 2ZJOA 3P9CA 3IE0A 2G9RA 3QY0A 1NQVA 3HS3A 1DXQA 1HXHA 4D0NA 1HZZC 2PYIA 4XX0A 1LI5A 2P9BA 1T10A 1T5SA 2C78A 4RTQA 2XXJA 2FXVA 4C3UA 1UH5A 5AM0A 5BVHB 1FJHA 2FDCA 5IKXA 3HXMA 5CT4A 2V59A 2PS0A 3AUXA 3IP3A 3EWNA 1YFKA 3KQUA 5CB6A 2PH3A 4DV3B 2E4VA 4R1LA 1ABFA 3D3QA 3HUDA 1ZGJA 3V8VA 2CY0A 1O7JA 5TRTA 5KYYB 2WT9A 3AZOA 3I52A 1F9AA 2QYTA 1EFDN 3GAAA 3CCBA 3O73A 4Y6SA 4C08A 3KAJA 1NFFA 1RKQA 2WYVA 3LP5A 1UBUS 3MAAC 3HVRA 3PQ6A 4I66A 2WJIA 2ZPTX 5K3BA 1CLEA 4GMHA 1NPDA 2V7QA 1U2SA 3IH5A 4G4GA 4PLWA 3HCBA 3ONEA 4JUIA 4QTXA 1WXDA 2XTZA 5K05A 2VLIA 2R44A 3OX3A 2IPLA 2F48A 3NAQA 3NGXA 5GONA 5LZ5A 4C1NA 5KU7A 3NV9A 3ADKA 1M76A 1MQSA 2O3TA 3AF1A 3CNNA 3PXDA 3QKSA 3PVCA 1MIHA 1K2VN 1SMKA 5TQJA 1WD5A 1WY5A 2X9NA 5E6UB 1CD5A 1WCYA 4R2XA 1A5SB 3RFXA 3LBYA 2R1VB 1WP4A 5EUBA 4W9NC 1G59A 4HWPA 1LPAB 4LJ5A 4JODA 1EHIA 4WRRA 1GTJ1 5FQOA 5CLFA 4F4DA 1G8FA 1ZGZA 3KR2A 1XGKA 4NL4H 1GNRA 1TYAE 2OAP1 2PKEA 4WECA 4IMRA 5K20A 1EHYA 2X19A 4MH0R 2X0FA 3TWOA 1D2MA 3PX3A 1F2UA 3X2SA 3NTUA 1Z5ZA 1CR4A 2F17A 1SQGA 3BBPA 3LK7A 4LHEA 2G07A 2PDAA 1K4YA 4WGFA 4ZRNA 2ZOSA 4AWBA 1O97D 1K63A 2Q62A 1OCEA 4JEHA 3AFHA 3MWJA 3SI7A 3TR0A 5JZSA 1VCNA 1G8YA 1SBTA 3HVKA 3JTMA 5J2UF 4GLOA 2B2NA 3R41A 4OK3A 1FK8A 2P2ZA 4LMPA 3FVRA 4K9NA 2Z2IA 3EFEA 3OQVA 1NYRA 1VQ1A 4ERXA 3X43A 1SCAA 1TW2A 1KARA 5CK4A 1FMJA 1BXGB 2C7BA 3IOYA 2KI5A 3A28A 2J30A 3ESDA 4P0TA 5EWJB 3FOAA 3FTDA 3GDOA 4ND4A 4C4AA 1DCMA 1Z2NX 2C2ZA 1XWIA 4JUBA 3LUFA 3EA5A 4MVJA 4WKOA 4JUFA 3GMTA 5CHEA 3SC2A 4CYMA 4OO3A 1GKYA 2NSLA 2C2MA 4EBBA 1QF6A 3ELBA 4P36A 1RBMA 1U2EA 5BSUA 3WA7A 1JNXX 3KZOA 4UNSA 2ATEA 4ARBA 4F2HA 5JHGB 2FWJA 2J0VA 1HEUA 2HNBA 3H4TA 2XYVA 3N2KB 3OA0A 5DNWA 3OSUA 3TZ6A 3EZ6A 3O7MA 4CIBA 2Z6QA 2ODEA 4YJDA 3LYUA 1PQUA 1F6WA 2ERYA 