4HDOB

Crystal structure of the binary complex of krit1 bound to the rap1 gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
163
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krev interaction trapped protein 1
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 163
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdoB00
1QRAA 1FNNA 2HUPA 1QHSA 5JJKA 1SVSA 1YZGA 5JJIA 4MKGA 4CYMA 1A82A 5CDFE 3C14C 2ZU0C 1GL9B 4Q7JB 5DGXA 4F93B 2O8BB 2H57A 1X8KA 3KXIA 1P7CA 1F2TB 1U8YA 4A0FA 1T0JB 1ZNXA 2HXYA 4RFSB 1UJ2A 1L8QA 2ZJAA 3NKVA 4DUGA 1NF3A 4M21A 3ZJYA 4D25A 2FPLA 4LPSA 5EQTA 5BWMA 1R0YA 2J5XA 4EJSA 5EE3A 5SZJA 2IBMA 2F1RA 2PZFA 421PA 4AD8A 3AQ4A 1US8A 5LB4A 3EZFA 1G3QA 2WWXA 1EFUA 1OXUA 2E9SA 3EZ6A 4JZKA 4PC6A 3AUXA 4NONA 3VU9B 4C0HA 2BKUA 4HB3A 4HB0A 5H70A 4LDJA 5K8TA 4PANA 4QHYA 4URYR 3R9IA 2GESA 2JLSA 3ZZ0A 3LBIA 3EZ9A 5CYPA 1JB1A 4RY2A 4LJ5A 1LF0A 3RS2A 4PQYA 5KSPA 1JR3D 5FTKA 2JLUA 3KJIA 4DLYA 3DVLA 1CTQA 4IDNA 1W4CA 1HYQA 1E1RA 1G21E 4Q9JA 1R0XA 1ZJ6A 3PUYA 1Z22A 3WYGA 3K1JA 3HPQA 5DYGA 4PR0A 1Z0DA 2QTFA 2H7VA 1LS1A 2F9LA 3CH4B 4A0HA 1NLZA 1KI1A 2G77B 1ZUNB 3PEUA 4EPTA 1BOFA 4Z54A 3U44B 2ZI6A 1TAGA 3I8SA 1II8A 1YZLA 4TYYA 4D4KA 4K46A 3VR1A 3QI2A 3TUZC 3FHTA 1X6VA 1JJ7A 4Q18A 2BM1A 2NG1A 3H1TA 1WB9A 1DAGA 2AWOA 4F38A 1MO4A 5FH9A 1JR3E 1ZD8A 1OKKA 3DZDA 4EQ6A 4XWAA 3D6TB 1KO5A 5DI3A 1OF1A 1IOZA 2OILA 1U0LA 2CBZA 1A4RA 4I1VA 1IXRC 3HJNA 4U7DA 2ZJ2A 4PPNA 4OQLA 3SJZA 4DCVA 4JSYA 3GEIA 2WIBA 2XJ9A 4HB4A 2QAJA 4B3FX 2VHTA 3ZVNA 1G5RA 1GZSA 1R0WA 4JJKA 4Q4JA 2X8AA 4BFUA 1E0AA 4LPKA 1S3GA 3W6NA 5EZ5A 2ZXUA 1FX0B 2R2AA 3KFXA 2DY1A 4I81A 2BV3A 3BB1A 5CK4A 4IVRA 4KXFB 4RZUA 5E7IA 1G8YA 1P2TA 3UG7A 4QJ4A 5FPHA 1Z07A 3K9NA 4XWOA 2IXEA 2WKRA 5C1BA 4HDQB 4FCWA 3H84A 4B48A 4AURA 4GDFA 2CK3A 4C0KA 3CNOA 2ZYTX 5FOWA 2F7SA 4Q47A 2QAGB 1VCOA 3LO5A 3BWDD 3ZGXA 3IO3A 3EPKA 5F9FA 2XXAB 2J0QA 2RCNA 4DLVA 1LY1A 3HR7A 3TAHA 4HEJA 3UMSA 2P67A 2GCOA 2YNMA 3CX6A 1S1MA 1CJMA 4P32A 4MKIA 2V4ZA 3QKRA 1T8UA 3L2OB 1E9RA 3BRWD 3H0KA 4LC1A 5B64A 2VP0A 3B1XA 4DIEA 2YWEA 2FZ4A 3OEHD 4BRWA 4JL5A 4KSCA 4WBSA 1ZM7A 1XPOA 4TL9A 4BWYA 2PEYA 3FOZA 3E1SA 2F1JA 5KNBA 2RHDA 5DN6D 3TUIC 5BXQC 3Q5DA 1OH6A 2O8BA 2WKPA 2ZAOA 3U7FB 1QVAA 3GMTA 3DOEA 1KK0A 5KOYA 1XEXB 2ZS8A 1F2TA 3PEYA 2QI9C 4RFSA 2WJHA 2ZETA 2F43B 1GNQA 2J7PD 3QG1A 1VECA 2ZRNA 4WXRA 4CRWB 2C2HA 3WXMA 3WNBA 3CRQA 4B2PA 1JXMA 2C5LA 4ZCIA 4QHTA 3GLFB 1Q1EA 4GP7A 4TWZA 3VKWA 3FGNA 1T3HA 3QBTA 5B57C 3TJZA 1XD9A 2I1QA 2PH1A 4RKEA 3VU9A 4EFNA 1FTNA 2GJKA 4X8OA 4XSGA 4IDPA 5LB2A 1M7GA 2HT1A 2R6GA 2H5EA 1G291 3B2EA 4IEEA 5FR2A 4ABYA 2O8FB 2R6CA 3JZAA 3U2QA 2XNDA 3T1VA 1VHTA 3IEUA 2FEOA 5A5GA 3PVSA 5JRZA 1OXTA 3WYFA 4Q7KA 4B76A 1I4LD 2ZI3A 5FI1B 2B92A 1ZNZA 1W36B 1XU4A 3N2EA 1E4YA 5ELXA 2F3RA 2VL7A 1N6LA 3P20A 1GM5A 1ZVQA 4QBFA 3VKGA 1S3SA 4Q1CA 1EWQA 2J7KA 4JLAA 5AUQA 2A2ZA 4EAQA 2XZLA 1SVKA 1X3SA 1Z8FA 1U9IA 3THYB 1M74A 4IXNA 1Q1ZA 2B6HA 3OEEA 4IVQA 5SZHB 2VHCA 1KNXA 3VR5A 1NSTA 2WM9B 1GFIA 5FR1A 1AS0A 1XMIA 3CX7A 4LJYA 3AEZA 2EVWX 1OYYA 3U44A 3UMRA 2BVNA 5J4LA 2O0JA 4FN5A 1X8LA 4RVCA 2ODEA 3ZZTA 3A4LA 5GJBA 2G6BA 2YOGA 3VNVA 2WIAA 2I3BA 2IL1A 5E4FA 1Z0JA 2EWWA 2EYQA 2Z4RA 4UKDA 4JT2A 1ZAKA 2XB4A 1G8FA 2ZE7A 1ELOA 2IUTA 3WNDA 3RS0A 3QXCA 3C15C 3CZQA 4MRPA 1RYFA 2OO7A 3IKJA 5JMTA 1OPXA 5FBWB 2P5SA 2BJWA 4B3XA 3RLFA 821PA 3IHWA 4NZYA 4QGGA 1DS6A 3K09C 4B2IA 5IK2A 2ZYVX 3BXZA 2J45A 1CJTC 4DJTA 1PUIA 1W44A 1MO5A 4I1SA 4JLJA 1KTVA 2BBTA 2D7DA 1FX0A 4NPHA 3GP8A 2WWWA 2JJ1A 4DVGA 4G5QA 5DYIA 2QA5A 4N0DA 4M1WA 5TMPA 5FTMA 2C9YA 2QRNA 3DMNA 2RAPA 4DWJA 4EPWA 4D4LA 1XPRA 2QAGA 2OG2A 2D2FA 4UNNA 3R8FA 2HYDA 4BASA 4QJ5A 1E2DA 4IDOA 2IYQA 4ZPXA 1KSGA 4MITA 4PPFA 1EFHA 4DC9A 3K0AB 2Q9AA 1ESNA 3T15A 4A0RA 4TLBA 1E99A 4YONB 1Z5ZA 1NVVQ 1SKYB 1MT0A 3TMKA 4JLBA 1FQJA 2F1HA 3HWSA 4YC7A 2GBLC 4D2IA 3OFNA 1NY5A 2ZVQX 3K0CA 4AG5A 3OE7D 2FFAA 1CXZA 4L9SA 1N3BA 3U60B 4LHVA 2XSZD 3B1ZA 2AXPA 4QNMA 1VIAA 1XEXA 4KITB 2LCFA 1E2PA 2FX3A 3D8BA 2HDNB 4HUQB 2CL0X 2BKEA 2F43A 2EFEB 3T34A 4LJ6A 2F6RA 4QM6A 2ZJ8A 4KJZA 2DWPA 4PHTA 2IK8A 4GP6A 1AZSC 3GLFA 4D0GA 1VG1A 5LD2B 1W2HA 3DO6A 4HI0E 4S2EA 5C4GB 1RIFA 4X8HA 2RGAA 2OBMA 4QGFA 2FSFA 2W6IA 2O8EB 2GEDA 5E7MA 3BBPA 1TU4A 1XMVA 2O8FA 1DAEA 5EXSA 3RHFA 2RGDA 2XTNA 4TQAA 3GLGE 3BFXA 2LWIA 2C99A 1R5OA 2FSGA 2D3WA 1HE1C 2V54A 3CZPA 4PXAA 1E0KA 5TVKA 2QE7A 1XEWX 3NVAA 3QOFA 3G82C 4GZLA 4LYJA 3OF5A 4EPXA 3CO5A 3ZS8A 4AC9A 1WA5A 1IN4A 2KI5A 3CONA 1LVGA 2A3RA 3CPEA 1GRRA 2BBOA 4JMPA 1FMLA 2P6UA 4DZZA 3THYA 2ZRFA 2OFOA 2ZI5A 2BHRA 4B71A 2CE7A 2KSQA 1G6HA 1HY3A 1W46A 1GSIA 2WZQA 3C5HA 2VO1A 3KQKA 4ESHA 2YC2C 4B73A 3WRYC 3RC8A 1H8EA 1WMSA 1DELA 2YC4C 5FBLB 3V4RA 1BS1A 2FF7A 3IIKA 2HLDD 2D62A 3LW7A 1AN0A 5AJZA 2G9NA 1G41A 3SC3A 1W4AA 3ZQ6A 4IJMA 3DMDA 1HA3A 1XZPA 4MYTA 3K70D 1IN6A 2DBYA 3QNUA 2GRJA 4C0QC 4HZIA 3WHLA 3L8ZA 1YZTA 5TARA 2IF2A 5HPYB 2QNRA 5KU1A 2YVUA 1OXSC 3T5GA 3TVDA 1NRJB 1Q1QA 1JEDA 3VNUA 4Q1DA 1XMJA 4D0NA 1EFRA 1G20E 2K5UA 1N5LA 4C0SA 1IJFA 3LRPA 8OHMA 3Q85A 1XXHE 