4HDOB

Crystal structure of the binary complex of krit1 bound to the rap1 gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
163
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Krev interaction trapped protein 1
total genus 52
structure length 163
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdoB00
1KDOA 2FE4A 4S35A 3L0PA 5EZ6B 3GLFE 4BPBA 5EP3A 2IS1A 2OXCA 4U7DA 3PUXA 4EPYA 2V4ZA 2H16A 3GJ6A 4GT1A 4QGGA 2ZJ8A 3ASYA 4KLNA 3KQNA 3AKCA 2REXB 1E9FA 3DO6A 3F3YA 5F98A 3WMEA 2A3RA 2ORIA 4JLJA 4LCBA 4UNPA 1E9RA 5KUTA 3TUZC 1DPFA 5KDOA 1KO7A 1WBDA 3BOSA 2C77A 1G8YA 1W36D 2E9SA 4A9AA 1JR3D 3QXJA 4KVAA 4O0MA 1KO1A 2OBNA 2FU5C 1L2TA 1UEJA 2QAJA 5G41A 2NO6A 2FFQA 4HB3A 4Q21A 1UJ2A 4JLVA 2OLKA 3GJ3A 1N2CE 1W7AA 3X1ZA 3KJIA 2FH5B 2OLJA 4Q4AB 3EZ7A 4DLSA 1G64A 2O8FB 2WAYA 2QMOA 1Z63A 2IS4A 1ZNWA 4S2EA 3VR1A 4B32A 2J3EA 1DOAA 1E69A 4ILEA 4OBEA 4BRWA 4MDEA 3LV8A 1XEWX 2QM7A 4BZPA 1ZUNB 3PXGA 4PQYA 1OHHA 3H84A 4WA7A 2BM1A 4M9ZA 1E0AA 3AVPA 3T1QA 1G8PA 1GSIA 1XJQA 1XFAA 1CR0A 1Z28A 2FA9A 4A0GA 4BFZA 3BB1A 4M1SA 3QE0A 4OYHA 1S0UA 3U7HB 4WZBE 3TH5A 1GKYA 1XX6A 4AWXA 4DLRA 1GP2A 1HYQA 2QAGB 4BGDA 5HKKA 1XD8A 2FG5A 1E2JA 4LV8B 3WMGA 3WY9A 1F60A 2B7CA 2ZE8A 3WHLA 1UDXA 4FW9A 2REBA 1KMQA 2W6IA 5HR5A 2ODWA 2BM0A 2JJ1D 1Z6AA 1JEDA 3QF4B 4JYBA 3GJ8A 3LBHA 2GAAA 1VHTA 2NO0A 4YXWA 4L4UA 4JL5A 1GTVA 5JI2E 3UMFA 5HZHA 4TMWA 2VRWA 3QG5A 4LJ9A 2F1IA 4YMSA 5E3HA 2GBLA 1D6JA 4DSUA 2EFDB 4Q66C 4QXAA 2GJ8A 1UF9A 4JKIA 1F6BA 1JB1A 1X1SA 4C0KA 2Q3MA 5EE9A 1N6LA 3U60B 4A36A 3Q5DA 4UXJA 1P9NA 3K8YA 3O47A 2F43B 1EX7A 4UJ3A 2ZXUA 2PMKA 4TL9A 1YU9A 2VL7A 4CIDA 3LWNA 1QVRA 1KK1A 1EFRD 2EYQA 2ZYVX 1TQ4A 2C99A 4OJQA 3TUIC 1A1VA 4KLZA 2G83A 3I73A 2GA8A 2QP3A 4WZ6A 3SHFA 3PV0A 4DEXA 2RHMA 1SVLA 4P0TA 4QGAA 2DY1A 1QDEA 5AJVB 5JHGB 1OB2A 4GRAA 3GJ5A 4UNQA 1JI0A 5KNCA 2GXUA 1KJZA 3O8CA 4TL8A 3P27A 3WNCA 4BZQA 4DZZA 2CLSA 1BO6A 1IN8A 1BMFD 4OHZA 4FMDF 4BZXA 1TF5A 2E1RA 1Z47A 2HF9A 3ZZ0A 4DLVA 1W47A 4KO8A 1T4GA 3CKLA 4NYMQ 4AYTA 1YR8A 4M1MA 2PJZA 3VMFA 2EQBA 4OJKA 1Z6YA 4E5UA 4LYJA 4B2PA 1SVOA 4ZPXA 1ZM9A 1OFTA 3A1WA 5EUMA 5DI9A 2ZSEA 1E9DA 5C4GB 1ZUHA 2WHXA 3P4YA 2JATA 1ZM7A 4C2TA 4KSCA 3SE0A 4Q5IA 2GCOA 4WBSA 1W49A 3VQTA 2E87A 5BWMA 3BD9A 1FNMA 4JBYA 3I61A 3TSOA 3CNNA 3K0CA 5FPHA 3CPEA 3SR0A 3ZQJA 5H1YA 3ND9A 1NL3A 4WXRA 4KSBA 3TIFA 3TW4A 2A5FA 2AK3A 4TMZA 1XZQA 4LWZA 2OFXA 2CK3D 1GRNA 4PZYA 4CEHB 4HAZA 4K46A 4EPXA 4BASA 2GHIA 4X8HA 2KB0A 3EIEA 4QBIA 1Q1BA 1CTQA 1S96A 1AZSC 1T0HB 2DFTA 1FX0A 2R6AA 3N2EA 4YDHB 3RNLA 3W8NA 5KTYA 1J8MF 1LY1A 1G5TA 4C7OB 2D62A 4D25A 1R6BX 5BQ5A 2LCFA 4F7WA 1DG3A 1J70A 1PVOA 3CF2A 2RGNA 5C2JB 1G8HA 1OIVA 2BCJQ 1IXZA 1E2HA 2IYTA 3BH6A 3RRYA 2JLUA 5BXQC 1M74A 2GJAA 1ANKA 1KI2A 3THOA 1IXSB 4DCTA 3IIMA 2Q3HA 3AVOA 2QORA 3CZPA 4LOAA 1LB1B 1OH8A 1JXOA 5SZIA 1QBKC 3CX6A 3B6EA 4DHEA 5G3ZA 2YC4C 2KBEA 4IDQA 3Q8XB 1N6KA 1P2UA 4CEJB 3RS5A 1W44A 1FUUA 1YR6A 3H1TA 1HQYE 2BEJA 2D2EA 2WPDD 3L2OB 2XTNA 5HTKA 1CULC 1VCMA 3AEZA 2MMCA 3K09A 4JJZA 1XU4A 4V0MA 3WYGA 4L9SA 4CRWB 1MRSA 2ZS9A 1E2NA 3AF0A 3SN6A 1UKZA 3WNBA 4OKSA 1DO0A 2JIZA 4NPHA 2CE7A 4OQFA 3BWDD 1JQLB 3Q72A 2QL6A 4JZKA 2DBYA 4NU0A 2J45A 2ORWA 4M4SA 3RS7A 2VSOA 3SI7A 1TF2A 3LBIA 5KDLA 4TMXA 5FUWA 1KI1A 4OHYA 3EWAA 2XEXA 1JJVA 2V55B 3DZDA 2Y8EA 3C5HA 2O8EB 1SXJD 1CF4A 4FINA 3ZZTA 2FJUA 4PZZA 2F1HA 2P0EA 2OCPA 4GBMA 4RCZA 1E2GA 1TAGA 3GLGE 2REOA 1XF9A 2OUKA 4BLRA 4U00A 2WWFA 6Q21A 3LVQE 1N0WA 2VIIA 3SBEA 1UEIA 4HAVA 1YZUA 5FUYA 4B33A 1AKYA 1OKKA 2Z83A 3SZRA 3A6PC 1GUAA 1C9KA 3DMNA 1XTRA 2IA5A 3B2EA 2ZSDA 3Q7PA 4TT3D 5DN6D 1OV4A 2ZRCA 3CZQA 4NZYA 1Z83A 3NG1A 3KJEA 4B2IA 1OH6A 2J41A 4Q1EA 3AF2A 2XITA 1KY3A 1Y3AA 1UBEA 2O8BB 4OQXA 2BC9A 2NZJA 4ACAA 1VG1A 3NTUA 1YE8A 2GNOA 4HLUA 5E7MA 1RKBA 5GJVC 2D2FA 2QP4A 1U8YA 4B35A 1H8ED 4ACBA 1A5TA 1AJEA 3KKNA 4XD7D 2O8CA 1QG2A 4Q4HB 3I32A 1GRQA 4XD7A 1XP8A 3QENA 4P3YA 3TAHA 1KYIA 4LBZA 1JEEA 2NOAA 2ZPTX 4LI0A 2NO7A 1W48A 5B58C 2W58A 2C9CA 3ZJYA 2L0XA 3ADKA 3GLFA 1LV7A 1XEXB 2QSZA 3KQHA 1LNZA 2FF7A 3T61A 1RRCA 2ASEA 1ZINA 4PHTA 3ZQ6A 3GLFB 2CLDX 4CEIA 3AF4A 1RJ9B 4JVLA 2CK3A 4HUQB 1P7CA 5B57C 3UANA 4PPNA 1Z06A 1ZM2A 5L8VA 4Q4HA 1HY3A 1OLOA 1E79A 4FWTA 5F9HA 1EXMA 3FWYA 5FOSA 3VX4A 3PEYA 2CJWB 1KKLA 1Q57A 5JECA 4LSGA 4KV9A 2BMFA 2WWHA 4HYYA 4PSVA 3NVAA 1QZXA 1Z8FA 2IWRA 1P73A 1E0KA 4LJ6A 4DSNA 2G77B 1T91A 2Q21A 1WF3A 3A37A 1W46A 3J81k 4DRZA 1HQCA 1LFDB 1K8RA 1GZSA 4JLAA 1E94E 2Z5FA 4JSTA 4Q4JA 3DM5A 4QJ3A 4IDOA 2QAGC 4AURA 1XEWY 4I81A 4LYHA 1NVVQ 3CONA 4AY2A 1WMSA 3AVWA 5HE9A 4F93B 4GDFA 1L4UA 3KB2A 4M22A 4Q4LA 2JIZD 3MWLA 3N2IA 4MGZR 4EJSB 3R9XA 5FI0B 5GJCA 2O8CB 3R8CA 1W4BA 1LF0A 4PHGA 4BLQA 2FPLA 1XBTA 3IGFA 4JYCA 4OL0A 4LJ8A 1R8QA 1Z07A 1GL7A 1R2QA 2PX0A 1CR4A 1OXVA 4P4TA 1E9BA 2ZM5A 3I72A 3L0OA 2WOJA 4RZXA 2J0VA 2QQ0A 1PV4A 4RJLA 1RJ9A 3QEOA 1YZNA 3THXA 1NLYA 2P65A 2BJWA 3ASZA 2D06A 5A4JA 1S1CA 3PR1A 2XZLA 2A9KA 3RDPA 3D8BA 1NBMA 4MH0R 4NYIR 2B92A 1LTQA 2AN9A 1ESMA 1ZNZA 1OPXA 4RY2A 4W5JA 5EE0A 4XVUA 2O0JA 2ZRLA 1KOFA 4FCWA 3THWA 