2NUPA 4GZ5A 3A3YA 4MW5A 3OFVA 4QA9A 4CT0A 5HTKA 5LQJA 3N2ZB 4IOJA 2A5FA 4KX3A 3TLEA 3VYTB 3F49S 3OCCA 3UY4A 1QGUB 4OGFA 3S2SA 2VSFA 5DYGA 4ZT3A 1IG3A 2RHWA 3GRAA 3DLAA 3ITDA 1TYDE 4RQTA 4CODB 3T4UA 5IDWA 2XOKD 4WNYA 1Y6GA 2I22A 3B9RA 3MIZA 1EWKA 2RD2A 1JE0A 2IXTA 4BXOA 2FLWA 3K1AA 3ZGZA 4NNJA 4G4IA 4FGWA 3W2TA 4NH0A 1VM6A 2FAXA 3IVXA 1H2BA 1E4OA 2FKAA 4I50B 4LI3X 2Q3LA 3G13A 5THXA 4TL9A 1XBTA 4UPEA 4F9EA 4PHTA 1IK4A 5JCXA 2ALJA 4AJHA 3WGUA 4QUJA 1CUZA 2EATA 3VGPA 5DE3A 1T2NA 4JWKA 5EWMB 1NR5A 2IP1A 1G41A 1XRSB 3PDUA 4PHFA 4YP0A 2VBCA 1SUFA 2WSSA 2Y68A 3DB2A 1ACJA 4R8SA 4PN3A 4YAWA 4YDSA 3SZGA 4EELA 1YFLA 4FI3F 4ZV4A 3DEHA 4RZXA 1UXHA 1E99A 1XG5A 3BOSA 3I2HA 3OCZA 3H2BA 4KXLA 4S35A 5CLJA 1RKXA 2EHJA 4FHFA 4L5BA 5JNRA 2W2VA 4IFTA 3ORHA 2GSWA 2XDQB 5JFGA 4FD3A 4HNAA 1TZCA 2NPOA 2QKYA 5ALQA 4BYMA 5ITVA 1XXHE 4P6VF 1N0HA 1WZCA 5K03A 1E9AA 1HDOA 3GCDA 4EAAA 2Z30A 3QE3A 3RBZA 4OTZA 1A2KC 3BUSA 2DT5A 1SVUA 2IYSA 3AI1A 1O54A 4NJMA 4NOLA 3V4VB 4DSZA 2KBEA 5LZ2A 5JS7A 4YI3A 1JX6A 3DMYA 4F84A 1SC1A 4BVEA 4M99A 2J59A 1LBSA 4GBGA 3FPEA 5D5PA 4ND2A 1DG3A 5KMGA 1IN5A 3LPDA 3UW3A 3L7YA 2DTDA 2EKZA 2YQ5A 3HY4A 3ZV7A 4DLRA 5HS4A 3AHDA 1JEJA 1NA5A 2WHQA 1GPBA 1FSZA 2IELA 2OV8A 4UBKA 3EJWA 2O8DA 1WMAA 2JEYA 3HO6A 1DSSG 3CPEA 3MOGA 3PSHA 4MS1B 1QVVA 4V24A 1WDTA 4RGQA 4QODA 1F38A 3CIOA 2OECA 2GK7A 1DEKA 4NJEA 1CG6A 4R9NA 4CMKA 1ZOIA 1F60A 2PRSA 1EP3B 1W2WB 4QJ4A 5EZ6B 4CIYA 3IDZA 1A5TA 1Q1BA 1ZUNA 2NYRA 2H1SA 3B6ZA 3DBIA 3H3XA 3N8GA 4LNAA 3RS2A 1MOZA 1WXEA 2F00A 4FEEA 3T3GA 1Z12A 3PENA 3JD3A 3RYHB 1PK7A 3ABSB 4O5AA 1MP0A 1XL0A 4QNMA 5DEOA 2R60A 3T5MA 3ZXIA 4ES6A 2Z9DA 3S1AA 1SKQA 1XTKA 3P0EA 4GMFA 4L2IB 1CRWG 3O82A 5HYVA 5FUQA 1FC0A 4JITA 1UK7A 5LR6A 1ZVJA 2SKDA 5L51A 5TNXA 1GG2A 