3SHFA 2V7QA 4Q00A 2WV9A 3TUJC 2D4HA 2V6IA 1KDOA 2ZRAA 3SYKA 4XD7D 1XTQA 2A7QA 1D2MA 2JDIA 4IOMA 4Q1FA 3KKMA 5L3VA 5GJCA 2QP9X 3BGWA 5E7JA 5FPSA 2QU8A 1UBEA 2A5FA 1BH2A 4GMDA 3V00A 5JI2E 1WE2A 4MYHA 4OI1A 2JCSA 1N6RA 4KO8A 1NJFA 1EG7A 1I4DD 5BW8A 4MGYR 2FH5B 3ICQB 5SZIA 1CR1A 3E70C 4Q4AB 2FDCA 3K0AA 2VIIA 3CR7A 3TKLA 3LA6A 5F98A 4QGAA 3O8BA 2QBYB 2OSBA 4HDCA 4M9SA 3AVOA 1TU3A 2BCJQ 3RC3A 2WSSD 3ECCA 3U7EB 4DB4A 4F4JA 4ARZB 2CXXA 1BIFA 4AKGA 1KMHB 3LWNA 3EG5A 1JPNA 5JCPA 3EPJA 2V3CC 2JLZA 4FI3C 3B13B 1SHZA 1RVDA 4TSFD 1KYIA 2IS2A 3GJ8A 1DBSA 2CHGA 4RKFA 2GJ9A 3TSZA 1G3IA 5DHFA 3ZD6A 3KKQA 1XPUA 3WMGA 2NO7A 5DE3A 4HUQA 1HURA 1EFTA 2JATA 3RVBA 3WY9A 3VHLB 1E98A 1BYIA 2YKGA 3UANA 1CJUC 4IOJA 4P4UA 2FE4A 3LXRA 1BMFD 4X8LA 4A2QA 4FWTA 4JVLA 1K5GA 2EU8A 3IDQA 1MH1A 3Q7PA 4PPGA 4RD2A 1E4VA 2GAOA 3KZ1E 2OXCA 2WAYA 3HU2A 2EW1A 3FTQA 4ZDIA 2XAUA 2WHXA 2PMDA 2PZEA 2RGBA 4M9ZA 1XEWY 5P21A 1G7TA 3BB3A 4F4CA 2J41A 2FNAA 4ERNA 4TL6A 1E9FA 2DPXA 2W83A 4C0LA 2O8EA 3VTKA 3QKUA 2QRZA 4OHVA 1E2GA 1Z06A 2IYWA 4XSHA 2DCUA 3IIJA 2JJ8A 2OEPA 2HCBA 3THWB 3KL4A 3AVQA 3PUWA 3U3JA 5GADl 3FMOB 1W4RA 4P4TA 4BFYA 3CF0A 1OXVA 4JT4A 2L0XA 4LUCA 4US0R 1RRCA 4NYIQ 5HCIA 1YVDA 3FFBA 4DLXA 4IXMA 2D7CA 5FOVA 3OZXA 3FMFA 4XH9B 2C04A 2XITA 4LSGA 1DOAA 1V5WA 1UM8A 2F9MA 2XZOA 3JVVA 1XD8A 1G4AE 4FCVA 1U8ZA 2ZRHA 4HB2A 4HDOB 3CX8A 4TZ0A 5FI0B 1SVMA 1XJ0A 1UBFA 3AKCA 1N6NA 3QXJA 3QG5A 4PO8A 1UFQA 2A9KA 2ZJYA 1EESA 2V8OA 2RHMA 1VCMA 5AR1A 1NBMD 4KCGA 1L2TA 4B35A 4DSNA 1L4UA 5C46F 1QF9A 4HATA 3OIVA 3EA5A 2BIFA 4PSVA 2YJTD 3NH9A 2MMGA 3MJHA 5BQ5A 1KJWA 1T8TA 1T3SA 1COWA 4EIWA 3EASA 2GCPA 4XJXA 3GQBA 1LTQA 3SYLA 3U6BA 1E6CA 2XOKA 3PJRA 3LDAA 1E3MA 5C18A 4PC7A 5E95A 2OUKA 4ILEA 1T91A 2YWGA 1R0ZA 3CH5A 3B1YA 1GKUB 1SVWA 4TYNA 1Q20A 1Z08A 3GJ5A 5FL7D 4B6FA 3RS4A 3KQLA 4BLPA 2KB0A 2H1LA 5J4YA 2BMDA 3R20A 1UDWA 2JJ2D 1JI0A 1XTKA 2X2EA 4P31A 4DLSA 2ZS9A 1G1MA 1VG9B 1J99A 1W0JA 1YR9A 1E94E 1B23P 1TMKA 2PEZA 3NBXX 1KAGA 1NBME 1N0VC 4HSEA 3REGA 4A2PA 4OQXA 4RCZA 5GJVC 3L82B 1GL7A 2ZRGA 3LQRA 4YXWD 4YQFA 3Q7QA 3SQWA 1II0A 1OSNA 2GDJA 2QM8A 4RCYA 2Z5FA 4ACBA 2O52A 4G5OA 1NY6A 4W9MC 4PC3A 4M1MA 3W8NA 1IXZA 4I1OA 5JEDA 4OK5A 3A1VA 1E1QA 4LBVA 3FPAA 1Z2AA 4Q4AA 2ZRPA 4BFVA 2W00A 4WXPA 2ZVPX 4DBLC 5KHOC 1P75A 2QBYA 3OAAA 4TT3D 1Z3IX 4UNPA 1CRQA 1BKDR 4JLMA 4ZI2A 3VR2A 2QUZA 2VRWA 5CDFA 4ARZA 1G16A 4RZ2A 2C8VA 1KMHA 1W47A 4Z8XA 1SZPA 4KAXA 1WXQA 2PT7A 4HLQB 4BZXA 1W5SA 3WNCA 2ZI7A 2CEAA 3B9PA 4QBIA 2FA9A 1KY2A 2CNWA 4BECA 2VSFA 4PQFA 4R2IA 2OV2A 2FMXA 3M1IA 1O87A 1WP9A 3DM5A 3RRYA 3GFOA 3K0EA 3HPRA 2ZANA 2EFDB 1RFLA 5BYJA 5CYOA 4M1SA 2SHKA 4NCIA 3REFA 4HAVA 2AXNA 1EXMA 1UKVY 1ZIPA 1CP2A 3QUSA 1K5DA 4DSTA 2XEXA 4Q48A 5CK5A 4DSUA 4WZAE 4EFLA 2AK3A 2ERXA 2A5GA 5J4HA 2HYIC 5G41A 1Z6GA 3BH7A 5KTYA 1E2JA 2WMNB 1OW3B 2MSEB 1SKQA 3SU8A 3HU3A 2NQ2C 3I61A 4WOPA 2GJ8A 4IOKA 4C0JA 3THWA 4YMWA 4UNRA 1E2LA 2G0NA 4R71A 3L0SA 4ZDWA 3EZ7A 2VSXA 2AKYA 1JXOA 2G0TA 5EE0A 2FV8A 2P0EA 2XTZA 3IEVA 3MWLA 2N1BA 4HAUA 4AK9A 4Q4LA 3A1TA 3ZDQA 4CEIB 4JKYA 3B1WA 4AYXA 1SQ5A 5CITA 2EQBA 2IA5A 4NTZA 3TBKA 1XCGB 4KSBA 4I4LA 2CHVA 1F2UB 1X86B 2VHJA 3PITA 3IIMA 4BFXA 3I3SR 1R7RA 2WWFA 4IFBA 4TTQA 2PLFA 2HJGA 4BLTA 2ZUDA 1WCV1 1UBGA 4BFZA 3MAAC 3LBNA 1KI2A 3I4LA 2EYUA 4AIIA 2ZQ5A 1ZP6A 2QY9A 2ZI9A 1H8HD 4KBGA 1ZM2A 5D3MB 4HLDA 1WBBA 3TGPA 3UWOA 3TIFA 2YWFA 4CT4B 1DVRA 3DEFA 1M34E 5HE8A 4XWKA 1DAHA 1JR3A 4PC2A 3P32A 2F1IA 1TTTA 3RSLA 1JR6A 1LFDB 3P4YA 2RGCA 3A58B 1CJKC 1MR3F 4LBYA 2X19A 3R8CA 2RGXA 3IILA 5FPKA 5CIQA 4YMTA 3DZ8A 4V0ME 4A4DA 1T3LA 1XTRA 1AQUA 3C41J 2BJVA 2D74A 5FL3A 1KO4A 3Q9LA 1NNEA 4P3YA 2G83A 1CR2A 4M1KA 1UPTA 2WVJA 1Z28A 3AB3A 3L8YA 6Q21A 1NJGA 4LWZA 4WAUA 3TR0A 1E0JA 1XRJA 3ADBA 4TMXA 1ETUA 2Z4SA 2CK3D 2ZRJA 4OHXA 2CCKA 4US2R 1OH8A 1VPLA 4W5JA 2QPAA 3KTAB 1GOTA 3W90A 2H18A 1UADA 2QQEA 4Q02A 2WBLC 3Q72A 4B44A 1SXJD 3C7KA 3LAWA 3RS5A 2ZI4A 3AKEA 4AWXA 3IGFA 2QSZA 4GOKA 4AKIA 4TZ6A 1DO0A 4D4JA 5TY0A 4ZKDA 2IYSA 3EC1A 2BCGY 3EPLA 3O47A 3BS4A 4A8JB 2C03A 5JRJA 2CL6X 4B43A 3O8RA 5JCZA 4YMUA 2GAAA 3CB4A 3TQFA 1E2KA 4A0GA 4RD3A 4DT1B 4OI2A 1KI9A 2A5JA 3UPUA 4TL8A 1KZGB 4CDGA 2MSCB 4DDWA 1AQYA 1KZ7B 1ZUIA 4KV9A 5H8WA 2JA1A 1E79D 3SDZA 2X77A 1ZC3A 3PV0A 4GBMA 4NHOA 5L3SB 3AF3A 4W5HA 2Q21A 3KUCA 4HAWA 4KFUA 4LC0A 5AJXA 4MA4A 1KI4A 3EIHA 1P9RA 3EWAA 5DI9A 2IS1A 2C9CA 1OFIA 1SXJE 1W5TA 4BFSA 1ZCAA 3AVUA 3NC1C 4QG7A 2FN4A 1UKEA 1NMXA 2H16A 3I1FA 1DARA 2ZR7A 4CIDA 1KK2A 1AIPA 4Z1MD 5JBQA 2ZJBA 4LV6A 5J40A 2LKCA 2GZHA 3KB2A 1UKZA 1ZNYA 1GDDA 2GILA 5EP2A 2ZROA 3NEYA 4LGMA 1J8YF 1ZYUA 3MFYA 4EPRA 1JPJA 3AP3A 2QTVB 5H1YA 4DB2A 3OEHA 3VX3A 4AKEA 1U94A 4D4MA 2AK2A 2R9VA 1G8PA 2P3SA 4JLNA 4N3NA 4U02A 4BLOA 4XVUA 2WPDD 4DDTA 2J87A 3VR4A 4GT1A 3GEHA 4AG6A 2O8DB 1Z47A 1NN0A 5DN6A 4PHHA 4DDVA 4OQFA 1P3JA 2P65A 1C1YA 3OIUA 2C98A 2UZ3A 4RD4A 5JS7A 2ZE5A 4ZO4A 5KSOA 2DB3A 3GJXC 5IHPA 1AGPA 1G4UR 1LS6A 2YV5A 3B7GA 3UATA 3RSOA 3NBFA 1EWRA 3AH8A 4LHXA 2EFCB 2Q3FA 2J7PA 2NO0A 1GRNA 2OT3B 4CEIA 4OHZA 1SULA 4NL4H 1KIMA 