4HDQB

Crystal structure of the ternary complex of krit1 bound to both the rap1 gtpase and the heart of glass (heg1) cytoplasmic tail
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
164
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krev interaction trapped protein 1
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdqB00
5JFGA 2GDJA 1E0SA 1Z28A 4MUAA 3D8BA 3K0CC 2VHQA 2V3CC 3HYTA 2YOHA 3PENA 3QKTA 1XX6A 2ZJBA 2D62A 4Q48A 3SJAA 4ARZB 4E09A 2JLQA 4PC2A 4LHWA 2ZSFA 2FSHA 5CYPA 2P3SA 4ZDIA 1ZJ6A 4RFSB 4B3DA 1UJ2A 3T15A 4NYJQ 2F9LA 4UQOA 3LLUA 3EAQA 2IK8A 2XTZA 3U4QB 2QM7A 3U60B 3QSYA 1ZIOA 3GJ6A 3TW8B 1CULC 2OBNA 2AXPA 1Z0AA 3Q72A 1XCPA 4YQFA 1JB1A 4LBZA 2E1RA 2XTNA 1SXJD 5FH9A 1LS6A 4IHQA 4B76A 2YOFA 2QGNA 3P4YA 4ARZA 1ZD9A 1XTQA 2ZRHA 1SGWA 3JVUA 1IM2A 1OE0A 2AFHE 2JGNA 1Q44A 3L8YA 1Z6TA 3U3RA 2GAOA 1DE0A 3GLHB 3I1FA 3NIBA 4FXPA 4RFVA 4RFSA 5C4GB 3U3JA 1W0JA 5FUVA 4DUGA 2YVUA 1NMYA 3ADDA 1W5SA 3GMTA 4D26A 3BH6A 3TR5A 3W90A 1JNYA 5KUTA 1RC8A 2HCBA 4QJ3A 4IVQA 2WJYA 1LW7A 3A4NA 3LLMA 4ZV4A 1QBKC 5AJXA 3CPEA 1SHKA 5JS7A 4B73A 1G18A 1SVOA 1S4QA 1UKVY 2XSZD 1OH8A 2IYTA 2J0QA 4U00A 5DN6D 2FEOA 1XTIA 3DOFA 1ESMA 3A1SA 4HLQB 2J41A 4PC6A 5G40A 1YRAA 1ZM2A 2WAXA 2NPFA 5JECA 3QENA 3K53A 3P4XA 4OK6A 4PAQA 2V8OA 1NKTA 2GTPA 2VP5A 4MKIA 4ASUD 1ZAKA 3CR8A 3KX2A 3K0SA 3WP1B 1F2UB 3AH8A 3UMFA 3EC2A 1BIFA 2A5GA 1XCGB 1EESA 2PZGA 2AFIE 3NBFA 4DZZA 1M1YE 4BZPA 2IS4A 4LJ4A 2WSSA 3K8YA 3REGA 5FOUA 2VL7A 2WZQA 2WWYA 1D2EA 3TUIC 1EG7A 2P6RA 1JBKA 4UNQA 4JMPA 4YXWA 4EPTA 2BMJA 1KJYA 4DSUA 4Q7JB 1G7SA 1TAGA 1CP2A 1YR8A 1SKYB 1CEEA 1S3GA 2ZRLA 5DNYB 3MCAA 3BFXA 4B75A 2ZS7A 3KKMA 3W5IA 4DLZA 2CDNA 1ZBDA 1TQ2A 1Z83A 3MMPA 4C0QC 4LYHA 4LCBA 3PEYA 3I92A 3GLFB 1VMAA 3PXGA 4Q66C 4KFUA 1KSFX 3A1UA 4LK2A 4AWXA 4TLDA 1N0VC 4PTLA 3H86A 4QOSA 2R65A 1DAFA 4TTQA 1G20E 4H1UA 4HDOB 4RJLA 1P2TA 2ONKA 3EG5A 2A5JA 1DBSA 1XD2B 2QRNA 2GBLC 2CMKA 4UJ3A 1DEKA 5FR2A 1J70A 4B3GA 4URVR 1G3RA 1Z2AA 3RSLA 3X1WA 2C77A 3KQKA 4JKYA 4OJQA 1CBUA 4JL8A 1PVOA 1DAHA 1V43A 1E96A 1HURA 2ZROA 3LDAA 3DKVA 1VHTA 3GLFA 3E5HA 3A58B 4KO8A 3NBZC 2QP3A 4CT5A 2HT6A 2BBSA 3AKDA 2ERYA 1NVVR 4G5SA 121PA 2F6RA 4CEIA 1SVMA 4E07A 2OBLA 3T1QA 2HCJB 1XD2A 1A2KC 1W0KD 3TIFA 3OE7D 2ZSDA 1GRRA 1VIYA 2IHYA 1JAHA 4O3MA 3K0EA 2OBMA 1LV7A 2XEXA 3OEHD 2KSQA 3KFXA 4PO9A 1W2HA 1GSIA 1OKKD 4URWR 2KE5A 4IFBA 1OFHA 3WRYC 2DWPA 5DI3B 3NH6A 4HAUA 3RWMB 4XWAA 1UF9A 2WOOA 4JSTA 1U81A 5L3VA 2OCAA 1DG3A 1W5TA 5CK5A 1HT1E 2HJGA 1QHHB 3C7KA 1YZQA 3ICEA 4JVSB 4PZZA 2WWHA 2ZE7A 5JHHB 1G3UA 1I2DA 2ZANA 1N25A 2Z4SA 2D06A 3B2EA 4PSVA 4F4JA 2VSXA 2J0SA 4NCJA 2P65A 4C30A 5FL3A 4PXAA 1OIWA 5E95A 1NP6A 2HF9A 4OJKA 4OYHA 3WNDA 4V0NA 4EUNA 2F55A 2J0UB 2C2HA 4M9SA 1FX0B 2JJ1A 3EZFA 3RAPR 1SKQA 2W83A 1WRBA 3MJRA 1NY6A 1R7RA 3OIVA 1SULA 2VRWA 5DI3A 1F5NA 1E2JA 4OHVA 3FGNA 4M1OA 1E2EA 1QG4A 4Y0VA 3DVLA 1QVAA 1QHHA 3PVSA 1IXSB 