4HDOB

Crystal structure of the binary complex of krit1 bound to the rap1 gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
163
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krev interaction trapped protein 1
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 163
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdoB00
3PIRA 4Q1CA 3PV0A 2JDID 3W6NA 5JS7A 1J70A 5JRZA 1G8HA 2C9OA 3WRYC 3ETLA 2IS2A 5CM9C 3KUCA 4I1SA 1U90A 3K9NA 1IQPA 1KOFA 3NXSA 4W5HA 4AURA 6Q21A 3U5ZB 2FPLA 3F0TA 2ZSDA 4HYYA 2BHRA 4HZIA 4V0LA 2WSMA 2AXNA 4FMDB 3KDSE 1E2HA 2XSZA 1DEKA 5AUOB 4DEXA 4Y0VA 3QOFA 2VA8A 1OH6A 1GKYA 2OESA 2W6JA 2F43B 4JLJA 3IBYA 3SI7A 1GDDA 2QQEA 3B78A 5LPNA 2JEOA 4KU4A 2W6IA 5FTLA 5F2EA 3K70D 3FKQA 2XB2A 1KO1A 1F2UA 2CVHA 1IM2A 4LYFA 2IWRA 2H7VA 2J7KA 2QP3A 4A82A 3LW8A 1VIYA 4PQYA 3B1YA 4LWZA 2X8AA 4AG5A 2Y8EA 1YHNA 3TR0A 5JLJA 2IW3A 1JJ7A 1NMYA 4BLRA 4JBXA 3FMOB 5M04A 1OXXK 3WHKA 3VNVA 4IDHA 1GTVA 2YWGA 4IDPA 1ELOA 5BYJA 5LD2B 5H8WA 1SXJD 5C2JB 2DWQA 4FMCB 2YWFA 3AF1A 5FOVA 4MGIR 4LJ6A 1KSGA 2CCKA 3U4QB 3B1WA 1COWA 3H2YA 4TMKA 1D9XA 1UEIA 2IUSA 3CRMA 4DUGD 5CITA 2ZRPA 2OO7A 2YC2C 2ZRIA 3Q8XB 3TQCA 3VR3A 2GWHA 1T8UA 3GLIA 2Z6VA 2ZI6A 4BWYA 3BFKA 1G3RA 3B60A 2F7SA 2H92A 3QKSB 4JKYA 1Z6GA 3I61A 3B1XA 4C0HA 4ZKDA 1NJGA 1SVLA 2WMNB 5JMTA 2ECKA 1FX0A 1Q44A 1XP8A 3IIMA 4RFVA 4URWR 3HP1A 4QM6A 1XEWX 4HAXA 2G1JA 1JEEA 2HCBA 4B6EA 4JL8A 5JECA 1XB2A 3ADBA 1IN6A 2WICA 1GL7A 3TAHA 3X1ZA 1G291 2HUPA 4F92B 1EWRA 4OJQA 4TYPA 1LFDB 2ZI4A 3IO3A 5BWMA 1FP7A 4GZMA 3U6KA 3THYA 1W5SA 3CPEA 3FE2A 2J0UA 1KI2A 4A0FA 4BFXA 4P33A 1P3JA 4LPKA 4NP6A 2IC5A 2JLXA 3A4LA 4HLUA 3GJ4A 1EESA 1ZU4A 3W3AA 3FHTA 2SHKA 4XJXA 3DL0A 4TT3A 3K0FB 1Q1ZA 1VDZA 4LY6A 1N0VC 1QZXA 3BD9A 4F4CA 4JLBA 2FN4A 1E9FA 1OXTA 1WF3A 3SR0A 3KQUA 3LBNA 2ZIAA 3FHCB 4C0BA 1W0KA 1FMJA 1KO4A 2DY1A 2EFGA 3D7MA 3ONWA 2JATA 4Q03A 3VR4A 4CVNA 4UNSA 1EFRA 5HE8A 1X8LA 3HWSA 3PEVA 2C98A 3TUIC 1E2NA 1S1MA 2QP4A 1W36D 2WWXA 3DPUA 5EZ5A 2L0XA 3TGPA 1KAOA 1FP6A 721PA 1AK2A 1E9EA 3JZMA 4UNPA 4BPBA 1HE1C 4U7DA 1DVRA 5KNDA 3MD0A 2ZI9A 1KMHA 3CX6A 4CDGA 2QBYB 2XXAB 3M4YA 4D4LA 1KK3A 1HH4A 3K70B 1QF9A 4B3CA 4PO1A 2AWNA 2G0NA 4KFRA 1Z83A 3KL4A 4RZ3A 2OCYC 1XD8A 1SZPA 4D2IA 3MGCA 4BFUA 5KUTA 1XPOA 4PC7A 4MYCA 4ACBA 3B2EA 1T5LA 3KJGA 3U7HB 1A82A 1XTSA 3NTUA 4ON9A 3NKVA 4B2LA 2YOGA 3SS8A 1FUUA 3Q7PA 1EX6A 5CDFA 3T1QA 1SXJE 1SXJB 2VP0A 3LVQE 5FUYA 3I72A 1IN4A 1N6OA 1R6BX 3L2OB 3UMFA 2GXQA 4ZDIA 4CIDA 1GVNB 5B2ZA 4RCYA 5ELXA 1KI6A 4CEHA 2W2TA 2OEPA 4TLDA 2WPDD 4Q00A 2XEXA 1XNJA 3GQBA 1L7VC 4TSFA 3R8CA 2FNAA 4A6XA 2R6GA 2NO9A 1JJVA 1I4TD 1MABA 2HEIA 3PJRA 4RD4A 3HJNA 1P61B 1XRJA 4PHGA 1OB5A 3REFA 5IHPA 3EC1A 2FG5A 4NBSA 2J0VA 3OFND 4PSAA 2PL3A 3BFXA 2FX3A 2W2VA 4Q02A 3A8TA 3BGWA 1KK0A 1TQ4A 3P4XA 1HT1E 2BEJA 2CXXA 1TQ6A 5FH9A 1UBEA 5FBWB 1I2MA 3GFTA 1ODFA 1X8JA 2WJVA 5G53C 2ODEA 3DDCA 3GLFA 3K8YA 1M6NA 3JVVA 4RD2A 3AVVA 4G5QA 3I62A 3DEFA 1DELA 2ZAOA 1R0WA 1CRPA 1P75A 1OIXA 4RKFA 2VYFA 4BASA 2QM8A 3FPAA 2UKDA 5EXPA 1OJLA 4R71A 2R8RA 3EASA 2BOVA 3VKGA 1ETUA 3S1AA 4A8JA 2BJWA 2WOJA 2PEYA 1NN0A 1DG1G 5ANRB 3AH8A 3CZPA 5FI0B 1DARA 3W6PA 3MG9A 3U3KA 4AYWA 5HZKA 1JBKA 4TMTA 2MSDB 4JL5A 1SVWA 2D7CA 1N5JA 2W6ID 3RS7A 4BRWA 4ESHA 4B71A 2VIIA 3P20A 1OH8A 1S3SA 3CM0A 3TIFA 4HLQB 2NZ8A 4HZUA 4BECA 2W0SA 1NBMA 1T4GA 2E1RA 1OFUX 1P6XA 2R62A 5JCZA 4HI0E 4V03A 4EQ6A 3Q5DA 1VKJA 2GBLC 4GOKA 5C4MA 2GVZC 2QAGC 2G1KA 2VHJA 2GBLA 4NDZA 4PANA 3L0SA 2QAGA 5FUWA 4C4PA 2Q6TA 4LCBA 4ZV4A 1C1YA 1E2KA 3ADKA 1UF9A 1Z6AA 2BWJA 4PHHA 1HQCA 5CLLA 3DZ8A 3AKYA 2BMDA 1COWD 4BFWA 3VMFA 4PPGA 3WY9A 2V6JA 3QNUA 2JAQA 4QNRA 3UG6A 2C8VA 1XEFA 4Q1EA 4CEIB 1Z3IX 1IY1A 4U5XA 2Q3MA 1F3OA 4JS0A 3LH5A 4TMZA 2F43A 2QUZA 3HU2A 2CLDX 2X2FA 4A0HA 1Y3AA 1NVWQ 1VCNA 1P4SA 1A1VA 3VU9B 4LJ4A 2OE2A 1JECA 4M1MA 2BKUA 4TTRA 1ZC3A 4YC7A 4JLNA 5L3VA 2IYRA 2Z4RA 4MRVA 1KI1A 2O0HA 5DHAA 3V9PA 1XTJA 3PG5A 2DFLA 4F7WA 2Z83A 1G3QA 4MH0R 1MRSA 2EYQA 1Q3TA 4G3XA 4BZQA 5LD2C 4TZ6A 2ANBA 4KHZA 4D6PA 4XTRA 1E99A 1T3SA 1G7SA 5JSZB 2I3BA 3LY5A 4BFYA 5IRCD 3K09C 2O52A 3I5YA 1W4CA 2MMGA 3U4QA 3AGPA 1KNXA 4MQBA 2AWOA 3K09A 3C14C 4UNRA 4ASUA 2GJSA 2R9VA 2J87A 2RH5A 1VYVA 3IEVA 4YXWA 1E9BA 1NF3A 4A2QA 1KI3A 1K5DA 2BIFA 2OV2A 2IT1A 4Z8XA 5J40A 4POAA 1HTWA 4TYYA 4JBWA 4JVLA 5FL3A 1Q57A 2VHTA 4B44A 4HDQB 2RGEA 3QKSA 4M9QA 1W0KD 1Z07A 3MSXA 3ZS8A 4TL9A 4TYWA 3T1TA 1R7RA 3NH6A 4QGAA 1G8PA 1L4YA 4EAQA 1LV7A 1ZD1A 2YV5A 3B1ZA 3GCGA 3FKSA 3ZGXA 2PZEA 4OQFA 4V0ME 1OHHA 2ZRFA 3I5XA 2P5TB 1YVDA 2ONJA 4QKQA 1RJ9B 2FWRA 3LD9A 1T91A 3RVBA 1E9RA 4UXIA 3EZ7A 5K8UA 1IBRA 3AM1A 4URXR 2RKOA 1YE8A 2PEZA 2R44A 3EIQA 121PA 1AN0A 1OW3B 1KK2A 1KSFX 2NPIA 2R2AA 4HAZA 2CNWD 4F4JA 3EX7C 2JA1A 4DSUA 5CM8B 2C78A 2FDCA 2OXCA 4JZKA 2HXYA 4PPQA 2LCFA 3ZIAD 3FGNA 3RS0A 3HDTA 1MR3F 4MUAA 1PJRA 4XVUA 4PFSA 4V02A 4KLZA 1JI0A 3K0FA 1QDEA 1G8GA 4ZDWA 4PHTA 2PJZA 1O87A 3QXSA 1U8ZA 2I4IA 2JDIA 3KXKA 4BEJA 4ITRC 3ZVMA 4EJSB 1X1RA 4TMXA 1E2DA 1NMZA 2ORVA 3TNFA 3MWJA 1N3BA 1NJFA 1P9RA 2NO6A 3K0AB 4FCWA 