4IKEA 5CDFA 1VCOA 4HLQB 5IHPA 2FGJA 1G16A 5LDDC 3NBFA 2J9RA 3C14C 3OESA 3IPYA 1N6OA 2EYUA 1CKEA 5D3MA 5AJXA 2ZR7A 2A5JA 2C9YA 3BAFA 4JVNA 3W5IA 4B3GA 3A4NA 1I4TD 4PR0A 2HT6A 1HH4A 3K0CC 3B1XA 2I1QA 3TGPA 4L8GA 4YMWA 3BK7A 4ZO4A 4W5HA 3GLHA 4AKEA 2R6GA 4B75A 5DSZA 3Q85A 1NBME 2WKRA 4YONB 5TY0A 2A78A 1Z0KA 4XWOA 4QRHA 4KAXA 3LY5A 1EFUA 3FFAA 3MUFA 3QXSA 4HSEA 1N5KA 3QEJA 3RRZA 4A6PA 1ZD9A 4M9XA 3K1JA 1OJLA 4FWIB 2W00A 4Q19A 3ZD6A 4NTZA 1M7HA 1W36C 1D5CA 4HLDA 2PLFA 1VIAA 4ESHA 3D7MA 5FOUA 3KTAB 4TLCA 3ADDA 1KK2A 4WW0A 4UXIA 4I99A 3GLHB 3LW7A 3TQCA 1EESA 2JLYA 1CRQA 1E0SA 3TQFA 4B73A 4PC2A 5G40A 1II0A 4PSAA 2G1KA 1Q1ZA 3BH0A 2F1RA 3FHOA 1DAGA 1II8B 2IC5A 5AJZA 2C04A 3I1FA 2O8DA 4ZV4A 5JEEA 4B76A 1II9A 3BBPA 4IVQA 4Q7MB 2ZROA 1DELA 5FOWA 1E1QD 4FN5A 3OIWA 2RGEA 1IY0A 4MKFA 1XXHA 4QJ5A 1ZMXA 3B82A 2D7CA 2RGBA 4X8LA 4MDFA 1OKKD 1BOFA 4A8JB 2J0QA 1XDBA 5IDVA 3FKQA 3WXMA 2WJIA 2OHFA 5J4KA 1PLJA 1SKQA 4IFEA 3B13B 4G1UC 1JQJC 1IBRA 4HDQB 3THWB 3G82C 4XWKA 4XVQA 2IYWA 1JNYA 2RGNC 2W2TA 1ZU5A 2Z6VA 2HDNB 1AGPA 4DT1B 3NKVA 1FL9A 4MUBA 4DBLC 1FW6A 4JLBA 4C0HA 2CHVA 3K0SA 5SZHB 5JSZB 3GPLA 4Q1FA 2H17A 1UM8A 3W6NA 4C3ZA 1IJEA 4CZ2A 5KDDA 1EWQA 4M53A 5J4YA 1LVGA 3NBZC 4PAMA 3VHLB 2BBSA 2PZEA 3AF3A 4PQFA 1G7SA 1P6XA 4M1OA 4QBHA 1RRGA 1LW7A 2F43A 2QTHA 5LBIA 2VP2A 3CBQA 3FB4A 3KUDA 4TYQA 1XB2A 4KVGA 1KMHB 1XPUA 1J90A 1ONBA 1KO4A 2G0NA 3CLVA 3LRPA 5CB6A 2ORVA 1L8QA 1CLUA 2PX3A 1H8EA 2B8TA 3DMDA 4JIMA 3A1TA 3BE4A 1I2MA 3LW8A 3RC8A 3KQKA 5JS8A 4D0GA 821PA 4W9MC 3ND8A 3IHWA 2G88A 2ZYWX 3FHCB 4MRPA 3QKUA 1R10A 1TQ6A 2FV8A 2WOOA 4PAQA 2AR7A 4JLPA 4X8MA 1TPZA 1E6CA 3IQXA 4ASUD 2IYQA 4OHVA 3BGWA 2QE7A 2QTFA 3AP2A 1GL9B 3QXCA 2I1VB 2DB3A 2UZ3A 2YV5A 3KB1A 3ONWA 1GKIA 2IX3A 2X19A 1OXTA 1XNJA 4NCJA 1G4AE 1R0ZA 4NCHA 4EPRA 2QSYA 1XPRA 3SYLA 4QGFA 2TMKA 2QAGA 4NE2A 3VU9A 1KZGB 1RZ3A 4TMTA 4GOXA 3FOZA 1ZM3A 1SULA 2YJTD 3OIYA 2GF0A 4OQLA 2QEQA 4LDJA 4LK2A 1MKYA 4G01B 4EJSC 4X8OA 2Z0MA 2LKCA 3W3AA 4DLXA 4NP6A 2C78A 2ZJBA 3R9WA 1ZD1A 2P5SA 3AP1A 3OF5A 1VHLA 2BMJA 2FDCA 1J99A 2YWGA 3K70D 1SGWA 4ESVA 1W4CA 5TB5A 3QUSA 1JALA 4AKGA 2GWHA 5E95A 4EJSA 2B21A 3RHFA 2F3RA 3EARA 1XD9A 1W2HA 2OBMA 3KXLA 5DO9A 3T12A 1WP9A 2QROA 3KFVA 3NHAA 2GBLC 4LJ5A 3JZAA 3WMFA 4N1AA 3AUXA 5K8UA 3LQRA 2NO1A 2QGZA 1G18A 3SJAA 1Q1EA 3AVTA 5KSZA 1GG2A 2O8BA 1GNQA 1KMHA 3K9HA 1Q20A 2FEOA 4D6PA 2ZJ5A 1Z22A 1X3SA 3IIKA 2QA5A 4P4UA 5TVKA 2OO7A 2IS6A 4HAXA 2D4HA 5IK2A 4YMTA 2IL1A 2P5TB 3IIJA 1DVRA 1U8AA 2IYXA 2XSZD 4R98A 5EZ5A 3ZS9A 2OAP1 3AGPA 5CLQA 3WBKA 4JVSB 4BUJA 4DB4A 3MLEA 4LC1A 5CK5A 3CIOA 3IILA 2P6RA 3T5GA 1DEKA 2X1VA 3LVRE 4O3MA 1NMYA 3QNUA 1XTQA 4Z8XA 2X2FA 1K5GA 4JL8A 4URUR 2XX3A 2KWIA 3F5FA 4EQ6A 4A2QA 2IK8A 3U61B 1OH7A 2NO9A 1OT3A 5KPJA 1XTJA 1S9HA 1MV5A 2BBTA 2OM2A 2JEOA 1J2JA 3IPXA 3NBXX 1KO8A 4F91B 2OAQ1 3AH8A 3C4JA 2B6HA 4LJ4A 1DAMA 2WWWA 3AVYA 3QKSB 4OHXA 4Q9IA 4MQBA 1NG9A 3G5UA 4RZ2A 5DYIA 5D3QA 1M8PA 3K53A 2YNMA 1ZIOA 2A5GA 1NKSA 4IVPA 2IUUA 3U3MA 3U7GA 3SDZA 3C41J 1GWNA 221PA 4I1SA 2PL3A 2ONJA 3VX3A 2HT1A 2BMDA 1GL6A 1TNDA 1U0HC 5EE5B 1AQYA 4QHTA 3DHWC 4US2R 3K70B 4O2LA 2OFWA 3R20A 3GLGA 4CDGA 5BYJA 3GJ0A 2ZRIA 2ZVPX 1CS4C 3RLFA 3QVUA 4QGHA 3KKMA 1VTKA 4CW7A 2JLWA 1XCGB 2FEMA 2R8RA 5L3QB 1TQ2A 1ZU4A 1E9SA 5JHHB 4C0JA 2F9MA 4B71A 4AK9A 1NVVR 2PBRA 4D81A 1D2NA 2NPFA 1JJ7A 3MJRA 2QMHA 2X77A 3TRFA 3IQWA 2NGRA 5LD2C 4DLZA 3SJZA 4KJZA 1W4RA 5AJYA 4M1TA 5G3YA 3AM1A 4LYFA 1NN0A 3HYTA 2QQEA 2ZYTX 1KSHA 1TU3A 1BS1A 5FPSA 4DIEA 1KI8A 4UKDA 4ZCMA 2CCJA 3UWOA 4TL7A 1U0LA 2FZ4A 4N0EA 3IO3A 2XSZA 3K70C 3IEVA 3QXXA 1V5WA 2BEKA 4ZDKA 5FTLA 4OQNA 4HEJA 4QC2A 1VG0B 3CRW1 3PFIA 3T06B 2FMXA 3LNCA 2IXEA 3U7EB 2HXYA 4MYUA 3RYTC 4XIGS 3VR2A 5J4VA 5FFMA 1VCNA 2FSGA 4NL4H 1U0JA 3KX2A 3CWQA 2ANCA 3L0IB 1GITA 2ZAOA 3MG9A 2V6JA 4TQ9A 4V02A 2OXRA 1P72A 2WIBA 1E32A 2W0SA 4OK3A 1VMAA 2GVDC 4Q9HA 1W1WA 1R5OA 4TSFD 4MRVA 4OK6A 3NDPA 1R5NA 1PUIA 3WYFA 1MO4A 4FMDB 4JLOA 1UKVY 1KSFX 1E2DA 1AGRA 5E7JA 2XGJA 1R4AA 2Q9BA 3RABA 4A0RA 3P1JA 4D4JA 1UBFA 3CWZA 3EZFA 5JLJA 4Q1AA 4W5WA 3SBDA 1HV8A 4KU4A 1SZPA 1IJFA 1G9XA 4A0FA 8OHMA 1EGAA 2ZI5A 2ZRJA 5KNDA 2IF0A 1OIXA 5EE1A 1MO6A 1TUEA 3GJ4A 2IUTA 2RKOA 1ZC3A 3CB4A 3P26A 4XVRA 2XZPA 1E1RD 2VLIA 5L3QA 1KI6B 4D26A 3BRWD 3P20A 1Q1QA 5EP4A 4CT4B 2AD1A 4LV5B 4IOJA 4A6XA 2OCAA 1TL7C 1B23P 1E2FA 2OBLA 2YOHA 3MGCA 5CITA 1N6HA 3LX5A 5K8LA 1ELOA 4BLOA 4M0LA 4R71A 4W7SA 2FGKA 1YKSA 5JWRA 3T5DA 1CR1A 1SXJE 5B2ZA 2FFBA 4RFSA 3BC1A 3T1VA 1GNPA 1FPMA 2IXGA 2JDIA 5HZKA 2W0MA 3BJIC 3VKWA 1E98A 3UWKA 4LJAA 1BYIA 4G0NA 2XZOA 4I4LA 2IEZA 4ON9A 1P75A 1VPLA 2CNWD 5KHOC 1RIFA 3CF0A 1FP6A 2QNRA 4A2PA 2WTUA 3PUVA 3PEVA 5GVSA 2BIFA 1AS3A 2IYZA 2YYZA 2ZUDA 1GFIA 1W0JD 4B48A 4Q4JB 2QTVB 4NCIA 4II7A 2DCUA 1IXRC 4DDVA 2QE7D 1P62B 1M6NA 1OXXK 5TARA 3HU1A 1NMXA 2GJ9A 2HEIA 4GMDA 3TNFA 5CDFE 1F3OA 1G21E 2AKAB 5J40A 1ZP6A 4LBWA 3CPJB 1A2KC 3A4MA 1WE2A 1U94A 3OFND 4WVFA 1OXSC 3I4LA 1DADA 3AVQA 4JKYA 1IN5A 2EFHB 2ZE7A 1CRPA 4OHWA 1Z6XA 4U02A 4GL2A 2O8FA 1Z2CA 4J0QA 2GEVA 4MYHA 5J47A 