4URXR 4MYUA 3EZ2A 1GFIA 1NF3A 4EPVA 3VHLB 1ESNA 2PCJA 2OZEA 3U3OA 2QMEA 4HB4A 2GNOA 4RD3A 1M6NA 2BEJA 2CJWB 2R6GA 2XB4A 1KI4A 1BMFA 1E2KA 1TUEA 3LH5A 4M1SA 1EGAA 3NXSA 1GM5A 3CX6A 4XOIA 1Z6GA 2D74A 3ZYCA 4XWKA 2J0UA 1XMSA 4A36A 1FX0A 4XSGA 3BRWD 4GOXA 3UWKA 4Q9LA 1OFTA 3BD9A 3TVDA 1G3IA 1AKYA 1FOEB 2RCNA 3N5CA 4TMXA 2A7QA 2Q0HA 2FEMA 4ZDJA 3WYAA 2QT0A 3KZ1E 1E1QD 4DEXA 3NVAA 5KTYA 4F91B 5EP3A 5FPYA 1NG1A 4O2RA 2EVWX 4EFMA 621PA 2B92A 1IHUA 2NO0A 2WKQA 1EFHA 3K9NA 5EZ5A 3AUYA 3HJNA 5JWHA 5D3QA 1OB2A 1ZVQA 4JBYA 3Q5DA 4M53A 4P33A 4NYJR 1E2LA 1AA9A 2Z83A 4Q7MB 3P1JA 2BCJQ 4N0EA 2PLRA 4CIDA 4BEBA 5C2JB 3C5HA 1ZINA 2FX3A 4A2QA 3EIEA 4MRVA 2EFDB 4CF7A 2AD5A 4GBMA 2O52A 4I99A 3WYFA 3MFYA 3CF2A 2GVDC 3NH9A 4LBVA 3QPWA 2ZQ5A 2ECKA 1NG9A 1RZ3A 3ZVMA 4TYQA 3U44B 1KJZA 3LRPA 4PANA 2AKAB 4L4UA 2GAAA 3KKOA 4EDHA 4C9BA 1Q21A 2W0SA 4HAVA 3U61B 4FMBB 2ZUBA 4DLYA 1DG1G 3HWSA 3CRW1 2Z43A 3BOSA 4AK9A 3AGQA 4ZCMA 1UPTA 4GFDA 3RS7A 3B5JA 3QPVA 4B71A 3AB3A 1D6JA 2CEAA 4KLNA 2RKOA 3L8ZA 4I81A 2JLSA 5HR5A 1BS1A 2FA9A 1H8HA 1HTWA 1HQCA 1RRFA 1KTVA 1W2GA 2OXRA 3LA6A 1KOFA 2Q21A 3UIEA 4A82A 4AD8A 5LBIA 4RD1A 4PC7A 1HYQA 3U44A 3ICQB 3JZMA 4B35A 5EUMA 4LUCA 4IDHA 1P72A 3I8XA 2ZRFA 2B8TA 4YMUA 2LKCA 4CDGA 5JI2E 2X1VA 1YZGA 3FB4A 3Q7QA 5KPDA 4DB4A 2C9OA 2CHVA 2NQ2C 3TKLA 3V4RA 3DMNA 1QF9A 1WA5A 2FZ4A 1F2TB 1ZD1A 2QL6A 4LV5B 4G5RA 4Q02A 5J4LA 2QGZA 4KFRA 4TSFD 1YU9A 3X1YA 2NO6A 1KSGA 1AKEA 3GEHA 1P4SA 5AUNB 4PFSA 1A82A 2W00A 1JEEA 5L8VA 3MLEA 4F4CA 1N5IA 1XB2A 4PQYA 2CXXA 2IF0A 4B2LA 3TQCA 4TLAA 2VQSA 2PMDA 1J2JA 1KGDA 4KV9A 4P3YA 5BYKA 3LW7A 4D81A 2C95A 4DUGD 4FMCB 3AKEA 4II7A 2BM0A 3FTQA 3C14C 2DY1A 3W9YA 4RZUA 4S2EA 4A0FA 1IJFA 4ABYA 5DHAA 4W5WA 3IEVA 5L3QB 4WIAA 3EZ9A 3AP2A 3EARA 5JCZA 3K0FB 3N70A 2FFHA 3QXSA 2GA8A 2BEKA 3CNOA 4DRZA 2BHRA 3CF0A 3K0AA 1YQTA 4V0OA 4M22A 1CR0A 4TL6A 3FYHA 4M2LA 1N0UA 3Q5EA 4Q1DA 3SHWA 3TR0A 2UZIR 2ZYWX 2HXSA 4DDTA 1BYIA 3EX7C 1JJ7A 4Z8XA 2Q9BA 4KSCA 3TVTA 1KO8A 2W2TA 1GG2A 3DDCA 4RZ2A 2WSSD 3Q3JB 3BBPA 1FL9A 4QBIA 2PZFA 4XVUA 5BWMA 3ZLJA 4YXWD 1AS0A 2PT5A 2NZJA 3RS2A 4B3FX 2JJ2A 1CJMA 2IUTA 1VYTA 2F9MA 2NTYC 3OEEA 4NHOA 1DAMA 2BMFA 4QGFA 2A30A 4DLVA 3I8SA 3UANA 4KSBA 2VEDA 2LWIA 5B30A 3IUYA 3FOZA 1IBRA 1AS2A 1RFLA 1AGRA 1TQ6A 2VSOA 1GRNA 3P27A 1NN1A 5B57C 2OCBA 3VTKA 4NZYA 3FPAA 3FMFA 1MOZA 1SVLA 2VP0A 1HEIA 3KJEA 1U8ZA 2QAJA 1IN5A 2IF2A 4JBWA 4AURA 5EUQB 3I72A 1Z29A 2D2FA 3MGCA 2BJWA 2ZR0A 4M1TA 1ZM4A 3QEJA 4LPKA 4NCHA 5FOXA 2G3YA 5LB4A 1MV5A 5EXTA 1N6OA 1ZYUA 4AKIA 2JDIA 1JALA 4ZCLA 1RJ9B 1XMJA 2O8CB 5IK2A 4OHYA 2IUSA 2QTVB 3QY0A 4ACBA 4RD4A 3B9QA 1G7CA 4NBSA 1Z8FA 5G41A 3RS0A 1WMSA 1P2VA 4XVRA 4TMZA 2GILA 4WXPA 4FCTA 3B8HA 1P61B 2FFAA 4CGZA 3GPLA 4R7ZA 1G7TA 4Q4JB 3NC1C 1J90A 4N1AA 4CVNA 2L0XA 2AR7A 2J7PA 1ELOA 5G53C 3QE0A 5ANRB 2PJZA 1RJ9A 2O8CA 1MR3F 3CRMA 3LNCA 1IXRC 2VF7A 4Q4LA 1M7GA 1R0YA 1GZSA 2C5LA 1ZC4A 1LF0A 