4JLPA 2WJVA 4OK6A 1DAKA 2UKDA 1GITA 3HR8A 1F2UA 2V1UA 3AF2A 1P2SA 4OK3A 4R2HA 3GCGA 1GNRA 1F5NA 1YE8A 4PSAA 5FBQB 1J90A 1NIJA 3FB4A 3AKYA 3AVWA 1OH5A 2JEOA 4KU4A 3W6OA 3ZS9A 2HT6A 3QVVA 1QVRA 4GZMA 1A5TA 5D3MA 4L15A 4JKIA 2B8WA 4G1UC 5AUNB 3JZMA 2QORA 1JAHA 3W5JA 2IYUA 2FG5A 4UNSA 2W58A 3SI7A 3AKDA 2WWGA 4EPYA 1EGAA 3TH5A 2BMEA 4C3ZA 3U6KA 3LFUA 3BB4A 4I99A 1G8HA 4RJLA 4PZZA 1FQKA 5LDDC 1AK2A 3RRNA 1SXJC 2VLIA 4MRSA 3D31A 1HTWA 1MO6A 2FFQA 2IF0A 3NXSA 5EE5B 3PIRA 4FMDF 1NSFA 2PJZA 5JS8A 1A2BA 1NMZA 1NN1A 1RRFA 2VQSA 2FWRA 3EPHA 5GVSA 2Z43A 2DFLA 1EFCA 2ZREA 1XXHB 3IBGA 4WW0A 5CM9C 3BK7A 4ZCLA 3HU1A 2P2LA 4MH0R 4PSKA 3AVVA 2CJWB 4KFRA 2ZRKA 2CMKA 4UJ3A 3KTAA 2OCPA 2QL6A 1E2QA 4F4IA 1OE0A 2REOA 1TF5A 4TLCA 4BZPA 2KBEA 3Q3JB 1R8QA 2CCJA 2DWQA 2WAXA 4AKHA 3QF4B 1QHXA 1T4GA 3K70B 4CEHB 3U3KA 621PA 3X1XA 2W2TA 3AF4A 2OAQ1 2GK7A 4LJ4A 2FEMA 2QGNA 2RKOA 4BE7B 3KJHA 1NVUQ 1IONA 2J9RA 3LQQA 3ZH9B 1NI3A 4A8JA 3IQXA 4MRVA 2QPTA 2A5YB 2W0MA 1HUQA 1T6NA 2ZR0A 3MWYW 5DLQC 4DT1A 3LX5A 4KFSA 1KKLA 4A92A 1OJLA 5FOXA 3TRFA 3QEJA 1DE0A 4FMDB 3ZLJA 4DCNA 4KLZA 1AM4D 2P5TB 4DLUA 4ZI3A 3RNLA 5HCNA 2IYZA 1DPFA 5L3SA 2AL7A 3W5IA 2KBFA 2OM2A 3AV0B 2BWJA 2WWYA 2O0KA 2VF7A 4LYAA 2ZRBA 4W5WA 3U7GA 2ODWA 3NDBB 3X1WA 2Q9BA 4O0MA 2R62A 2WMOB 4NMMA 1KI6B 2YINC 4L4UA 3DOFA 1G19A 1TQ2A 4IDHA 4WA7A 4QKQA 4Q7LA 3A36A 4BEJA 4US1R 1N0WA 3K9LA 1Q3HA 3BE4A 4QOSA 2PL3A 3BORA 3D7MA 4KVGA 4M9XA 4PFSA 5AJYA 1JECA 1AKEA 4GOJA 4C9BA 4DCUA 2GJAA 2CL7X 1LB1B 1Z6AA 5B2ZA 3ZVMA 3DKVA 4IFEA 3NHBA 4LYFA 2FGJA 4H1UA 1Z6TA 4TQ9A 2R8RA 4L16A 5FOUA 1UEJA 3U4QB 4IKEA 4E5UA 1NG9A 1CKEA 1F6BA 2O8DA 2GVDC 3OE7A 3CRMA 4M22A 3SBEA 2PT5A 4B33A 3BFKA 1L7VC 1QDEA 2XSZA 2ZS7A 1OFUX 3NHAA 5BN5A 1Q1BA 1G3UA 5C4MA 2QP4A 1KI3A 3N2IA 3ETLA 1PUJA 1TUIA 4K81B 1OT3A 4D80A 4TYPA 1Z63A 1G7CA 5FOSA 3A37A 1R5BA 3TAUA 5JLJA 5FPYA 4MRNA 4BFWA 2ZIAA 4M1TA 4Z51A 1Z0AA 5FTNA 2NMVA 1Z0IA 3SOPA 1ZUHA 5CJ2A 3MLEA 1IQPA 3QXSA 5G53C 3R7WB 1VCNA 3QPVA 1NL3A 4KODA 2W6JD 4PO9A 1D5CA 2HF9A 2PX0A 2WOOA 3AP1A 1OV4A 3FVQA 4U00A 5FBVB 4MKHA 2GA8A 1W1WA 3KDSE 1JALA 4G5SA 4I1UA 4B74A 3G5UA 1PLLA 4HAZA 2NGRA 2GCNA 1IJEA 1SVOA 4QL3A 3PUVA 3W3AA 3AGQA 3F5FA 1W4BA 4FCTA 2Q0HA 1XMSA 1E9SA 2GVZC 2ZAMA 1RC8A 2W0SA 4FMBB 1Z6YA 5KPDA 4B3GA 2QAGC 3UWKA 5AK0A 3B5JA 2YWHA 3GLHE 2VP5A 1TQ6A 3BD9A 3NG1A 2RGNA 3IPXA 3CPJB 5JWOA 1RZ3A 2Z0MA 3VFDA 2HCJB 5FUXA 1XDBA 1JNYA 1XXHA 4D0LB 1Q22A 2JAQA 1N6PA 2MMCA 3L0IB 3BAFA 2ORWA 4D82A 5EP4A 1QHGA 1YHNA 5IDVA 1XTSA 2ATVA 2CJWA 2REBA 1E2NA 3DM9B 3I32A 4IHQA 1XWIA 1CF4A 3K0CC 1VMAA 3SNHA 1U90A 1XFAA 2ORIA 4HAYA 4Q21A 4K8OA 2GNOA 2DHRA 1T5IA 2HLDA 4M2LA 5JHGB 1U0HC 2B8TA 4BQSA 3WMFA 2E87A 4XTCS 3I62A 5JZVA 2C9OA 1KO7A 3QF4A 3NIBA 2JLVA 3SEAA 2AR7A 1G7RA 5FUYA 4CEHA 5IF9A 3MMPA 4URUR 1FMJA 5JFGA 1VYTA 3LVQE 3UG6A 3U3OA 4FMCF 4ZV4A 3X2SA 4DLZA 2OAP1 5DISB 5EE1A 1TQDA 5IRCD 4LYHA 1RKBA 2D06A 4LK2A 3VKHA 3X1YA 3CR8A 4MGIR 1S9HA 2Z83A 4URZR 1VYVA 4GI7A 4QBHA 2IHYA 1D2EA 2O0HA 4RZ3A 4V0NA 1XCPA 4Q5IA 3B78A 2XJ4A 3K9HA 4XD7A 4HUTA 4DCSA 1XF9A 1KJYA 3B85A 3VQTA 3H4MA 3L0PA 3PR1A 2GXAA 4M4SA 3AVXA 4HAXA 1DG1G 3LX8A 3UKDA 1YZQA 2ZPTX 3DKPA 1KI6A 3EZ2A 4BUJA 1Z6XA 3QPWA 2WTUA 2QMHA 1AA9A 1SVLA 3GJ7A 1OFTA 3SE0A 1GKYA 2WKQA 1DO2A 2WJYA 3P27A 4O2LA 2QT0A 4UNQA 1YR7A 2DFTA 1AGRA 1PJRA 3LNCA 3P1JA 1J2JA 1DTSA 3QE0A 1G7SA 2YOHA 1E9BA 4FMCB 4EPVA 4ASUD 5EE9A 1HQCA 4EDHA 4JLKA 2AHOA 4FXPA 1GUAA 2NO6A 2WSSA 3RS7A 5JSZB 2CLSA 1IY1A 2JLWA 1GTVA 2GF9A 1KO1A 1GIAA 4L8GA 5HKKD 1ZINA 3B60A 3U4QA 4QGHA 5TV2A 3CRW1 4IEIA 1XBTA 3ICEA 1CBUA 1S0UA 2VHQA 2ZU6A 1S1CA 4D81A 4A1FA 1RRGA 3CPHA 4LJAA 5C2JB 3WRXC 4TSFA 1FP7A 2IYRA 3KQHA 3BH0A 4Q7MB 5TB5A 3T61A 2ERYA 2F55A 2PLRA 5EP3A 2PJRA 4MKFA 4NDZA 3NEJA 5AUPB 2Z6VA 1BMFA 4LOAA 2UVQA 1KNQA 2ZTSA 3ASYA 1GRQA 2ONJA 3QIAA 4PZLA 3BH6A 1N6KA 2QPOA 3MWJA 3NH6A 1HQYE 5EUQB 3SJAA 2QT1A 3R7WA 1RJ9B 3CWQA 3ZIAA 2CCGA 3RANA 4XTRA 1MRNA 3EC2A 4E09A 5DNYB 4L9WA 2JIZD 5G40A 3BFVA 5E3HA 3HDTA 2OXRA 1IY0A 1JQLB 3GEEA 1DAFA 1JBKA 1I2DA 2JLXA 1DAMA 1YR8A 4KI0A 5KSZA 1TX4B 3FYHA 4BEBA 3FKSD 3OIWA 1SHKA 4MYUA 3UIEA 1NP6A 2BEJA 1M8PA 2OCYC 3QENA 3RAPR 5J4VA 2ODNA 4G0NA 1W0KD 2IS4A 1VDZA 2LKDA 4M53A 4TL7A 5HTKA 4S35A 3RS3A 2IYTA 4OHYA 1OHHD 1R2QA 1OFHA 5EP1A 2EWVA 2VYFA 1KKMA 4OQNA 1IAQA 1G5PA 4LY6A 5EXTA 1KI7A 1OB5A 1ZW6A 1CS4C 2PCJA 1P5ZB 4LRWA 1W7AA 4TLAA 2FOLA 2ORVA 1NBMA 3U3MA 2JGNA 4IOLA 4BRUA 4Q9KA 3GLIE 2VA8A 3K0FB 2IYVA 1FP6A 3SS8A 3IO5A 1DADA 2Y8EA 1NKTA 1ZU5A 2QN6A 4LV5B 5L3RA 1PLJA 1WRBA 5EZ6B 1OXXK 2H17A 5JEEA 4E03A 1Q44A 1ZMXA 3F0TA 3PG5A 4IDQA 4QFMA 3W9YA 2NTYC 2OCAA 1KJZA 2BBWA 3IUYA 2I1VB 4NCHA 4BGDA 1VYUA 4P4SA 5LD2C 2R44A 3U61B 4ON9A 1E2FA 3KB1A 2YYZA 3GJ0A 4P33A 5FL7A 4D26A 4OKSA 4GNKA 2ASEA 4TYQA 4OJKA 1Q57A 3RDPA 3ZZUA 4IVPA 5J47A 2JJ2A 3NBZC 1T5LA 3GFTA 3FDIA 4HLUC 4LBZA 1S8FA 2JLQA 3KUDA 1R5NA 1ZRHA 3IQWA 3Q5EA 5LPNA 2OLJA 2ZSAA 4WZBE 1SXJB 3SR0A 4DHEA 4DUGD 4RD6A 3MD0A 1Y63A 4RFVA 3U5ZB 3GFPA 4YXWA 1U0JA 5BYKA 1NVWQ 3CRRA 3VX4A 1KDTA 2QP3A 1HH4A 3CRVA 5G3ZA 