1QF9A 2R65A 5J4HA 4LHWA 2OCBA 1N5IA 2ZJZA 4I1VA 2IYLD 2J59A 2IEYA 4YMVA 1YZKA 2G6BA 3HPRA 2OEPA 4FD2A 2AWOA 1CJVC 4QHSA 3K9LA 2PT5A 2B8WA 3QIAA 2EFEB 1E1RA 2ZS7A 1YZTA 2JLSA 1KJYA 1RRPA 5AJWA 2OG2A 3SYKA 1FFHA 2ZQ5A 4BRUA 1TMKA 1L4YA 3EC1A 5TDHA 4TLBA 2J46A 4N3NA 2RGDA 1DAIA 1Z5ZA 2OV2A 4PHHA 3RSOA 2QUZA 1E9EA 4TYWA 1S1MA 4LJ7A 2HV8A 5B30A 1KSJA 2V1UA 2AK2A 4RD2A 3SS8A 4HB2A 2FPKA 1WRBA 2OCYC 2OT3B 3AP3A 4IOMA 3DZ8A 1O87A 3K0AA 1KTVA 5CJ2A 4EKDA 1R0XA 1Z0DA 1KJWA 4G5SA 1P61B 3A1VA 1KDTA 4TMKA 4B44A 2J0UA 3B5JA 1BH2A 1T0JB 1YZQA 3X1DA 1CJTC 1Q12A 1A2BA 4EFNA 4KYIB 4PAOA 5G53C 3SJBA 4H9GA 5CYPA 4GP7A 5GVRA 3TE6A 1TQDA 3ECCA 4OQMA 1COWA 2RGGA 3W90A 2D3WA 4JLKA 4TQAA 1BMFA 1XPOA 3FHTA 2HCBA 4MA4A 4WZAE 3O8DA 2GAOA 2J7PD 4BFWA 1W0JA 1MR3F 3UXMA 4YQFA 2AD5A 3AVUA 2YVUA 4NH0A 2RMKA 4XOIA 2YWHA 3VR6A 2WAXA 1GM5A 1VKJA 3GEIA 1RW4A 2JJ2A 4LHZA 2F6RA 4RVCA 3GLGB 1VG9B 2R44A 3CPHA 5KO2A 4XSHA 2WICA 2OILA 2WSSD 2NG1A 2JAQA 4ZI2A 1IAQA 1XCMA 1ZBDA 2ZEJA 1FQKA 4TL6A 2BDTA 2ATXA 1ODFA 3AKYA 2D7DA 4PC6A 1NN3A 2F1JA 2VH5R 3AKDA 3LFUA 3DKVA 1Q3TA 3N5CA 2CCGA 4M1KA 1YRBA 2EFGA 4BFXA 2QBYA 2ZRNA 1Y63A 4HATA 3CNLA 4A92A 2FZLA 3CO5A 3K0FA 1WQ1R 4JT4A 3D3QA 5EQTA 1H65A 4D2IA 1X8JA 3UMSA 3P4XA 3F0TA 4MITA 1Z3IX 1WA5A 3UMRA 4KBGA 1TU4A 3L82B 4ZCIA 5K8IA 2CLCX 2SHKA 4XWAA 2ZUCA 3MCAA 3REGA 4CEHA 2YWFA 3SFZA 2V6IA 1NLZA 1OYYA 3LQQA 1S8FA 4B6EA 1TF7A 4KHZA 3GP8A 2R62A 3B8HA 4PC7A 5AUOB 2EW1A 3GMTA 1XMIA 4OI4A 3C15C 4TMVA 1D9ZA 3MWKA 2ZYUX 3CX8A 3PQCA 3HU2A 2ZSFA 1AKEA 3SJCA 3OE7D 2ZI4A 5FBVB 1YRAA 2RGAA 3P32A 4Q9KA 2WKQA 1VECA 3OE7A 1VYUA 5AK0A 1OB5A 1KI7A 2ZE5A 5CIQA 4URYR 4F92B 4PQRA 3TSWA 1NIPA 5KNBA 4AG5A 2ZETA 4EPWA 4MYCA 1F2UB 1VG8A 2W2XA 1XMSA 4Z1MA 3U44B 4TWZA 3DOEA 2N46A 4GMXA 3U44A 2GK6A 3U3JA 1ZIPA 4Z51A 2WVJA 5IRCD 3OZXA 2HLDD 2ZUBA 3TK1A 3B85A 4FMBB 3EPHA 3SQXA 5GJBA 2WWXA 3CR8A 2F3TA 4PO9A 1AIPA 1TEVA 3JVVA 2ZR0A 3ZVMA 4MRNA 3EPKA 1OFHA 4LPSA 3H0KA 1FOEB 5K8TA 3QBTA 3VR3A 5DISB 3SYNA 3WRXC 2MSDB 2WMNB 3C16C 4ZCLA 1IONA 3EAQA 4BLTA 4L15A 4GSYA 1UDWA 4BFTA 1G41A 4RFVA 3DKPA 5DGXA 3AVXA 2BMEA 3B60A 4EQ6B 3DEFA 1IN4A 1GIAA 1R8SA 4HLCA 2J5XA 5AUNB 4YXWD 1G17A 1ZC4A 1EFRA 2JLZA 5J5CA 2W2VA 2BWJA 4Z54A 2FSHA 1XMVA 4Q47A 3PITA 1GKUB 3RS0A 1NJFA 3NH9A 1G20E 5A0FA 1G291 2CJWA 5BYKA 4NYIQ 1KKMA 3VFDA 1KIMA 4B34A 1IN6A 2ZAMA 1VYVA 2A2ZA 5L3VA 2ZANA 1VIYA 2NIPA 3GCGA 4Z8YA 5FUVA 3NC1C 4M1WA 4PO8A 5F2EA 1T6NA 2V3CC 3Q7QA 3U3KA 1DTSA 1OYWA 1I4DD 3WP0A 4TLEA 1KAGA 1Q22A 1W5TA 4C9BA 2QP9X 1P2SA 2GRJA 2GZDA 4MGIR 2XXAB 3T1OA 1L7VC 3GFTA 2GZHA 4HUQA 2D74A 4LBVA 2A5DA 1D2MA 3TR5A 1FP7A 2XOKD 5F9FA 1CJUC 2QMEA 5FBLB 3U3OA 4BE7B 4G5RA 4D0NA 1US8A 5IT5A 2YKGA 3L0SA 3ETLA 3I5XA 3KTAA 4ZDIA 3SQWA 3KKPA 2A5YB 4Q9LA 5HE8A 1GRRA 3EX7C 2MSEB 1IM2A 5JJKA 1EG7A 3U3RA 4D4LA 3WHKA 1TTTA 2CL6X 2JLVA 3T15A 5DI3A 4WOPA 3D31A 5DLQC 3RAPR 4E09A 2GEUA 5FTMA 3W9YA 4C0BA 1KDRA 4HAWA 2CHGA 4M8NE 4PANA 4RFSB 4US0R 4URZR 4TZ0A 4M2LA 4HZUB 4DEYA 4DC9A 2YINC 4HB4A 5FBWB 2H1LA 2JJ2D 4DB2A 4NDZA 2VPPA 1N5LA 2BBWA 4TLDA 3B7GA 4DCVA 2IWHA 4URWR 1YZLA 4ZKEA 4DCUA 3FVQA 4TYNA 2AKYA 2H8KA 3EPLA 4IRUB 5DHFA 4IDNA 3ICEA 2P67A 4G3XA 3GLIE 1II8A 3QXHA 5JJLA 2ZRGA 2Z43A 3C7KA 1ZUIA 1U81A 4QM7A 1G8GA 4Q48A 2BBOA 1KNQA 1MT0A 4P4SB 5CM9C 5BN5A 3NEYA 1NG1A 3BXZA 3W34A 5J4LA 4TQUS 1KSGA 1CP2A 3UIEA 4BFSA 5FR2A 121PA 2WSSA 3ZIAA 5A5GA 2W83A 2XJ4A 4V0OA 2XB2A 1XCPA 4QOSA 2RGCA 2IYVA 1E99A 1S3SA 1T5IA 3U4QA 1Z29A 2ZI9A 2N42A 1CR2A 1ZJ6A 1G8FA 5DE3A 2GJKA 1CJKC 3MSXA 2ONKA 1F2TB 3UG6A 1IQPA 2YZ2A 1ZRHA 2GILA 4IVRA 4B47A 3TSZA 1KK0A 3UK6A 2Z4RA 4JVMA 3R8FA 3LXRA 3PCRB 1AZTA 3U7FB 1OSNA 721PA 4QG7A 2VHUA 4ZDWA 3PEUA 3LAWA 2ZREA 1RFLA 3FYHA 2BKUA 4IOLA 3DVLA 3GLHE 2N1BA 4JLNA 4NCNA 4C0SA 1G5PA 4MKHA 4R7ZA 4FCVA 3CUEF 3WP1B 3LXXA 3EZ2A 2VTKA 3LLMA 1XD2B 4NYJQ 1FTSA 1X8KA 4TYYA 1G3IA 4C0QC 5C18A 4XTRA 2NMVA 3NBYC 3FMOB 1J7KA 2PEZA 4EFMA 3G0HA 3RRNA 1RVDA 3AV0B 2CDNA 5FTNA 3ZLJA 1HE1C 4ZKDA 4IXNA 1J8YF 3X1YA 4G5GA 1FX0B 1YHNA 2H7VA 3E5HA 1COWD 4IEIA 4RKEA 1F5NA 4LHXA 5HCNA 4OI1A 1Q21A 4LV6A 4RKFA 2RAPA 2PCJA 1H8HA 3RS3A 4HLUC 1NLFA 2XXAA 2G1JA 1A82A 3VU9B 2H57A 2HF8A 5L3RA 3PENA 1N3BA 5FOXA 5F3WB 1MRNA 3MWYW 4A1FA 3DPUA 1AM4D 4FI3C 4WIAA 1ZNYA 3NEJA 2DWPA 2IW3A 4HDOB 3ZVNA 3MAAC 4TZ6A 1C1YA 3ZZUA 1E0JA 3O8BA 1AS2A 2V1XA 4GP6A 2QU8A 3T1TA 3KQUA 2C03A 5JJIA 2VHCA 4JLDA 2X2EA 2J7PA 2YOFA 3W8RA 1N6RA 2BKEA 3T34A 1RE0A 2CL0X 4M21A 4IFBA 4OK5A 4TTRA 4V0ME 5FR1A 4B3CA 5KPDA 1AQUA 3GD7A 1S2MA 3OIUA 4BLSA 2IT1A 3BFXA 2P6NA 4XH9B 3C5CA 3UATA 4TSFA 1EFHA 3LBNA 4LPKA 1CIPA 1A7JA 3THYB 2R6DA 2HXSA 1P60A 1ZM4A 4F4IA 1P9WA 4IHQA 1LS6A 4WAUA 3ZVRA 5M04A 3I92A 3OHMA 1KO5A 2MMGA 1MO3A 3SU8A 1PLKA 3UKDA 2CE2X 5EE3A 5JEDA 4DLUA 1UAAA 1G6OA 1XTSA 2H5EA 1SXJB 2ZRAA 2VSFA 2O52A 2K5UA 2W6ID 2ZI6A 4KXFB 2DPXA 5JWOA 1QHSA 1E2EA 3IBGA 4ASUA 2C98A 1E2KA 1MO5A 3K0FB 2UVQA 3KKQA 4YLGA 1IY1A 1EX6A 1ESNA 2JASA 3W3ZB 3OAAD 4IDHA 3PEWA 3IEUA 2Q0HA 1UPTA 3O8RA 3PVSA 2CCKA 2GVZC 2MSCB 1EWRA 1K5DA 1QG4A 2ZITA 3VNUA 4TTPA 