2O8EA 1KSHA 2ZI7A 1G8PA 5J4YA 1CIPA 2JA1A 1XBTA 4NTZA 1TQ4A 1JR3E 4I1UA 2Q9CA 2O8BB 4IJMA 4BPBA 1U99A 4LYFA 3CKLA 1W4AA 2AKYA 4Q4JA 4B2PA 2A9KA 1FQJA 2W6IA 1JR6A 4B3XA 4LSGA 3UWOA 4D25A 3KJIA 2AX4A 2XAUA 1XU4A 1G5TA 4HUQB 3RS3A 5DYGA 1E2HA 3TRFA 3KL4A 4LJAA 3FKSD 2ZRAA 1CS4C 3I3SR 1O3YA 3G82C 2OSBA 3BAFA 1L7VC 4U02A 4A0RA 3OIWA 3W34A 3GFOA 2B6HA 4BFYA 4DIEA 5JRJA 5KNDA 1GDDA 3IIMA 4M9ZA 2JJ8A 1G1MA 1N6KA 2V7QD 4V02A 5AJZA 3T34A 4OI2A 5HZHA 1CU1A 3KDSE 3IQXA 2O8BA 5CK4A 5DISB 4HATA 4CZ2A 2RH5A 3U7GA 4BRUA 1BMFD 2ZRIA 4KHZA 3J81k 1G8GA 3V00A 4X8OA 1PZNA 1XEWX 4HUQA 1D2NA 3BE4A 4WZ6A 2OV2A 4DLWA 5EE3A 4M8NE 4C0KA 1Z63A 2XNDA 4B34A 5K8UA 2IA5A 1GKIA 4A92A 2JLVA 3I5YA 1KAOA 1E4VA 2WIBA 5JMTA 2F3TA 3AP1A 1DAIA 3BS4A 2QORA 1TEVA 2OAQ1 2FSFA 1IOZA 1G17A 4PC1A 3ZVRA 1YE8A 1KKLA 2JIZA 5FPSA 5LDDC 1OJLA 2VIIA 4LC1A 1G41A 2QU8A 3F5FA 5KHOC 2WWWA 4NYMR 3KQHA 1N5LA 4JT4A 2CCGA 2IW3A 2HUPA 1QHYA 3W6OA 3KXKA 2YHSA 3FFBA 1J7KA 3SQWA 1M7HA 1FUKA 2ZJZA 4KVGA 1AM4D 3WHKA 1X8LA 3VFDA 3D3QA 4G0NA 2R62A 5JLJA 3CX8A 4P4UA 2ASEA 1KK2A 3GLIB 3PV0A 3VR4A 1KO1A 4PQFA 1BKDR 5EZ6B 1EFUA 1DS6A 2IX3A 5BXQC 1X1SA 2XJ9A 4UKDA 1UEIA 4AYXA 1CR2A 3CB4A 4TMWA 2OAP1 1JPNA 1QZXA 2QG6A 4XTCS 3GJ0A 1R0WA 1W48A 5AJVB 1VPLA 3QQ5A 1R2QA 5KSZA 1H8HD 4ERNA 3H84A 4DHEA 1AS3A 1VKJA 1DAEA 2CL7X 3QXXA 3SE0A 1E32A 3IPXA 1ZNZA 5F9HA 4Q7KA 2SHKA 4LJ8A 4HDCA 4OHWA 1TL7C 3B85A 1FNMA 2QSZA 5FOSA 2P6UA 4YMSA 3R7WA 1KAGA 4V0KA 4YDHB 2FNAA 1T3LA 5HPYB 3L0OA 1XP8A 4F4IA 5JEDA 5EP4A 1GVNB 4ZI3A 5HKKD 3FHOA 2OG2A 5KU1A 1Q3TA 1G8HA 2H7VA 4BZQA 1GKUB 1VCNA 1RYHA 5H8WA 2Z6VA 2ZEJA 3K70D 1U90A 3NEYA 4Q1BA 4OHZA 2O0JA 5CB8A 1ZRHA 4HAZA 3IDQA 4GL2A 1R0ZA 3T1OA 4MITA 2P6NA 5DHFA 3TW4A 1OIXA 1UADA 1UBFA 2DCUA 2XOKA 4C4PA 3CX7A 1OFUX 2V55B 4GP6A 2A2ZA 4FW9A 1DAGA 3K9HA 4R2HA 1XEFA 4JLPA 2J46A 1VHLA 1QHXA 2OLKA 1JEDA 3GJ3A 5FOTA 4RVCA 3IO5A 2GCOB 5SZHB 3IILA 5G3YA 5FBWB 3I32A 1R8SA 1EWRA 4B2IA 1VYUA 3U6BA 4MGIR 1ANKA 2JEOA 3TMKA 2IS6A 2RGAA 3QG1A 3B1XA 1G64A 4QBFA 2VSFA 2JASA 3NHBA 4LRWA 1JAIA 1Z0IA 1G16A 5F2EA 5SZJA 4F7WA 2PEYA 1X1RA 2ERXA 1FPMA 3ETLA 1FZQA 4AIIA 2B21A 2CL6X 2HLDD 2ZVPX 4D4MA 5DYIA 3RRZA 3L0IB 3IBGA 2GCOA 1EX7A 1GUAA 3BC1A 1MO6A 5GADl 1Q22A 3A1VA 4Q7LA 1OHHD 5KDLA 3VX4A 4V0ME 3K1JA 4Q21A 1P5ZB 1E9CA 2R6CA 1FNNA 1OW3B 1NI3A 1G8YA 3QNUA 3LBHA 4DCTA 2GVZC 2PX0A 1JXOA 4AYWA 3T1VA 1E1RA 4BZXA 2A3RA 1N5JA 1B0UA 1OV4A 2FDCA 2CK3A 5HTKA 5KNBA 1R0XA 4UNPA 1ZM7A 4Z1MA 1D9XA 4QJ5A 3OZXA 1OIVA 1E0JA 2BM1A 5FTLA 4JL6A 3U4QA 1P9RA 2J5XA 2CLCX 4C2UA 3AVTA 3EC1A 2ZSEA 2IYQA 4RZ3A 1FUUA 6Q21A 2GJAA 2ZM5A 2KWIA 5G3ZA 1KO5A 1DOAA 3NDPA 1Q0UA 3RANA 1GL9B 2GCNA 4D4LA 4HSEA 4F93B 3PEWA 5JSZB 1K5DA 2CHQA 3GLHA 3AGPA 2ZI3A 4QL3A 3IO3A 5CM8B 3L82B 4HUTA 5FI1B 2FH5B 2VLIA 4QG7A 3BB4A 1LB1B 2IYRA 3QXHA 4G5GA 4JLKA 3D7MA 1OSNA 5IF9A 1AN0A 3M1IA 3DMDA 2I3BA 1S9HA 3PEUA 4AYTA 4BGDA 4URUR 2GBLA 5C4MA 2JLZA 