4M1TA 1EG7A 2H17A 4YMTA 1RPZA 3RC8A 2GCPA 1R2QA 1GUAA 2BMFA 5KHOC 2XTZA 2ZE6A 2GEUA 5KSOA 1QVRA 4MRPA 1MO3A 1WCV1 4LBWA 4BLTA 5KYKA 4NKRA 2ZVQX 5E7IA 1OSNA 4GT1A 2NO0A 4O2LA 2BV3A 4IOKA 2OLKA 4F4IA 2IHYA 2ZRDA 4PAOA 1NVUQ 2OILA 2J9RA 1E2QA 2QBYA 2XXAA 3K70C 2H1LA 2GVDC 4ZO4A 1E4VA 4AYTA 4FXPA 4NU0A 3VNUA 2QM7A 2GA8A 2XZLA 3C41J 4OK3A 3FMFA 2KBEA 1XCMA 2IXEA 1SULA 2ZRAA 4URUR 4GP7A 4IHQA 2J41A 2IHBA 2GF0A 3NG1A 1MO6A 1NLFA 5SZHB 3BFVA 2IS6A 1II0A 3K0EA 3AF3A 3R20A 4PX9A 1OKKA 3ZVLA 5EXSA 4Q1DA 1NG1A 3SJBA 1E96A 3GFPA 1UKYA 2IYSA 4KCGA 1Z0AA 3Q5EA 3TW8B 3QXXA 3DKPA 1XMVA 2B7CA 2ERYA 2IS4A 1SXJC 1KZ7B 1XJ0A 2Z0MA 3WMEA 4DCTA 1HEIA 1SXJA 4ABYA 4QFMA 4Z51A 3X1XA 5CYPA 2GJ8A 2QORA 1G4UR 1VYUA 1E4YA 2ZRBA 1QHHB 1TQDA 3HPRA 4DUGA 5AJVB 3V00A 1IN8A 1NN5A 3PEUA 1XBTA 2FEOA 4PC3A 4WA7A 4M2LA 1IY0A 4DLWA 4IOLA 5C1BA 2OHFA 1YR7A 4D80A 2QU8A 1CF4A 3AF2A 3D8BA 4WOPA 3MWKA 1E9SA 2H18A 3NHBA 1FZQA 2REXB 1KI9A 5J4YA 1SVOA 2YNMA 5GJBA 2CHGA 2D06A 4W7SA 1NL3A 3QXCA 3HYTA 1VIAA 3ADCA 5C18A 5JFGA 3LBHA 4Q9LA 4YDHB 1P2UA 1AGRA 4GOJA 3NEYA 2BMEA 1F5NA 2CLCX 2D7DA 3TQFA 1TUIA 3W8RA 3VX4A 4MYUA 521PA 1R5BA 2QAJA 2FSGA 3K9GA 1YRBA 3WBJA 2XZOA 2ZE7A 3A37A 4JJZA 5H70A 2GCOB 1KJZA 4O25A 2FGKA 4RZXA 2VH5R 5SZJA 3RSLA 3WNCA 1Y63A 1KMQA 2VP4A 1S9DA 4WXRA 4RD0A 1JQLB 3QEOA 5EP3A 3AVUA 2YKGA 1K5GA 4DKXA 2GZHA 1XDBA 2WKPA 5FBQB 1LF5A 4QBIA 2AK2A 3GJXC 4B43A 1F48A 1U0JA 3UK6A 1LTQA 2J7PD 3AB3A 3CNNA 1AQYA 1ZRHA 3NH9A 3VKWA 2WZQA 4Q9IA 2WMOB 1ZW6A 5JHHB 2AKAB 4TTPA 2V7QD 4KBFA 2NZJA 5CK5A 2ZS7A 4B3BA 5CB8A 1Z2CA 1W36C 3T12A 2QENA 3QG1A 3BB3A 2Q9AA 3UANA 1MT0A 1FQJA 2ZR9A 3SBDA 221PA 4LHYA 1Z63A 3B85A 3KTAB 1SVKA 2GESA 3IO5A 4V0OA 1NP6A 4BFTA 1WDTA 3C7KA 1PLLA 2ZE8A 2Q3FA 5J4KA 4JT2A 2PX3A 1EFTA 4Q1FA 2MSEB 1ZINA 1OIVA 4KXFB 2P6NA 1BS1A 1JAIA 2AKYA 4UJ5A 5DGXA 3RRMA 5KPDA 4DCUA 5KSYA 4NCIA 3TK1A 4IRUB 2VEDA 2IF0A 2VLIA 1DAMA 4ASUD 1DPFA 2AX4A 2VHUA 2XNDA 2WIBA 4LBVA 4YXWD 2AK3A 3K9HA 5TB5A 2FU5C 4JJKA 4XWOA 1FUKA 4CEIA 1E1RD 3K53A 1TU3A 3ASZA 4URVR 4LC0A 3BERA 2O0KA 2XGJA 4BRUA 2OCBA 4E09A 4ESVA 4JLDA 3BJIC 3GEIA 3I32A 3N2EA 1M34E 2ZRLA 3DO6A 4Z8YA 2V4ZA 2I1VB 3CB4A 1U81A 2AHOA 4NL4H 3B9PA 4AKGA 4I1OA 3R7WB 1G4AE 3ZD6A 4LYJA 4RD3A 4NCHA 3VU9A 3KJIA 3TW4A 1T8TA 3TKLA 4LYHA 4NCNA 3FKSD 2ONKA 2IA5A 2LKDA 4DB2A 3QY0A 4CGZA 4LJ9A 1A7JA 4UQOA 1CR2A 5SZIA 1E1QA 4XWKA 2ZYVX 4IFBA 3F3YA 4C0AC 3RWMB 3CWZA 1YZQA 3CNLA 2VL7A 2ANCA 4KITB 1ZM2A 5JHGB 3VR5A 2BC9A 1RKBA 4OI2A 4XD7A 1BO6A 4RJLA 3OESA 1TEVA 5JSZA 4QHTA 1OE0A 1T9HA 2F1RA 3W90A 4TYQA 3IQWA 3FOZA 1YR8A 4U02A 2RHDA 5F3WB 4NYMR 4PC6A 3OFNA 4LGMA 4BZPA 4NONA 4B76A 1ZD8A 1UPTA 5EE0A 5FPTA 5G3ZA 2KWIA 2NO1A 4M8NE 2ZS9A 2PMKA 2GK7A 1S4QA 1L4UA 3IPXA 4IXMA 1T3HA 4JMPA 5DYIA 5GJVC 1U8AA 3TSWA 2VQSA 4TLEA 2Q21A 1NIPA 3C5CA 2ZRCA 5AK0A 2UVQA 4KFSA 1KDRA 3MJHA 4DDVA 4B35A 1UDWA 1GNPA 2DHRA 3ZD7A 4IKEA 4LJ8A 2IEZA 4AC9A 1CR4A 2A5GA 2IYTA 3WRXC 4WZAE 4E5UA 1ZMXA 1SVIA 4RCZA 1DADA 3BRWD 4FWIB 4V0MA 4HSEA 2NMVA 5TARA 1RJ9A 1WA5A 4OBEA 4TZ0A 1KO5A 3FVQA 2ZUDA 2PH1A 4LHZA 4Q19A 2P6UA 5TDHA 1AM4D 2CL0X 4ZKEA 3X1DA 1NVVR 2HJVA 1OV4A 1E32A 4QOSA 4Q1AA 3W5JA 4Q1BA 4LV6A 2JJ1A 1R0YA 5L3QB 5JWHA 5KPJA 3BOSA 1XD2B 4XH9B 3MJRA 2C77A 4LUCA 2CEAA 3SFVA 4LJAA 4MDFA 3GLGE 4LHXA 4M4SA 2HT1A 4R2IA 2ZSFA 2IX3A 3GLGB 1OKKD 4EJSC 2A30A 3KUDA 3L0PA 3CONA 4DLUA 4OKSA 3KKNA 4FI3C 2Q9CA 4EJSA 2ZYUX 4FD2A 2R6CA 1NLZA 2V8OA 1E2IA 3K0AA 1G7CA 4D26A 4OI1A 4PC2A 3GLHE 3CR8A 1ZIPA 4UKDA 3TSZA 1ONBA 2GK6A 4DBLC 4TL7A 1N6NA 3GLHB 2VHQA 4D0GA 3NIBA 2FGJA 4Y0AA 4B73A 4M9XA 5JEDA 1US8B 3RS2A 5AJYA 3Q9LA 2ZTSA 5L3SB 1GRQA 1SHZA 4HATA 2A5YB 3N5CA 1DO0A 3QPWA 1KIMA 1H8ED 2FPMA 3ZS9A 1OXSC 4KLNA 3LLMA 5JJIA 1GL9B 1SKYE 2QPOA 2ZUBA 2NG1A 3AV0B 3BWDD 1Q21A 2QT1A 1SKYB 2WV9A 1GKIA 5EUMA 2W83A 1DAIA 3QQ5A 4G5GA 4S35A 3EIHA 1GSIA 5KSZA 3VR1A 2DFKB 1GNQA 2FEMA 1UEJA 4OK6A 1G9XA 1HA3A 4XSHA 3ZLJA 2FZ4A 3Q85A 1LW7A 4GP6A 2W00A 3PUVA 4HAVA 4TQAA 3AVQA 5IT5A 1G21E 1EFHA 4TLAA 4HLUC 1UBFA 5CYOA 1IJEA 1KSHA 2RGAA 4R9UC 3DVLA 2FSHA 3RABA 5DIFA 2CDNA 4C9BA 1QHHA 3ICQB 2ZROA 3I1FA 1PVOA 2XTNA 3DMNA 4IJMA 4N0EA 2CCGA 2QMUA 2ATXA 1D2NA 4H1UA 1Z08A 2ZSAA 2W58A 2CK3D 2GF9A 5FOUA 3NBFA 5BYKA 4PZLA 1W2GA 4G5OA 3O47A 5FI1B 3Q7QA 3LV8A 3AKCA 1IXSB 5CLQA 3SBEA 2ODBA 2X2EA 1ZIOA 1ZC4A 3GMTA 3KB2A 2WSSD 1NNEA 4DWJA 3RNLA 4IDOA 1W44A 3SJAA 4N0DA 1OIWA 2KB0A 4C3ZA 3EAQA 3ECCA 3UATA 1W7AA 4US2R 3T35A 4OQLA 3T15A 1H65A 2BEKA 3WYGA 5EXXA 2O8CB 2CNWA 2NOAA 2ZE5A 3BE4A 3RRZA 3ND8A 4FINA 2JLWA 2WJYA 1GFIA 2GCOA 1KKMA 4NYJR 3DOFA 4M9SA 3ZIAA 1E0JA 1E2PA 2XNDD 1H8HA 3D31A 5E95A 3OZXA 3EZ2A 2IYVA 2ATVA 2V55B 3GJ0A 2RGXA 2G6BA 3QBTA 3WXMA 2XOKD 3A1SA 2RMKA 2YINC 4H1VA 4DHEA 4HB2A 1P9NA 4K46A 2ZJ8A 1W48A 2ZJYA 4KSCA 1E9DA 4OHVA 3CRW1 2IBMA 3UMRA 3IHWA 3ASYA 3AVOA 1T0JB 3LX8A 3SEAA 1YZTA 3JVUA 1E0KA 4TYNA 4B3DA 3GEHA 4NZYA 1T6NA 5E7JA 3D6TB 3KXLA 1GL6A 4JVSB 1CIPA 4PXAA 2BKEA 5BN3A 1K8RA 1HY3A 1VHTA 1E1QD 3KTAA 1BH2A 2P65A 3RYTC 3QF4B 1FTNA 2WWGA 2BBTA 5GJWC 4XD7D 3U6BA 2K5UA 4PQRA 1RZ3A 