1N25A 1PLLA 3RWOA 3PG5A 2AXPA 1QHNA 3FTQA 2G3YA 1MOZA 4PZLA 1F2UA 5E4FA 2IYYA 3V4RA 1HT1E 4GI7A 4PHFA 5LB2A 1FUKA 1G7TA 2I3BA 4V0KA 4B2LA 3GQBA 1FMLA 1NVXQ 2V7QA 4D80A 1BIFA 2GXAA 1DBSA 1QHYA 4FXPA 3KQLA 3M0EA 3E70C 1ZCBA 2VEDA 2GEDA 1U8ZA 1N6PA 3NDBB 4MRSA 1KDPA 4F4JA 2QRZA 2ZU6A 1NSTA 4ITRC 3I3SR 4D82A 4L9WA 1WB9A 1P2TA 1M7GA 4WXPA 3A4LA 3ADBA 2UZIR 2IYUA 3HJNA 1U99A 3QPUA 1QHHB 2ZSBA 5FOVA 4LJYA 3WYAA 1OFUX 5FI1B 4B43A 4KFRA 1QHXA 4C4PA 2VSXA 2WPDA 4P33A 4AC9A 1BKDR 1TUIA 3HPQA 4JL6A 4NCKA 4BFUA 3FFBA 4A15A 1E1QA 4JBWA 3THXB 1T8TA 2WBLC 4L5BA 1Z2AA 5CLLA 3ZGXA 2FSIA 3WBJA 2EU8A 1NN5A 3OEED 1D9XA 2R2AA 2C95A 3HU3A 4JS0A 2OESA 3JZMA 3SC3A 3R9IA 4M1YA 4Q7LA 3EA5A 1NKTA 1B0UA 2IHBA 2WZQA 3CH4B 3GJ7A 1KZ7B 3BFKA 3HR7A 3B1WA 3MMPA 4ARZB 4Q1CA 5FH9A 1HEIA 4NONA 3QKRB 1G6HA 2ZRBA 3R7WA 3A1SA 3MJHA 1KAOA 2VYFA 3EXAA 3OEHD 4ARZA 5H8WA 2Q9CA 3PUWA 2EWVA 2GKSA 3FKSA 4BFYA 1NI3A 1W2GA 4E22A 3NHBA 4QL3A 1VDZA 1Z0FA 3A8TA 1T8UA 3EIQA 4C0LA 3K0AB 1WCV1 4GOJA 2FFAA 4DCSA 1E79D 4CYMA 3H4MA 1G5RA 5D3MB 3K09C 5FUXA 2QMUA 3NC0C 4IJMA 1OF1A 4I1OA 4PXAA 4GZLA 3EC2A 4IW3B 5EXTA 3RC3A 2O8EA 1YR7A 2WWGA 2PLRA 4IOKA 2DFNA 3LLUA 4MGKR 2DFKB 2VF8A 3EG5A 1G3UA 3KJHA 5DH9A 5H70A 2FX3A 1F2TA 1JR3E 3DDCA 3VTKA 1IOZA 1ZYUA 1OE0A 4GPTA 1UFQA 3RSLA 1NJGA 1SHZA 1QHGA 2YOGA 2B7BA 2CXXA 1CEEA 3H2YA 2V7QD 4ZI3A 1ZW6A 3EWSA 3N70A 5EP1A 3JVUA 3HP1A 3A58B 4CVNA 5KU1A 2NPIA 4AD8A 2QPTA 4EUNA 2H92A 1NF3A 1NVWQ 1KI6A 1YVDA 1SKYB 2PH1A 1D8TA 4HZUA 4LX0A 4JT2A 4KFSA 3K9GA 2Q6TA 5CB8A 1NN1A 5LD2B 1U9IA 2WSMA 2OZEA 4C7OA 4C30A 3TW8B 3U2QA 3VR4A 2ZU0C 4QHYA 4AIIA 4HAYA 4EFLA 5DI3B 2PZGA 4MRRA 1HURA 2BJVA 4FMCB 2QENA 1E3MA 4CEJA 4RZUA 2IBMA 4NKRA 1N0UA 4UNSA 3QF4A 2Z4SA 1RPZA 1NSFA 4DT1A 2IYSA 1JECA 4G5OA 1E2PA 5BN4A 2ZSAA 1WDTA 2QPOA 2VP4A 1ZCAA 3K0EA 4DVGA 1AN0A 2V54A 4URVR 3LH5A 3QI2A 2HUPA 4B3DA 4ABYA 4Q9JA 2GCPA 1WXQA 4BLPA 4DIDA 3R7WB 2JJ1A 1KNXA 5FOTA 5P21A 4ZIRA 3B78A 3V00A 3CW2A 2VHJA 4B3BA 4AYXA 5FBRB 3BIFA 4IEEA 4PX9A 2QT0A 2A30A 2C5LA 1DG1G 3QQ5A 5H68A 5JRJA 1XXHB 4B6FA 1M34E 3L8YA 4AKIA 1JAHA 5SZJA 2CVHA 4POAA 2GETA 2PCLA 4TTQA 5FBQB 3I8XA 5AR1A 3RVBA 4DSTA 1NRJB 2DFLA 3VHXA 3CM0A 1GDDA 1T5LA 1UKEA 3TLXA 1OFIA 1KHTA 4UNNA 3ZYCA 4JLMA 4NHOA 4O25A 1BYUA 2GJSA 2WJJA 2ZS8A 1E9AA 3DOFA 2VF7A 4DCNA 3QVVA 1X8LA 4PPGA 3L43A 5EP2A 2HJGA 1AK2A 2HYDA 1OIWA 5HPYB 5IK2D 4RD3A 2ZJYA 4FMCF 4LC0A 1CJMA 1CXZA 2C2HA 2ZIAA 4AG6A 1NBMD 4A82A 4A4DA 5LPNA 1HE8B 3LO5A 4AI6A 1EK0A 2J87A 4DSOA 1HT2E 2QM8A 1U98A 3TR0A 3EASA 4IXMA 2AL7A 3FMPB 1QRAA 1M7BA 1GNRA 1Z6GA 2RGXA 1GOTA 2VP9A 2YC2C 2F7SA 2HLDA 2RCNA 4CEIB 3AB3A 3QKRA 1XRJA 1Z6TA 3HWSA 5JFGA 3S1AA 2EVWX 2FWRA 421PA 2ECKA 4N0DA 5FTJA 3RWMB 1W36B 3M4YA 4PC3A 3QOFA 5EXSA 1KI4A 2XB4A 4QJ4A 2J0SA 2XNSA 5ANRB 3FMFA 3CH5A 2EFCB 3BB3A 4C0AC 1P4SA 3ICQB 3WRYC 2QN6A 1JPNA 3EZ9A 3VR5A 2BVNA 1S4QA 4NBSA 2O0HA 2PT7A 1X1RA 5UKDA 1U2RA 4EPVA 1E4VA 1Q3HA 4TLAA 3SOPA 2HCJB 2ERYA 1YQTA 1NNEA 3NH6A 5C46F 3ZD7A 5JCPA 1E4YA 2XAUA 4HZIA 4UNRA 4TT3A 4Q4AA 5DN6A 3PJRA 1M2OB 4V0NA 2AX4A 4EIWA 4Q03A 4IDPA 2GF9A 4F4CA 3QPVA 5FPTA 3TAUA 3MWJA 3UG7A 4QKQA 2QY9A 2FNAA 4Q18A 4RD4A 4Q1DA 1TEXA 1DAKA 3TVTA 1XJ0A 3UPUA 2ZRHA 4DLTA 2IYRA 2CNWA 2BV3A 3E1SA 3HDTA 1Q44A 3FGNA 1R0WA 2WJYA 3CR7A 1IN7A 2PMDA 2JLXA 2C8VA 3GEHA 4Q02A 2FOLA 4EDHA 3IDQA 4JBXA 4XSGA 3ZVLA 5DYGA 3KL4A 2VO1A 4F38A 2FPMA 1SXJA 2QBYB 4HAUA 5DHAA 4XJXA 3IBYA 4M9SA 1OW3B 4JMPA 1KY2A 1SVWA 3EW9A 4O2RA 2DHRA 3BORA 3OFNA 3D6TB 1N0VC 1E96A 4UJ5A 1FTNA 3OEEA 3WNDA 1SVIA 3VNVA 4K81B 3CNOA 1SHKA 3KZ1E 2ODBA 2VHQA 4PSKA 4DUGD 3KXKA 4M9QA 2HYIC 1N6NA 2X8AA 4OI2A 4R2HA 2VP0A 2WMOB 5EUQB 4B3FX 4Q7JB 4GZMA 3OEHA 4HB0A 1HA3A 5KSPA 1LF5A 4BFVA 4Y0VA 3OIVA 3TKLA 1CBUA 1S9DA 3GFPA 1NIJA 2CMKA 1W0KA 2GTPA 3U6BA 3AVVA 4KI0A 1EFCA 3REFA 2KE5A 4KBFA 3V4FA 2CBZA 5JBQA 5FL7A 4NMMA 2NTYC 2EWWA 4QFMA 1ZAKA 4E03A 4D4KA 3X2SA 4RD1A 2I4IA 3I62A 3E2IA 1P2VA 4JSYA 2WJHA 1Z08A 2P3SA 4H1VA 3W6PA 4DXAA 2ANBA 2FSFA 1P5ZB 5E7IA 3CRVA 2NQ2C 1G3QA 1OXUA 1N6IA 1KI9A 3RS4A 4YMUA 1QVAA 3NWJA 2LWIA 2WM9B 1R5BA 2KI5A 3B9PA 5JWHA 4KODA 4KFUA 2ZRDA 1DS6A 1US8B 4GNKA 2C96A 1Z0AA 3PIRA 5SZKB 5FPKA 1NVUQ 2QGNA 5AUPB 2XNDD 5GADl 1DO2A 1UBCA 5C4MA 5TMPA 4H1UA 2CEAA 4PO1A 3RANA 1SVSA 3SFVA 3HR8A 1OH5A 1OHHD 1DE0A 1WBBA 4P32A 1Z0JA 4A0HA 3QPWA 1Z0IA 1LS1A 3AF1A 2IHYA 5FTKA 1AS0A 1XXHE 2R6FA 2OE2A 1G3MA 2WKPA 2WV9A 2XTZA 1HUQA 4LHVA 4LYAA 1JXMA 4LGMA 3FKSD 3LD9A 4KITB 2IS2A 4LUCA 3CF6R 3QJYA 5TXGA 3QF7A 3I8SA 5JZVA 2QG6A 1MABB 4PPQA 3HYRA 4A8JA 1U9IC 3EPJA 2C9OA 4U5XA 5CK4A 5GJWC 4E07A 1E2IA 4OI0A 2JLRA 1U90A 2R9VA 1T3LA 1KGDA 4PFSA 5CYOA 5HCIA 2J7KA 1G3RA 2ZI3A 4K8OA 4R2IA 5CJPA 3SHWA 1X86B 521PA 2VBCA 1F48A 4QBGB 5AWFC 2IF2A 2Q9AA 4HDCA 5EJEA 1GAJA 3GLIB 3C8UA 1AA9A 2QRNA 1SKYE 1DARA 1FQJA 2PEYA 3A1UA 1NP6A 3BH7A 3PUYA 1YR9A 4DLWA 2DR3A 4KFTA 1GILA 1G19A 1T9HA 2AFHE 2ZE6A 2ZTSA 2R6CA 4HI0E 5BW8A 4RD0A 5FL7D 2ZJAA 1P3JA 3M6AA 3U6KA 2AHOA 5JS7A 5JI3E 4Z1MD 4I1UA 2PJRA 1DAEA 3ZS8A 2A7QA 4LRWA 1MH1A 1XWIA 2G0TA 2IUSA 3TJZA 4ZDJA 