4MGZR 1DTSA 5JCPA 4B47A 3KQUA 3OAAA 3H2YA 4JLDA 3KQNA 3I4LA 2CHGA 4R71A 2E87A 4LOAA 3TE6A 3Q9LA 3QVUA 2HV8A 3QXJA 3DZ8A 4KVAA 3TK1A 1WBDA 5KSOA 3B13B 3S1AB 4TT3D 4BASA 4Q03A 5EE5B 1EX6A 1N5KA 2JDID 4K46A 4ZDKA 1TQDA 2AD1A 2PZEA 2IYYA 3FDIA 5IK2D 2WKRA 3B60A 4MRNA 5CYOA 4UNSA 1F2UA 4R9UC 3ZQJA 1NMXA 2NOAA 3CRQA 2QMOA 2XITA 3PUWA 2C9CA 1ZUNB 2QY9A 2ZAOA 5C1BA 2YKGA 4GZMA 2CNWA 2ZJ5A 1II0A 1IAQA 4UJ5A 1E69A 3O8DA 3R9WA 3DEFA 5FTJA 1NBME 4BFUA 1JPJA 2YZ2A 4KFTA 521PA 5J4HA 3S1AA 4BFXA 3HPRA 4JLMA 3M4YA 3PUYA 4V03A 3RVBA 5LD2B 4PAOA 3SS8A 3WXMA 2QPAA 5FL7A 2WJJA 3ZZTA 2IUUA 1NN0A 4DDUA 1DELA 2LCFA 2N42A 1UKEA 2XZPA 1AIPA 1G4UR 2C8VA 2ZRJA 2ZU0C 3GEEA 4NYIQ 1T4GA 4HLUC 5CJPA 4QHSA 5F3WB 3Q7PA 4RY2A 4QM6A 3WMGA 4U5XA 2W6ID 3DO6A 4P31A 1W4CA 2QQ0A 4OKSA 1C9KA 1NIPA 3T61A 3R20A 4B74A 2H8KA 4K81B 2C9YA 3LX5A 1MRSA 1Z6YA 1ODFA 2IEZA 4P4TA 1Z06A 3BORA 2AXNA 1VYVA 3ZZ0A 3QKSB 3ND8A 5FBQB 2DPXA 4GI7A 4JLAA 2GRJA 5KOYA 5H70A 1GWNA 3CPJB 2KB0A 3W3AA 4PHGA 3SQXA 2O0HA 1P3JA 2D3WA 3CWQA 3CNLA 5JBQA 3CR7A 1N6HA 1COWD 4S35A 3SZRA 4DC9A 4E03A 2BWJA 4JVNA 3VR2A 2XZOA 4OI1A 2J0VA 1NBMD 1CTQA 2EWVA 1S96A 2QUZA 3QUSA 4XSHA 4QRHA 2YYZA 4LV6A 2H5EA 1NN5A 3W6NA 5DH9A 1Z08A 4JKIA 4A1FA 2ZSAA 4BEJA 4N0DA 5JRZA 2WKPA 4IXMA 2EW1A 1IY2A 4CW7A 3T06B 1GL6A 4FD2A 3SNHA 4IDOA 1JI0A 5K8LA 3QKSA 2HYDA 1QG2A 2QAGB 4Q1CA 5LD2C 2IYLD 3GLGE 1S2MA 1XZPA 1IN4A 4KFSA 4URZR 1NLYA 4JT2A 3UG7A 1HH4A 1N0WA 4A6PA 2QMUA 1H8EA 4ZIRB 2GHIA 1ZD8A 2OFOA 4DLSA 2NIPA 2ZVQX 4PZLA 3B6EA 2I1QA 1DPFA 3V4FA 5J4KA 3OESA 1OT3A 2Q3HA 2RGBA 3AF1A 3B7GA 1NY5A 4G01B 1FTNA 2FG5A 4IOJA 3NC0C 4RKEA 2ZIAA 4M1MA 4CEJB 3BJIC 3ZD6A 2ZJYA 2V1UA 1QHNA 3D31A 4IFEA 1KMQA 4PO1A 3EPLA 2FJUA 3ASYA 3LFUA 1BOFA 1E94E 2QAGA 5TXGA 4O0MA 4P32A 1GRQA 4O2LA 4QNRA 4HB3A 1YR9A 4RCZA 4C0JA 1FTSA 1E2NA 1I4DD 1KDPA 1D8TA 5EE9A 1XTJA 4ZIRA 4Z54A 1TUIA 2BBOA 1D2MA 5JEEA 2WIAA 4LI0A 4DXAA 1G21E 1XZQA 3EZ6A 4D0NA 1Q1EA 2FU5C 4CEJA 1NRJB 2CJWA 3NBXX 4PHHA 3UG6A 4PX9A 4NL4H 8OHMA 1LS1A 3KB1A 4KYIB 1T6NA 1E79A 2J3EA 3L43A 3GD7A 3EPHA 2C96A 1AK2A 2BMEA 2ZRNA 1MO4A 3C41J 1OB5A 3EA0A 3CIOA 3LQRA 4MKGA 4NU0A 3T12A 4OBEA 1G5RA 2B7BA 4WZBE 2QAGC 3AKYA 3L0PA 3UMSA 2KI5A 3C8UA 4DCUA 3SYNA 2ZUDA 2MSDB 3KKPA 5KYKA 3A6PC 3ZD7A 1U8AA 3HP1A 3K09A 1E2MA 1US8B 1EWQA 2PX3A 3PUZA 4GOKA 1G7RA 4J0QA 1G3QA 3BIFA 4LBWA 4ITRC 2ZRCA 5DI9A 3W6PA 1RPZA 1X8JA 2IXFA 3IPYA 4DEYA 3DKPA 1PLJA 2XOKD 2JCSA 5DE3A 2VP9A 3KUCA 2REXB 3RC8A 3MWLA 4IOMA 4TMTA 2AHOA 1IQPA 3TNFA 4CRWB 4A0HA 1TPZA 2QNRA 1Z6AA 5BN5A 3HU2A 1XD9A 1K5GA 1IY0A 2CL0X 4P0TA 1US8A 4ACAA 4AKGA 1KY3A 3K09C 3TSWA 2QMHA 3ASZA 4HDQB 3RHFA 4IDPA 4AKHA 3GLHE 4R2IA 3GJ7A 1OH6A 1XXHB 3HU1A 2C78A 1KIMA 2GK6A 1JQLB 3C4JA 4OL0A 2B8WA 4A4DA 3OIYA 3HU3A 5DSZA 4DSOA 1NN3A 3M6AA 1P2UA 3AVYA 3KXLA 5K8IA 4QXAA 5FBLB 2VYFA 1TF5A 2ZUCA 4ESHA 4YMWA 2EYQA 4FCWA 3LXXA 4U7DA 4TWZA 3TAUA 1P9NA 3DPUA 3MG9A 2I4IA 