1YR6A 4JYBA 4CW7A 1ZM3A 5KDLA 1G3RA 2J0SA 4Q4HB 1KDPA 1G17A 4LJ7A 2ZM5A 3IHLA 2IS6A 4TYWA 2IWHA 4Q19A 2GF0A 2OFWA 1PV4A 4TT3A 3T1OA 4BZQA 5JSZA 4A82A 3OESA 1P9WA 2BM0A 4TMTA 3VAAA 1D9XA 4H9GA 4V0OA 1A2KC 1GILA 3EARA 1IXSB 3MJRA 5F3WB 5CJPA 3HYRA 1P2UA 2FJUA 1E1RD 3PEVA 4QNRA 4OBEA 2YHSA 2RH5A 3C5CA 2HF8A 5EXPA 4CT5A 1CIPA 2ZRLA 3TE6A 4F91B 3C4JA 1FW6A 5DHAA 2XTMA 3SFVA 3MG9A 1NKSA 4UXIA 2ZYUX 1HV8A 3I5YA 5F9HA 5FFMA 2KE5A 1NLYA 4JJZA 1NN5A 4POAA 3ZYCA 2PBRA 3WHKA 5FOTA 1XTJA 2BMFA 5J5CA 221PA 2VTKA 4WZ6A 1VG0B 1CLUA 4YLGA 2HV8A 1E9CA 1RJ9A 3CF2A 4Z8YA 2V1XA 1AJEA 4AI6A 3RYTC 1N0UA 3KKNA 4GOXA 2NPIA 4LJ9A 1OKKD 4Q1AA 4B3DA 1A1VA 3CUEF 1ZCBA 1IN8A 4C0BA 4FIDA 4DLWA 4JL8A 4M9QA 1DG3A 4OL0A 2XGJA 2OHFA 3CW2A 1FTSA 1QBKC 2ECKA 4PTLA 3BJIC 3EXAA 2A30A 4Q03A 3LLUA 3Q8XB 4V0MA 1K6MA 1KSFX 1UBCA 2E1RA 2GTPA 4AYWA 5A4JA 2RGEA 1C9KA 3B6EA 3EIEA 1TL7C 1KK1A 4G5GA 1P72A 3AM1A 3MUFA 1KO8A 1VG8A 1E2EA 4A15A 3U3RA 3QSYA 3B9QA 3TK1A 4A6XA 2J0VA 2O5VA 3LV8A 2BMJA 4JLOA 1H8HA 1HE8B 1ZNWA 2FPKA 2WOJA 4KBFA 4KYIB 4C30A 4R98A 4JVNA 1Z0FA 1W48A 5UKDA 4OI0A 1IN7A 2JLYA 5B58C 2N46A 1AKYA 3KKOA 4P0TA 4YMVA 4XVQA 1ZC4A 2HXSA 3ND9A 4DLRA 2ANCA 2DFKB 3PXGA 4ZIRB 1ZBDA 4LX0A 3I5XA 3I92A 5BN3A 5JI3E 1N25A 3K0FA 3V4FA 1G6OA 2QTHA 2OE2A 5FUVA 3QQ5A 1LV7A 3NDPA 3SHWA 3W34A 4EJSC 1BYUA 3QEOA 4GRAA 3KQNA 4FW9A 2QMUA 4B3CA 1GVNB 2EFHB 4ZDKA 3R9WA 4A6PA 5GJWC 4GPTA 2VH5R 4URVR 1G64A 1FFHA 4M1YA 1TNDA 1S9DA 3TSOA 1ZD9A 4Y0AA 4NU0A 1SXJA 2AD1A 4A36A 1M1YE 5ANRB 3HYTA 1LNZA 1MO3A 2H8KA 1E0SA 2OCBA 3A1UA 3A1SA 1D2NA 4JBYA 1RYHA 3K09A 4DEYA 4WVFA 1G5TA 1XCMA 2QZ4A 4JBWA 3RWMB 3WBJA 1J70A 1VIYA 1NVXQ 2REXB 1X8JA 1HT1E 2P6NA 4PAMA 3SBDA 2MSDB 2D2EA 3W3ZB 3AGPA 2J46A 4Q4HA 2ZYWX 3LW8A 1ZM9A 1U2RA 3BERA 4RD0A 2AX4A 2G3YA 2QG6A 4TMZA 2XNDD 1NN3A 1OIXA 3SJBA 2I4IA 1I4TD 1XP8A 3B82A 1CRPA 1T9HA 3QBVA 2GZAA 3W6PA 1M7BA 2ZSEA 3PUZA 1E79A 4LBWA 1JEEA 5SZKB 3WYAA 2VSOA 3GLGB 3ADKA 2J3EA 4CVNA 2FZLA 5CLLA 4ZKEA 4V02A 4DRZA 4PC1A 3QXXA 3EWSA 4PO1A 1ZM4A 3MSXA 1GKIA 1PLKA 2A78A 2ZJZA 3BIFA 3LVRE 4URXR 1XB2A 5FTJA 3IPYA 3SFZA 1U99A 1KGDA 1E32A 4M0LA 3QKSB 4W7SA 3OEED 4JVMA 4NYJQ 4LJ8A 4Z1MA 1N6OA 4C0AC 3GPLA 1F3OA 1P62B 3AF0A 4E07A 4X8MA 4A9AA 2ZEJA 2GBLA 3W8RA 1FL9A 3CF6R 3E2IA 4G5RA 4Q1BA 3THOA 2IHBA 3MGCA 4NCJA 3LBHA 2WPDA 3TW8B 2VHUA 1U98A 3A1WA 5EJEA 2FSHA 1EX7A 2AD5A 4UQOA 3RRZA 1VTKA 2QMEA 2GETA 2QGZA 3L0OA 5H68A 3SJCA 1RPZA 1M6NA 4CF7A 1MABB 2C77A 3AP2A 1KI8A 1N2CE 2R6AA 3GLHB 1R10A 4MRRA 3TSWA 4NYJR 2QQ0A 1ZU4A 3FKQA 3KX2A 5IK2D 1N6IA 1GP2A 2GJSA 3JVUA 1ANKA 2OZEA 2QROA 4OQMA 3WP0A 4M1OA 2QEQA 4OYHA 3SZRA 1XJQA 3NC0C 1KSHA 2XX3A 3KXKA 2JJ1D 5HZKA 1II9A 2JASA 2ZRCA 1FZQA 2ZE6A 1Z29A 5FPTA 1FOEB 2NPFA 3FHOA 4OHWA 3SQXA 1OIVA 4PHGA 5JECA 5CB8A 4RSGA 3G0HA 1KHTA 1LW7A 5D3QA 4GSYA 5DSZA 4BLQA 4DKXA 721PA 4TQUS 5K8UA 5CLQA 5KDDA 5K8LA 3FMIA 1TUEA 4B32A 2WICA 2CVHA 3L43A 4ZIRA 4NCKA 1L4YA 3VMFA 2AWNA 2AN9A 1HEIA 4B3BA 4E22A 2XZPA 4OI4A 5BN4A 2B21A 4XIGS 4DXAA 1TQ4A 2BOVA 2IYXA 5KDOA 4GMXA 1M2OB 4NYMQ 3TNFA 3P26A 4EUNA 2ZRDA 1ODFA 4PZYA 3T1QA 5CM8B 1H65A 4YMSA 3NWJA 1QHIA 3SYNA 3CNNA 4JYCA 3THXB 4C7OB 1ESMA 4MDFA 3OFND 2BBSA 1E96A 4XVRA 2PZGA 2NIPA 1TEVA 1B0UA 4BLRA 3FMPB 2CDNA 2RGGA 4JIMA 4AYTA 1KY3A 3ASZA 1N5KA 2W2XA 1G3MA 2J0UB 3N70A 3EW9A 1MOZA 4QHSA 1N5IA 5L3QB 2XXAA 2ODBA 2PX3A 4PAOA 1YZUA 2NO1A 5KNDA 2Q3MA 1IM2A 3VHXA 3T06B 4MUAA 5FTLA 5KPJA 3GD7A 1Q12A 2GWHA 1WF3A 3UK6A 4DLTA 3PEWA 2PMKA 2ZUCA 4KHZA 2BDTA 4GL2A 3I73A 4NYMR 2HEIA 1Z2CA 3O8CA 3T12A 1ZIOA 3F8TA 2R6FA 3V9PA 2R6DA 1CU1A 5JWHA 2O8CB 1U9IC 2NZ8A 3M0EA 2VP9A 3N5CA 2ZR9A 2C78A 3I72A 5JWRA 2W6ID 2J1LA 3HP1A 4O2RA 4LV8B 1QZXA 1AZTA 3PENA 1UDXA 2Q9CA 3FE2A 1QG4A 2X1VA 5KO2A 5AUOB 1MRSA 4ACAA 1P61B 3KXLA 3LY5A 4YDHB 2BEKA 3U7HB 4TMVA 4TN1A 1XX6A 4CZ2A 4MUBA 3GLGA 1W36D 4HYYA 2ZRIA 2VP6A 1SVIA 2QE7D 4EFMA 3B1VA 2ZJOA 3BC1A 1P6XA 1OH7A 3GJ3A 2B7BA 2GKSA 4H1VA 1VKJA 2OFXA 4Q9HA 4HZUB 2QMOA 2ZUBA 3MRSA 1WQ1R 5JJLA 4J0QA 3S1AB 4B34A 2FU5C 4KFTA 5M04A 2ZSFA 3QJYA 2B7CA 4LHZA 4CEJB 5DIFA 1KOFA 1NVVR 3GLFE 1RW4A 4N0EA 2VF8A 2IEZA 3QKSA 3ZD7A 1YU9A 2DYKA 4JS0A 2IC5A 4C4PA 3SN6A 2HJVA 2NO9A 1YRAA 3DL0A 3T35A 4LI0A 3ZQJA 2W2VA 1H8ED 2X2FA 1J8MF 1R6BX 3PCRB 3VR6A 3KFVA 5EUMA 4ZDJA 1D8TA 3AVYA 2G1JA 1CEEA 1D6JA 1QHHB 3ADDA 1XD2B 3CNLA 3T5DA 1E9AA 5GVRA 1P60A 2C96A 2IT1A 2OBNA 4NH0A 2TMKA 4BLSA 2VBCA 1TF2A 3LXXA 4DDUA 3EA0A 4FD2A 2OESA 4M8NE 4B75A 3QY0A 2YZ2A 3EIQA 4TLDA 1S2MA 1P4SA 3QVUA 3A4NA 2ZSBA 1MABA 2ZITA 3X1DA 4B2LA 1PVOA 3AUYA 2YOFA 4CGZA 2WWIA 4XOIA 4O3MA 3KQUA 3GLHA 2ZE8A 1X1RA 3NBYC 3ZVLA 3WBKA 1M7HA 1OB2A 5KUTA 1Y3AA 5EXXA 1C4OA 1UKYA 2UZIR 4D6PA 4TTRA 1EFRD 4QRHA 4A8JC 3DPUA 2IUUA 3CLVA 4DCTA 4C2UA 3F3YA 2V55B 4JL6A 1S4QA 2V7QD 1ONBA 4GFDA 2AFHE 4JSTA 1E2IA 1CR0A 4PPQA 3M4YA 1JJVA 1NLFA 2W6JA 3AVTA 1TPZA 3QPUA 3TVTA 1BO6A 2JDID 1N6HA 4L5BA 5HR5A 1GAJA 2JLRA 4TMWA 1SGWA 4ESVA 2BC9A 4NE2A 1XZQA 4F7WA 4QJ3A 1OLOA 4DSOA 1MKYA 1VCIA 3X1ZA 3CIOA 2H92A 3LLMA 3PFIA 4ITRC 3GLIB 4Q66C 1KDRA 4LCBA 4A2WA 1YRBA 