4ERNA 5KYKA 1IHUA 2JCSA 2QPAA 4CF7A 3ADCA 1E2MA 3KFXA 3AUYA 3TVDA 4RSGA 4L16A 5L3SB 2P2LA 1G7RA 3BB4A 2WWYA 2QI9C 3IUYA 1YZGA 2V8OA 4BQSA 1R7RA 4JJKA 2F9LA 1P9RA 5CIWA 4DUGA 2FFHA 3KUCA 2KBFA 4LHYA 1MABA 1FZQA 2WWIA 1R0YA 1QHHA 4Q01A 4UXHA 1XTIA 1DAHA 5FL3A 2GCNA 1SXJC 4CGZA 1HTWA 3CX7A 4V03A 3VAAA 1IY2A 3NIBA 3CRQA 3EZ6A 4KYUA 3CRRA 4QNMA 4MGYR 3H86A 3B1YA 3NXSA 1T3SA 4C2UA 4D0LB 1K6MA 1XEXA 1C4OA 1O3YA 2H18A 4ZIRB 3KDSE 3EA0A 1XD2A 3S1AB 3DM9B 1SQ5A 1GVNB 3W5JA 2GZAA 3GFOA 3FPAA 4DDTA 5C1BA 2ZVQX 4DWJA 1D2EA 4URXR 3FMIA 3TBKA 2XTMA 3W6OA 5JMTA 2ZR9A 1EFTA 3FDIA 5LB4A 621PA 5KSYA 3B1VA 2GCOB 4XTCS 1S3GA 4QNRA 3ZH9B 1DAFA 3IHLA 4RD6A 2JLQA 3ZIAD 4DDWA 2GXQA 2RHDA 4Y0AA 1T3HA 3DL0A 2G9NA 3KKOA 1E2QA 2DWOA 4BWYA 1XZPA 3FE2A 2WJGA 4GFDA 4BEJA 2WJVA 1JPJA 1KK3A 4MYTA 4A2WA 1NY6A 1PZNA 5JRZA 4HUTA 2ZJOA 2QZ4A 5CM8B 3L8ZA 2QT1A 1JR3A 1FMJA 1RYHA 1W0KD 1YJ5A 2AFIE 5FPYA 1JR6A 4G5QA 3GJXC 5TV2A 1JAIA 4V0LA 5L3SA 3V9PA 3LA6A 1TADA 3B1ZA 2VP6A 4MUAA 5HKKD 3I5YA 1PJRA 4LZZA 3U4QB 1KI3A 5DNYB 4BECA 4YC7A 3F8TA 4YDSA 2YWEA 4QBFA 4UQOA 2W6JD 2VHTA 4DDUA 5AUQA 3RS2A 1FNNA 2GXSA 2RH5A 2W6JA 3LX8A 3MRSA 2JGNA 1W5SA 4AKHA 1ZVQA 1V43A 5KOYA 4RCYA 2LKDA 3AQ4A 3Q9LA 2XOKA 1SVMA 2GDJA 3BERA 2GESA 1VCIA 5B64A 2O8DB 2VQSA 3VKGA 4GOKA 3OAAA 1E9CA 1Q0UA 3AGQA 4LY6A 1RC8A 1NMZA 3AKEA 3QSYA 3QG1A 4Q7KA 1G7CA 2ZRMA 2DYKA 2O0KA 1G4UR 3QBVA 1SVKA 2ERXA 2UKDA 2XNDA 1JBKA 2J1LA 2ODNA 5EXXA 1NY5A 2VP5A 3X1XA 3SEAA 2ODEA 2V9PA 3LDAA 4TN1A 4B74A 1X6VA 2BOVA 3MD0A 1W4AA 2GK7A 2Q3FA 2ATVA 4NYJR 4BEBA 4R9UC 3TMKA 2KJQA 2ZRPA 3T35A 3CRMA 1ETUA 2AWNA 4DLYA 1QHIA 1PUJA 3Q5EA 3QKSA 2FN4A 3IKJA 3SNHA 1RRFA 1UADA 2O5VA 1M1YE 1H8HD 4A8JC 4TYPA 1A4RA 3GEEA 1I2DA 3QY0A 5BN3A 1CU1A 2DWQA 4RZ3A 2ZRKA 5JSZA 1VYTA 2KSQA 2OFOA 2OSBA 1XEFA 1UBGA 4D4MA 1TX4B 4P31A 1XJCA 4DKXA 2YHSA 3A36A 5DIFA 5EXPA 4CT5A 3BS4A 2BHRA 4Q00A 4B3XA 4LBYA 1G1MA 3PUZA 3U5ZB 3GLIA 2VA8A 3X1WA 1XMJA 4Q1BA 2PZFA 4KCGA 3QKTA 5JCZA 4QM6A 2JJ8A 4EPTA 4PC1A 2ZJ2A 4DJTA 5IF9A 2HJVA 2JA1A 5KSOA 2J0UB 1ZNXA 1UKYA 4P4SA 3ZDQA 4EAQA 3THYA 4MKIA 3VKHA 2NZ8A 3TUJC 4PPFA 1RYFA 2CVFA 3BFVA 1N5JA 3K9NA 3KXIA 3MFYA 4FCTA 4FIDA 2CHQA 3KJGA 3Q3JB 2WIAA 4PTLA 4US1R 3EIHA 4NYMR 5ELXA 2RB4A 3RRMA 2BCGY 2F55A 2IXFA 2P6UA 4MKGA 3IO5A 3B9QA 1XTKA 2CL7X 1E2LA 2ZI7A 2ZRFA 3M1IA 1ZD8A 2JDID 2XJ9A 1I4LD 4AYWA 2AXNA
chains in the Genus database with same CATH superfamily
3DLAA 1O54A 4FEAA 1R0LA 2VUSA 3SF0A 2G08A 3L9WA 2Z57A 3MBOA 3F8SA 1P4HA 2WFLB 5F76A 3R7AA 3TPZA 1BX3A 4GT1A 4A10A 1X0XA 4QGGA 4U7FA 3KFLA 1MIHA 2PKCA 5EN4A 1PR6A 1NNSA 3VU8A 2B0JA 1TQHA 2GZ1A 1AF4A 4BGVA 4ZK6A 4A8PA 3ND6A 2FYTA 4OREX 1ZAYA 1DUVG 1FFXA 4JLJA 2CKDA 4CUKA 2IYEA 4UNPA 2FUNB 5KUTA 4YCMA 3TUZC 4GKJB 3THSA 1OVMA 1DPFA 1WS6A 2O2JA 1O08A 1W36D 5F4BA 4YK7A 4YRQA 1Z5PA 2WU3A 1Z2DA 4WZBA 4YCCA 4O63O 1L2TA 3IELA 2NUAB 3TTXA 3N0WA 1DG9A 4DNFA 5G41A 5AXDA 2FUG1 3U49A 2PTHA 4Q21A 5BY2A 2OLKA 2HU7A 1NQTA 2P1ZA 2QOEA 3TQHA 1TYZA 1MD9A 3WIUA 4P7GA 1KF0A 4U63A 4R6XA 1Q19A 3WHPA 1Z63A 3AI3A 3C7TA 1V5FA 3R0VA 4OU5A 3C6YA 1Y3CE 1EH5A 2VNHA 1NFQA 3T9FA 1KMIY 2Q5HA 3LV8A 1XEWX 3AR2A 3R6TA 1ZUNB 3PXGA 4K86A 3VSAA 4BZPA 1IZ9A 3SC6A 4WA7A 2H6EA 4Z4GA 2VF4X 3LT4A 3VR6H 3WK8A 1XCLA 3T1QA 5B1YA 5KQSA 1O1YA 1XFAA 1CR0A 1JAYA 3ITEA 4INJA 4A0GA 3KJXA 4GBED 5CW1A 2DKNA 3QVGA 3TIXB 4ZYZA 2NX2A 3FZQA 3TTSA 2RSLA 4IQGA 4OYHA 4U5QA 1QGZA 3TH5A 1Z16A 4P6VF 3K0KA 1HYQA 3KLNA 2C5AA 4C03A 4WWHA 1MNQA 3ESYA 4J76A 5LKAA 2FG5A 4NICA 4LV8B 3JAKB 4QGSA 4L4SA 4UASA 4IZ6A 4AROA 1F60A 4DQUA 2FRVA 2FJPA 3WHLA 4UVGA 1JF8A 1PR0A 4EVRA 2REBA 3CMCO 1WHTB 2H0RA 5G2OA 2VRCA 3Q6IA 4KE9A 4G09A 5F35A 3V7NA 3A10A 1TIKA 2JJ1D 4HXEB 2DHDA 3TQRA 1JEDA 3KVYA 1DHTA 3G79A 3DZFA 5A3SA 4JYBA 3LBHA 4EKYA 2GAAA 4BKMA 2DP4E 1CUVA 3FIUA 2O05A 4F4FA 2XVAA 1WDWB 1X7WB 1LK5A 3BMNB 3TLKA 3WGLA 2JARA 3VR6D 3ZHXA 3PF9A 1F0YA 2QVYX 3QG5A 3QTTA 1K63A 2QVCA 4K9DA 4LJSA 1EJBA 2F1IA 1R3UA 3B5IA 3U7QA 3W77A 2OGZA 4GM0A 4Q6BA 4TV9F 1JIIA 1M2OA 2PHZA 4M36A 1UF9A 3WICA 3MTBA 1F6BA 3QPAA 2Z5VA 5IEJA 2EJUA 3JARB 2QN1A 4C0KA 4ZT2A 2G67A 2QI9F 4F21A 1QGDA 4HWPA 5AMXA 4BC1A 3NRJA 3QHPA 1JHYA 5D7BA 4LSMA 3T3OA 3LDGA 5T5QA 3L40A 1P9NA 1D2HA 1RR6A 1SY7A 1TRHA 2XI4A 3GGGA 1VB3A 3IOCA 3IURA 3M6MD 2PMKA 3CC8A 2IUFA 4IHJA 4QEDA 4UE3S 5EKXA 4QICA 2VJAA 2VL7A 3TOSA 3LWNA 3TPCA 1KK1A 3DUFA 4CIDA 4LVCA 2ZT5A 1MB0A 3O8OA 1XPJA 1V9CA 2HO5A 3M9LA 3OUTA 4KLZA 2Z8YM 1NDHA 3EIOA 4NH4A 4ZVKA 3SHFA 1NU6A 5ESWA 3VC2A 2RHMA 3WIEA 2GJ4A 4QGAA 2DY1A 2WMDA 4GZ5A 1OB2A 3AFGA 3JQAA 3JQBC 1KVTA 4LJKA 3GJ5A 3WC4A 4C2BA 1IBKB 4CM1A 2R5WA 3IOBA 5KNCA 4QECA 3C70A 4ESEA 3ABIA 2PAFA 2B5VA 2QD5A 2FOIA 5I7VA 2BFDB 2YL2A 3I01M 2VDPB 3BK2A 3LPDA 4TL8A 2CLSA 2IXTA 3WNCA 4BZQA 1Y3DE 4FMDF 3QX3A 1K6IA 1TF5A 2R7LA 4G25A 1WU7A 3HWWA 3CKLA 3ESBA 4NYMQ 1GG5A 1E2UA 2FN7A 4M1MA 3RK4A 4AYTA 4E5UA 8ADHA 2B69A 2OBYA 1WOYA 2WHEA 3I9NA 1TVKA 3NJRA 3T5CA 4PIMA 4I1RA 3ILHA 3VOSA 1A98A 2ZSEA 4LEIA 4PGMA 2BKXA 2BYTA 3IAHA 2E5FA 1NZJA 1VMDA 4R1SA 4A0SA 2C5BA 5EHXA 2DSNA 