3DHWC 2JLRA 1UDXA 2QRNA 2BBWA 5B30A 3KQNA 2FE4A 2OXRA 2ZS8A 2Z43A 4JLVA 4C0LA 3B82A 4M0LA 4YMSA 4PC1A 1OFTA 2WJHA 1EGAA 4PAQA 3GJ8A 1G8FA 3FFBA 1AKYA 1G7RA 4UXHA 3RS4A 2YWEA 3CPJB 2PJRA 3I92A 5KDDA 3R9XA 1MV5A 4L9SA 3VR6A 1JXMA 3R7WA 1NY6A 2QSYA 2O5VA 3QG5A 3VX3A 4L8GA 4GBMA 4OQXA 3RANA 4IVQA 1T0HB 4DDWA 5HPYB 3TVTA 4EDHA 2VPPA 4LV5B 4A8JC 4JLPA 4PZYA 1MKYA 4DLVA 5A5GA 1ZM4A 2FH5B 4PQFA 4QGFA 3DOEA 1KGDA 2ZJOA 1YZLA 3OIVA 2PT7A 2F9LA 4C0JA 4YQFA 1DG3A 2A5FA 2P5SA 3CF0A 3LRPA 3NDPA 1U0LA 3BH6A 3AP1A 3K9LA 3WMGA 4D4MA 3U7FB 1WB9A 1S8FA 3Q3JB 3BH0A 2JJ1D 1R5OA 2Q3HA 5CIWA 5EJEA 5FOXA 1IONA 1KO7A 2WWYA 4LBYA 2FFBA 3EG5A 3U3OA 5FOWA 2QSZA 2IK8A 1LB1B 2BM0A 4BLSA 3QXHA 3O8RA 2IXFA 5FPSA 1G6OA 1GG2A 2QE7A 2V1XA 4JLMA 2DBYA 1YZNA 2PCJA 3BK7A 1XFAA 4NCKA 3PQCA 2C9YA 1E2FA 1U99A 3WHLA 1FNNA 1V5WA 3GJ5A 3BAFA 5J4LA 2PLRA 4NMMA 1E2EA 1KJYA 3ND9A 4EFMA 3BB1A 4IDQA 4XWAA 1BMFD 2REBA 3C5HA 3IILA 1ZCAA 4IXNA 1RRFA 1CS4C 1N6HA 2ERXA 3EA0A 2YWHA 4NH0A 4MKFA 2W0MA 5EE3A 2VP6A 2EFHB 5F98A 2OCAA 1IAQA 1TX4B 1UJ2A 3UWOA 4DB4A 1IOZA 2IS1A 4IVRA 4C7OB 1WP9A 2JJ8A 4MKHA 3I4LA 4YLGA 3OE7A 3ZJYA 4HUTA 2J7PA 3B5JA 3FMIA 3JZAA 4JT4A 1ANKA 1ZVQA 5GADl 1M1YE 5K8IA 1YZGA 2V7QA 5E4FA 4D81A 5L3QA 3C4JA 2D4HA 1CTQA 1XD2A 1R0XA 4QC2A 4B2IA 1R8QA 3DM5A 5EE9A 1KTVA 2FA9A 1TEXA 1NRJB 4KVGA 4A1FA 3GLGA 2JLVA 1YKSA 2J1LA 3B8HA 1XMJA 3A1WA 5HZHA 1M8PA 1YQTA 3SQWA 4MKIA 3KJHA 5EP2A 2RGBA 1ZJ6A 2BJVA 5KO2A 1IN7A 2WAYA 5FPYA 1UBCA 5CJ2A 2ODWA 4O0MA 2N42A 3REGA 4KAXA 1LY1A 5GVSA 3GLHA 1VG1A 1MO4A 2WM9B 4LJYA 4Q9JA 2BMJA 2IYWA 1E1RA 1US8A 3MFYA 3UXMA 2C03A 1LNZA 2VBCA 5L3SA 1WQ1R 3A6PC 4RFSB 5FFMA 3W34A 3U7GA 1ZUHA 4D4KA 1HYQA 1VMAA 2OFXA 1G19A 1GP2A 2NTYC 5FL7A 2VF8A 3CX8A 4G5RA 3GEEA 2A5DA 5FUXA 3P27A 3PVSA 3W8NA 3MRSA 5DHFA 1XU4A 2OCPA 1N0UA 2CHVA 3PUXA 4C0KA 3SHWA 2D62A 1E6CA 2BBSA 2Z4SA 3QBVA 1KK1A 1OPXA 3LXRA 3QEJA 4R98A 3SZRA 3SQXA 3AVYA 3I8XA 3NBZC 3OHMA 4CYMA 5B58C 3EC2A 2NIPA 2MMCA 1QHSA 2C5LA 4DT1B 3CNOA 1RC8A 2Q9BA 4IEEA 4DLSA 3CX7A 3IHLA 1Z0DA 3PFIA 1PUIA 2FFAA 4MRRA 5EP4A 3EPHA 1TF7A 1MOZA 3R8FA 3QSYA 1E69A 2J5XA 3WNDA 5AUPB 4X8MA 1H8HD 2QA5A 4RZUA 3DKVA 5DISB 1UADA 2ZI7A 1E98A 5HCIA 1AS0A 3KZ1E 4Q48A 3U60B 2H5EA 3P26A 2GEVA 2ZRNA 3UIEA 2VSFA 5FTJA 1OFHA 2RAPA 4MKGA 3BB4A 5E7MA 1IN5A 3LQRA 2PMDA 3ZZ0A 3BXZA 3VFDA 4D25A 2JGNA 1FQKA 4IEIA 4KYIB 4MYHA 4L4UA 5SZKB 4EFNA 2ODNA 3VHLB 4JVNA 1VG9B 4UJ3A 1QHYA 4N1AA 3BORA 5JI2E 3MWLA 1XCGB 4A2WA 2QN6A 5EE5B 1E3MA 4KSBA 3AF0A 4LOAA 4P0TA 4K8OA 2NPFA 2F1JA 3TUZC 2G3YA 3OIYA 2B21A 1ZBDA 4HLDA 3CKLA 3C15C 1KYIA 2O8CA 1ZNYA 4YMWA 3KKQA 2GJAA 4V0KA 2XX3A 1P7CA 1G3IA 2QGZA 2QZ4A 1P5ZB 3PUYA 1JQJC 1G3MA 1N5KA 3X2SA 2BVNA 4BLQA 4P3YA 5KU1A 4HB0A 4C0QC 1TMKA 4Q9KA 2CJWB 4A36A 3CIOA 5D3MB 5CB6A 1TTTA 3A58B 4CRWB 3HPQA 2J3EA 2OBNA 4W5JA 1KSJA 2JCSA 1E79D 1OYWA 4QBHA 2GDJA 4FN5A 2A9KA 2A78A 4A0RA 1CR0A 1JEDA 2GNOA 3C8UA 3QI2A 4CW7A 4IVPA 4TN1A 4ZCMA 2O8BB 1KKLA 1RRGA 4TL6A 4AD8A 5JJKA 3OEHD 4HLCA 4N3NA 1A5TA 3LWNA 4ZCLA 4ZIRB 4CT4B 1XCPA 2VP9A 4MYTA 4G0NA 4PPNA 4JKIA 1AGPA 3KKPA 1JAHA 3Q72A 4FIDA 2ZR0A 3QF4A 1XD9A 1T3LA 4QJ4A 2KI5A 4JIMA 5KNBA 1H8EA 1GM5A 3L43A 4L9WA 4WIAA 3TBKA 4LK2A 2B6HA 3SJCA 2D2FA 3TE6A 1EFUA 3U44B 3HU3A 4KFTA 3U61B 1OH7A 3K0CA 2OG2A 3N70A 4HAYA 2OFWA 2EFEB 2QE7D 2UZIR 4KVAA 3LAWA 1G17A 3QENA 3VKHA 4DC9A 1Z29A 2HLDD 1CLUA 3DZDA 1M7HA 1FW6A 2WWIA 4DDUA 1HE8B 4DIDA 4BLPA 1SVMA 1HV8A 3H0KA 3LNCA 3QVUA 2F1HA 5BW8A 3QIAA 4BFVA 5J4VA 3FYHA 3NWJA 1JXOA 2WKRA 3SYNA 2JLZA 1R5NA 3IPYA 2CBZA 3B7GA 2ZJZA 1XX6A 4BFSA 3AVTA 1OYYA 1U8YA 3SN6A 1N25A 3CRVA 4DSTA 1JALA 3CLVA 5E3HA 1AIPA 4HB4A 3I3SR 4II7A 3RRYA 4ZCIA 3AGQA 3NBYC 1OH5A 3PITA 4NYMQ 3T5GA 1F60A 1EXMA 1M2OB 1VCOA 2A2ZA 1X6VA 2EWWA 2CK3A 4ZDKA 3OE7D 1XWIA 2DPXA 4JSTA 1BKDR 2H57A 5KDLA 2XITA 1U2RA 1ZNXA 4Z1MA 1NSFA 4DIEA 4HB3A 1D2MA 3NDBB 1TPZA 3IIKA 3SJZA 3WMFA 2HT6A 4Q4AB 3RS3A 2WSSA 2AXPA 5HR5A 2F9MA 2WOOA 1W2HA 3AKDA 1B0UA 1NG9A 2G77B 4D0NA 5DH9A 2TMKA 5JS8A 3A36A 3AF4A 1RE0A 1ESNA 1R4AA 2CHQA 1ESMA 1NMXA 1NKTA 3KB1A 4LHWA 3TJZA 1XEXB 3E2IA 3H4MA 2RGCA 3EW9A 3M1IA 1HQYE 1YR6A 4US1R 4C2TA 3CH5A 3IUYA 4CEJB 1FOEB 1LF0A 4NE2A 1NVVQ 1G3UA 2AD5A 4IFEA 4ERNA 1XXHE 2X1VA 4XSGA 1T5IA 2HF8A 3BS4A 4BGDA 2ZPTX 1XXHB 1D9ZA 2HJGA 3ZQJA 3W5IA 2XOKA 1A2KC 3AQ4A 4H9GA 5G40A 5JWRA 1OB2A 3A1VA 4OL0A 4C7OA 1Z0JA 2IXGA 5FR1A 2E87A 1X1SA 3CPHA 2VSOA 3FHOA 3TMKA 4B32A 5BN4A 5TVKA 2UZ3A 4PSKA 4EPTA 2RCNA 1MABB 3EZ6A 2DYKA 4Q4HB 5FL7D 1Q20A 3CF2A 3NC1C 1MH1A 1BYIA 1P2SA 2HV8A 4IW3B 3RWOA 4B48A 4DLXA 1AA9A 2VP2A 3K0SA 5DYGA 2KE5A 5TXGA 1CBUA 1ZNZA 1G18A 2XJ4A 4MGKR 2ZITA 3QE0A 4GNKA 1VG0B 2HYIC 5F9FA 1S3GA 5L3RA 4XIGS 2PZFA 4FMBB 3VQTA 2ZRGA 3V4RA 1HURA 2XAUA 1E2JA 4DCNA 3AVXA 1MRNA 3RHFA 2YC4C 3TSOA 1KNQA 3P32A 2ZR7A 4WBSA 1UFQA 3LA6A 5LBIA 2D74A 2GTPA 4LX0A 5LB4A 5JI3E 1RW4A 1AZSC 1DAGA 1ZAKA 1OT3A 3OF5A 1WXQA 3LBIA 2QTHA 4LJ7A 2HCJB 3SC3A 1QRAA 1XPUA 3WNBA 1XEWY 3O8CA 1NLYA 3WP0A 2OFOA 4LPSA 4RFSA 1LVGA 3LQQA 4KV9A 4KYUA 1DAEA 821PA 4GI7A 3SDZA 3SYLA 1W4AA 1UKZA 