4B47A 1TEXA 4PQRA 1QG2A 4G01B 1KAOA 1MV5A 2CHQA 3NTUA 3DDCA 3D3QA 4NBSA 5AJVB 3B8HA 2CVFA 4MYCA 4JLDA 3PUXA 1FPMA 3J81k 2GEVA 3LD9A 4HLCA 1F60A 1IN5A 1XEFA 1IY2A 4Q01A 4TLEA 3FHCB 3T1TA 1FUUA 1R8SA 2FSIA 4U5XA 2J59A 4P4SB 3A6PC 2ZRMA 5HE9A 3THXA 4C7OA 2OBLA 5TXGA 4R7ZA 4BFTA 5B30A 2G88A 3OIYA 4MGKR 4AY2A 2GEUA 4FWIB 4Q9LA 1F48A 3RABA 2WJGA 3R9XA 1Q21A 4MGZR 2ONKA 2XNSA 3EX7C 2NZJA 3P4XA 4II7A 3I8XA 5JHHB 3AVPA 2J0UA 1QHNA 3ZVRA 4MQBA 4RZXA 5L3QA 2GHIA 4TTPA 2OLKA 1EK0A 2WJIA 3CBQA 2IX3A 1CULC 3K0SA 1IHUA 2DR3A 3CM0A 3H86A 3ADCA 1W36C 1KSJA 2GXQA 1NG1A 2PCLA 1HT2E 2IYYA 1WDTA 2EFGA 4G3XA 3CKLA 4O25A 2WWHA 1UAAA 521PA 3AF1A 1G18A 1UF9A 4QM7A 2O8CA 3FWYA 2CE2X 1NIPA 1GNPA 1SKYE 1U8AA 1ZD1A 4V0LA 2R65A 3QF7A 1JAIA 5AWFC 3UMFA 2VP2A 1E9DA 2N42A 1YKSA 2Q6TA 1UEIA 2GXSA 1YJ5A 4NCNA 2GXUA 2FFBA 2QM7A 4RD1A 4YDSA 2CLCX 3FFAA 2KWIA 3CWZA 1P2VA 1IBRA 1W2GA 2DFNA 2F3TA 1XTIA 4HZUA 2RMKA 4EJSB 2GK6A 1CR4A 3O8DA 3S1AA 1RRPA 1OIWA 121PA 4CEJA 1G8GA 4DIDA 1E2MA 4Q1EA 3VR3A 4Q9IA 2A5DA 2WSMA 4NP6A 1US8B 4PAQA 2ZSDA 5DH9A 2RGNC 2IWRA 2FFHA 2AKAB 1G9XA 3ZIAD 3C16C 1V43A 2AFIE 4HLUA 1P9NA 4QC2A 4OJQA 4ASUA 3LH5A 3DHWC 4JVSB 3WP1B 1QHHA 1XD2A 3K8YA 5HKKA 1A7JA 2Q3HA 2VP4A 4KLNA 5LBIA 3K9GA 2FGKA 1YQTA 1P73A 4C2TA 4B6EA 1LF5A 4ZCMA 1AS3A 1O3YA 3C8UA 1COWD 3OHMA 5AJWA 5G3YA 2P6RA 2V6JA 4EKDA 5KSYA 3K70C 2XOKD 3KJEA 2VEDA 5TDHA 4UXHA 5KYKA 1R4AA 4QXAA 1NMYA 4IW3B 4V03A 5FUWA 1WBDA 1KK3A 4PX9A 5CIWA 1K8RA 3GJ6A 4QBGB 4FINA 1FUKA 5KNCA 3TW4A 1GG2A 3EAQA 2NOAA 1II8B 3GJ4A 3PQCA 3A8TA 5FBRB 5L8VA 1XNJA 2G1KA 1W0JD 1E9EA 1FNMA 2RB4A 4N1AA 3RRMA 4KYUA 2CLDX 5J4KA 3ONWA 4NYIR 1OYWA 4V0KA 2IEYA 4EQ6B 4KVAA 2JIZA 5CB6A 3ND8A 1RE0A 2ZJ5A 5DI3B 4UJ5A 1W49A 2WJJA 4MDEA 4F92B 1QHYA 2GZDA 2IXFA 1T0HB 3RWOA 3GLIA 3K53A 3KKPA 5A0FA 2C95A 3QKTA 1D9ZA 1I2MA 2DWOA 1PZNA 1E1QD 3A4MA 4JLVA 2V9PA 1DEKA 3TR5A 2IXGA 1GL6A 3E5HA 3MWKA 4URWR 4Q4JB 1GWNA 4JBXA 4LZZA 3FKSA 4NKRA 1X1SA 3BOSA 2QSYA 1YZNA 3OAAD 1TADA 4PHFA 2IW3A 2QENA 1Q0UA 1W0KA 1YZKA 2IYLD 3M6AA 1N5JA 2ANBA 5F2EA 5IT5A 1OHHA 5DO9A 4LHWA 5HZHA 4R9UC 3MCAA 1Z0KA 1Z83A 1Q3TA 4Y0VA 2ATXA 1E2HA 1TF7A 3UXMA 2IUSA 2CNWD 2VPPA 1KMQA 5K8IA 1DAIA 1CJVC 3IBYA 1S96A 4LHYA 1E69A 2KJQA 1EX6A 2XB2A 4UXJA 2GCOB 4BPBA 1U81A 3TQCA 4TMKA 1JQJC 3QXHA 3H2YA 3TLXA 1J7KA 4DEXA 3QKRB 1XJCA 4WIAA 1VHLA 2FPMA 3KJGA 3WMEA 1AS2A 4IRUB
chains in the Genus database with same CATH superfamily
3SSNA 1LDMA 3QQPA 3KQMA 1QHSA 2KS6A 3AI2A 5AOCA 5JJKA 5JG7A 1PRYA 4YCDA 3TZLA 1P3DA 3GH1A 3NYRA 1X77A 3O95A 4CYMA 2LPMA 1GU7A 4Q7JB 2ARKA 4QUAA 1YDEA 1P1JA 2R84A 2BM9A 4IIVA 5A5FA 4F93B 2H57A 3KXIA 1G4HA 2DJIA 1O9GA 4A6DA 1KP2A 1RQGA 3ONFA 5EWMA 2HQSA 3MILA 2ZJAA 1M33A 1YFZA 3IHKA 3HXTA 1T36B 1JYSA 1PO7A 2HAEA 1X2BA 2WILA 2HDHA 2O14A 4D25A 3G0GA 2Q5HA 3LECA 5AK3A 5KOHA 2ZR8A 4EJSA 4DF3A 3HJGA 3ZXIA 1NWCA 1YB4A 4I2NA 1DC6A 5EE3A 4OEHA 2MT9A 5E8RA 2J5BA 2PN1A 4AD8A 4Q24A 421PA 2RHWA 4QEKA 2GN0A 1FLAA 2B3DA 4FKMA 3MJVA 3G5MA 3DOIA 4U6SA 5A4DA 3EZ6A 1OXUA 1SZJG 1IEWA 1SU7A 4NONA 3VAYA 2VDPB 1VLMA 3PC4A 4PLWA 4U0KA 4C0HA 5KVSA 3CSUA 1NAHA 2BKUA 2NYVA 3KVVA 4HB3A 4LDJA 4PANA 1IM5A 3SAJA 3NHJA 2JLSA 3A25A 1I9GA 5DRYA 3UV6A 1LGYA 4G0PA 5LIPA 1A1SA 4EX7A 4Y2YA 1QMPA 1YDHA 1U8EA 1VLVA 4RY2A 4LJ5A 4I1PA 2PZ8A 2L2QA 3BM5A 1F0NA 2Q2QA 4TZTA 1WLYA 3QITA 2A9JA 2QM0A 5CD9A 1N34B 5BSGA 3LWDA 1NU8A 1V5EA 2X4LA 4WE3A 1D03A 1O1YA 3HB1A 3O4IA 5AVTA 1CFJA 4UHFA 4DG9A 2IYEA 2WKWA 1HK7A 5LOVF 1IPEA 4RHFA 1OJ7A 2OZPA 3VDRA 2VH2A 4FWBA 2I7VA 3K1JA 1HFWA 3NATA 3P52A 1JU3A 2HF2A 3R3SA 3NBUA 3SZLA 5DYGA 1Z0DA 2MSNA 2F9LA 4Y2QA 3X1JA 4PONA 4A0HA 1NLZA 3PEUA 4UTVA 2O2DA 1JSZA 2ZT5A 3N28A 3ZJ4A 3QEAZ 5T6BA 3M6VA 4F71A 1G55A 5L9AA 3KCNA 3V8MA 3E4CA 4TYYA 4D4KA 3IVMA 5IM4F 2XCIA 2ZBVA 3UJPA 4ZAGA 1GGJA 1HETA 1N9GA 5JPDA 3RYCA 1X6VA 4UCXA 4OHMA 3WC4A 3DE6X 4QDJA 4YV0A 5I8ZA 4PYIA 4INJA 4W82A 3AERA 3R7NA 4A8PA 1XVUA 3EH1A 1QP4A 5C81A 5G0TA 4OHKA 3ZE9A 4U7DA 2ZJ2A 4IGEA 4OQLA 3SJZA 2PKXA 4JSYA 3VOSA 4F1WA 5IDQA 5BSTA 3WK4A 5L7WA 4D41A 3O74A 1XDUA 5JAUA 3QZUA 5ILOA 1E5QA 2XB8A 1C2TA 4BB9A 3RFXA 2X8AA 1W73A 4LPKA 1THGA 1S3GA 2B35A 3PNPA 4L07A 2X7JA 3G17A 3G2KA 4PFJA 2UZ0A 4X94A 1RWNA 3KFXA 5EZ5A 1YJBA 4I81A 3SDBA 2BV3A 1TVMA 1XZKA 2PDAA 4B4OA 4S1WA 3E05A 1G8YA 5E7IA 1WUYA 4DJ5X 1TCUA 4CKCA 1ZOPA 2WKRA 1KYXA 2WU3A 4HDQB 2HN9A 3I9V1 2WAOA 1PT6A 4AURA 4N5HX 2ZYGA 3W4KA 2DPLA 2ZYTX 1VSUA 3GXBA 1JLMA 2FWNA 2IEDA 2DY0A 4X63A 2EZ9A 1HNXB 3P19A 2A9PA 3WMXA 2ZCUA 3IO3A 1DQNA 3KEGA 3AOEC 1QC5A 4ZYWA 3IERA 1AK9A 4PCLA 3ACDA 3RU9A 1MAVA 3JAKA 4YCAA 3FTEA 1I6KA 3ESQA 2P67A 1BXGB 1O08A 2DE0X 3AFNA 1PUXA 3M5PA 1C1XB 3OZCA 5EGNA 2XT9A 4P32A 3TRIA 5JAZA 1X7DA 2V4ZA 2WNSA 3LPMA 3QKRA 4FYIA 4RK5A 3L2OB 3K6SB 4DAOA 4ZAWA 4DNFA 2VP0A 3RBVA 2ZAYA 4DIEA 4PSUA 4RJKA 1WHSA 3WGNA 1ZVKA 2FLKA 2VFAA 4MJLA 2JBAA 4B6QA 4AJNA 3A4IA 4MVJM 2PUJA 3T7KA 1SJ9A 2JL1A 4BWYA 4JXZA 4LOIA 3FOZA 3AFIA 3BUSA 3P45A 1T1IA 3D4NA 3QM1A 2LRHA 2ZAOA 1MORA 2NLOA 2X3FA 3GMTA 3U7FB 3P5BA 3FWPA 5LA6F 3M6XA 1WNTA 3LZCA 2O5EA 