4TMKA 1TX4B 2YINC 1H65A 3LQQA 4D4KA 4TQ9A 1W49A 3E2IA 2HXYA 3AVUA 4Q9KA 4WZAE 1XMIA 2Q3FA 1W0JD 2CK3D 1MKYA 5GJWC 1XXHA 2I1VB 2A5YB 1QHIA 3W3ZB 1F2TA 1J99A 2G88A 4US0R 2VHTA 1U0HC 4IEIA 4QGHA 2G77B 4FN5A 3RABA 2WMNB 3TSZA 4PSKA 4M0LA 4PPQA 1SXJB 2MMGA 2QN6A 1W44A 3SJBA 3LWNA 5JWOA 2FPMA 2ZRBA 1II9A 4L9WA 4PSAA 1OXXK 4JLNA 1G9XA 1QRAA 4Y0AA 5EP2A 1TU3A 3ADCA 3PUVA 2WOJA 3SFZA 3BB3A 4A8JB 4G1UC 1SKYE 3QKRB 3B1WA 1T5LA 4JVMA 2ATVA 3SBEA 2WJHA 4PAMA 2YWEA 4IW3B 4OQLA 3GLFE 4KYUA 2REBA 1KNXA 4GZLA 4TZ0A 5ELXA 4NYIR 2QTHA 2FGJA 1ONBA 4N3NA 2XXAB 3OIUA 3E70C 1XFAA 5EXXA 3C16C 3SBDA 5FBRB 3X2SA 5L3QA 3OAAD 5E7IA 3BERA 1R5BA 2QRZA 3FKQA 2OE2A 3K0FA 4ESVA 1MRNA 2ODNA 1Q1BA 1HQYE 4A8JA 2FN4A 3BH0A 3QKRA 3ZVLA 3GEIA 2A5DA 4IEEA 4D0LB 2HT1A 1VG8A 1X86B 1A5TA 1IJEA 1KI1A 2ZYVX 2P5TB 2VP6A 5DGXA 3X1ZA 2FFQA 1LFDB 2WV9A 3M0EA 4HB2A 5LPNA 4MYHA 1TF7A 3N2IA 3THXB 5A5GA 2IYUA 4O25A 1PLLA 4BUJA 2NO7A 5FFMA 3C15C 4BLSA 1KY2A 2XSZA 1YZKA 2P2LA 4EFNA 5BQ5A 1RYFA 2IS1A 2YC2C 5DN6A 5CB6A 1SXJC 1XEXB 3AVWA 1F60A 1GOTA 3QI2A 1Z6XA 2QP4A 2WWIA 4BRWA 2G0NA 3MAAC 2CLDX 5FTNA 3A4MA 5CIQA 5AUPB 1UDWA 3EWAA 4L9SA 4A8JC 4ASUA 1E2DA 1UBGA 4EQ6B 2BV3A 4M1KA 2FFBA 1U9IA 2KBEA 3AVPA 4NH0A 2G0TA 4LYJA 3AVOA 3CNNA 3R9IA 3QJYA 2C04A 4ZCIA 1AZTA 1KKMA 3FHTA 1P6XA 4JZKA 1OH7A 5TV2A 1MH1A 3I62A 2ZE8A 2ZREA 3ZJYA 4EJSB 2Z0MA 3HDTA 4QNMA 2F3RA 4Q9JA 2IYSA 3QPUA 1E9RA 1QDEA 1N6NA 3CH4B 2R44A 4A15A 3LBIA 2GCPA 1F48A 3RS5A 2GZHA 3VU9B 2OESA 1GNQA 2BC9A 1IONA 2WWXA 2ZAMA 3DL0A 4XIGS 4EQ6A 4OK5A 1KO4A 1SVSA 2QROA 1OXSC 4PO8A 3PUXA 1Z0DA 1ZIPA 3A4LA 4GMXA 1U9IC 4KITB 4DDVA 4X8MA 1CXZA 4Q19A 5JZVA 3FHCB 1X6VA 3I5XA 3EPKA 2QM8A 4DCSA 3B78A 1PUIA 1XJQA 2PLFA 1L4UA 1XJ0A 3UATA 1R8QA 5FUWA 3THWB 5SZIA 5EQTA 2DFKB 2YWGA 1NMZA 3IQWA 4MGKR 1OYWA 2ODEA 5JJLA 2F1HA 1S1CA 4EJSA 4NONA 1KNQA 4JBXA 3NTUA 1E9DA 1E0AA 4MH0R 1AGPA 4RD0A 1Q1QA 2UZ3A 1Q1ZA 4ZPXA 5FPKA 2G6BA 2BKEA 4IOKA 3VU9A 3VKWA 2IL1A 4CEHB 2JJ1D 1YHNA 2O0KA 4GRAA 4US1R 1FP7A 3AF0A 1TEXA 2JLRA 3QBTA 1XTKA 2PCLA 2BBWA 3AKCA 4URYR 4Q1EA 5HZKA 5BN3A 4MYTA 2QE7A 4W7SA 1G3MA 1GL7A 4HZUB 2EQBA 4YDSA 1W0KA 4BLOA 4DLUA 3THWA 2ZI4A 2O5VA 4I1SA 1EFCA 1GITA 3VMFA 4LX0A 2VP4A 1G291 5KNCA 1KI2A 2OLJA 1XWIA 2F1JA 3VR3A 5C18A 3OEHA 3LAWA 4X8LA 4EJSC 3DM9B 4FMDF 5J47A 3ZS8A 4TQAA 1SHZA 3EIHA 4CEHA 3KKNA 4HAWA 1T5IA 1OKKA 3NHAA 5FUYA 1UAAA 3B1YA 1N6LA 3VNUA 1KI9A 3U3MA 4AG5A 2XX3A 5SZKB 3TUZC 2UVQA 2ZSBA 4LY6A 421PA 4HZUA 4RD2A 5J4VA 1KK1A 4RD6A 5JJKA 2ZI5A 2RGNA 5E3HA 5TB5A 1P9WA 3CBQA 3FMOB 5AUQA 3WNBA 3IBYA 1ZM9A 1M34E 1P75A 2GJ8A 4MQBA 4ILEA 2JATA 4M9XA 2NPIA 3IKJA 4I1VA 4NCKA 3KUDA 4MDEA 2IYWA 3R9XA 2DBYA 1AQUA 1NL3A 2MSCB 2G9NA 4BFZA 1F6BA 5J5CA 3AVVA 3GFPA 1XTRA 3ADKA 1BYUA 1VIAA 3PJRA 3VKGA 1UM8A 3U6KA 1PLKA 4JS0A 2GJSA 1MABB 3QKUA 4JL5A 2Z5FA 5DLQC 2XZLA 5B64A 4LHZA 1KMHB 4BLPA 3MJHA 3QF7A 1N3BA 2QENA 3LXRA 2WMOB 2RGNC 3F3YA 4DLXA 2D2EA 