2P67A 4I1UA 4DCSA 4QBGB 2R6DA 3CH4B 4EPYA 2ZVPX 2AFHE 2YHSA 4M22A 2QRZA 3EIEA 4OYHA 1KHTA 1SGWA 1J8MF 1WBBA 2J0SA 3ZDQA 4KBGA 4I99A 1TU4A 4LDJA 2HF9A 3SE0A 2FFQA 4GPTA 4Q7JB 2O8DB 1AS2A 1G41A 2C04A 5BXQC 3T61A 1W47A 2J45A 4YONB 3OEED 1YR9A 4DT1A 3EPJA 3VHXA 3LVRE 1ZYUA 2QAGB 5AUQA 3T06B 5HKKD 1U98A 3L0OA 5AJZA 5F9HA 2ZRKA 1ZM7A 4B33A 5J47A 2ZEJA 4W9MC 1Z0FA 1Z2AA 1TNDA 5IK2A 3ZH9B 3QKRB 4YMVA 1CKEA 1E9CA 1WRBA 1F2TB 2YOFA 2A7QA 4DEYA 2ZRMA 4E03A 4D0LB 4QJ3A 4NYIR 3BH7A 4OJKA 1VYTA 2V6IA 1TUEA 5GJCA 4CZ2A 3QKUA 2IYQA 3SNHA 2AL7A 5DNYB 4F93B 4CF7A 3FB4A 4GZLA 2EWVA 3F8TA 5DLQC 1BMFA 1SQ5A 2QMOA 5C4GB 2RGNC 4Q66C 1VCIA 3R9WA 1UM8A 1CJKC 1XTRA 2RGNA 2YYZA 2J46A 2QPTA 3UKDA 4A2PA 1S0UA 4PR0A 1YRAA 5EE1A 5FBLB 3GJ7A 3MMPA 1NIJA 3HYRA 4IOMA 4NYJQ 1PV4A 1P60A 1QVAA 4G1UC 1P73A 1CULC 1Z6YA 2IYXA 3A4NA 3R9IA 3W9YA 1OFIA 1ZD9A 1FL9A 3ZZUA 3KXIA 1EWQA 1ZUNB 1E0AA 2OSBA 2KSQA 1TADA 5K8TA 2F3TA 4I81A 1W4RA 5H1YA 3CR7A 1YZUA 3RC3A 1PLKA 4GMDA 4HAUA 3W6OA 1NY5A 1I4DD 3U3RA 4D82A 3AKEA 1NVXQ 3GPLA 2V1UA 3IBGA 2WKQA 2ZI3A 1Z6TA 2CJWA 1J90A 4QNMA 2F6RA 5D3MA 4JYBA 1XJCA 1NN1A 3EXAA 4QHYA 2ZJBA 4BLOA 4OI0A 3VR2A 2IYUA 5DE3A 1AS3A 1Q12A 3KJEA 1KO8A 1IY2A 3PEWA 1ZP6A 4HDOB 5J5CA 4AK9A 1VECA 3ZZTA 4TMWA 2B92A 1PLJA 4G5SA 2O8BA 1M7BA 2A3RA 4KO8A 1Q1BA 2GHIA 3KX2A 2NO7A 5P21A 1W0JA 2AD1A 4LZZA 4ZIRA 2DCUA 1M74A 4FWTA 3E5HA 4OHWA 3NBXX 1BIFA 3CBQA 1D2EA 3VAAA 3TRFA 3EPKA 1ZM9A 4M21A 5CIQA 1P2TA 4PPFA 1JNYA 2C2HA 4W5WA 1CJMA 5TV2A 4ZI3A 1II8B 4DSOA 2AR7A 2RGDA 4O3MA 2R6FA 1FNMA 1S96A 1ZU5A 1GIAA 4WW0A 3MAAC 4Z1MD 3E1SA 5FPHA 4OHYA 1DTSA 4ZPXA 1XF9A 2X77A 2XJ9A 4DLRA 3U44A 3VTKA 3KFXA 5TY0A 3ZQ6A 2BBOA 3EARA 5KNCA 2OZEA 3IEUA 1VTKA 1U0HC 4FCTA 1RRCA 3GJ3A 1PZNA 1J7KA 2QEQA 1JR3D 3FDIA 3THXB 1Z5ZA 1BYUA 1EFCA 3H1TA 2BDTA 1HT2E 1GITA 1TAGA 1Z0IA 1A2BA 2EW1A 1XZPA 2B7BA 3UPUA 4B47A 3BBPA 2CE2X 2ZSBA 4IDNA 4PO8A 5K8LA 4LSGA 2G9NA 4P4SB 5H68A 3WYAA 4JLKA 1KZGB 4OQNA 4X8HA 3W3ZB 2G88A 2A5JA 3OAAA 1N6RA 2FV8A 3IGFA 1S2MA 1E2LA 4MITA 5EXTA 1X86B 1EX7A 4P4TA 1Z0KA 5A0FA 1IHUA 1G5RA 1XTQA 3CZQA 4NCJA 2EFCB 3AVWA 1D6JA 2ZI5A 2CMKA 2B8WA 1N5LA 1GILA 2OT3B 4DLYA 1U94A 2G83A 1FTSA 4MRNA 4OHXA 1RRPA 1W49A 2VRWA 1G64A 2ZUCA 2X19A 1E94E 4CT5A 4Q4AA 4MGZR 4RD6A 1FMLA 2WIAA 3M0EA 3TR5A 1CJVC 3TAUA 3RRNA 4ARZB 2ZYTX 3O8DA 1VG8A 8OHMA 4PTLA 1ZCBA 4Z54A 4OK5A 2IUTA 2Q0HA 2QPAA 5DI9A 1XEXA 3QUSA 2ZRJA 4MRSA 1KI7A 1EK0A 2MSCB 2FMXA 1RFLA 4HEJA 4Q7MB 4CEJA 4DDTA 4L15A 4XOIA 4GOXA 1LS6A 4DXAA 2WWHA 2WJJA 4KJZA 3UMSA 2O8EB 3THWB 2PBRA 3UWKA 4AY2A 1XXHA 3G0HA 5JJLA 2JIZD 3KKOA 1E9AA 5KOYA 2JLUA 1UBGA 3EA5A 4LC1A 4P32A 3T1OA 4C2UA 1CRQA 4FCVA 2ZQ5A 3ZVRA 1N6KA 5JZVA 1BOFA 1E79A 4HUQB 4Q4HA 4HDCA 1Z47A 1G1MA 4KFUA 3MLEA 4EUNA 4XVRA 2CL7X 4G01B 4TQ9A 3LDAA 5L8VA 3L0IB 2C96A 3OEHA 3RDPA 3SHFA 2QMEA 2D2EA 4MUBA 4LRWA 1D8TA 4UNQA 1O3YA 3A1UA 4DRZA 2BCJQ 3AEZA 2VTKA 1G8YA 4UNNA 2REOA 3RAPR 4AWXA 1OXVA 4YDSA 4M1YA 4R2HA 3GJ6A 4US0R 2QQ0A 2OLJA 2ZRHA 4EPWA 5CK4A 2EFDB 2XSZD 5IK2D 1KDOA 1GKUB 1GOTA 3KFVA 4PHFA 1JR3E 4RKEA 2W6JD 3LO5A 5EQTA 2HLDA 4QGGA 5FOSA 2ZSEA 3AVPA 4J0QA 2GJKA 1XTIA 4P4UA 4WZ6A 1KY2A 2YZ2A 4ACAA 1GZSA 3OIWA 3LLUA 5FUVA 1P9WA 2Z5FA 4E07A 3LX5A 1AZTA 4F91B 1K6MA 1XTKA 1W4BA 2RGGA 3G5UA 1FFHA 3PCRB 4WVFA 3LW7A 1RYHA 4BQSA 5DI3B 4FW9A 5TMPA 1J99A 2LWIA 1P2VA 1Q0UA 1W36B 1TQ2A 2DFTA 2QG6A 4GL2A 3EWSA 4AYXA 2KBFA 1NI3A 4QRHA 1G7TA 2F55A 2F1IA 4Q4LA 2O8DA 1OF1A 1G6HA 2CCJA 2QTFA 4X8OA 4L16A 1RVDA 1DAHA 4QGHA 4DJTA 1GRNA 2WJIA 3SOPA 1DO2A 5DO9A 3SYKA 2C99A 5FTKA 1XMIA 4B6FA 2PLFA 4GFDA 4MDEA 4QL3A 2FJUA 5DN6A 4AG6A 2FSFA 5FOTA 5JCPA 1GNRA 3AUXA 1QG4A 1N6LA 2ASEA 1AJEA 1NKSA 3QKRA 4DVGA 2DB3A 4AKIA 3KQLA 4AKHA 3O8BA 1F2TA 4TWZA 3WYFA 2DR3A 4M1KA 4EPVA 1HUQA 2LKCA 3SFZA 2GILA 4Q4JB 2N46A 1F6BA 3I73A 3KKMA 5JEEA 4B34A 2VSXA 2KJQA 1R8SA 1DAFA 3MUFA 2YJTD 3MCAA 1UAAA 4NTZA 4LV8B 1R10A 2QT0A 4I1VA 3F5FA 4ZDJA 5IDVA 5AR1A 1DAKA 2IL1A 2HYDA 4DSNA 2JASA 3P4YA 1W0JD 5BN5A 2O8FB 4QM7A 1GWNA 1TL7C 3I8SA 3A1TA 1XZQA 2CLSA 4D4JA 4F38A 2J0QA 3KQKA 1R0ZA 1VHLA 3IIJA 4GRAA 3FMPB 3SU8A 2QTVB 4JLAA 4BEBA 4GDFA 4P31A 2JJ2A 2OM2A 1Q1QA 2QI9C 4A0GA 1ZUIA 3U3MA 3CW2A 4B3GA 1II9A 4DLZA 2RHMA 3PXGA 1OLOA 3PUZA 4FMDF 4E22A 3AP2A 4TT3D 2GXAA 2JLQA 1SKQA 2XTMA 1J8YF 5UKDA 3DM9B 5CJPA 2R6AA 1Z22A 1G20E 4DZZA 1Z6XA 3A4MA 2PCLA 4OQMA 2DFNA 2GRJA 1QHIA 3H86A 3HR7A 4GMXA 5HE9A 5J4HA 4M1SA 1IJFA 1A4RA 5KDOA 1EFRD 4AIIA 1D5CA 1Z28A 4UXJA 2CVFA 2FOLA 1GAJA 3OAAD 4AKEA 2GETA 3CRRA 2ZJ5A 1I2DA 4NHOA 2WHXA 2ZREA 3CO5A 1QHXA 1VPLA 4PAMA 2GCNA 3L82B 4OI4A 1IXRC 1II8A 1WMSA 4TLBA 5A4JA 5G41A 1JPJA 4URYR 2QGNA 2IEYA 2H16A 5D3QA 1F2UB 1XMSA 2WWWA 4LJ5A 4FMCF 5FBRB 1KY3A 4Q18A 2PZGA 3U2QA 4YMUA 4NPHA 1QHGA 2GZDA 4KODA 2IYLD 4R7ZA 2OAP1 2BM1A 3C16C 3LXXA 2WJGA 1WBDA 3NHAA 4TTQA 2VF7A 2CL6X 1I4LD 4A6PA 3THXA 4LYAA 4MGYR 3OEEA 3NVAA 1S9HA 2XZPA 4EIWA 5JBQA 4QJ5A 2WTUA 1E2GA 5HKKA 3QVVA 3NC0C 2G0TA 2AFIE 2ZJ2A 4P4SA 1FPMA 4EPXA 1CU1A 2XB4A 3ADDA 2GZAA 2IYYA 3J81k 3ZYCA 2OBLA 2P3SA 3BC1A 2WWFA 4Q47A 3TLXA 