4DA8A 4EKNB 2YXBA 2NXWA 1LBHA 1XLUA 4RWEA 2ZETA 1E8NA 1ZK1A 2F43B 2YVQA 3FCCA 3A6GA 3HWX1 1GNQA 2J7PD 4BNZA 1SO8A 1D0IA 1KF0A 1VECA 1T36A 2C3MA 2PGNA 2VUUA 2ZRNA 4OGFA 3W7BA 4C22A 1DUVG 4UHKA 3J81A 3U40A 1G59A 4CRWB 3CRQA 1JXMA 4RY0A 1KH2A 4Q7QA 3WE7A 4K0KB 3JAWB 4GP7A 2V7BA 5EJ2A 2Y6VA 2GEJA 2Z3WA 4UEKA 1Z4LA 2O2YA 3L7DA 2MIIA 2EJCA 1T3HA 3ASVA 3TJZA 1QKJA 1Z56C 2I1QA 4QXMA 5F7JA 5A6SB 4JBIA 1FTNA 1M8JA 2GJKA 4X8OA 4H0FA 3WWEA 1X1AA 2BT4A 1G291 3GK3A 4M99A 3TNYA 2HO5A 2VJDA 4U39A 3U2QA 3PRYA 4RFLA 3EVZA 2XNDA 3DVSX 5ELMA 3MN1A 1XA4A 1VJRA 3ROMA 3SKXA 5A5GA 2Y27A 4WH0A 1OXTA 4P8RA 4Q7KA 1I6LA 2EJWA 3E3MA 3UJDA 2HQ1A 1GJRA 2ZI3A 3MB5A 2HPZA 5FI1B 3DLCA 1ZNZA 1R8JA 1NBWB 4RSHA 1XU4A 4BDSA 2W42A 1DC4A 5F73A 1Y3CE 2PU5A 4JC8A 4HH4A 1TIBA 2SCUA 3DAPA 4TXNA 2ZQZA 2BGNA 3P20A 4MYDA 3ZWQA 3ZEIA 1P7YA 3EXG1 3S2FA 4NG4A 1PL7A 2J48A 5AUQA 3SX4A 1UXOA 1QFJA 4J90A 2YY5A 1X3SA 1Z8FA 3DZKA 2NTJA 3DZHA 2HF7A 4R3WA 1JLLB 1HE5A 4Q3KA 4XUGB 2I2AA 2QW0X 4IXNA 2BHLA 2Y2VA 4F84A 2P2CA 2B6HA 3OEEA 4B7CA 1TT7A 3CUYA 3JYHA 1SB9A 4RA6B 3VR5A 3ZDZB 1AS0A 4L5CA 4WXHA 3FBGA 2XQFA 3H5OA 3OC6A 4C7JA 2W37A 2EVWX 4HWGA 3FUWA 4JEIA 4HWRA 2NSJA 3UMRA 5BQPA 5J4LA 1KJJA 2O0JA 3AUAA 1SHTX 3HVIA 4O2BF 5GJBA 4QTUB 2JZNA 3L6EA 1UDAA 3VNVA 3O8LA 5E4FA 5EVCA 2DFVA 2VJNA 4IIJF 3HEAA 1ZAKA 3O93A 2PSEA 1T1RA 3SZOA 3QYAA 3SHVA 3KYIB 1EJBA 1Q0RA 5HKLA 4QTZA 1DHTA 3DAYA 3RFFA 3QXCA 3F8WA 2I29A 1L7NA 1ZS9A 3IKJA 3CF4A 4HVTA 5H02A 3ANNA 1K88A 2C94A 2EHJA 1ESZA 1NVGA 4FJ0A 4G4JA 5JC8A 2RCYA 1YQWA 3OETA 4LCJA 5IVDA 1T4CB 1ZN9A 2GNAA 4NOJA 2ZYVX 3BXZA 3EQ9A 1CJTC 3WWYA 2I3AA 2Z8YA 4ZVVA 2KM1A 5IZCC 1PUIA 1W44A 3DMRA 5JARA 4BNFA 2A9RA 1KTVA 5C34B 3KR1A 4Y6SA 5TQ2A 3WQRA 2B7LA 3RRFA 1TM3E 3IH5A 2AUMA 1QO9A 2WWWA 3QX9A 2BUAA 5JIBA 3T7IA 4UCFA 5JAMA 3KQVA 1CUYA 3K2EA 3LF2A 3LXMA 2DR0A 3QNWA 4QYSA 3V46A 1G5HA 3LUGA 1N36B 1OMOA 1OTHA 3C8HA 1HEYA 3DPIA 3DMNA 4DWJA 1EEXB 5EFZA 3BTSA 1EVQA 2OMEA 2QRHA 4D4LA 1PFYA 2H54A 3BICA 3ITEA 3W5BA 1P5HA 2Y9MB 4E1AA 4MEJA 2AOWA 2D2FA 3EUEA 2FVYA 2BMWA 3LUCA 3WL7A 1G2IA 5GY7A 3ZCVA 1BXGA 4LTDA 4BCCA 1C1XA 4FX5A 4GMKA 3I2IA 4X24A 4MITA 4GDMA 1KSGA 3K6KA 1VKRA 2Q9AA 3LT4A 1XR3A 4OLJA 5ERXA 2AIRA 3K6SA 4IF6A 5KQLA 1T9AA 3K6RA 4G81A 3SF0A 5K3CA 1CUSA 1NVVQ 1X7XB 4GC5A 4Z0HO 4BNJA 4IWXA 4C4ZA 1QJCA 2X1HA 1I2AA 2VUHB 4B7UA 4NCBA 1QH8B 2WZBA 2F1HA 2BFCA 4P7BA 4KL8S 5CUQA 2GBLC 5D1HA 3OFNA 1NY5A 2ZVQX 3CW9A 3V48A 4L9SA 3U60B 1IG0A 2V7WA 4S3MA 1IUNA 2A67A 3KLPX 4IZIA 4JOQA 5IX8A 1RLMA 3ZJTA 1KZ1A 1YS9A 2VZLA 2WDZA 4KSYA 4YRRA 1CYEA 1VIAA 1CDEA 1WZIA 1ZIXA 2Y0DA 2O1SA 3GNSA 1Y7PA 2C58A 4IQFA 5DYNA 3W79A 1PFQA 3ZHYA 1LJLA 1X9HA 1DG9A 4NV1A 1QX4A 3C7AA 3URKA 2F43A 5K7SA 1RKQA 3GRRA 2AF4C 2HZ7A 3T34A 1AV6A 1T26A 2OCDA 3DMYA 3GUCA 4JUFA 3SSAA 4FFDA 4QM6A 2ZZMA 2ZJ8A 2PT9A 3CEMA 4KJZA 1JF8A 1RXVA 3QEBZ 5AYVA 1P19A 4QUDA 1ZJ4A 4TWAA 4X5OA 4DABA 4R7GA 3JAWA 2JHAA 5B2FA 4MLCA 3P9PA 2VQ6A 1W2HA 1QIDA 1OC2A 3U4AA 4EY4A 3CTMA 2HO4A 2O57A 3NHMA 1RIFA 4RENA 5A6SA 2QYHA 4BMVA 1N4DA 2XKJE 4QGFA 1Y89A 3IR7A 2FSFA 2W6IA 3VPHA 4KGXA 2XXJA 3OJCA 1XMVA 3F96A 1C3VA 2XCOA 5EXSA 3QOYA 4DREA 3GLGE 1XKQA 3L3BA 1QR6A 4PNPA 4WNYA 2C99A 1VE9A 1R5OA 4ZAXA 1T9ZA 2FRVA 2YL2A 4PXYA 3W3AD 1HE1C 2V54A 3CZPA 3Q8WA 3FR8A 3F6YA 4LE2A 3S2SA 1I1QB 4GZLA 2ENWA 3OF5A 4Y2RA 3RAFC 4R9NA 2A6PA 2WABA 1IN4A 4ZO8A 2R751 5IKXA 2RHCA 1S2LA 2KI5A 1O03A 3ZY5A 4AU1A 1IEXA 4D8UA 4QQNA 1GRRA 2BBOA 2XVMA 4WMLA 4JMPA 1LEHA 1Z4OA 2P6UA 3D7SA 3QUTA 4CUZA 2H5JA 3BE8A 1RLOA 3ML1A 3T94A 1JLLA 4GI5A 3O4VA 4EX6A 1JGTA 2KSQA 4OLFA 4AMYA 1K63A 1NF9A 1UCFA 1W46A 2I76A 2I03A 5D01A 5KTKA 2FN7A 1TZCA 1SCKA 2R3SA 3C5HA 3TQOA 2VO1A 3UF0A 4ESHA 3GCDA 1WPRA 2C57A 4RA6A 4NZOA 4CM9D 3HY3A 4MDHA 3FZGA 1H8EA 3PNYA 3R7FA 3BJZA 1YR3A 4I8IA 4O5OA 3ZQKA 1ORWA 5TJHA 3F98A 5AJZA 5JVDF 4IXWA 1W4LA 2BZGA 2XB6A 3HV0A 5LKAA 1CIJA 2O2ZA 4YAKA 2X5JO 4MYTA 3B48A 1IN6A 3QUBA 1I3LA 3ZCUA 1ZGHA 1FX1A 4B0OA 4E0BA 3L8ZA 4G4GA 5TARA 5FHRA 1WB6A 4P53A 2YVUA 1OXSC 3FWHA 2X0FA 3SX0A 4YV1A 3VVMA 3OJLA 5LL6P 3K2QA 1T4CA 1NRJB 4ITUA 5DF1A 1J97A 3L0DA 4RE6A 3IQEA 1Y5RA 4Q1DA 1SIBE 5CCDA 3LRPA 1NQXA 4LTMA 3Q8MA 2V7QA 2WV9A 3TUJC 1E3QA 2AJDA 2V6IA 1U3UA 2OBYA 3R4CA 4KE7A 1OA1A 3UH0A 2PLNA 2ZRAA 4BKPA 4W1PA 4IIHA 1PKXA 4U7FA 3DFZA 3AEKB 1DIOB 3AF6A 2RHHA 5L3VA 1KYZA 4KH0A 4J1TC 2QP9X 1OYVA 3ZD8A 4DCPA 2QU8A 5IUNC 4J03A 3RK0A 1L3CA 1BH2A 4FEGA 1SXIA 2OKCA 2HU5A 3GLKA 5JI2E 4N4AA 1D1QA 1SUFA 1NJFA 4FU0A 1I4DD 2QRMA 2B99A 1GN9A 1XAJA 4PG6A 5F9MA 2RHJA 4MGYR 2FH5B 5KVVA 5GV8A 4ZC1A 1CR1A 1KRHA 1DC5A 1R50A 2PK3A 4CMKA 4C3OB 1FDVA 2PGOA 4N5NA 2CNDA 4UREA 5HKAA 2VIIA 4B4KA 5A7GA 3F7NA 3LA6A 5F98A 4QGAA 3O8BA 4RPJA 2QBYB 5BSKA 1KA9H 3L7CA 5CFRA 1DXQA 1K1EA 1IULA 2BCJQ 3DFUA 1X7XA 3RC3A 3U7EB 1ECPA 1W29A 1XTUA 4QBKA 3H9EO 3ZV3A 4FLMA 5JYEA 4MGHA 5G1PA 1B15A 1WD7A 4ARZB 1BIFA 2AC2A 1QH8A 3RIMA 1YONA 3LT5A 4ICIA 5LWHA 2C4WA 2OENG 4OH7A 3HP7A 2B9EA 4PCVA 3EPJA 3QX7A 3OQ6A 1EBFA 2PWYA 4FI3C 4KIGA 1CHNA 1SHZA 1HDCA 2A9VA 2G28A 1RVDA 4GPEA 4FHEA 1KYIA 4Q3CA 