3KWJA 3GP5A 4TZTA 4OLBA 4KL8S 4NZZA 3U0BA 4BNYA 1AB5A 3SE0A 1ECBA 4ENPA 1LJ8A 4I14A 1XZHA 2CNDA 3NPMA 2JGJA 4Q5IA 3RC7A 2GCOA 1YVRA 2K2QB 3TZKA 3W5HA 2HA2A 2E87A 5LZ7A 4DG5A 3BD9A 1BMQA 3DF7A 3P2OA 3TSOA 1LQUA 2MTBA 1QIHA 2QY6A 1ZK1A 4GKAA 3CPEA 4PCAA 4UDOA 5FPHA 3SR0A 1H23A 1S2NA 4F04A 1BVUA 4WXRA 4W1PA 1J0CA 3EXG2 2WINI 2PPVA 5C1IA 4CIWA 3KO8A 2ZTVA 2UVPA 3BMOB 4HAZA 4LCEA 3DL2A 3CZ9A 4EPXA 1OI4A 3HA3A 3Q40A 4BASA 3A3PA 5JDIA 1DKLA 1TM4E 2CF6A 1E7RA 1XZDA 2HJHA 2DFTA 2KB0A 2HUNA 2RK3A 4QXMA 4DIKA 1FX0A 4AJ1A 4YRIA 1HK7A 4PLPA 3DEKA 3ZI0A 4MUIA 4YDHB 3ZGNA 3ZK9A 3RNLA 5KVCA 1KH1A 1N2SA 3LHDA 1G5TA 2I76A 4QOHA 3BWEA 5DX0A 3TDKA 1NASA 1MG0A 2D62A 1R6BX 2DPHA 5BQ5A 2VTBB 1I5EA 3W79A 1XQWA 1I7NA 1J8VA 2Q6IA 3HABA 3KEQA 4PG4A 1ENYA 1OIVA 1XNGA 1IXZA 1E2HA 2BCJQ 2X9QA 3BH6A 3W2HA 3DJFA 5EIEA 4AFNA 1M74A 3F7TA 3KKEA 3U7IA 3D3WA 3FW1A 1BFKA 4F3CA 3KQQA 1KI2A 4D9NA 2Z3WA 3CNBA 3EXHC 2VJOA 4LMRA 1C29B 1IXSB 3IIMA 2BFEB 3AVOA 5KOHA 2QORA 3BTUA 3VH2A 1YJBA 3VAYA 3ZLUA 2PXXA 1DKUA 2QMQA 1AKTA 3F9CA 1RZUA 1V35A 4PGHA 5EJ6A 3FAZA 4UUOA 4HY3A 3KR1A 2PRSA 5G3ZA 3AHCA 5H9VA 4LF5B 1N6KA 1W44A 1GA1A 4CLEA 4L50A 4ND7A 4MVJA 3V2IA 2VTEA 1V71A 3JU3A 3UJDA 3H1TA 2BEJA 2M6LA 1S2OA 4UTZA 4EZIA 1IBLB 3G88A 1G38A 1VCMA 3DJYA 2FE1A 3K09A 3WYDA 1OXBB 5HDBB 4L9SA 2EP7A 1E2NA 5KVQA 1DO0A 2JIZA 4WKPA 2CFIA 1JQLB 3Q72A 4BP8A 1GKKA 4JZKA 2J45A 2PR2A 1FTQA 1XEAA 5JXJA 5L7WA 2AQHA 3RS7A 2LE0A 1TF2A 1CB0A 2IE8A 4TMXA 2H1FA 3P2IA 4FGUA 1KI1A 4RKWA 5FUWA 3U4HA 1L5VA 3L1JA 2Y8EA 3ELDA 3CWCA 2FJUA 4LE1A 2AF3C 2OCPA 2W11A 3MS7A 4GUDA 1N34B 1UP6A 4GBMA 2HWWA 4RCZA 1E2GA 3GRVA 1L4NA 4F12A 1L7QA 1DRVA 4XCXA 2REOA 2OUKA 4BLRA 4BVEA 4DGSA 2AVDA 4GVXA 5E4JA 4AX4A 1I7PA 3OU2A 3QNWA 3B2QA 6Q21A 4IIVA 3LVQE 1TJ5A 1X7ZA 1XZGA 2FN3A 2VIIA 3MWDA 3R9KA 3SBEA 1X7XB 2DJIA 2HRCA 1DEAA 1AKYA 4B33A 2OXEA 4P08A 3A6PC 4RHXA 3UMVA 5K1ZA 4MW0A 1T2UA 4G84A 5FNVF 4KPYA 1Q2UA 3QEMB 5JE8A 3Q7PA 5DN6D 3MBIA 2QRGA 3GGDA 3N53A 4F86A 3UCFA 1Q0QA 1O9BA 1QQ6A 2J41A 2V98A 1IEXA 4Q1EA 2HMYB 4D43A 2XITA 2F4NA 3U9SA 5CHYA 2X8JA 4IJ6A 3VUFA 1VGQA 3DCYA 3K6KA 2JFXA 1S2LA 2DFVA 3QEKA 4Z49A 5EWLB 5LZ9A 4JJ7A 1JLRA 2D2FA 3IKTA 1QH8A 1B0AA 2GFQA 1ZA1A 2DTEA 2PUBA 2JGAA 4JYAB 1NXPA 2VQDA 4UAJA 3X43A 3BF7A 3C45A 4ACBA 1AJEA 2H3HA 3UK0A 2YZKA 5LU8A 1GPYA 4YCAA 3GUHA 4XD7A 2DBZA 4YAGA 2HZBA 2ZSJA 3STYA 3ZI4A 3GFSA 4W63A 1NR1A 3TAHA 1JEEA 4PX5A 2FLKA 2L2QA 1O4WA 1W48A 2ZKLA 5ECDA 3SYTA 5B58C 2C9CA 2IU3A 3AF5A 2Z2IA 2HA4A 3ODPA 4E5MA 3IVRA 2QWXA 3T61A 4E12A 4AS1A 2GZSA 2P9FA 2XT6A 4J3JA 5L9AA 3GLFB 3CRZA 3ZQ6A 2IU4A 3CGGA 3K71B 4WN9B 1RJ9B 4JVLA 3T4UA 3UT6A 3PVCA 1FMCA 1WUTA 3ONDA 3IPAA 1E1MA 1P7CA 2BZGA 3UANA 5AK4A 2H52A 1SG6A 1L8AA 4PQEA 1I1QB 1N1GA 2W2MA 1ZN8A 5DBIA 4OPMA 3LL7A 5CLJA 1SELA 5SYNA 2GN9A 4FWTA 3FTDA 1BVYF 3PEYA 1KA9H 1X7XA 4LVOA 3L6RA 3VX4A 3EDRA 2XUJA 1FEZA 3N2YA 5JECA 2XE7A 2C88A 4Z9FA 4GQAA 2F17A 3CU5A 4P0QB 4EHBA 4Q05A 3OOWA 3NVAA 1QZXA 5JD4A 2WF6A 3Q8KA 3UMJA 3ZV6A 3GT4A 4J7XA 4LJ6A 2PJDA 1DRWA 2QQFA 3WLTA 4DSNA 1TTPB 1WF3A 2Q21A 2ZPAA 3A37A 3HSYA 1IHOA 4MA5A 5CT5A 5HRCA 4NESA 2XKJE 2XUGA 1HQCA 4CM9D 5K9ZA 1GZSA 4D8YA 4JUAA 2R0QC 3NIDB 1HLGA 3DM5A 4ZOCA 5IJ0B 4AURA 2BLLA 4LYHA 1CVIA 4M98A 4UVEA 2FW0A 4HNAB 4NK5A 1AH2A 4F93B 4TKUA 1KJQA 4WCDA 1ZVVA 2WJWA 2E4WA 4LYGA 4L95C 4REOA 4UU0A 2ECPA 5DOVA 1IRIA 3IEXA 4EG6A 3HY6A 5IW8A 4MGZR 4X20A 1QMGA 4EJSB 3L8HA 5GJCA 5KYUA 3R8CA 4UREA 1YZVA 5TPZD 2FPLA 2QJWA 1XBTA 1YVPA 3IAAA 3IGFA 3GYBA 4JYCA 1ZUWA 4GX0A 1HFEL 4KN6A 3T3EA 5JQGF 2PX0A 1TLFA 3OM8A 5K3BA 4I2NA 5M7EA 1H2WA 2Q8NA 3CPSA 3HYSA 3EMBA 3IUEA 2XDQB 3HJGA 1U3WA 4JOQA 3MB5A 3U4IA 4NDNE 2J0VA 1PV4A 4BEWA 4U6SA 3WWYA 4XFKA 4G0VA 3QELA 4C7XA 2X1LA 3QPCA 3VKUA 4YR9A 2BJWA 2P65A 3I0ZA 1T0PA 2G25A 1N2EA 1QWSA 2HBZA 4MWZA 2QLBA 2JCVA 5ALRA 3S5JA 3T3IA 2XNKA 3T9CA 2WG0A 4ZJZA 3UK7A 2QLFA 4Y2GA 4CTMA 1GUYA 3VKVA 5TLSA 2LP4Y 4MH0R 4ZYXA 4MXDA 1SQ6A 2VNAA 3TIGA 3F74A 3IPCA 2AN9A 3K4HA 3TOCA 1ZD3A 2O0JA 3NGMA 3OZDA 4FXOA 3NHLA 4Z7JA 4HNVA 1UPFA 3HBMA 4ZARA 2FGJA 2VH2A 4BKUA 2UUPA 1AD2A 3WZLA 4F3KA 5LDDC 1BX1A 1UPXA 1F9AA 1FUEA 1E1CA 3FMGA 5B7PA 1TTQB 4IDBA 5D3MA 5AJXA 3GAAA 5D8DA 1FSZA 4K8RB 2C4HA 4M8IA 4QPCA 1XWWA 4LGCA 1I4TD 1G60A 5BPHA 1QP7A 1G0NA 2BFFB 2HT6A 3MK31 1HH4A 1KS2A 1X3LA 3MYRA 1TUBB 3K0CC 1ZXLA 3R5JA 4EGQA 2UXBB 3TGPA 4ARIA 1EVQA 3DV0B 4L8GA 4WERA 1DJOA 4YMWA 2Y0EA 4XYLA 3HYCA 2R6GA 1T13A 2HWUA 3JPYA 4KKXB 5DSZA 2C00A 1NBME 2WE8A 2WKRA 2IY8A 2XQVA 4L74A 2A78A 5F64A 4EUEA 3OA0A 1DBPA 1Y98A 4F56A 1WEHA 4KAXA 3LY5A 2C2OA 2FPIB 5L6MB 4Q93A 5LSAA 3QEJA 2ODQA 5M29A 3PYXA 2JD1A 4R9RA 1KZ1A 3I30X 3M49A 3K1JA 3EOZA 4Q19A 4WHMA 4LJLA 1N7GA 1P3DA 1TK9A 4QX6A 2XRYA 3JQ8B 4QNNA 2HHCA 3FPFA 2PLFA 4LECA 1VIAA 4RXUA 1GKLA 2CVPA 2JD0A 3D7MA 4FOTA 4IH9A 1VZ3A 1RBQA 2HA0A 3DTVA 3L4SO 4R2JA 1KK2A 1B6RA 1PWYE 3ZV3A 2H4JA 1LC0A 1U04A 2LUOA 2V3VA 2WFAA 3TQCA 4BDTA 3IVCA 1E0SA 3JW8A 5HF8A 3JRNA 4N41A 3UUWA 4NG5A 5HK8A 1MTOA 2XW6A 4PC2A 2VN8A 4LISA 2JIOA 4PSAA 4Z0PA 5G40A 4BLUA 3WGVA 2EZTA 1YR3A 