4A15A 3FTQA 4PSVA 3GLIE 4OHZA 1G5TA 3QF7A 621PA 2FSIA 4C30A 1M7GA 2BCGY 2J59A 2VP5A 3GLIB 1L2TA 2C9CA 3B9QA 1Q1EA 2VO1A 2QROA 1ZNWA 4TSFD 2DWOA 3RSOA 2GXSA 4JYCA 2ZXUA 2JLYA 4RZ2A 1FX0B 2QNRA 2QY9A 1Q22A 3AUYA 2EYUA 3K1JA 3MWYW 4K81B 5G3YA 2FPKA 3IQXA 1YU9A 4PO9A 1SVSA 2GEDA 2IUUA 4WZBE 3QKTA 1DBSA 4ARZA 2ZAMA 4QG7A 2C95A 4BFZA 4M9ZA 5FPKA 3V4FA 4U00A 1NSTA 1RIFA 2ZANA 3THYB 1KI8A 4A92A 2J0UB 1XPRA 1X3SA 2P0EA 4Q21A 5AWFC 2W2XA 1E0SA 4KI0A 1SHKA 1P62B 3CF6R 4Q9HA 3K0CC 2D3WA 3H84A 3D3QA 1AQUA 4RY2A 4A9AA 1N5IA 4IOJA 4B75A 2GKSA 1Q3HA 5HCNA 3THOA 2ZM5A 2O8EA 3T1VA 5B57C 4M1WA 5EUQB 3THWA 3WBKA 1VCMA 4B3FX 3X1WA 1E2MA 1B23P 3QJYA 2QL6A 2O0JA 5JRJA 1P72A 4BUJA 3OIUA 4AI6A 3NEJA 4RD1A 4Q01A 4L5BA 4WXPA 4HUQA 3RS5A 3DMDA 3RLFA 5AUNB 4LHVA 2FZLA 1MO5A 3EPLA 1JPNA 2EVWX 1NBMD 1DE0A 3GFOA 4TLCA 1N2CE 3KQHA 4ZI2A 4XTCS 1GRRA 2N1BA 3TVDA 2WVJA 4BZXA 1C4OA 4EKDA 4X8LA 4EFLA 2GXUA 1KDTA 2H8KA 3TH5A 2YOHA 3ICEA 1KMHB 4M53A 3EWAA 1KDPA 2P6RA 2HXSA 1QHNA 3GD7A 2VHCA 3AP3A 5DN6D 2V3CC 4QHSA 2ZU0C 2ZETA 3CWQA 5JWOA 1YJ5A 1Z06A 1CEEA 2OAQ1 2PX0A 5IF9A 2RB4A 4BE7B 3U3JA 5EP1A 1YZKA 5CDFE 1JR3A 4Q7LA 2OUKA 1CR1A 2IWHA 3L8ZA 2E9SA 1NN3A 1XJQA 1U9IC 3T34A 1W1WA 5KSPA 1X8KA 3CRQA 1U9IA 3IDQA 2I1QA 3LFUA 4QBFA 1JR6A 3EZFA 3FFAA 1QBKC 2HDNB 4ILEA 4MA4A 5DI3A 2JLSA 1KJWA 2FF7A 3B6EA 1N6PA 4XVQA 1QG2A 2EQBA 4CEHB 1KI6B 2OBMA 5DSZA 2NGRA 3HR8A 3IKJA 1J2JA 1OXUA 1PUJA 5LB2A 2EU8A 5B64A 3HU1A 3ZVNA 3QXJA 1TF5A 2DWPA 4O2RA 2IF2A 3T5DA 4JVMA 4B3XA 1UKEA 2R65A 2JJ2D 3G82C 3PUWA 4NYIQ 2ORWA 5FTMA 3CUEF 5FR2A 1IXZA 2PT5A 1V43A 1DS6A 5KTYA 1CJTC 1LS1A 4GSYA 5EZ6B 1AKEA 2GAOA 2CE7A 4TQUS 1S1CA 1L8QA 1W5TA 1JB1A 3P1JA 4M1OA 1C9KA 1TF2A 2ZYWX 4B74A 3B13B 3QPUA 4URZR 2V54A 4LI0A 4DLTA 4WAUA 3E70C 2AN9A 5AJXA 5FTNA 5HTKA 4Q4JA 3UG7A 2GJ9A 5FBVB 5GVRA 3GLFE 4RSGA 2WAXA 3X1YA 3GP8A 4EPRA 3GLFB 1ZM3A 4I4LA 4HAWA 4Q7KA 3L8YA 421PA 3B1VA 3M6AA 3U7EB 3PEYA 1CJUC 5BQ5A 5C46F 1W46A 2GAAA 4QXAA 1KAGA 2F3RA 1KI4A 2ZJAA 1CP2A 4Q5IA 4C0SA 1N0WA 3TUJC 4JBYA 1OHHD 3S1AB 2NQ2C 2P2LA 4A8JB 2XNSA 2O8FA 2WPDA 2IYZA 2JIZA 4JL6A 1CXZA 3PENA 3WP1B 1G5PA 2V9PA 1RYFA 1WE2A 4RVCA 3PR1A 2QMHA 2WBLC 3FWYA 2YVUA 3BIFA 4B2PA 1G16A 3QPVA 4TMVA 1N6IA 1Z8FA 4JLOA 3EZ9A 1NBME 2B8TA 4JSYA 4LBZA 4HZUB 4PZZA 5AJWA 2ZU6A 2FFHA 5LDDC 4V0NA 1DOAA 4TL8A 1UKVY 3N2IA 2QP9X 4A4DA 4S2EA 4DCVA 4EQ6B 2ORIA
chains in the Genus database with same CATH superfamily
1JL3A 2B1RA 3PV0A 3ZOZA 2B37A 1J70A 1BCRB 4IIHA 3RTEA 3WRYC 1INLA 1XKTA 4XFKA 3W8DA 3HFRA 5CM9C 2CBGA 4RWEA 3KUCA 2Y1CA 5AVWA 1K97A 2PMCA 2GH1A 3GYBA 1Y8RB 2WNHA 2ZSDA 2IHZA 2WSMA 3R09A 3I1IA 3Q3EA 4FMDB 3KDSE 2WV7A 2XSZA 1YFLA 2JKYA 4CQLB 5AUOB 3RAJA 3HCCA 4YS6A 4ZVRA 1PEYA 2IIPA 3B1FA 4RGQA 4FWBA 5IZ4A 4J94A 4NFYA 1LNQA 1VBFA 2D5LA 4JBHA 4ECEA 2OESA 5BP7A 5HM8A 3I23A 4ENQA 3GT3A 2F43B 3AYZB 2Z8YA 2GZSA 3SI7A 1GDDA 2B4KA 3KT6A 1R1DA 2P9BA 5LPNA 4KU4A 1F8GA 2Y9PB 5JALA 5T8KA 3D8TA 1DINA 3FW1A 3R3UA 1ZO8A 5DDIP 3PUIA 1NNUA 5F2EA 2GCIA 3FKQA 2K6GA 2AN5A 2CVHA 4LRTB 2XB2A 3FKJA 1RYBA 2H7VA 2J7KA 3PJGA 4A82A 4DV6B 1A3CA 2P2CA 4KPUA 3IKMB 1GZ4A 4AJNA 3JS5A 2X8AA 2Y8EA 5JAOA 4DTIA 2QLFA 3DW1X 1ISGA 5F4BA 1OXBB 2O19A 2IW3A 2VK4A 1IEQA 4D5EA 3UCXA 4XM0A 1QPGA 3WKEA 1Q2XA 5JY1A 1E1MA 2CDCA 1D0SA 1V1MA 2PKRA 2XGSA 5AKLA 1MO2A 3O95A 4OFXA 2OZLB 1HC7A 3G59A 3JQCA 1GQYA 5H8WA 1GFWA 1PQWA 2DWQA 1X8XA 2CB9A 4FMCB 4J16A 5FOVA 3WLOA 3G7SA 1KJQA 1RIIA 1KSGA 1PJSA 2DTEA 3H2YA 1FTGA 4TMKA 3UJCA 1W1UA 1CVRA 1UEIA 1TYBE 2B5VA 3CRMA 2HRBA 2WSLA 5CITA 5JAZA 3FFXA 2H29A 4L75A 4GYKA 4OH1A 2YC2C 3TQCA 4QTTB 3FUWA 1S2LA 5BT9A 3OJWA 3HXPA 1T8UA 4HH0A 4BU1A 2Z6VA 1DC6A 1CQJA 4BWYA 3TOZA 4JJ4A 1YONA 3C3XA 4MPRA 2GSWA 2H00A 1GNLA 3G85A 4P83A 1HGXA 1E7QA 3DKRA 1WUIS 5EKSA 4C0HA 1Q1GA 1IHXA 4BYGA 3ENWA 4EL0A 5KNCH 1SVLA 2BHNA 5T4HA 3T0IA 4C4AA 1K0UA 3IIMA 1DEHA 1BNCA 3WJ2A 5FWDA 2BM9A 3GH1A 2P9EA 2BGNA 1WHTB 2GFHA 3R0JA 4JL8A 3BVPA 1XB2A 4B6EA 5JECA 2J3JA 1JJFA 4C29A 1HE3A 2V5UA 4ZN6A 3EZXA 3I39X 3ESDA 3LCJA 5AJTA 5AXCA 1KYVA 3SZ3A 4B7CA 2Q6LA 4U1RA 3VR4H 4BWFB 4F92B 2OK8A 1EWRA 3CV3A 2OO5C 3Q10A 3U6KA 1FP7A 1YR3A 4RMHA 4DF3A 4R0MA 3FE2A 5ECDA 4A0FA 3GVIA 5CG2A 3KKEA 1AY0A 1KZYC 2WJ4A 1YIOA 5LQAA 3AINA 1K8QA 3VAYA 5IMSA 5ALEA 2JLXA 1YZ3A 1FW8A 2WM3A 1TK9A 2FVXA 1R6UA 1O6BA 5FNVB 2BDEA 4ZICA 4TT3A 3RSZA 1L4BA 1P5HA 1Q1ZA 1VDZA 1T6XA 4B80A 4F4CA 1GG5A 1CERA 2C92A 4JLBA 3K9WA 2FN4A 4R2MA 7REQB 1C3VA 3PQ6A 4GR5A 3F46A 3PGJA 1JSXA 3LBNA 4M46A 2UYHA 1RZRA 2QN7A 1W0KA 2Y77A 2XUDA 4OXIA 3TQIA 1FMJA 1AK9A 4MVWA 4KP7A 1QTQA 4C89A 3RT1A 2ONCA 4GVXA 1CX9B 4ZYVA 4K9RA 3B7PA 3FXAA 4Q03A 1QLHA 4CLXA 5GP1A 5HE8A 1JQ3A 5KJ6A 3P52A 3RIEA 1F0NA 3W1WA 3PEEA 4D3SA 1S01A 3TUIC 3COSA 4WNIA 1VC2A 2AZDA 1FVFA 1K63A 4N4AA 3D6UA 2ZFUA 3CVJA 3CLRC 1J2YA 3G0DA 3K4QA 4PNHA 4AP9A 3H0EA 4FEYA 4E12A 5DXJA 3VPCA 4BTLA 2BUBA 1E9EA 1WVMA 2DBVO 3HJAA 4UNPA 4U7DA 4AVYA 5D5PA 3GEMA 3QVKA 5KNDA 3MD0A 3ZZMA 1UC8A 2XXAB 3P9KA 3FR7A 2H1IA 4ZREA 4LDQA 2QTNA 3PHCA 4QRDA 3V9AA 3E9YA 4H3VA 1QF9A 4N0MA 5A9SA 1VSBA 