4KZKA 4TSFD 3X2FA 4DMFA 1FJGB 2IS2A 4RKFA 3HRHA 3ZD6A 3KYDB 4MWGA 1SBTA 1XZBA 1G8AA 1QG6A 2BFOA 2HPVA 3CGWA 3EPPA 3G89A 1U6KA 5DE3A 1NW7A 3C7TA 2QZJA 4INAA 2HCTA 2Y77A 1BYIA 5U4QA 5CT8A 1R0CA 5KYVA 3LXRA 1WCXA 4X8LA 2JGRA 1P9LA 3S5UA 2EU8A 2IZ0A 3ETNA 2COEA 3SJUA 1XRQA 1E4VA 1XZLA 2GAOA 3ANSA 5CAEB 4DEVA 3TFOA 1HG0A 3CUTA 2V65A 1S89A 1SOMA 4H15A 3FTQA 4ZDIA 5A4FS 1UJMA 2IP2A 2XAUA 2WHXA 5H81A 4B3HA 1HDYA 2M6KA 3QY9A 4YP7A 1A50B 5JLJA 3HUUA 1UDRA 5AW2A 1U1CA 3H97A 2DPXA 5DLYA 1JDNA 1D09A 1SC3A 1Z6PA 2XZDA 2YQZA 4IGFA 2QRZA 4C0LA 1E2GA 3HXMA 1V5IA 2DCUA 4HWOA 1QU3A 2JCGA 3KL4A 1QAQA 3PUWA 3OTWA 4LGYA 5D8DA 1YKFA 1RAGA 2FEWB 1VHWA 4R3NA 3CF0A 1IZ7A 2ZG6A 5HM6A 4JT4A 3SR3A 1HTBA 3N0TA 3QVXA 1W8DA 1G21B 1Y6QA 4MZXA 1Y1RA 3FFBA 4L08A 4IXMA 2D7CA 3MTDA 1TZJA 2JGJA 5EJFA 3OZXA 5I51A 3FMFA 4OV6B 2C04A 2AI2A 1U7PA 2YN4A 3PDIB 1DOAA 1V5WA 1QB8A 3R0ZA 1HTTA 1PZHA 2XUGA 4MVJF 4N65A 4QPDA 3QE9Y 3TX6A 1U8ZA 3O5AA 2ZT7A 1YDWA 5LP6C 4EO9A 3NB0A 3CX8A 4GLBA 5B3AA 5GOZA 3WHIA 5KEIA 5L51A 4TZ0A 3CNBA 4ZQHA 5FI0B 4ZQGA 1YJCA 1WZUA 1CT9A 4ZFNA 3RIYA 1UBFA 1N6NA 3QG5A 4OXKA 5KNDH 3CKYA 4NARA 1AKNA 4ZT6A 4C2AA 3CLRD 4NXNB 1M1UA 1O95A 3LPDA 3M1AA 4KTTE 2GD0A 4S0XA 1MD9A 3H6KA 4HNAB 2Z5VA 4DSNA 2JJYA 4FGUA 1UINA 1G38A 1PSZA 1L4GA 4XB2A 2NZ2A 1SBZA 2OVFA 4ZCSA 1I7LA 4PSVA 4GKJB 1CS0B 3F49S 1IL0A 2I4RA 5BQ5A 1T8TA 1H0RA 3KTOA 1DRUA 4RKYA 1HNZB 4JHLA 1T3SA 1JYFA 3OI7A 3ZDAA 4ABYA 7GPBA 3QU7A 3BXXA 5AP9A 1ZMOA 3JQQA 3HJFA 1E3MA 5E95A 3ZZUA 3ZHRA 4ILEA 4N82A 1R0ZA 3AJRA 2QLTA 4YV2A 2QNBA 4KR7A 3ROGA 2YYAA 4KPYA 4L76A 2OORA 3MIZA 3COWA 1ZA2A 3IXLA 4FHDA 3WAJA 3F90A 4CQNA 3BSFA 2MOKA 2JKZA 4IINA 1Z75A 1XTKA 2X2EA 2JPDA 1LSOA 1Z5PA 1A5SB 2ZS9A 4IQ4A 3ZKWB 5I7VA 2G9ZA 3OJEA 4BLUA 3SC6A 2PEZA 3AEKA 3NBXX 5HBGA 2XOXA 3L82B 2O2XA 3IX7A 1GL7A 3LRTA 4FDLA 4RPGA 1ECLA 1TJ3A 3LQRA 1GR1A 5AXBA 3Q7QA 3IRVA 1OSNA 2ZIXB 2DHCA 1TD1A 2Z5FA 2WIGA 3TYXA 2O52A 4G5OA 1J09A 2HIHA 1IXZA 1GAWA 1QNFA 1RXEA 4IO1A 3LOUA 4PBRA 4E1BA 4W5QA 1TW3A 4I66A 5KQRA 2PUGA 4LBVA 3FPAA 4EJ2A 3G1WA 2ZRPA 3C6ZA 2VZ9A 4YJHB 2ONYA 4WXPA 1U1GA 2ZVPX 3P2JA 2QBYA 4W99A 3S8MA 2GK3A 1Z3IX 5CFNA 4UNPA 1CRQA 2B8EA 4KN9S 1WLSA 4MUXA 1KPHA 3HUDA 3LDUA 1BEZA 2UYCA 2QIOA 3EDYA 4YGYA 4AECA 4ARZA 2G71A 2RK3A 4RZ2A 3ZK7A 4F9EA 2XHZA 2H4JA 2H00A 1SZPA 5H4HA 4HLQB 3HVKA 4GKKB 3LDGA 3WNCA 2CEAA 3X44A 4RTRA 3FLMA 5THQA 2JRCA 2CNWA 2GO1A 1RAAA 4WV3A 1WETA 2GI4A 2AXQA 3KYDA 1PVVA 3MPOA 4XX1A 4XI9A 2FEPA 5DNWA 3IT3A 5H9VA 4DM7A 2FMXA 1AY0A 2LIPA 1WP9A 2JGKA 3K0EA 1SXPA 3RVLA 4UM9B 3HPRA 3IBCA 2EFDB 4J0IA 5HZMA 3CFYA 4CETA 1RFLA 2QGFA 2SHKA 1I7NA 2BMVA 3REFA 4HAVA 3QV1A 4AZ0B 1ZIPA 3B70A 4V38A 5CAEA 4J2HA 1X70A 3D6UA 1K0FA 3T3PB 5CK5A 3D8NA 1P6UA 4FFBB 4HX5A 1PTJA 4JROA 2A5GA 1EXDA 3ZWDA 2HYIC 1ZISA 5G41A 2Z6UA 3BH7A 3Q3GE 4CM8B 4OX9B 3MMZA 5KTYA 2GN8A 1E2JA 4X84A 3ZBTA 4B8ZA 3GGJA 1E7MA 2P3OA 2GAJA 1FSGA 2CNLA 2Q9UA 3BMCB 3HU3A 4GQAA 3VVLA 5K8JB 4WOPA 3HCRA 2GJ8A 1TUGA 2H5LA 2XIJA 2O2HA 4GI3A 4IOKA 4IICA 3W9SA 4C0JA 3BDAA 1KFBB 4YMWA 4UNRA 2FPXA 3L0SA 4DQDA 3EZ7A 4RMGA 4V2UA 4K6OA 4PCUA 3MT7A 4KWHA 4UEJA 5EE0A 4XDGA 5CT5A 3A26A 1HC7A 2FV8A 1G21A 1I10A 1K92A 2P0EA 3I6MA 4X60A 3WQHA 2I78A 3CLRC 5DM1A 2MYTA 3ZDQA 4JKYA 4MPTA 2X86A 3UN1A 1SXQA 2ZBUA 2P9GA 4C7MA 1AN9A 3KFLA 3PDIA 4NTZA 4QE3A 1XCGB 5CFMA 5JD6A 2YJ6A 5JS6A 1E8DA 4MWEA 2VHJA 2KX7A 4ZJUA 2YJ4A 1HNNA 1OBFO 1PJZA 2Z57A 4IFBA 1VQ1A 1Y3BE 2HJGA 2VZ0A 3MAAC 1IMOA 4R1OA 2EYUA 2H48A 3E9MA 1PGJA 1QLWA 1N3LA 1RP1A 1X94A 4GC9A 3UHJA 4YJFB 5LZ9A 1V11B 4HLDA 1MGOA 4IDEA 4CF5A 3E35A 2CVOA 2YWFA 4EUKA 1DVRA 3EQ8A 3FTNA 3UHPA 2P2YA 1JR3A 1LRKA 3F9IA 4MI6A 2REQB 4MIEA 2NWQA 3KV1A 4HNAA 3WL8A 2RE8A 3PQ7A 4MP3A 3PGA1 4I55F 4DW8A 4I6GA 4G0UA 4IYRA 4LXGA 1SEVA 3LHSA 4DYDA 5FPKA 1DV2A 5KYTA 1M75A 5LVAA 3DZ8A 3DTVA 4A4DA 1XTRA 2ZVJA 3I64A 5MDHA 1CR2A 3KB8A 3Q6MA 5C5DA 1K8YB 3EF3A 6Q21A 4M36A 1T35A 1NJGA 3FGPA 1OUMA 1YJAA 1N9KA 1GTRA 1QMGA 2DUWA 5K9ZA 4TMXA 5F64A 1PJBA 4R51A 3IVAA 2Z4SA 2CK3D 3E9EA 2GZSA 4US2R 1X1EA 1X9GA 3V55A 5FUBA 3LQYA 3V1NA 3KTAB 1GOTA 1EK1A 4UVIA 2H18A 4QUGA 3ZKWA 4Q02A 2A92A 3IPAA 4FILA 4TT8A 4F3TA 4Z0NA 4B44A 1XQYA 4X6XA 4EGAA 5BW6B 2JLWA 2LR0A 4E33A 1M76A 3IGFA 4WLNA 5CLGA 2JI7A 3STXA 2QJWA 4BUZA 4XR4A 5JDIA 4NK5A 1OGIA 2ZIXA 3ZBUA 5I4BA 1H2ZA 2QXUA 5A6VA 4F45A 3DDOA 1T8RA 2JFZA 3O47A 3NHYA 4ZYUA 3CC8A 3JYOA 5ICCA 5JRJA 2CL6X 3NM5A 4B43A 4HP8A 4J4BA 4TXJA 3CB4A 1ZHOA 3TI7A 4F3KA 3S4YA 5CDSA 1Y3HA 1XO1A 1GUBA 5AVSA 4YJHA 2I65A 1HSZA 1KI9A 3G0DA 1DKQA 1GPDG 4IQ8A 4K86A 3GY0A 4TL8A 2XMQA 1HOXA 2MSCB 3P0RA 5CLJA 4EHNA 4DDWA 4LRYA 1KJIA 4KDCA 4ZCQA 1AA6A 1V4BA 1ATZA 1NF2A 4YBRA 2FPGB 3SDZA 4XB6B 3MZ0A 2CZGA 2DPGA 4JB8A 1EUDA 2MSKA 3AF3A 3JD3A 2JAWA 4NHOA 4F2HA 1BX0A 1VKOA 3P2EA 2A86A 5F3RA 3OU7A 2KLBA 4LC0A 5AI4A 3EIHA 5DI9A 5AHKA 2QG9A 3K35A 4IGAA 1OFIA 1BFUA 3F46A 3DB1A 1DX4A 1W5TA 2GN2A 3L02A 4L9RA 2WYWA 1ZCAA 1X42A 3Q12A 4XX0B 5B36A 2OPBA 4N6NA 2JLAA 4R2KA 2FN4A 2OQRA 4XWGA 1P5FA 2XKKA 3LU1A 2H16A 1IHOA 3GVIA 5B2EA 2Q1XA 1AIPA 1MB3A 3PHBE 