2J31A 2F1RA 4CODB 1Z68A 3IMGA 3TZLA 3H9JA 4BVGA 3FHOA 1DAGA 2O14A 4MJLA 4ZI7F 1K5HA 3GH3A 2NUBA 5BSGA 1II9A 1KH3A 3GDWA 4H17A 3CEAA 4HX2A 1DELA 1GT91 1E1QD 3LWBA 5FOWA 4AQYB 4MLDA 2BKLA 1PQ4A 3KAQA 5D01A 5IBQA 4ROSA 2DRIA 4O02B 4K28A 3PXDA 1LI4A 1Y9EA 3AIKA 2JCXA 3L6OO 3CURA 1ZMXA 2JJQA 1YQXA 3EH2A 2RGBA 5CGZA 3FTCA 5AI5A 4D5GA 2CSXA 4WY5A 4A8JB 3L93A 5T8KA 4C7VA 1ML3A 2AH5A 2PWYA 2GD6A 3TDMA 1RDFA 3WXMA 1KY4A 2EGGA 5J4KA 5FBHA 2Q6LA 1PLJA 3OEYA 3S2UA 5HOEA 2H31A 4IWXA 4UULA 4G1UC 1ZCFA 4KNWA 1FBTA 4E94A 3G82C 1YB7A 4KXLA 5K05A 4C4TA 2IYWA 2W2TA 2G9QA 3WGQA 1QTQA 3OETA 1A8QA 3EVBA 5I7OA 1SUEA 2J9XB 2AG6A 4ND5A 1FW6A 3AR8A 4O4HA 5JSZB 3O1JC 5ALYA 1MJGM 1UM8A 3W6NA 1XLTC 3LDHA 4HLNA 4IIJF 1O94D 4M53A 2R96A 3TZBA 4QYWA 3W7BA 5LZ4A 4MEBA 3HUTA 3OZ7A 3V4OA 1N9KA 2HU8A 3VHLB 5JDIC 3AF3A 3ZCXA 1G7SA 1SR8A 3O21A 1RXVA 4M1OA 1EP2B 2OC4A 1RRGA 3PHGA 4HDAA 5TGZA 4AWAA 2YN4A 2Z5GA 3BA1A 1NJ6A 3FB4A 5LBIA 1RJDA 4KVGA 2PVCA 3GFQA 3OSUA 5IJ0A 2G0NA 4IKOA 4OH7A 4ZV9A 4ALMA 2I8CA 4MUEA 1U3FA 3CTPA 5HSGA 4EL5A 3O4FA 4U2CA 2B8TA 2M6RA 3DMDA 5CYFA 5JNVA 1KKUA 1UWLA 4B3RB 3ENVA 3RRJA 3BE4A 5CB0A 1USUA 3SBOA 3LK6A 2J8ZA 4GMGA 2IVFA 4AMVA 1YRWA 1TZMA 1ZSYA 5K3CA 2OD2A 5ICSA 2IPLA 3OD1A 1PFVA 1M2JA 3FRJA 2ZYWX 3BULA 3QKUA 3TOZA 3W8FA 1ZD4A 1T6YA 1E6CA 1VE5A 4TRNA 3UTCA 4CJXA 1H69A 4YT2A 4ASUD 2FXIA 1D4AA 1OX4A 1UFVA 3FG9A 3BGWA 4OHVA 5HOQA 4KB5A 3AI1A 5JJBA 2AHRA 2ZRQA 3AP2A 3QXCA 4PAGA 4AO7A 2I5PO 5DV9A 1H6DA 1SQ0A 2NVOA 3OMLA 4IYRA 2PX4A 2YV5A 3GFBA 1E3WB 3UMGA 1IEVA 1OXTA 2JH9A 3RV4A 2R79A 3B70A 1DDOA 1R0ZA 3OPMA 2WILA 3F78A 4ZOLA 4QGFA 1TYDE 2TMKA 3SYLA 2ZUWA 3UJNA 4XX1A 2I2CA 1BHSA 4JQCA 4RU1A 3H2JA 4OQLA 2QEQA 1RLUA 1QVWA 2NV0A 4K03A 5TMBA 4V0QA 4M54A 1WAMA 4RVOA 3PNYA 2Z0MA 1EJ6A 2ZPUA 3WNZA 3WQSB 5KMGA 4F06A 5K6AC 1QPZA 2C78A 3E53A 2R48A 2ZBDA 3R9WA 4X00A 1Y4DE 1K3FA 2AQKA 2YCBA 3ZCPA 3CCBA 3E81A 1NXTA 2H07A 2YWGA 3W04A 3RW9A 1SGWA 4ESVA 1D7OA 3F90A 3P9KA 1JALA 3FFTA 4D5EA 5KYGA 3AHJA 1LLFA 4AKGA 1XR3A 2DBVO 5E95A 3DE2X 1XF1A 4RTLA 3OZFA 5DNAA 2F3RA 3RHFA 3BQMB 2RAVA 2FK7A 4KQ1A 1W2HA 4PAWA 2FZVA 1PG2A 4N49A 3T12A 2QROA 3NHAA 3QLJA 5KX5F 1I01A 2C2ZA 3TQQA 5IDXA 5K8UA 1JW9B 3L7YA 5D6OA 5JW6A 2HY7A 3SZOA 3HNOA 5A0VA 5JS2A 2QE6A 1OWLA 4DFDA 1PR5A 2O8BA 3VU0A 4D1YA 2C42A 3EBOA 1KXJA 5C52B 1VSUA 1MTZA 2MIIA 4P5DA 1YQQA 2FEOA 1VBFA 4Q3OA 2B30A 4CT0A 4D6PA 3K2BA 5DHSA 4H08A 3OU6A 5TVKA 4Z3OA 1HEUA 2W6OA 1X1CA 2O3JA 4L72A 3WB0A 2IL1A 3IIJA 3Q12A 1DVRA 3VYTB 2C8JA 2XSZD 4U9HS 3W8DA 3ABOB 2FWMX 4MV7A 3S40A 3HMQA 4R98A 4E0BA 2YMQA 4P98A 2YS6A 4IICA 3VNQA 5CLQA 4BUJA 1L1QA 1EUDB 3JVDA 2GLUA 3NGXA 3PRHA 3CIOA 5CK5A 2ZXEA 3NKLA 4F2PA 4O3MA 1EK5A 2A9RA 3AEXA 3T5GA 4E4YA 1VRVA 1QO9A 2W2QA 1Y7LA 3IODA 4Z9YA 3C8ZA 1H0HA 1P4AA 3OLXA 4LTNA 4JL8A 2C0CA 4URUR 5BSWA 4NJEB 2XX3A 1EXDA 1NFFA 1LSSA 3F5FA 5EZYF 2H7XA 2NSLA 3AUKA 4YLYA 1PW7A 3U61B 4JJ8A 1NVFA 2NO9A 2P2NA 1SOUA 1XTJA 1S9HA 2TMDA 2OPHA 3FROA 4CU5A 5T8KC 5F73A 3IA2A 2JANA 5IN5A 2PY6A 4U2GA 3OPYI 3FCYA 5TS2A 5GZ1A 2OAQ1 1EFAA 2QYHA 2PH5A 1FX1A 1SU7A 1XTUA 1J6UA 2AZ4A 4TUYB 1RZVA 2DUNA 3QKSB 4H6XA 3TB4A 4AMZA 4OUDA 2VUTA 4DMHA 5EQDA 4RX1A 1NXSA 2OO5C 1I30A 2JFQA 1ZRSA 4IVPA 1NKSA 4R2KA 2IUUA 1WVIA 3DD5A 3SDZA 2VZ9A 3QA3E 1NFRA 2PBFA 3UAVA 1IH8A 4WOBA 4EELA 4UHFA 5EJ2A 5TMEA 2HT1A 1ZHFA 3RYHB 3D5EA 4RLSA 5M3BA 1HT0A 1XYVA 1NUHA 3AK4A 3F6CA 4LOHA 3UHOA 3PDUA 3VYVA 1EDDA 5BWLA 3D2LA 3INYA 4EI2A 3SIWA 3DHWC 2OOKA 4US2R 3K70B 3COVA 3EODA 1MORA 1PDOA 2VZLA 2ZUVA 2GZ3A 1GTL1 1VHQA 4K87A 4KP7A 4CDGA 3MGKA 1RADA 5MN5A 4O1IA 5LA6F 4L4YA 4XYBA 3H5VA 2AQ8A 2WMYA 3D6UA 3HA7A 3KKMA 1VTKA 5TS3A 2JLWA 4MQFA 1I3LA 2FEMA 2JIBA 1NSYA 2OV6A 2QUJA 3GJRA 1TQ2A 1ZU4A 4JOCA 3EIWA 3JWJA 1IHDA 5JRZA 4DNQA 5JHHB 4UCFA 2F9MA 3GHYA 1B26A 2WUDA 3CINA 4AK9A 2PBRA 1D2NA 1PV1A 2AF4C 2YXLA 2NPFA 1TKRA 3MJRA 3KYCA 4MW7A 5FP0A 2HPZA 3OTIA 4E5SA 2GNPA 3IVXA 5G4KA 2NGRA 1XK6A 3DL4A 1WXIA 5CURA 1JSRA 2J3MA 5AJYA 4M1TA 1L5HB 3OJ0A 5G3YA 1NN0A 4QYTA 1P6QA 2Q1YA 4UTOA 1NATA 4WJKB 4FFSA 4M7OA 5A9SB 1VLHA 4E15A 1EHCA 4HXGA 1TU3A 3CKMA 4UKDA 1YS2X 2GRAA 1CRLA 3HFSA 2DHEA 2JBAA 3KAPA 4O4IF 4GKKB 4N6NA 3ZY5A 2IYPA 3SHQA 3WIDA 4WEOA 3QXXA 1V5WA 3L7JA 1AKQA 8AT1A 4GNRA 4GGMX 4EB8A 2Y0BA 4R05A 4HEJA 3NCTA 1QS0A 1VG0B 3CRW1 2R60A 3PFIA 2C5GA 3KTDA 4KMSA 5CBPA 3LNCA 5L51A 1OFVA 1QOZA 4X1KA 3DDHA 3ZDBA 2ROQA 1FXWF 1O5TA 1E3WA 3T3MB 5J4VA 2Q99A 4ZRMA 1GPMA 4NL4H 1HL7A 4FGWA 4PBSA 3DTTA 2ANCA 1E1CB 1R8YA 2B5OA 2ZAOA 3K94A 3RS8A 3VTAA 4ATNA 2OXRA 5LUBA 4HTAA 4AP6A 4QLBA 4U7HA 1EGVB 5GINE 2A59A 2D0PB 2CLFB 2ZUSA 3O82A 4Q9HA 3NDPA 4JITA 3T9DA 1PUIA 4AO8A 4MS3B 4FMDB 3DDNA 3HUEA 1RKUA 4QDXA 4YLEA 4EF6A 1E2DA 1LBQA 2QUHA 5E7JA 5LPNA 2Q9BA 4GU5A 4EBFA 2XMGA 5B55A 1TA9A 4EARA 1UBFA 2J3KA 2A88A 2HU2A 3CWZA 3SBDA 2VXBA 4OUKX 5DWQA 3SDBA 3ZE1B 2CLLB 1SZPA 4FDMA 3C97A 3RU7A 9LDBA 3VO2A 1G63A 4J7UA 4A0FA 5BQXA 2ZRJA 1Z4PX 1DQZA 2FXVA 2TECE 2XLBA 1TUEA 4QDUA 1UMCA 5K3SA 1YC2A 2JGDA 3JYHA 4S05A 1E0DA 3N3AC 1YULA 3ST7A 4XVRA 1A8SA 1NAIA 2XZPA 3GOQA 