1WB4A 2AWNA 2OCGA 2R8EA 3GT4A 3ZN2A 1UBHS 2B4AA 1I8TA 4NFHA 4RZ3A 1SA0B 5FJJA 1L7NA 4XPIA 2AMYA 4EUKA 3I37X 2WJWA 3EJWA 4L8WB 4QD3A 3UH1A 4D2IA 5KUTA 4ZAZA 4IIFA 3B2EA 3E58A 2CUTA 3DE4X 1Z6QA 5DCWA 2C61A 4PM4A 1A82A 4B2LA 4BYMA 3NKVA 2YOGA 3SS8A 1Z4NA 5BQFA 2D3TA 3JVIA 3VPFA 2X5NA 1SXJE 1A50B 3D8SA 1YRYE 4HWTA 5D86A 4ED9A 5AW9A 3LVQE 1N7IA 3WGMA 3FY4A 2PD6A 5CA1A 4OGGA 5HF9A 4EFDA 1BSVA 1M9NA 2E85A 2F48A 4YRTA 1WZUA 3FSGD 3NQ41 3L9XA 4MROA 5B2ZA 5ELXA 3BWMA 3IAM6 4PS0A 4CQJA 3IULA 3P96A 4MJXA 1G55A 3DL7A 4UUQA 3IRUA 3DZCA 1CUAA 4E21A 4LK3A 1MAHA 2ZQYA 2I6TA 1L7VC 3R8CA 2CXHA 2YV2A 1LZLA 2VNHA 1EVJA 3L06A 1H9AA 1MABA 3ENKA 2CNNA 3KL2A 3HJNA 1P61B 4R3WA 1LLDA 5HBGA 3JATB 3HKEA 4PQGA 2FG5A 2Q2QA 3UAYA 3FYDA 4NATA 4K03A 3OFND 3R5HA 1FVHA 3LSTA 3MCWA 4OQYA 4ZZ3A 5KZMB 2VJBA 3HYSA 4P4GA 3ZE6A 5K0ZA 2ACKA 1P0CA 2W2VA 4RY0A 4UBIA 1KDZA 3TPCA 4XWWA 3EGXB 4KREA 3AZPA 1E7YA 1TQ4A 1ISHA 1HT1E 2BEJA 2CXXA 2HWWA 2W48A 1UDBA 3MMZA 1GG8A 5DGIA 5DGCA 1TQ6A 4BDSA 1Q91A 1A8UA 4DMLA 4D9BA 1OBOA 3A9SA 1PU2A 2DX7A 3KQVA 1O4WA 3DDCA 3VRHA 4LG1A 3JVVA 3AVVA 4G5QA 3I62A 2FPUA 4LCJA 1DELA 3LUJA 4MVJD 4QUHA 3PVCA 5ENZA 3CUWA 1B00A 2ZAOA 5T4EA 2ZZNA 4Y2JA 1PS0A 4RKFA 2VYFA 3BMOB 2VPXA 1ZNQO 2QM8A 1VFNA 3BHJA 3FPAA 3GC6A 3IIIA 2P9GA 3IJEB 3NHFA 3R3JA 5F35A 4R71A 3KSBC 2VQFB 1QMGA 3SYTA 1YQWA 4AUKA 5HKBA 4CUJA 3VKGA 4LKRA 4Q15A 1W5FA 5HJEA 2HMUA 4BIIA 2WOJA 5FV7A 4TOIA 3I9NA 1KKUA 2PEYA 5DT9A 3PSHA 2WM8A 2BGIA 2P90A 4TKVB 5FI0B 1DARA 2A9OA 1OPRA 3W6PA 5KOHB 1HETA 1JBKA 1GTJ1 3LPMA 3DE6X 3IJ5A 1SVWA 4JL5A 5LU8A 1AF7A 2FN8A 4PCUA 2VIIA 4Y6RA 4ID9A 1IK4A 3CM0A 1OU0A 3DV0B 4EY3A 3GNSA 2JHFA 3ZHQA 4MUYA 2QWXA 2WQ6A 3LUBA 1NBMA 3GJRA 1SXGA 3KQWA 2IQ5A 1X9GA 1SIBE 4O02B 1UOQA 1ZH8A 5DYNA 5AVVA 3DVQX 2NQTA 4AZ3B 1O2DA 4GOKA 2I6UA 2G1KA 2Q41A 4DR5B 1W73A 1IM8A 3L0SA 4OUDA 4PANA 3HNOA 2PKQO 4JFAA 5FUWA 2C7GA 1M2JA 5I7UA 3SYMA 2VAMA 1UF9A 4PSDA 2RBGA 3BX1A 3DZ8A 5ISMA 1H0SA 2X5XA 1DZ3A 2P9CA 3BDIA 2JAQA 3IEXA 3WL3A 1XEFA 4Q1EA 1V26A 3LIIA 4RIGA 4U5XA 2GYVA 3RREA 3K0BA 4TMZA 2DPMA 3HU2A 1KDYA 1X3LA 4PONA 4BB6A 3U1TA 1JT2A 2X2FA 4QU5A 1C2TA 4A0HA 1Y3AA 2E89A 3STWA 3GWZA 5CX1A 3ZBTA 3W5CA 2PGIA 4L0CA 4OUKX 2XLBA 5DKFA 3VU9B 5LNK1 1R27A 5CHYA 1JECA 1T13A 3O2SB 4XWYA 4D3FA 4F5WA 3MNFA 1PBNA 2BKUA 1ZC3A 3IMCA 1QK5A 2HA2A 2IYRA 2P1ZA 4UZSA 5EHZA 2GEKA 2I33A 3AO0B 5T64A 1JAXA 3WB1A 1JYEA 5CVJA 2XXJA 5DHAA 3EVNA 2VYCA 1RAFA 1Z75A 1YRQA 4JJ7A 3PG5A 3UV7A 3KZNA 4UU0A 1Z56C 1XOIA 1G3QA 5F3RA 2EYQA 2FW9A 2EEZA 3P9SA 2QN3A 3UJ3X 1AKTA 4KX5A 2ZM6B 1E4EA 4X1IA 1CT9A 1LQUA 2MSNA 1LK0A 4RL4A 1J5PA 1XU7A 1G7SA 2RI6A 3CF4A 2AC7A 4ISBA 5LUAA 4WOJA 1GKKA 3K09C 2O52A 1QB8A 2Y1XA 1ST3A 1JRLA 3M4NA 2RG1A 5EFOA 3AGPA 5HDQA 3U4QA 1KNXA 2H63A 3NYWA 4ASUA 2GJSA 2I4LA 1CNFA 1MEJA 2Q5QA 3BWCA 4YXWA 1E9BA 1YR2A 4BMNA 2PUCA 1KI3A 4Z8XA 4U4AA 2PG3A 1ES9A 1HTWA 4MMYB 1F6WA 2VYND 4HDKA 3QU2A 1CUUA 2BEUB 2YN4A 1PL6A 1KVQA 1NUTA 4B44A 3JAWA 1FP4A 4NAHA 1SKUA 2RGEA 3QKSA 4MDYA 4DFDA 2QLBA 1U8TA 3MSXA 3OT1B 3P9QA 4O2BA 1UC5B 2WIJA 2HY7A 1Y1KE 1G8PA 2OLEA 1L4YA 4I4IA 3CEPB 4U2FA 1ZD1A 3P9YA 4QX6A 4YJGA 5LJIA 1KAEA 4MYRA 4DXDA 1KQFA 2ZPUA 4RXTA 4P1ZA 4PLWA 2CLMB 3UV6A 4CMHA 4OQFA 5BV1A 1OHHA 1XZFA 4RJJA 3I5XA 3ZLUA 3I34X 4BX2A 1SBNE 4F9EA 1F17A 2ONJA 2G71A 2QE6A 2WD7A 1BMTA 3LK6A 4QKQA 3PLAE 3LD9A 1T91A 2O2JA 2QX7A 5AOBA 4EMBA 1E9RA 2COEA 4OU4A 4RGVA 3WK9A 1O0BA 3AM1A 2RKOA 2PEZA 3C6YA 1VDMA 1Z9BA 4IIUA 121PA 1AN0A 1OW3B 2JH8A 3RQIA 4CPDA 5CEEA 1BJTA 4UVDA 3HVHA 2R2AA 4HAZA 3TNDA 4F4JA 4NOKA 1R8JA 3Q1LA 3PGVA 3AILA 4L76A 3V6LA 4CV0A 4DSUA 3EDMA 5I45A 3EX7C 2FDCA 3OT4A 4JZKA 2CLHB 4FB4A 2HXYA 3PI7A 2XB8A 3O3NB 2P1DA 3FGNA 1IHYA 1ODSA 3N0RA 3N7TA 4PPQA 2I9PA 5HJ5A 3T8YA 1WUKS 4CR8A 2QD1A 4MUAA 5JV5A 4V02A 1OBFO 5EIEA 2JGFA 1YB4A 1D03A 1G8GA 3CH7A 5DTIA 4PHTA 2PJZA 4CN9A 5KYWB 4XW2A 3R5JA 2XA2A 3ZPXA 1XLUA 3QXSA 1U8ZA 2I4IA 4Y6GB 5EEHA 1MENA 1PR2A 3CVYA 3ZGYA 4PTZA 4KQKA 2KPOA 4XXHA 1G8KA 3G9XA 3F9IA 4Q7QA 3IAEA 3T3PB 1SKBA 4NBUA 2ORVA 3W2TA 4CU5A 2LXNA 3H8JA 1P9RA 2NO6A 1QDUA 4A26A 2H17A 5C35A 4ZGWA 1RPZA 1V1JA 3ELUA 4NE7A 3T4EA 1EK1A 3RODA 1QZ3A 2QG9A 1BMQA 3CPSA 3IT2A 5KHOC 3AOGA 4GWGA 4Y2QA 4P34A 1JSCA 2Q7XA 5BV2P 5IULC 1ECPA 4WK4B 1MO3A 3C8DA 4F6RB 4MS3B 2X3UA 1CW2B 2BTEA 1OUMA 1BRTA 1MORA 5KYKA 1SWVA 1YBHA 2CJFA 1LDNA 4YUAA 2OLKA 5AK4A 1HO3A 1OILA 1U7ZA 1NVUQ 1QS0A 2ZRDA 3QNWA 2QUBA 2QBYA 4FONA 2H1LA 4RC9A 3S27A 4AWBA 5DPMA 4AYTA 3VNUA 1D6NA 2QM7A 5KWEA 2BSQA 1IFXA 1H4TA 1E3QA 1UK8A 2ZRAA 2VEOA 2X76A 5EJGA 4GP7A 4ZJPA 1QWSA 2SBTA 3SQXA 2IHBA 2QR3A 2ZBRA 3IR7A 3PCTA 1MO6A 2A1IA 4G4SO 3G2HA 5SZHB 1ND6A 2ZATA 4HNGA 4BWGA 2IS6A 1II0A 2UXCB 3R20A 4PX9A 3P2JA 4YXFA 3ZVLA 3LHSA 4P5EA 5EXSA 3AIIA 4HQLA 1U2ZA 1E96A 3IQDB 4TV8A 1FDIA 1PHRA 1VI5A 1Z0AA 3AFGA 3QXXA 3DKPA 4O8ZA 5BWOA 1XMVA 1SU7A 2ERYA 2IS4A 3JQEA 5EXDA 3C6QA 4KXMA 2Z0MA 3UB2A 4DCTA 2M98A 4P5DA 2WUVA 2OKCA 4MTLA 2A8YA 1G59A 1G4UR 2I9KA 3K2IA 3NLLA 3ILXA 1H0RA 4HWKA 1TO6A 5ALKA 1TQDA 1G2OA 3GRKA 5KYVA 5U4XA 2EIHA 3UQZA 1XBTA 3S5UA 