4PNEA 2YCBA 3TTSA 1Q14A 4ER0A 5ALYA 4YY3B 5C5IA 1UKZA 5IC5A 4AZ0A 1G60A 1FTGA 4QDOA 4JXKA 2CV2A 1WVGA 1OWOA 4LGMA 1ZYUA 4RQAA 3MFYA 4IMJB 3T9FA 1ETHA 4FFBA 4IH4A 1WSWA 2J5QA 5DMHA 4UDNA 1FP2A 4CM8A 2R9VA 4HRVA 4U02A 1D2GA 2A59A 3OTOB 3D7NA 2WPDD 3FJYA 3A3OA 3VR4A 3GEHA 1SA0B 4EY7A 4PLGA 3BMCA 4COOA 1UM9B 2P65A 1MAHA 4GLJA 4PZCA 1PJCA 3WYBA 1Q5PA 2C98A 4GKAA 3AT1A 2ZE5A 5IHXA 3GJXC 1B1AA 4KIWA 1BJTA 2J8ZA 2Q1TA 3RSOA 3CUVA 1AHNA 3UJ7A 1QM5A 1FYWA 2RBGA 3L6BA 3G9QA 5I7RA 3MJTA 2BKLA 4N40A 1M3SA 4NMHA 1ISMA 1N5RA 2LZ0A 4AJ4A 2B69A 5CA0A 1JA9A 4NL4H 1KIMA 4U2FA 2M32A 5FO1A 2D8AA 4OK6A 1DAKA 3CEPB 3HR8A 3GRKA 3ZCRA 1SD2A 2ZGVA 3AF2A 3GZTB 3TZ6A 3VISA 1PT7A 1I4EB 2Q49A 2Y05A 3DLTA 4GPBA 2D0OB 3NRJA 1J90A 4ND8B 1W8IA 1T1GA 4BVGA 1JLRA 3FB4A 3AKYA 4UOQA 2LDBA 5EHGA 4AJJA 5E4YA 4QYTA 3DMTA 3AR8A 4KU4A 1FDWA 3WK7A 2HT6A 2HBZA 4FM9A 4YJFA 1A5TA 2VJMB 1V11A 4JKIA 2B8WA 1B6TA 4DFDA 5CCEA 4KMMA 2IYUA 1JJFA 4QNNA 4I5GA 1Y82A 1FXWF 2Q50A 4K6FA 1WMFA 1SIUA 3LXUX 1RRKA 5T8KC 1W94A 4JI6B 4C3ZA 3U6KA 3NU1A 1ZMTA 1CUVA 1O5IA 4BFLA 4NCAA 2OG1A 2IHKA 3SNKA 1QK4A 2B5WA 3N8KA 5FV4A 2IF0A 2AR9A 3BIOA 4L4RA 5EE5B 5JS8A 1YSCA 4U8HA 1VBFA 3FWKA 3EPHA 1DBQA 2DFLA 2CEKA 5K0EA 4EOGA 2BR3A 3GAAA 1XXHB 4L0MA 4UDOA 2Y1EA 1B43A 4Y2GA 1EGMB 3UXHA 1UBJS 3ZNOA 4KLRA 5CM9C 3BK7A 2RJNA 2AZTA 2P2LA 4PSKA 1Y6GA 2D3TA 5EJAA 2PVPA 5M34A 3JWJA 3RJZA 3QE4A 3R0JA 5I8PA 1PE0A 1NBHA 4WFJA 2PMCA 3KTAA 3FMGA 2Y2UA 3SFTA 4F4IA 2F1KA 1EJ2A 4GX5A 2REOA 2H59A 3IMKA 4PZ0A 2KBEA 4TLCA 3OFSA 3Q3JB 4ZVSA 3WNZA 1O9HA 2DWQA 5KNDD 4AKHA 2CJYA 3OZVA 4BNGA 1X74A 1XK7A 3NIDB 2BE9A 4EHFA 3U3KA 4CEHB 3PDHA 4N49A 3X1XA 5BNIA 1RP7A 2W2TA 2Q4RA 4P2GA 3BGDA 1HORA 5THKA 1XLVA 1G2QA 2J9RA 2P9QA 3WRYA 2RKBA 4L02A 2QPTA 2A5YB 3LC1O 3VV3A 1B7GO 1HUQA 3K31A 4JEUA 4H1WA 4WJLA 3LX5A 3OIGA 4KFSA 1BXKA 4EY5A 5FOXA 4ISCA 4FMDB 1DE0A 3ZLJA 1TGYA 3U0BA 1MAWA 1LTHR 1WKBA 4J6FA 5HCUA 5IASA 4ZVLA 1A7AA 1EE9A 2FPGA 2VOJA 3UPDA 1GADO 1SBNE 1ZZEA 4OTZA 4ECAA 2OM2A 5AI8A 1XTTA 1I2ZA 1BGVA 2IIPA 2WDPA 1MJNA 1M1XB 2O0KA 5C3UA 3FLEA 4LYAA 2ZRBA 4CCAA 3U7GA 1YVEI 4FOSA 2P9CA 2Q9BA 3PQEA 5ALPA 5HM8A 2Q2VA 4GMGA 3QLVA 4CR8A 1D4OA 2FMKA 1O89A 2YINC 3B12A 3QLUA 4XX0A 1G19A 3V2UA 2PSSA 3KDAA 4Z53A 4IDHA 3L1HA 1XXLA 5LUBA 4UD2A 4K9QA 1D2RA 2FHSA 3K9LA 4XW2A 4G1FA 2GFHA 1Z82A 2OUIA 2PL3A 3ANLA 2WJWA 3BORA 3NBMA 4PFSA 3LIPA 1M0WA 1RPNA 2X22A 4RPHA 1JAZA 3GCWA 3V8BA 5KTRA 4C9BA 3DOHA 4BNUA 1GEEA 2I91A 2AOVA 2X0NA 3OCCA 3ZKAA 4RQTA 4IFEA 4ZOLB 1ZMRA 4LYFA 2OLEA 1MJHA 1QE3A 2HZBA 2AFIB 1X19A 1U28A 1I1NA 3J7TA 3TZQA 3KE8A 2EATA 3O7MA 4LYEA 4WERA 2FN3A 1SA0A 2GVDC 3F1KA 3NI2A 4OUKX 3SBEA 4N8DA 4M1QA 1UM9A 2IDMA 2BTQB 3KSUA 1WZ2A 1E64A 1L7VC 2XSZA 1JIQA 1YVRA 1FDRA 1L5VA 1TK3A 1CUIA 2IZ1A 1DQZA 4XJVA 2QP4A 2X6QA 2XNHA 3ETLA 4C6RA 3AB8A 1C7RA 4K81B 3L7OA 3KWLA 8ABPA 4IZHA 1KYYA 5I3CA 1S02A 3Q87B 4LF8B 3C70A 1E3WB 1F12A 2X15A 3BGSA 3L04A 5FPYA 5DCYA 1EHCA 1A8QA 1Y33E 4KXMA 2OXTA 1JEQB 3RUAA 4BFWA 2QLJA 2J5RA 2P4SA 3PKZA 3RROA 4UEQA 4Z51A 3B3FA 4MV0A 4PG5A 5EHNA 5FTNA 2XMZA 4B9AA 3GJTA 4GF5A 4DLNA 1GAXA 4PY2A 3JD4A 1I7SB 1NL3A 1SCBA 4ND8A 4PO9A 3CV3A 3VXKA 2NSLA 3B9RA 3H3XA 2HF9A 4AY6A 4U00A 3LLSA 1GPBA 2GA8A 2EKZA 2FK7A 3PQFA 4MW7A 4XCXA 4U9HS 6ABPA 1EUCB 4I1UA 1VL0A 3UMMA 3LTNC 2VJMA 3G5UA 5EWJB 3IMGA 4HAZA 5FD8A 1DCKA 5AW1A 4B3SB 1VL6A 2GCNA 2EFJA 1Z0SA 3KOUA 3VKUA 2HA5A 4TM7A 5KYNA 4IHAA 3RC9A 3WMWA 2ZAMA 1BHSA 3GPDG 2O8VA 5C8ZA 5KB3A 3DF9A 1TYBE 4B3GA 3OE1A 2JBHA 4Q3OA 5ES3A 2HSJA 3FWZA 1D6NA 1TQ6A 1Y5MA 3MINB 3NG1A 3ESXA 4FSDA 3VYUB 5JQGF 4HLNA 1YQUA 5EVJA 8AT1A 3IPXA 4Q39A 3CW8X 1WZNA 1PEAA 1FLNA 1RZ3A 4HGZA 5KX5F 1DJMA 3PIDA 3VFDA 3I34X 3TO5A 1ENPA 3P9CA 2YFYA 3DBOB 1XXHA 3TIGA 1LD3A 2JAQA 2W6MA 3L0IB 5IULC 3ZGZA 1V25A 5AW8A 3R75A 1YZFA 2FRXA 1JW9B 5EP4A 1QHGA 3C3XA 4L0DA 1YHNA 3EDMA 4PIMA 1IOVA 4HF7A 5CHEA 4IHQA 3WOVA 1EQAA 3F4LA 2JARA 3I32A 1F7VA 4HCJA 2OK7A 3GLTA 1XMPA 5D85A 2OYCA 3KZCA 5FP0A 2GNOA 1RWKA 4H3HB 5C7IO 1S3FA 1MXFA 2VTEA 5JS1A 2X0DA 3DZBA 4BE9A 1N2IA 1JFRA 2E87A 3AR7A 4RHXA 4XTCS 3I62A 3H2GA 2IPAB 4UEOA 1INLA 4MUFA 4CEHA 5EIWA 3C6MA 2Z3VA 2YMPA 2DT5A 3RTGA 3OG9A 4DMLA 3W8FA 2R2GA 2AOUA 2VDRB 4MPRA 4MUNA 4ZV4A 2QVLA 2YXEA 3DNMA 3HJHA 4WFKA 4L3OA 5SYMA 1FY2A 3E7FA 1W19A 5DISB 4BFCA 4C5CA 2DUMA 2HSWA 3N74A 5JXJA 2HXGA 5LLTA 3BYZA 3AIIA 2HD4A 4LK2A 4FFSA 4M0FA 4EGSA 2RIRA 2PXXA 1PT5A 1J2UA 4MGIR 4FHGA 2QG4A 2Z83A 1LK0A 3QA9A 3NWPA 3HCPA 4URZR 1VYVA 4QBHA 3HFSA 3MOIA 3VJMA 4MVJP 3ZXUB 4I7EA 2XE4A 3PXBA 4V0NA 4BHTA 1XCPA 3G85A 5CYGA 3B78A 1GNTA 4JWTA 4KMRA 1YKGA 3DW3X 3GXOA 1CR6A 4NCXA 3I5UA 5EHQA 1ULBA 4BX0A 1YCFA 1OAOC 1NVKA 5EXDA 1FLVA 3H4TA 3H4MA 3BJEA 3PR1A 1I51A 1JG3A 3DUWA 1MA0A 2EIXA 4HAXA 4I4NA 5LDHA 1QTIA 3LX8A 1HG1A 1WW8A 3RPEA 1E1YA 1DWOA 1R6AA 1YZQA 2ZPTX 4BUJA 1P33A 2QJRA 1Z6XA 2WINI 3CLSD 2WTUA 4M98A 2D1RA 2JI6A 1LU9A 2QQ5A 3SKVA 4RV4A 3GJ7A 4RVFA 2WKQA 1JMKC 4O2LA 1C1DA 3K8ZA 4BYMA 1YR7A 4HWPA 1POWA 3W77A 2HIMA 3R3YA 2VF4X 5CFOA 3LNCA 4ZYVA 1J2JA 4FJ1A 1RPTA 4FE4A 4P83A 4U7JA 3R09A