1YRBA 2ATXA 2BBTA 3RWOA 2DFNA 3GLIA 2O8FB 1T0HB 3U7HB 1VG9B 1TNDA 4LC0A 1E1QA 1CJVC 1Y3AA 1CF4A 1AQYA 3DZDA 1L2TA 3L2OB 4IVPA 3QVVA 1GIAA 4B6EA 4QBGB 3GCGA 1I4LD 4E5UA 1TU4A 2R9VA 3CZPA 2OFXA 2QQEA 2XJ4A 5GJCA 3SU8A 1YR7A 4QKQA 5KDOA 1OFIA 2V1XA 1NSTA 1ZM3A 3REFA 4LV8B 5TMPA 1E9SA 1KSJA 4G5QA 1VCIA 2O8FA 3TQFA 1Z22A 5JHGB 2PEZA 4TL7A 3ZVNA 5E7JA 2XGJA 4HYYA 1J8YF 2N46A 2HYIC 2VP2A 5EXPA 5FUXA 3PITA 4FMCF 2RGCA 2IYVA 2ZRMA 5E7MA 3ZGXA 4JLVA 1T8UA 2KJQA 1D5CA 1Z0FA 3HPQA 5CDFA 4Q5IA 2HEIA 3G5UA 1GAJA 3KJHA 3HR7A 4G3XA 4ZKDA 4JJKA 2PH1A 4UXHA 1TMKA 3KXIA 2QPTA 2DYKA 2ZJ2A 5AJWA 2RGXA 1E98A 2FE4A 4V0LA 1YJ5A 3WRXC 1RRGA 1KYIA 5L3RA 1G6HA 3EZ7A 2DWOA 2PBRA 5BW8A 3TGPA 4C7OB 3FE2A 4QBHA 5FTKA 4UNNA 4B44A 1A7JA 1L4YA 2J45A 5DIFA 3KQLA 1WCV1 4QJ4A 5CLLA 1OXTA 1W47A 3QEOA 4L16A 4OHXA 4TLEA 2YOGA 1F3OA 1XJCA 2FWRA 3BK7A 4PPFA 2BMDA 2G83A 1HE8B 5TY0A 4E22A 4Z8YA 5KDDA 1MT0A 2X8AA 2NGRA 2BDTA 4JLBA 4NE2A 1S9DA 4TSFA 2F7SA 2IHBA 1G8FA 1OPXA 2PL3A 5BYJA 4C7OA 2ZRPA 1OXVA 4HZIA 3PIRA 3OFNA 5D3MB 2JJ2D 2C98A 3D6TB 3MWKA 4M21A 1TADA 3OEED 1FMLA 4M1YA 2GXUA 2WSMA 4A0GA 4F92B 3CF6R 4C2TA 1NVWQ 2ZJAA 1TF2A 2EFHB 3Q8XB 1XPRA 4OQXA 2V6IA 5TARA 4Q18A 3KFVA 4BLRA 3QBVA 4AG6A 2R6FA 1JQJC 5AR1A 3FMIA 3JVVA 1GP2A 4LZZA 4TTPA 3T35A 3IGFA 5F98A 4XVQA 4XWOA 1A1VA 2WJGA 3U7EB 4B33A 2O8DB 1E6CA 3JZAA 5AWFC 2UKDA 4LHYA 5D3MA 2LKDA 5AK0A 3UXMA 3O8CA 3NG1A 3VX3A 1UBCA 1DVRA 2RHDA 2TMKA 2VPPA 4YMVA 3P26A 3WBJA 2D4HA 2V9PA 5A4JA 4DT1B 1R4AA 5JSZA 2V54A 3GJ8A 3FWYA 1YKSA 2DR3A 2V6JA 5AJYA 1R10A 4DB2A 2ORWA 3AF2A 2W2XA 1GILA 2WM9B 3A37A 3T5GA 2H16A 1WDTA 2PJRA 3MD0A 4IRUB 3TJZA 5KO2A 3VNVA 1NJGA 1W36B 2HF8A 1YZUA 1VG0B 4NP6A 1UDXA 4JLJA 3AF3A 4HLUA 1A2BA 2FMXA 2GXSA 4XH9B 2ZS9A 3RYTC 3QF4B 5FPHA 5IRCD 2O8DA 3WNCA 3SYKA 2JAQA 4RZXA 4B3BA 3AEZA 1W7AA 2DB3A 2OXCA 2GF9A 1YR6A 1AZSC 2WPDA 2G1JA 3VAAA 3NKVA 5FPTA 3BB1A 2H1LA 4DT1A 2E9SA 1T8TA 4LPSA 1A4RA 4DKXA 2WAYA 2OCPA 2J7PD 4XTRA 5GVRA 3RRNA 1DO0A 2ZR7A 4F38A 3NBYC 3PFIA 4KU4A 3PEVA 1YZLA 4GP7A 4R98A 2H17A 1WQ1R 4DVGA 2AK2A 2Y8EA 4G5OA 4HLDA 4IXNA 3LVQE 4CEIB 1IN8A 4KBFA 3RC3A 3KKQA 3QF4A 4PZYA 1RIFA 4L8GA 1ETUA 4ZDWA 1X8KA 2WHXA 1XMVA 3H0KA 3VR6A 4EPYA 1U0LA 2ODBA 2QA5A 1MO5A 4QC2A 1HV8A 4QM7A 2ZU6A 1Z07A 1IY1A 3EW9A 3THOA 3IHLA 4XJXA 2GF0A 3AV0B 4LJ6A 1KDRA 4LGMA 3K9GA 1E9FA 1KI8A 4DLRA 4DWJA 2XNSA 2ANBA 1RW4A 4TLCA 1M2OB 2FOLA 1VCMA 3NWJA 1HY3A 2QE7D 2AWNA 5J40A 2RGDA 1LNZA 1W36C 5AUOB 1WF3A 4FCVA 3SC3A 1CJTC 1Z5ZA 2AWOA 4Q01A 2FGKA 4DLTA 3A36A 3T1TA 3ZQ6A 2YJTD 2R8RA 3EWSA 1VCOA 4BFTA 3AVXA 4IDNA 3UK6A 3LVRE 5KSPA 4FINA 2AN9A 1KO7A 1CR4A 1E9BA 4CT4B 3R8CA 3PCRB 4A2WA 4WOPA 4B43A 2XNDD 4NDZA 1CRQA 1U0JA 4B32A 1IXZA 1XD8A 2OCYC 4BE7B 3GLIE 3MSXA 3P32A 5UKDA 2X2FA 3BH7A 4YLGA 5JI3E 2CCJA 4DSTA 1EK0A 4MKHA 4DDWA 1GNPA 1OF1A 2JIZD 4TZ6A 2EFCB 4H9GA 3W5JA 2W6JA 3SI7A 3HR8A 1S1MA 2ZJ8A 1QHSA 4KAXA 3AVQA 3SYLA 4L5BA 