1LBTA 1LA2A 2J9ZB 2VLIA 3BHNA 1ENZA 4GYYA 4XQGA 1XAJA 3U4GA 5JY6A 1Q1QA 2V6GA 4CT4B 3OLCX 4CMEC 4OGGA 4TSKA 1QZZA 3KUKA 4IP0A 1U9CA 1E2FA 1B23P 2VWGA 4EHJA 2CNLA 3MGCA 3DR5A 4Y2VA 1N6HA 3HUFA 3CKYA 3E1GA 1Q0LA 3HZRA 4FDVA 1ELOA 4BLOA 5K8LA 4M0LA 4R71A 2V9CA 1T1GA 3GAMA 1G9TA 3D5TA 4G23A 4L5JA 1W5BA 4IO0A 2ZTMA 1H6BA 3JQCA 4DC0A 2ZBFA 2H1WA 2FFBA 5B2ZA 2X5KO 2OK7A 4XUDA 3I12A 3HY4A 5BP7A 1K8ZB 5LXTB 4RENA 1W52X 3OJXA 4K9RA 4UD6A 2W0MA 5HZKA 4J0EA 3VKWA 1DTWB 3GXOA 1BYIA 2YTZA 4XGIA 4YCLA 4RY8A 5DYWA 2JCYA 2P77A 4H7KA 1QJCA 3QJ5A 2ZB4A 9MHTA 1V45E 3IUJA 3V1NA 2QNRA 2YXPX 3H05A 2W6ZA 3PRYA 4I55F 4LZPA 2OYSA 1L4LA 4RADA 1WMAA 5JMPA 4CMHA 2BIFA 1TAQA 5HJ7A 3FA2A 3TJRA 2YYZA 2J4CA 3AR4A 2EWMA 3DBLB 4L28A 5HYVA 4UM5A 2VNJA 1I32A 4II7A 1OGJA 3ZHUA 2FPOA 3O2QB 1P62B 3HDGA 3HU1A 3KT8A 5A6SB 2GJ9A 2LIVA 5FXMA 5J9FA 2FPPB 1G21E 2AKAB 1KYVA 1ZP6A 3ESXA 4LBWA 2UYHA 3DR3A 4HFJA 3A4MA 4HQRA 4JI7B 2WTAA 2VDRB 5JAZA 1YRYE 4JKYA 4JGGA 1S7CA 1Q7BA 2G82A 3F4KA 4F85A 4GL2A 1S8OA 1GRVA 3CF4G 2B3TA 2ZVDA 2F3UA 3AOEA 3LOUA 4J0QA 4QFCA 2GEVA 4XWWA 4WK6A 3TWOA 3KETA 3MZ0A 4QQNA 3S81A 1PEAA 1CUIA 3JQAD 2OCBA 1WPXA 1N5IA 5JVDA 2VJQA 2P9JA 3EG9B 2PNJA 1YZKA 4GZ6A 4QVKA 1TK3A 5DIZA 2G71A 2DY0A 2IIVA 2X76A 3K2EA 3VVLA 3HXKA 3JRXA 4C5CA 5ED0A 3PHBE 4ZVRA 2XQFA 4FQ5A 1IIRA 5JNRA 1YZTA 2HSZA 2DM6A 2JLSA 3ROPA 2OPBA 1FFHA 5K4AA 2ZQ5A 1BWSA 1Q7CA 4O3FA 4CG0A 1MC5A 4EMUA 5TDHA 4I46A 2J46A 2VK8A 3ZY6A 4N3NA 1DAIA 3HKEB 1VHJA 4LA4A 2BSQA 1RU3A 4GICA 5CDGA 2QUZA 2YWBA 3ZZ1A 1KPIA 2MR6A 2Q6KA 4JXZA 1DKNA 4TYWA 4Y6PA 1E1NA 1GGMA 3H87A 1ZOIA 5DP1A 1U2EA 3INTA 3VYRB 4C3VA 1E20A 3FXAA 3D4PA 1UXHA 5K0SA 1DEOA 3F67A 2WYIA 2G5PA 1KTVA 3RM3A 2IFTA 4ERXA 5KYWA 3L46A 3A1VA 4CF5A 5KQPA 5F1YA 3U16A 4JX9A 2J0UA 3B5JA 1T0JB 2YMLA 4LI3X 4KO4S 4CLOA 1EVIA 3WLKX 4DKJA 4N5MA 1NWHA 2HSWA 3TCKA 3TSYA 3GA7A 1Q12A 3PUIA 4WGFA 4BJ3A 4XASA 1X2EA 1JT2A 2AX3A 3LO8A 2ENWA 2AOUB 3GN2A 4U7TB 1LPNA 1T0UA 1J0DA 2OCXA 1CNMA 4BIIA 4HGPA 4EF4A 5C8YB 3RAFC 4F9EA 2RH4A 3HKDA 3R3VA 2HCBA 4WI1A 2GHTA 2Z30A 3O8DA 4AJNA 2JGEA 3INRA 4YQFA 3PTAA 1SUIA 1KERA 4K6CA 4HGOA 4EFKA 4IYJA 4NH0A 1UP4A 2RMKA 1IY8A 1T9CA 1R16A 2YWHA 4XOIA 5DNVA 3S8MA 3VHQA 1GM5A 3GEIA 1OBOA 1RW4A 2JJ2A 4H1TA 4RHYA 4CG3A 4FR0A 3GLGB 2R44A 4FJ0A 1IMOA 1IWOA 2QYSA 2WICA 2OILA 2WSSD 3GZTB 3HJCA 4H27A 4RK7A 5LQCA 3VDXA 1IAQA 4BX3A 4G0OA 4XZ3A 3BCRA 3B53X 2ATXA 1UODA 1X7YB 1ODLA 3LFUA 3AKDA 4PC6A 3WXBA 3DKVA 1Q3TA 2I1LA 2CCGA 1XUOA 2GPJA 3N5CA 1AF7A 4M1KA 1MX3A 4MRMB 4WX2B 1RI5A 4DMUB 3IULA 1U80A 2YDYA 2A9FA 1O89A 1K8YB 2DH6A 1UANA 5EY5B 1VPVA 2ICAA 5E9WA 1ORIA 4BJ1A 3SYRA 2CBXA 3Q3VA 4GF5A 3IR6A 1WDLA 3K0FA 1HNWB 1WQ1R 2IDJA 3CYFA 3OQBA 2JK1A 3KLBA 4EEKA 1CEYA 1CZUA 2BEUA 2H4WA 4MLZA 4PSDA 3AW8A 4BO0A 3P4XA 2EP8A 3LX4A 5KWIA 4MIEA 1Z3IX 2AOTA 3HJAA 4ZCIA 4RPGA 5K8IA 1OOEA 4XWAA 3REGA 4RTRA 1P2BA 2YWFA 3SFZA 2V6IA 3JY6A 4J49A 1NQXA 4G8DA 4WFQA 5AKIA 3TOVA 2WC1A 4C0XA 4GAEA 2I65A 4QXRA 4EHAA 4ZZ2A 1THGA 3DEIA 4V0SA 3FLMA 5SYMA 5LL6P 5AUOB 1BROA 4JEUA 5ALPA 5FWXB 3T7CA 3V3TA 3SZUA 1KYWA 2ZYUX 1FCJA 3WX0A 4MIYA 4CNQA 4F84A 3OCUA 1UFRA 1U1EA 1ZUNA 3LP8A 4QARA 4IXDA 3V32A 3T5PA 1M0WA 3F7MA 3N8HA 4ZC1A 2O2GA 3SJCA 1ISMA 2RGAA 4UEWA 4WFIA 1QX3A 4RTKA 5CIQA 2ZE5A 3E9ZA 4URYR 5CNKA 4R0MA 4F92B 1NIPA 1WMDA 3KQLA 4AG5A 5A7GA 4FYJA 1OZAA 4MKRA 4MYCA 3RT1A 1DBIA 1F2UB 1VG8A 1H94A 1XTPA 1YBMA 4HR7A 4TXLA 5FNZA 3WRVA 1QLWA 2WYHA 1AGYA 4PCLA 3UJ8A 3ZLTA 1AHPA 5ARBA 4C4XA 2LNDA 2DZDA 2C7QA 3ZLVA 5AW6A 1OC4A 2EIXA 3RTBA 4QUHA 4FT4A 2GK6A 1QH9A 1T5OA 1U0EA 1W85B 1Y80A 1ZIPA 3RUIA 4Z51A 3UCEA 5IRCD 4DPMA 3OZXA 1XDDA 4BO6A 2ZUBA 3TK1A 1RHUA 3B85A 1O5OA 3OY7A 4XDZA 1BMDA 3EGDA 2F3TA 2X8JB 3GG9A 3HCFA 4JI5B 4PO9A 3EIFA 4C4AA 4EB6A 3UMMA 1JLLB 1QHFA 3ZVMA 4LPSA 5LOVF 1FVXA 3EE6A 3QQPA 4KV7A 3QBTA 1OYVA 3FBGA 4ZAZA 4HNUA 5DISB 4QQRA 5AJHA 4DIMA 6YASA 2BKVA 2MSDB 2WMNB 2FN9A 4X60A 1RQGA 2RHJA 2WFLA 4DDMA 5H5JA 1E8DA 3O84A 4GX1A 2FMHA 4BLTA 3G2QA 3ZTYA 1K6JA 4IUCS 2XYPA 1CUCA 1G41A 3F1KA 2XZTA 3OY2A 2OCGA 1OI7A 2BMEA 1G8KA 3ECSA 3VV2A 3W5UA 4EQ6B 5KNBH 3HM2A 2ZBQA 1RKXA 3GA0A 3LF1A 2J5XA 4QSHA 2PMEA 4DQLA 1QIGA 1ZC4A 3SZMA 1Z4IA 2JLZA 4J0JA 2BWJA 4DBLE 2FSHA 5K3DA 2AFRA 1DLJA 4DVJA 2A94A 3TB6A 3O38A 1NOKA 4YAUA 2CV0A 2ZM6B 2CJWA 1SHLA 3HNPA 3V1KA 4QRIA 2P3OA 3NZEA 5L3VA 2ZANA 1VIYA 3PDCA 4ZI5A 1XN1A 2G5TA 1T6NA 4RANA 2V3CC 2ZYAA 3F5SA 1B74A 5F23A 1RWNA 1WUHS 3HCPA 3PFNA 4OP3A 4WESB 4Y9DA 1OLUB 3NORA 4I3FA 1E3EA 5IVKA 1A76A 1KAGA 1YI1A 2PRIA 2RI0A 4QUJA 5LVAA 1P2SA 2G36A 2R66A 5EKSA 3T1OA 2P4SA 3SLRA 2D74A 3KVOA 1F51E 2HN9A 3A9SA 3AJRA 5AXBA 5LQNA 2E5LB 3GDHA 5AQ1A 3U3OA 2FJ0A 2YKGA 3M6LA 4MS3A 4ZTUB 2Z6UA 1YFZA 3IMFA 3L0SA 4X1IB 4UZSA 5HS6A 2OZLA 2RHLA 1PU2A 2V7BA 3ETLA 3SSMA 4MS1B 3W5VA 1ZJWA 5P8WA 3C85A 2O4CA 3NIGB 4LOJA 4Q9LA 1FNBA 3EVTA 5HE8A 2B83A 2VT2A 3L7CA 4AUEA 2X5OA 4KGXA 3R7SA 2OFPA 3IQHX 4A03A 4W1RA 1EG7A 3DZGA 3IB3A 1FTGA 3RREA 3V8RA 3ZK8A 1TT5B 1PL6A 2VNSA 1TTTA 2CL6X 2JLVA 5DLQC 3DOUA 4E09A 3B1JA 1OMOA 3G2NA 3BEOA 4C0BA 1GTG1 4Q37A