2N47A 3Q87B 4K3UA 4LXXA 1DTSA 2ETVA 1XCGB 1NDHA 2GZ2A 2JFBA 1V4NA 2N1BA 2IU6A 3DLCA 5JZVA 2OXCA 3WRWA 1UBSB 1H6DA 2KHZA 5ITWA 1XZPA 1OZHA 4U2GA 4Q3KA 3H8JA 4LDQA 3O8BA 1T3LA 4O4LB 1WNFA 1RT9A 2GPBA 5ITZA 2PUCA 5JNSA 3QA3E 4WFJA 5CCBA 1EX1A 2ECPA 2VF2A 4YRCA 4RM2A 3N0VA 1IZ8A 3LECA 1DQSA 4P4GA 3IX7A 1QH1B 3S27A 3A3OA 4L74A 4PGAA 3STVA 3E9CA 3ELYA 5IBPA 5JS2A 5I45A 4ZI2A 1TE2A 3WFZA 2IXGA 3KQKA 2WMYA 1Z38A 2CXQA 3T6KA 3BEDA 8MHTA 4PYRA 1OYOA 4I2VA 5SZIA 5BN1A 16PKA 1XDUA 1J2UA 2ESRA 1TIPA 4KLAA 3ZHUA 4PLHA 4CDNA 2ZIXB 3ACBA 2JFQA 3L7NA 5UKDA 4KW7A 4EHNA 1VSQA 1W93A 4QYWA 2OYSA 2EP7A 1AUVA 1F8XA 1YR1A 1EX9A 5DXFA 4FFBA 5GM2A 4BE4A 3BS4A 5KNDH 3GBPA 2HJGA 3DDSA 3Q0TA 5D3QA 1U2GC 4JOCA 4Z7JA 4H3VA 4DIBA 3TXYA 4FTWA 3TO5A 2X0NA 2QM3A 3TVDA 4F8YA 2NV6A 5KTRA 1BMFA 4GYWA 3L9XA 4KH0A 4AP9A 5GINE 1K68A 2VTBA 4LPKA 3OA2A 4AU1A 1ZEMA 1AKUA 1C3OB 1U5CA 1Z5PA 3VR5A 2ZTUA 2IIBA 1J8FA 5CDFA 1F0PA 2Y99A 3N7TA 5FWXA 2APJA 1B4DA 4IO1A 4UVEA 1NNSA 3DDOA 1RJDA 1RQ2A 2OOKA 3IR6A 1W5TA 1WY7A 4QYIB 2O0HA 4HQ0A 1T2EA 1PHPA 1V11B 1JEEA 1SY7A 1X1DA 2I71A 4M86A 4NXNB 5DHPA 1JYEA 3HP7A 3BJMA 4YWJA 3ASUA 1YOVA 3QIAA 3QXGA 2J3LA 4OQ4A 2XKJE 3JYOA 2E87A 4LDAA 5AHRA 3RAPR 4Q4CA 4DR1B 3U7GA 2NO9A 1D07A 2NO6A 1G2OA 2GZMA 2V7TA 4R7TA 2VCYA 2PUAA 2VYVD 4QXMA 3OH8A 1WZIA 4BN5A 2KLHA 3LWBA 3I6QA 2IUUA 4AG3A 1GA6A 1PK9A 1YBHA 2MSEB 3IUJA 3G49A 2H2DA 1T4CA 1ULHA 2I78A 1A8QA 5C1DA 3VUEA 1C0EA 1RMTA 2PIDA 3DCJA 3F8WA 2PZAA 3H8WA 3AONB 3FKQA 1JXMA 3IAAA 4KHZA 4MAMA 4J49A 4QDXA 4GZLA 4YC7A 4BVAA 2CXXA 2MMCA 2FFJA 2WMOB 1M7BA 3OE5A 4OXXA 3TIXB 2QL5A 1BVUA 2C3UA 1QO0D 2VHWA 3ET4A 1VTKA 2K4MA 3V1TC 1UQUA 3GCXA 5A03A 4NK4A 1B76A 1W73A 1ZH2A 3HB5X 1XVTA 4E3ZA 1ETUA 5IKMA 1IPFA 4PPNA 3JD4A 2HD4A 5FUXA 1FW6A 1G7SA 