3KTAB 4NKRA 1SQ5A 3ND9A 1KK3A 2QZ4A 2PT7A 4W5HA 1T91A 1V5WA 2QSYA 3H1TA 1XEWY 3CRVA 2W0MA 1VTKA 2OEPA 2WVJA 4PC3A 3I61A 4OI0A 1SVKA 3UKDA 3FKSA 4JIMA 3AQ4A 3ECCA 2OM2A 2ORVA 1Z0JA 1NLFA 1L8QA 2AL7A 3G0HA 1C1YA 3SJCA 2DFLA 3ZS9A 2FSGA 2V7QA 4TL8A 1ZP6A 4Q9HA 2BKUA 4BFWA 2CE2X 3IIJA 2GJKA 4OQFA 4YC7A 3KTAA 2DFTA 1E9AA 2ZE6A 4YMTA 1O87A 1Z47A 2ZRGA 3BFKA 3K9LA 2W2VA 3SHFA 5EE1A 2A78A 5CDFE 4FWIB 4IOLA 4W9MC 2IYZA 2P5SA 3GP8A 2RAPA 4QFMA 2VHUA 1KJWA 4PPNA 1B23P 2VBCA 2D7DA 1ZUHA 4EFLA 4C3ZA 3OHMA 5HE8A 1RE0A 4P4SB 4FMDB 5EXSA 3I73A 3VR1A 3LD9A 1FFHA 2IXGA 1JR3A 2OHFA 2ZR9A 3H4MA 3GFTA 4Q9IA 4YONB 2JLWA 4IKEA 3A8TA 3T5DA 1KI3A 2P67A 3P20A 4M1WA 4A2PA 4UXJA 3CH5A 4JYBA 2GZAA 5FR1A 1P62B 2WTUA 2AK3A 4EPRA 1QHGA 3O8RA 2RB4A 5EP1A 1KHTA 2ZYTX 3MRSA 1KK0A 2C99A 3W8NA 4D80A 3EPJA 3SJZA 1P60A 2Z4RA 3RS4A 4EPWA 2NO9A 4PR0A 3SOPA 3ONWA 4B48A 4BFSA 2OILA 1SVIA 3RRMA 4MRPA 1ZU5A 5CLQA 1KZGB 2BVNA 4WAUA 4FWTA 5H68A 4P4SA 4B6FA 2CVFA 2FPLA 1LF5A 2OO7A 4DCNA 5KPJA 2X19A 1DADA 4KODA 1M7BA 2FPKA 2YC4C 2NO1A 2ZI6A 3X1XA 3B1ZA 1N6IA 4AKEA 4M9QA 2HJVA 3K70B 5CM9C 3ZIAA 4GT1A 5JJIA 4QHYA 3RDPA 1FP6A 5F9FA 2ZPTX 3A1TA 2IC5A 2VTKA 5IDVA 4A6XA 1Z2CA 2X77A 4KI0A 3E1SA 1KI6B 4XD7A 1GKYA 5IHPA 2BOVA 1FQKA 2QP9X 1XCMA 3CZQA 3PG5A 4AY2A 4JLOA 2H57A 4TQUS 5K8TA 3ADBA 1AJEA 2VA8A 4LJ7A 3TSOA 3HYRA 2NZ8A 4NCIA 4NMMA 1EFRA 1Y63A 221PA 4MKFA 5HKKA 3EIQA 2ANCA 1ZUIA 2CVHA 4KLZA 4NYMQ 2BJVA 1UEJA 4TMVA 4A9AA 4DJTA 1E1RD 2R6AA 4DIDA 1ZU4A 1UKYA 2ZI9A 1ZC3A 5FOVA 3VKHA 3GJ4A 4Z1MD 1KI6A 3R8FA 4BECA 4WVFA 3SDZA 1SVWA 4AC9A 1HT2E 3U2QA 4WW0A 821PA 3U5ZB 4FI3C 1KDOA 3OFND 1G5PA 2CLSA 3LY5A 2F1IA 2F1RA 4JVLA 3AM1A 1EFTA 721PA 4TYPA 2VHJA 3CM0A 3K0AB 3CLVA 5L3SB 1Q3HA 4RCYA 4WA7A 1XTSA 3F0TA 1G19A 5BN4A 3VR5A 4BLQA 4TL9A 2MSEB 2EYUA 4KJZA 1JXMA 2B7CA 1BO6A 4TLBA 3KJGA 5JWRA 5TVKA 3K70C 1XPUA 4C0SA 4Q1AA 1Z3IX 3DM5A 3LX8A 3PR1A 2YWFA 2HLDA 3BFVA 3CW2A 2VO1A 3V9PA 2IS2A 4GNKA 4I1OA 2DHRA 5KSYA 4HLCA 1XPOA 2GEDA 2IWHA 5E4FA 1SXJA 1ZNXA 4LBYA 5FTMA 3QOFA 3C5CA 2WJVA 2GXAA 4D82A 1OHHA 5L3SA 1WE2A 4NCNA 1VECA 2A5FA 2F43B 4IDQA 3SEAA 3IEUA 4OQNA 5FI0B 3CPHA 1HUQA 5TDHA 3O47A 1QVRA 2WWGA 1TTTA 1K8RA 2QI9C 4JSYA 1NNEA 4D6PA 4QGAA 3TH5A 4Z51A 3CONA 2WWFA 4QHTA 3B1VA 1U98A 1NKSA 3WP0A 1E2QA 3CUEF 1CKEA 2ZRDA 4UXIA 5P21A 2XXAA 4US2R 1R6BX 4LJYA 3GJXC 2YWHA 2CNWD 2CE7A 1NLZA 4FIDA 4Q4HB 3FMPB 2WPDD 4HI0E 3TAHA 2FF7A 3NEJA 1T3SA 4JJZA 2GZDA 2F43A 5A0FA 1N6RA 1CR1A 1XRJA 1YVDA 5LB2A 1JJVA 3KB2A 2VF8A 4L15A 1E2GA 1S8FA 2K5UA 2JLYA 4EPXA 4DBLC 2XB2A 2X2EA 1UBEA 1W36D 2IYXA 2QPOA 5FL7D 4WBSA 4UNRA 2CBZA 2RHMA 3DOEA 2ONJA 4HB0A 3WYGA 5GVSA 4BFVA 4C0LA 3THXA 3BGWA 1E9EA 2H18A 2FV8A 4Q4HA 2ODWA 1DARA 3MUFA 1RVDA 3SR0A 4V0MA 2WICA 4Q1FA 1N2CE 2V4ZA 3AP3A 4MRSA 5EE0A 3RSOA 1WXQA 1M74A 1XEXA 1EXMA 2ZRKA 2GKSA 4TT3A 4LWZA 4OQMA 1X3SA 2QBYB 3ZDQA 5FBVB 1ZW6A 1BH2A 1Q12A 1PUJA 1T0JB 4X8HA 2R6DA 