2GYWA 1VJRA 4OXNA 1VPVA 2P2ZA 3GA7A 1L4EA 2OHFA 3NHPA 3HZZA 2X40A 3UH0A 3UVEA 1LSOA 3AW8A 4KNYA 3JWIA 4KRXA 3OZEA 3R40A 3ID6C 4C78A 4E6PA 2I4RA 1FFWA 3MWKA 1W85B 4GDMA 1EJBA 2YNMC 3ROQA 2XUJA 3AEQB 5J4YA 4DR7B 2WQZA 1EHYA 1SVOA 1S5PA 1QOZA 2I99A 3LUKA 4MRMA 5BR4A 5GJBA 1GEEA 1L5ZA 1HFKA 2D06A 3RJTA 1VMDA 3MYRA 1BXGB 1J33A 4J0CA 5IABA 1JV2B 4CIAA 4C6TA 1SUWA 3S55A 4YDHB 2XT6A 3DF9A 1SCNE 1JQBA 1X77A 4GOJA 4DADA 4E5PA 1QPBA 1LSSA 2CLCX 1QIDA 3OM8A 3W8RA 2V7EA 521PA 4A5OA 3PC8C 1NW8A 2QAJA 2FSGA 3K9GA 1YRBA 1IZ7A 2GUWA 3N2NA 2BI4A 3ESAA 1H5QA 2COKA 2GCOB 4AUEA 4BO5A 2FGKA 4DWOA 3EGDB 1Y63A 2B5OA 4Z5XA 2A1UA 2GPAA 5BXYA 3DT8A 4KN8A 4EYGA 3S2FA 1UJNA 4EI2A 2FMIA 3KKLA 1LEHA 1RWMA 5FBQB 3JQ6A 1JX6A 3PFKA 4CM8B 1YSCA 1U1GA 2OHGA 3HO6A 3FPKA 1OYVA 4NZZA 3GJXC 4FYXA 5AM2A 4L4XA 1LTQA 2JFFA 5LZ7A 2X9LA 3AB3A 2XR1A 2Q7DA 2MJLA 2QTZA 2Q99A 2Z3WA 3NH9A 4BNNA 4DM3A 2QZSA 3CNBA 2QMZA 4FBGA 3KYCB 3NTOA 4GQIA 2AKAB 4HFRA 3OC6A 4KBFA 5DYWA 4B3BA 1DKRA 4YRIA 1W36C 3GU3A 2QVLA 1QF7A 4UMDA 3COVA 3OTIA 4LFBB 4MI1A 4D9FA 1MT0A 5BN3B 1VMKA 2YL2A 4KE7A 4L50A 1PKXA 5M3BA 4JUBA 2GESA 2QN9A 1IHDA 3VDXA 2C3UA 1PBTA 5SY4A 3K16A 1WDTA 3C7TA 3C7KA 1PLLA 2DH5A 4YLEA 3QWAA 2HCFA 5ICEA 3FPEA 5A2QA 2XYQA 2OQVA 3FCUB 1WMDA 4PVCA 2PX3A 2FW6A 5IMBA 1OIVA 1OI3A 4LVUA 2P6NA 1BS1A 3BA1A 3I1YA 5KPDA 5DGXA 3KOOA 3TXXA 4E2FA 4DCUA 3VZCA 2B4YA 2OKGA 4NCIA 1GA4A 2GJ4A 1QF6A 1NJSA 1Y80A 2WVAA 2XRFA 3A11A 3CW8X 2AX4A 3F7MA 3PKZA 4M0CA 3IOCA 2DUMA 5TB5A 3RYFA 3CKMA 1GTMA 1HE4A 1E1RD 3BZWA 4LGYA 2IV7A 4Z7QB 4URVR 2POCA 2Z98A 2BSAA 4LC0A 2FPXA 3BERA 1FVXA 4NY1A 4XLLA 1UL1X 2WW8A 2FP4A 4WN9A 2QRVB 3BJIC 4E11A 2XGJA 3I32A 3KV3O 1SK9A 2P4HX 2V4ZA 2I1VB 3CB4A 2AHOA 2VSNA 3DAPA 3B9PA 1TQHA 1A04A 2CHEA 3CSSA 3L8HA 4AKGA 1S7GA 5JNTA 3Q2OA 2DC1A 4V3CA 4RD3A 3FSEA 1UBNA 2XD4A 2NV2B 1K88A 3KJIA 3P45A 3PYLA 4NJMB 4OFBA 3N3BC 4UULA 3TKLA 3TW4A 3K72B 4LYHA 3T7DA 2O2GA 2ONKA 4RZHA 2XNCA 2JIOA 5AM4A 3VC2A 3DW3X 1QRUA 3UGTA 3TKYA 1CDDA 5E9JA 3ZNQA 4CLRA 3QK7A 1FFGA 4HGOA 3N07A 1CR2A 4UQOA 1Z4LA 4YRQA 1QIKA 2ZYVX 3DHVA 3F3YA 2FN3A 3RWMB 1G5IA 1YZQA 2P79A 5DM4A 2QNBA 4KITB 3K6SB 5HDBB 1ZG3A 1Z7EA 2UXDB 1RKBA 1XAIA 2H1VA 3OESA 1TEVA 2FXIA 5G4KA 4QHTA 1OE0A 1T9HA 2GS9A 4X63A 1NE2A 2F1RA 3W90A 3FOZA 3A9CA 1YR8A 1NVEA 2I6SA 1ACJA 3OFNA 3QE4A 4NONA 3ADOA 1UFRA 5EE0A 1R0LA 1NZJA 2KWIA 5MGNA 2ZS9A 3A32A 1CB7A 4C0XA 1RTKA 3RVLA 1W1IA 3M5PA 2ZSIA 5GJVC 5DYIA 5BSUA 2QX6A 5JXJA 5EJFA 3KOYA 3NUZA 4N8EA 3D6VA 3VGJA 1OX4A 4TLEA 3U19A 3STHA 2YVQA 4DDVA 7AT1A 3H97A 2Z1MA 4MVJA 1UDWA 4GLFA 1UH5A 3ZD7A 4OEHA 1ACLA 4OMCA 1WZNA 2Y4NA 3EVAA 1YVEI 1L7XA 3EH2A 4HJRA 5ITWA 5J2UA 4FOOA 1P0QA 1RLTA 3OQ6A 2SECE 1SVIA 4RCZA 1P33A 1DADA 1GQQA 3M6LA 4V0MA 4WZAB 1SC1A 2YX1A 5C5EA 1RJ9A 1UBUS 4MI6A 1TIBA 5BSMA 5SICE 3FVQA 1AQIA 1JLKA 5IEBA 4LE1A 2HLNA 4LNAA 1GNTA 3WKCA 5KTKA 3AR3A 3JD2A 4MLZA 3WLKX 1OV4A 1YZHA 1E32A 4B0PA 2OV3A 5LR6A 3U4DA 2VYVA 1AKUA 3QVJA 2X0IA 3SHTA 4EAAA 3NRCA 4LV6A 1YDEA 2I2DA 5L3QB 5KPJA 1Z37A 1ZITA 4EB6B 2C77A 4E2WA 4LUCA 4I50B 2HT1A 2FSPA 5F33A 2Q8NA 2DUNA 2WYOA 4P7FA 3P19A 4O33A 2DULA 1JLMA 2BRUC 4PGAA 4KL8S 2XQKA 3GLGB 2QVYX 4IH9A 4HHEA 4J9UE 4EHLA 3I45A 3KKNA 2YHAA 3BD7A 3TWOA 1AQJA 4WFIA 3J81A 4IF4A 3ROMA 2G04A 2I3AA 3UJDA 3R5TA 1GAWA 2P9YA 4Y6PA 3OJLA 3DD5A 3DMGA 3K0AA 3QNMA 3G8CA 5J58A 4BUCA 5I9MA 4D26A 4OI1A 3MJTA 1ZH4A 4MVJF 5THXA 2BZ1A 4X85A 2LE0A 1ONBA 3DD1A 4C7XA 1N6NA 2NW6A 2GN4A 3G0BA 1GUYA 2VHQA 4AY3A 4Y0AA 5J2UF 2GFIA 4GXNA 1ITZA 1L5HB 5JEDA 1US8B 3NAGA 3HXTA 5AJYA 3LUFA 3Q9LA 3R5SA 4J7AA 5L3SB 1SHZA 1JHYA 2A5YB 4FKMA 1P1RA 1U5CA 1U2QA 4DJDC 2DMRA 2CHFA 1H6DA 1QLWA 1RYZA 1H8ED 1YCGA 2DVMA 3GFRA 4YRGA 5KNBD 3LF2A 4KLNA 3N2ZB 4BNHA 4MUIA 1Q7BA 3ORHA 1N9GA 3AC0A 2JLBA 2ZUBA 2CLLB 2NG1A 1VLQA 4W9RA 5EVCA 3RUCA 5ADUS 4FSHA 5FORA 1JHDA 2WV9A 3WWPA 2I8LA 1GKIA 3OJXA 5EUMA 4CM4A 1URPA 5K99A 4X65B 1VHDA 2ZKLA 1G8SA 3I6ZA 2MINB 2PX6A 2PPVA 3K30A 3VSBA 3FYUA 1OZGA 3P9PA 4IDFA 4S35A 1J2TA 4KR6A 2WY2D 2AXQA 3DEKA 5KSZA 1AZWA 1XEAA 2DZDA 2JI9A 2D1YA 4UTZA 4WACA 1XQ9A 2DFKB 4DRYA 1WMAA 2FEMA 3W2EA 3DDHA 4WSOA 5DEIA 1G9XA 3ZLJA 1I5RA 4RHUA 4DQ0A 4N6OA 3A05A 2CXUA 3B3GA 1MCZA 2H2IA 3QX8A 4M6WB 4MAMA 4OXRA 1EFHA 1HLPA 2AUTA 3GLQA 4FI3F 3CCBA 3H5AA 3MHPA 5ICCA 1QYCA 2QUIA 1CEYA 1P6UA 2FSHA 3QPAA 3ODGA 1QFXA 3HKBA 2AE2A 2WWVD 2X0FA 5IDYA 2NYAA 4C9BA 5F7XA 1QHHA 2JANA 2ZROA 2DTDA 3PRHA 4OHPA 1NJ1A 3G9TA 1NBEA 4IJMA 2V0NA 4N0EA 5IC6A 3WI7A 4R1LA 1RI3A 3HRIA 2QMUA 4IJWA 4ZAYA 3KUKA 1ULUA 3LUAA 5T4BA 4DR1B 1D2NA 3JQQA 2D54A 2IPMA 1Z08A 3AJDA 3RV3A 3GVHA 3UBMA 3O91A 5FOUA 3VH2A 4FILA 3TLEA 3OZ7A 2IXAA 5E9WA 3RVNA 4YCNA 4G5OA 1C0IA 5JO9A 3Q7QA 1IXSB 4AN1A 2Z8YM 3NT4A 4PS1A 4NWIA 2ODBA 1ZGZA 4B6QA 1YE3A 3QX3A 3GMTA 4R2JA 4TTTS 3IBTA 4CF4A 2WSSD 1ZCFA 1U3FA 2VP3A 3FI9A 3PNVA 4QDUA 3RNLA 3RVPA 3IKLA 4PZCA 5KYYA 4C3ZA 4UW9A 1NXPA 2VVTA 3M4JA 1XMQB 1NW5A 4CMAA 1F4PA 3AR8A 1K98A 4HDRB 1D0IA 3I42A 2D5AA 2Y68A 3QU9A 4F3YA 5EXXA 2AJDA 2C82A 1Z0UA 2NOAA 2Y2VA 2ZE5A 3R3HA 2I1LA 3RRZA 1XZEA 3ZLBA 2QUKA 