2W2QA 3SKXA 5A3VA 3KPYA 2R97A 5JH7B 5LBUA 3G0DA 3LNTA 4L8YA 2JBAA 3CO0S 2VK8A 4PIPA 4Y2SA 4A15A 1GPYA 2IS4A 1CNMA 3BJRA 3N3AC 5H3LA 5J4YA 1E1KA 3X1MA 2FRDA 1U7HA 4EW3A 5JNUA 4IHKA 2FZCA 5IDQA 3INYA 3OZSA 1W76A 3K4QA 3P9XA 4E2WA 4DADA 1Y8ZA 2H4FA 3FCCA 3HUEA 4ER3A 1WMBA 2I91A 1N78A 4M37A 4GKKB 5KOYA 2R48A 2O0JA 1XIVA 1Y6QA 3HKEB 2HCRA 2QROA 3CNOA 3R40A 1K88A 3TL2A 1GUAA 4CTNA 4MWZA 3UAGA 1YRAA 1XJ5A 1NX9A 2OQ2A 4RVUA 1UDBA 4OL0A 5E9WA 1FFBA 1I6KA 2OV3A 4MR7A 3WDMA 5L9AA 4FGLA 3WBKA 1KDTA 4Z51A 5B1IA 4G5SA 4LA4A 4CFZA 1KAGA 2B99A 2C4MA 2O3RA 2FUNB 1ECBA 2NAPA 2QMHA 1TJNA 4M1KA 4ZYTA 1FNBA 1PWZA 1FTYA 1D6SA 1V9LA 3H1AA 3HR7A 2ZCVA 4OEHA 2F6RA 1DKNA 3H84A 4QEKA 5HF9A 3Q8XB 2EP5A 2DKFA 3DXYA 3TQOA 1BDHA 3O1IC 4W5HA 1A0OA 2J9ZB 1LPPA 2X13A 4PSUA 2V7VA 2QRJA 4IQFA 1JFFA 1R0YA 2VZEA 1NJ2A 2OG1A 3L1JA 3PA6A 4MX8A 2QTFA 3HCDA 1C8BA 4Q3DA 3AC0A 4KB5A 3QWAA 4DZRA 1QOPB 4HLQB 3BZUA 2X8WA 3PNSA 5IT4A 1FRVA 1UJ2A 2Q9CA 5KQSA 5DM60 4HLNA 5CVUA 4MVXA 1W96A 2JIQA 1V7ZA 1P4HA 3Q7EA 2OG2A 1V3UA 4KYIB 4PZEA 3V1KA 5JASA 2C2BA 2EWVA 2YWXA 1OY1A 4PQEA 1JHPA 4JJAA 2QL9A 2B1IA 2FSGA 2G8LA 3D6UA 3Q5EA 2V6JA 3KP1A 5D84A 1CDDA 1UXJA 1WF3A 2BHNA 4H2DA 1YZFA 2VJDA 4LECA 3TNDA 4KITB 1XZCA 5B3AA 5ABPA 2ZS7A 1ZN9A 2H85A 3B8HA 4YRPA 2PUEA 3CTPA 4UQLA 3ZG6A 3C4QA 2YICA 2GNOA 3VKHA 1RQLA 2G1AA 3HEMA 1IMJA 2FFBA 3M9LA 3ITNA 1AUQA 1OFVA 2JFPA 4NHEA 2O06A 1VJ1A 4N82A 3UJHA 4B74A 4IZOA 1R0ZA 5I01A 1YK1A 1XV5A 4OLBA 1IB0A 2ONYA 3KTDA 2H48A 1I0IA 3HCNA 5ALWA 1FE8A 1Z88A 4GDMA 3AB3A 4WSOA 1XR3A 2GNAA 3VPGA 3WDLA 3HRIA 3ZCQA 1YI0A 4R9UC 1T36B 1W9MA 3K0CC 3ADCA 5HK9A 5AOCA 1TMKA 2E3JA 4GRAA 4A03A 1UOEA 4XM0A 5F2EA 3AB7A 3FPKA 2ZRJA 2OBXA 3K4HA 1OXTA 3OD1A 1J90A 1XFAA 5DXJA 3UJ7A 1RQPA 4TWAA 5GOZA 2AE1A 4H15A 1O4VA 3H17A 4L8WB 3C8HA 3RSHA 1GSIA 1YQGA 4RE6A 2NUAB 1VCHA 3JQ8A 3UV3A 2P0EA 2IIVA 2RG1A 1YMUA 3S5JA 3TPCA 2JH8A 3JATA 2AJCA 3ETGA 1Y9AA 4BUZA 4PZ0A 5BNIA 3TQIA 2NNWB 4G8CA 2RK4A 1TPZA 4FN4A 4XWOA 5BWCA 4UTZA 3V8MA 2O5CA 1ND5A 3ZXXA 1XNJA 3L1KA 4HOYA 3B52X 4IDFA 2UZIR 3EXG2 1W8DA 1GSAA 1IHPA 1I4LD 1ZM7A 3SEAA 3I4FA 1EP2B 3UW1A 3QHQA 3ZXUB 1E4VA 2X6TA 3D3NA 3CVYA 5BT9A 3GFSA 6LDHA 5KREA 1OWLA 5K99A 5DSTA 1YK0A 4KIUA 1GUZA 4LF9B 5JZOA 2IEGA 2I6GA 4FPXA 4DREA 3LPNA 4LGYA 1GLVA 2YY5A 3HP1A 4G0MA 4LYAA 3ONFA 5I3CA 1EWRA 1ZM4A 3WKEA 3TUZC 1EK1A 5IC4A 5GONB 2HIMA 4MGZR 1CRPA 1G98A 2PRJA 2VHZA 3NXKA 3QKSB 3WICA 2C31A 1TQ8A 3GZ4A 2HOQA 1TKBA 2V9PA 1YKSA 1CQZA 1ZD2P 3BMOA 3IB6A 3MJTA 4HKTA 4ZXFA 5AW7A 1HR0B 1ZW6A 3SKVA 4MUNA 2RJOA 3KJGA 4W5OA 2WC1A 4J9VA 4NU5A 3GUVA 3H1FA 4L4YA 1GOTA 1GPWB 2PVPA 4MI6A 2PU7A 1Z0AA 4BASA 3X44A 2O8EA 1HLGA 1F2UB 3FPGA 5DWDA 4BLRA 3Q1KA 2CHVA 1KEKA 4Q9KA 4QM6A 2W6ZA 2B7CA 3QPBA 4G0XA 4PGGA 4D9EA 5AYVA 1HDRA 2WAAA 3DPUA 4PQYA 3RSCA 5B6PA 3BWXA 4BVBA 3JD1A 3GIWA 2HGSA 3OQPA 3UO8B 4C3VA 3KKLA 3M6VA 4H7KA 2H57A 4QM7A 1CZLA 2QTBA 3IHWA 4FEYA 4G5XA 4NCNA 4QAJA 1BC5A 1XZQA 4ZKDA 4PU0A 5JD4A 1QX4A 2FUG1 3TOSA 3OE7A 4L8LA 1K4MA 4L6CA 3VZDA 5TPZD 4EX7A 5C35A 2HBYA 2A9JA 2J6CA 2ZSUA 3X1JA 1TCAA 1YGYA 2FWRA 2V9ZA 1GNPA 1B42A 4OGWA 1RPTA 5FTMA 4P4SB 2WA1A 1EVKA 2YZ2A 4I1UA 1R50A 4NCBA 4LV5B 1N3LA 1JAZA 1UT8A 1HO3A 1XCPA 1J70A 1E79D 4TYWA 5KSPA 3OIVA 2IPAB 5B5SA 4BV8A 3PJEA 3F5DA 3EVZA 3RHFA 3SC2B 3IBGA 3W79A 2JI9A 1EZ4A 1U7DA 2B5VA 2WYHA 3AUTA 4HR7A 4CMEC 1B0PA 3W5SA 1Z6QA 3F7NA 3PXCX 3N8KA 3PYXA 4ZAVA 2VXBA 3TSAA 3EVEA 4CRWB 2JAOA 5CW2A 3DCNA 4I1SA 2OO5C 3LXMA 4JBGA 1PD0A 1KE2A 1A2BA 2XGSA 2FEPA 2HWYA 2JCXA 2ZZKA 3FH0A 3PXXA 3FYDA 4RQAA 5TQ0A 