2WJYA 1GFIA 4BKOA 1PR0A 3FHJA 2H54A 3ZX5A 4CMEA 3OTOB 4RTQA 2PYDA 1KH1A 4N82A 3IVRA 4NYJR 3NNNA 3F3SA 1E2PA 3LSYA 4LXHA 2XNDD 2VT3A 3D31A 2X8WA 3T3NA 1MC1A 1TK3A 3ROPA 3W7BA 2IYVA 2V55B 3IVAA 1NVDA 5T4FA 4UAGA 2K2QB 2VJMA 4BN4A 2XOKD 3A1SA 2CUZA 4UHDA 1IE3A 4K46A 4FCCA 1VIDA 3A9WA 1JSRA 5GMOA 1IAVA 3TDMA 3MJEA 4KSCA 1ABBA 3ETNA 4KXNA 3DMTA 1TT5A 4OHVA 3UMRA 3B36A 2P2GA 3ASYA 3BK2A 1N4DA 1YZTA 4TYNA 5GQSA 4HPJB 5E7JA 4LXTA 3F6EX 3D6TB 5ED4A 4DANA 4F5EA 4RESA 4KPGA 2BKEA 1NZFA 1ORHA 3IQFA 4LKOA 1YKGA 1FLNA 3VR6H 3KTAA 2CGEA 4IQ4A 2PBLA 4Z0PA 1BH2A 1HTTA 2R5NA 4X97A 1MGPA 1OQAA 1BCSB 2LGJA 2O2HA 3H2ZA 2QTWB 5EN4A 1CY7A 2XEDA 2JLRA 1B2LA 5LOVB 3UNXA 1NE7A 2OXRA 2NO4A 5BMOA 1XCJA 2PUTA 4IH4A 4DTCA 3DYVA 2JFBA 3MS4A 5J23A 1X7XB 4XJVA 4HVCA 3WZMA 1U2EA 3Q1KA 5BOVA 2YHIB 4XVHA 4JLUA 3UAWA 1EX9A 1DIBA 1G8FA 1L9KA 1PFKA 3FZQA 4EG5A 4JJ8A 2EW2A 1AKYA 1G7RA 2EQAA 3NEAA 4IXWA 2FRVA 4XUCA 1FFSA 5HK8A 1FZTA 1XTPA 2PJRA 4KQWA 3KQQA 4PINA 3JQ7A 1DC3A 3R9XA 4L9SA 1JXMA 1PR6A 3EE6A 4F4DA 1NY6A 1XNHA 3SXUA 3RANA 3M5DA 1T0IA 3PF9A 3PPYA 3LFTA 3DVAB 3TVTA 3D3KA 3JYNA 4R9NA 1W9HA 1USVA 1VJCA 3HDQA 4PZYA 2O2SA 4GPEA 4XIIA 3D1VA 4A8JC 3EXG1 1KS9A 3IMEA 1ZM4A 2RI1A 3HGTA 4NXMB 2IELA 1JHAA 2AW3A 4Y7DA 3MC1A 2NYVA 4L7QA 1MU0A 1KGDA 3DOEA 3WLSA 5D85A 1PJQA 4ZVVA 3EVEA 5KS2A 5TIIA 2VJYA 3HLYA 1N2JA 3K0KA 3E03A 3EQ8A 4YQFA 3IV9A 2P5SA 3CF0A 3LRPA 3LBYA 1T6YA 1LW6E 2BGRA 1DC8A 1N5OX 1WPXA 2VUUA 3BH6A 3CZ5A 4D46A 2FMUA 2V7VA 4IJKA 3BH0A 2Y71A 1R5OA 2Q3HA 5EJEA 1GFZA 3QQPA 2WWYA 4LBYA 4AWAA 2PT6A 2PL9A 2G1AA 3IV7A 5FOWA 1BA3A 1LSUA 3N2YA 5EVJA 4XGQA 3VH3A 2BM0A 3HVIA 3QXHA 4KDRA 4BO1A 2VK2A 1G6OA 3EXIB 2QE7A 3OU6A 2DBYA 3GRVA 3I30X 4Z9XA 4N7RA 4UAVA 3FCOA 4ZK2A 1E8NA 1E2FA 3WHLA 4GBGA 1MJNA 2AZXA 1QZZA 2FR8C 2WTXA 4OA8A 2YHUA 3L79A 4DM4A 4DV0B 1QG0A 1TM2A 3AERA 1WCWA 1XTVA 1DC4A 3PGXA 4DY6A 3RBZA 4ZC8A 4U0KA 5E9AA 1WXGA 1KJYA 4DIOA 3GWGA 4EFMA 2RG7A 3QLUC 1B15A 1RWOA 4KQEA 1LPAB 4XI9A 5E2BA 3R7AA 4DBVO 2BGWA 4AMBA 3IILA 1TECE 4QAJA 2HPVA 2HA7A 1N6HA 2HJHA 5E6SA 5JO0A 2Q1TA 1SXHA 3D2BA 2YWHA 4J8PA 5ADVA 1TMYA 1VSUA 5EE3A 2EFHB 2Y0DA 3UOGA 5BR8B 1GV0A 2OCAA 4F3CA 5BURA 3IXMA 3I2YX 3K92A 4RTLA 1IOZA 1MVLA 3WIUA 1N2EA 4YLYA 1AUOA 4RQBA 1SIOA 3TXAA 2ISQA 3NP9A 4MKHA 5EGSA 1U8UA 3SBOA 2ZT6A 3ZJYA 3FMIA 3B5JA 3I5UA 4N47A 1ANKA 2BF7A 3TVYA 3RJMA 1IOLA 1X7ZA 4EG7A 5K0GA 2C2OA 1XHLA 4AS3A 1T1IA 3IVXA 1EM6A 2PL5A 4GC5A 1R0XA 3O8LA 1IPFA 2IPOA 1YZVA 5TQ2B 1E1CA 1DBVO 2HU2A 2R1VA 1NRJB 4A1FA 3NP7A 3AEKA 3EG9A 3UENA 1QGUA 2ZTHA 2HSEA 4G24A 1YKSA 4ND5A 2J1LA 3VOAA 5F9FA 1MEOA 1Z38A 2JH9A 1RLUA 1IRXA 3FD8A 3QA9A 2I0FA 3DWFA 1KOGA 1OU4A 4PY2A 1KEEB 1M8PA 5LA6B 3OJEA 3JQAD 1X0VA 3MF4A 4ZHSA 1UANA 3R44A 4U0JA 1L4LA 4J2OA 3SQWA 4MIKA 2RGBA 3C6XA 1ZJ6A 2WKSA 2BJVA 2RH8A 2W2NA 1ZWKA 4QXPA 5F5LA 2CXOA 3HB4X 4JYAB 3ZGLA 1I3OA 5CJ2A 3REGA 3DZIA 5FULA 2B2CA 1U9CA 3CLUD 3RVOA 3VPDA 5KBYA 1UXKA 2HJWA 3M5CA 1CUDA 1OLUA 3AR9A 3A3YA 1MO4A 3OQBA 1MZVA 4LJYA 4RA9B 1LJLA 3TF5A 2PGJA 4OXKA 2A92A 3BZBA 1E1RA 1UMDA 4EVIA 1RXWA 2QOEA 1WQ1R 3A6PC 2AZ4A 2VWQA 3ORRA 4YJ3A 2YH2A 3ZNOA 4JDPA 5FYQA 4WBNA 1G19A 2PRYA 1H6BA 4G0ZA 1EZZA 1K0FA 3O5AA 4EW6A 1E1YA 4WEOA 2VF8A 4ZVPA 4ER3A 3UKOA 3C1UA 2I4OA 1DCTA 1T5HX 1U7XA 2RI0A 3Q4GA 4DXHA 1LRKA 5CLHA 2P0YA 2VQDA 4L2IB 2EP5A 4HYTA 1V5IA 1T10A 1TM3E 1E6CA 4WTOA 3O31A 5JS2A 3OHMA 3NBZC 3OY7A 4BJ5A 4YIHA 3IXLA 2C0PA 1Z34A 4CYMA 5B58C 1ULTA 5K0CA 1ZKMA 2XMPA 3PX3A 5D3ZA 2MMCA 1C0LA 1QHSA 4WLVA 2J09A 3W79A 1C7RA 1WD7A 1RC8A 3MWGA 2Q9BA 3OE5A 1AKVA 4U2EA 2WG1A 3WFZA 1B26A 2WVHA 1YQEA 1SFRA 4URFA 2P68A 5LQRA 3S1SA 5EP4A 5CT5A 4C4SA 2YZGA 1EYZA 1A76A 1E69A 2CUKA 3IPLA 2PMEA 1XL1A 4HAIA 3WNDA 3ECAA 2QA5A 5C1IA 3CLSD 3DBRB 2B1IA 4YJ2B 2XBLA 3CLTC 4XQEA 1Y6GA 2OCIA 4X20A 3KTDA 4Q48A 2C9MA 3VDNB 1QUEA 2ES4A 2GEVA 3P26A 5FA6A 1B74A 3UIEA 4YJ3F 4P6VF 4G0UA 4WBNF 5NULA 3JWJA 4OSPA 4C5AA 1XZMA 3W05A 2XY4A 3TFWA 5GINE 3PD7A 3BXZA 4DSAA 4W6QA 2JGNA 2CMDA 2C59A 1E64A 1U0OC 2CVQA 3H9GA 3PXUA 3CNEA 1MN6A 1CQIB 1L7DA 2P91A 1UMBB 4KYIB 2Q27A 3WIBA 3AG6A 2WIFA 5EIBC 2V7UA 4JC5A 3ZBQA 2QV0A 2PX4A 5J1SB 4N65A 4P80A 2XCOA 3BORA 5JI2E 3MWLA 3OCVA 2DCMA 2XDQA 5DNVA 3G9UA 3IAAA 1DJNA 5I5EA 4BO2A 4LOAA 1V4VA 4YVFA 4K8OA 3TUZC 3OX4A 1PW7A 2I1WA 1M8KA 2PJUA 1ZBDA 3GUVA 1Q74A 3OIYA 4HLDA 4KQ9A 1J97A 1EXNA 3CBGA 4QSMA 5KYNA 4QDXA 5M2QA 4YMWA 1XDWA 2C2BA 2Q5IA 1A8SA 4LZLA 2XYGA 4J0FA 4ZQFA 5K3FA 2XX3A 1E1DA 1XQYA 3R7BA 1G3IA 1UZAA 1L7AA 2QN1A 1JFSA 2LW7A 4J1NA 4LNUB 3B2QA 5A3RA 3CGGA 3Q3HA 4D98A 5KQPA 1CDZA 1NFFA 2K4MA 3CEAA 3LLCA 2M6SA 4I9UA 4XFJA 5FADA 3WGOA 2FZ5A 3X2SA 4B3TB 1L6IA 3A14A 4HB0A 4C0QC 3P2YA 1PL8A 2W70A 3WL8A 5C52B 4BZWA 1IXYA 2V59A 4A36A 3QW2A 5JH7B 1ZJ4A 2W7TA 5G0UA 1IB0A 1OI2A 1GZDA 1KFKB 4F1KA 2YWXA 2VT2A 3DVRX 1A9OA 1KSJA 2JCSA 2PS3A 4W5JA 4YP6A 1LBTA 3D3JA 4GLBA 5K4HA 2HF2A 4QBHA 3MERA 4FN5A 3LC2O 5LZ9A 3QI2A 2GNOA 1JFVA 3C8UA 4N7JA 4I6GA 1ACMA 3MGKA 3VNSA 3H17A 3EOZA 3KHUA 2HWUA 4MPJA 4AZVA 1KKLA 1ODKA 4TL6A 4PG8A 1I5OA 5DEOA 3D54D 4Y8VA 1CRLA 3ZDFA