2NUPB 1KQPA 4KDEA 2WUVA 4B84A 2V5AA 1SXPA 3I39X 4N5LA 4F86A 2EX1A 4MUHA 3UIEA 4XLTA 4E51A 2Z5LA 3B1JA 4Q1AA 3ZIDA 1K6IA 1P0FA 3G0GA 1EAMA 5FIUA 2E4XA 1ESCA 4FNOA 2JNWA 1N4AA 3DZKA 4AICA 4XB6B 4HT3B 3UJAA 4BXOB 1XK7A 2WJHA 1M8GA 3B6EA 3K1AB 4DJEC 4HC4A 1Z4NA 1AMOA 3SMQA 2JAPA 2R8XA 2D7CA 2FJUA 8GPBA 2OILA 3QOWA 1EGAA 1PBNA 3ZGXA 1LXCA 1Z3IX 3GJ5A 5EP3A 1U28C 3RRBA 5DBFA 2ATCA 1ENZA 1A9XB 2IYUA 2JFYA 3KUDA 3CLSC 1CF9A 5ECGC 2DKNA 3ROEA 4AJOA 2UXBB 4LSGA 5IAGA 2O4CA 1Q50A 1BHSA 2J4CA 1G5QA 2QLFA 2RKBA 2Z8YM 1MHPA 3DMTA 3PT9A 3QVGB 3RF7A 4PX5A 3NCTA 2EGHA 2IE0A 2REBA 3BFXA 4EGSA 3KZVA 2FUCA 2FUG6 4KQ2A 2IY8A 2IPOA 1AE1A 3QPUA 4LI0A 3IL2A 3SYKA 1XZLA 3VZCA 3LUPA 3CW2A 3EZ2A 3K2EA 5ER9A 3O94A 1SBCA 3A6LA 4HNAB 4YEDA 4HPWA 1UKZA 1GP2A 1OKKD 4OXYA 5DIZA 1YCGA 1A9SA 2J08A 2PTGA 5HIMA 5KS2A 4PY2A 4QLOA 2C9OA 3WKDA 2FR0A 1E6EA 4NJMB 5BXQC 2DH5A 1IU9A 3GGGA 3KYBA 4EFDA 1T6ZA 3PFKA 2CDRA 3IEXA 1L9XA 4IDGA 3REOA 3OZBA 5EJ2A 3T61A 5HRUA 1LTKA 1P6QA 2QVYX 3I9KA 4INZA 4L9WA 4YP1A 4ZZ1A 2GHIA 1C30A 2WM3A 3ZK9A 5KMGB 5HMLA 1HQYE 1N6NA 1N7JA 1Z2AA 2GYYA 4KIFA 1N6KA 1GL9B 4F9FA 4HD8A 2ANCA 3RYFA 3TEMA 2O8DB 5HF5A 1I7QB 2O2JA 3B5JA 1BIFA 3PHGA 1EDEA 2IITA 3ELDA 3LF2A 3CRW1 4HZUB 1SU8A 3DZ8A 1QGYA 2X0IA 3C1AA 1MIOA 1QF9A 2ZDHA 3HCFA 4HUJA 1IBCA 1BWSA 4KH1A 4LJYA 2I34A 4YK7A 4ZMRA 2GXQA 3AEZA 3ZZTA 3NR2A 3N0TA 2CK3D 4U00A 3GLIE 1ORHA 4BDTA 1IBMB 3HL0A 2BEVA 4RFSA 4W9RA 2BTOA 1YRHA 3FDIA 4GAEA 4K1LA 5FH9A 5D5QA 2JVIA 1U2PA 4WASA 4CG0A 1N57A 3WWDA 4Z3KA 1ECCA 1D3AA 1FDWA 2WIAA 1PFGA 2A84A 2X40A 4W7SA 3HBMA 3HYTA 5IM5A 3TZBA 2XF2A 4BO8A 4BTLA 3S1AB 5AVUA 5ILOA 3PU6A 4F72A 4DARA 3G8AA 3KE8A 1XQ6A 2Y67A 1N5MA 4RD0A 4AJ2A 1UBTS 2JFWA 4P08A 1T0HB 5J5CA 3BSFA 3SLGA 3F5SA 3V4ZA 1K6MA 3E8XA 3G5LA 2PU5A 3ZS9A 1YONA 4FMBB 4W99A 5DO9A 4OFWA 4ZJUA 2IH2A 4H0FA 3V3KA 5BURA 1O0CA 2ZUBA 2PMDA 1ZISA 4RH3A 1VSVA 2G9QA 4ER0A 5HQTA 4URXR 5ITZB 1TLFA 2QXTA 2D7DA 3M83A 3TW8A 3BT7A 4JNCA 4DE5A 1Q1NA 4DY6A 1VGQA 1QDUA 4RF5A 4CQMD 2DR0A 3GW8A 3HUTA 3HCAA 1H1DA 3JVIA 3GPDG 4RKRA 1GCGA 5JMOA 3H5TA 1J39A 2NO4A 4ZOCA 4BUCA 2W6PA 4G37A 2PVSA 2XMQA 2JS7A 4ZAWA 5HEKA 1EK2A 1QO7A 2KE5A 1PFYA 2IPMA 2VP3A 2YWDA 5E9JA 1V1MA 1V26A 1P3Y1 1PQPA 1QG2A 2E4AA 1ADBA 4OHFA 4DPMA 1VIMA 1F8YA 2EHDA 1ZIDA 2ODQA 4KSBA 1N36B 1UAAA 2IYPA 3R4VA 4ABYA 2ANBA 2BV3A 3CSUA 1EK6A 4FFBB 3INNA 2XXAB 1OVMA 2VYQA 3LRTA 1BA3A 3IEUA 1KYXA 2F59A 3NDIA 3HLTA 4HGPA 4K9LA 4YJ3F 2XHEA 3T9AA 1VPWA 4FR2A 2VTBB 4JVLA 1GTL1 3REQB 1SBYA 3EXG1 3V8PA 3TOVA 1SQSA 1QYDA 4B45A 2GPJA 4L4XA 3IA2A 1PRYA 5CYOA 3FG9A 4PC1A 2FFHA 2R5FA 1XI2A 4DA6A 4A23A 1QP4A 5EYPA 3MZ0A 1RVDA 4N4AA 1CERA 1KDOA 1HSZA 4WESA 3D3EA 3RQSA 3G1UA 3NUGA 5CIQA 1PI3A 4NYIQ 2H8KA 1YOVB 1JG6A 1O6FA 1XROA 2JJ1D 3BK7A 2JFFA 1IFXA 2HHCA 2GYUA 1XAGA 2BE9A 4M3NA 4QG3A 1Z4IA 1G5IA 4K6GA 3KXIA 2WFAA 3W34A 3PSAA 1MTZA 2OXIA 3P9ZA 3Q15C 3NHRA 4FZJA 1QDEA 1PR0A 2ZYTX 3O38A 1FNMA 1QC5A 5HX7A 1T4CB 3DSRA 3PJFA 4AF7A 1DWUA 2DHRA 3FVQA 4EB6A 2Z5FA 3ZE1B 3G9QA 1CVLA 1TNDA 2R65A 1MORA 1TAQA 1ZZEA 2FMUA 1OREA 1LI7A 4MR9B 8AT1A 2Z4TA 2GN1A 1KZYC 5JPDA 3O2SB 3EIEA 2FSVA 2OE2A 2HTFA 3OFNA 3PPWA 5EE1A 3TLXA 4EAQA 1AA9A 4UHCA 2AW5A 1ZCZA 3DAYA 3GK3A 3AEYA 3C8UA 2WNSA 4QYXA 3D0OA 1HQKA 1X1TA 3OHMA 2GI4A 3ZY2A 3GAFA 4FFRA 4YUYA 3QZUA 4HG2A 4I4TA 2Z95A 4JBNA 4LXQA 4H31A 2XDWA 3BG5A 4HQOA 3NBXX 3Q7IA 3K71B 4M1QA 4ZOEA 3AVVA 2JBAB 4MS3A 3BWEA 4LOIA 1SZDA 3PJRA 3G79A 1ZC3A 1UZNA 3STYA 4NY1A 4LXGA 2QPOA 1IY8A 2YV5A 5LMCA 4HMPA 1A77A 1RBZA 3QLVC 3M1YA 5CG1A 5FJJA 3D8TA 4AD8A 3P9IA