1GTVA 5HCNA 4C0HA 4BLTA 1YZNA 1E99A 3A1WA 2EWWA 1NJFA 2H92A 4MYCA 4ON9A 1UKZA 2O8EB 4EAQA 4MA4A 5B58C 1FMJA 2MMCA 2IBMA 3B9PA 4GDFA 1OH5A 1XNJA 1RKBA 2RGEA 4LHXA 4DSNA 1RRPA 1MO3A 3LO5A 3MWYW 3GQBA 1ZNWA 2QBYA 3SFVA 2C03A 5DO9A 3VHXA 1N6PA 4EIWA 3Q85A 4TN1A 3OF5A 1GNRA 4Q47A 1CRPA 2GEVA 4MGYR 2IEYA 4MUBA 4NPHA 1PV4A 4K8OA 1KDTA 2IXEA 2EFGA 3U7FB 3F8TA 1H8ED 1U8YA 4KBGA 1PJRA 2ZE5A 2W6JD 2GK7A 1VDZA 4H1VA 1XDBA 1Z0KA 3B82A 5IT5A 1RRCA 4C0AC 2NMVA 3OE7A 2Q9AA 4POAA 3TBKA 5HCIA 1NVXQ 1W4BA 3DHWC 4KXFB 1J8MF 3GJ5A 4HAYA 1ZCBA 4RSGA 4HEJA 3ZH9B 1DAKA 1NVUQ 1S0UA 4AI6A 3TLXA 4B3CA 4MRRA 1Q57A 4PPGA 4IVRA 1HA3A 1E0KA 2W58A 1YZTA 4LJ5A 3FFAA 5H1YA 2QEQA 2ZJOA 4I4LA 1CJKC 1W46A 3NDBB 1OXUA 4ZKEA 1COWA 1S3SA 2IT1A 5B2ZA 1KZ7B 2OT3B 2GESA 4GOJA 1NBMA 2DWQA 1II8B 3LV8A 2YNMA 4OI4A 1D9ZA 3WMEA 2EU8A 2GXQA 3UMRA 4PQRA 5CITA 4MDFA 3TUJC 1E79D 4LYAA 3X1DA 1SZPA 1LVGA 1ZNYA 5JS8A 4GPTA 1IN6A 1E2IA 2ZS8A 2BIFA 2GJ9A 4LJ9A 1OLOA 1ZCAA 1UFQA 2N1BA 1JR3D 3IIKA 3SN6A 5FOWA 3THYB 4DCVA 1NVVQ 2EFEB 2REOA 2ZXUA 4QGGA 3AF4A 1IN7A 2P0EA 3EXAA 1LTQA 4GSYA 4PHFA 3UPUA 2YV5A 2G1KA 3RLFA 3EA5A 2ZITA 1II8A 1Q20A 2OUKA 3BWDD 1WB9A 2D7CA 1P2SA 2KBFA 1E4YA 3W8RA 4OK3A 1OYYA 1E3MA 1G4AE 2Q3MA 1I4TD 2QTFA 4TYNA 3GLGB 3ZZUA 1DO2A 1G6OA 1XXHE 1CJUC 1T3HA 2RMKA 1WP9A 3QG5A 2GETA 4W5JA 1CLUA 3R7WB 1VG1A 2ZYUX 1W1WA 1M8PA 3CRRA 3THYA 3LBNA 4WXRA 1NIJA 3U3KA 1C4OA 2CCKA 2FSIA 4BWYA 2BCGY 1MABA 2ORIA 4ZO4A 2VH5R 1KMHA 4PHTA 3WHLA 1E2FA 5CJ2A 1E2PA 4D4JA 2NG1A 3WBKA 3ZIAD 3RNLA 1XF9A 1FW6A 2FZLA 3IHWA 4CYMA 4TTRA 2OFWA 4XD7D 3GLGA 1P7CA 2J87A 3WMFA 5GJBA 5GJVC 3PQCA 2VHCA 4JYCA 1NSFA 4Q4AB 4Q00A 3K0CA 1HE1C 1ZMXA 4GMDA 1JECA 2R2AA 1WBBA 2J9RA 4BQSA 2GWHA 2GEUA 4RKFA 1EFRD 1KI7A 3MWJA 3N2EA 3WY9A 1R5NA 3QIAA 1SXJE 2QT1A 2XTMA 2ZETA 5HE9A 3O8BA 2WJIA 4LHVA 1I2MA 2Q6TA 3BXZA 1K6MA 3CO5A 3CWZA 2JLUA 3VQTA 1U2RA 2WBLC 1P73A 1U94A 2IWRA 4D2IA 3LW8A 2J7KA 4ZI2A 4C0BA 2J1LA 1LY1A 2HDNB 5CIWA 4EKDA 2J59A 4TYYA 1R5OA 4KCGA 5M04A 4M4SA 5C46F 5EJEA 3EASA 3L0SA 4D0GA 4Q4AA 1W4RA 2RGGA 2PMKA 2ZTSA 3AUXA 1T9HA 3FVQA 4HAXA 4LDJA 3QXCA 3RRYA 2JLXA 4TYWA
chains in the Genus database with same CATH superfamily
4HG2A 2BTEA 4NNJA 1D1QA 1VLZA 2N75A 1UDBA 2R84A 1ZRSA 1OZHA 2JI7A 4GPIB 4LWPA 3PWTA 3PXDA 8LDHA 1MZVA 2EDAA 4ARZB 2QL7A 4KDRA 3D7KA 3PNOA 4QWMA 1L7MA 1PFGA 4U8GA 4YGYA 1L7RA 2H11A 4PC2A 4QUIA 5AJUA 2GA9A 3AFMA 5CVDA 2LR0A 1FFXB 2C07A 1JX6A 2O3JA 2QD4A 3PPYA 4NJOA 4RFSB 5FADA 4ZDIA 1GT91 4NYJQ 3ANLA 1I7PA 2WU4A 3DHEA 3EAQA 1JXQA 2IK8A 1H2AS 1PT8A 2PKRA 3U4QB 4PLHA 3RJZA 3U60B 2UYYA 4LOIA 1I7LA 1MVLA 3PDUA 2NUTA 4TVSA 4CCAA 2HFJA 4PBSA 1WVMA 1V9SA 3Q72A 4OIFA 3NASA 4R8SA 4Y9DA 5CTAA 3EQ8A 5FH9A 2R8OA 1LZLA 4G0QA 3X44A 3V1LA 3KO8A 1C7QA 1GKLA 2NADA 1P74A 1PNTA 4JT9A 3UK2A 1SGWA 1SCUB 3SK0A 1U2GA 3ZKAA 2AFHE 1VMKA 2JGNA 3U3RA 1DE0A 2Q8NA 5IC4A 4HNUA 1P9LA 5JSUA 2QN8A 4OJMX 1YQXA 3PHCA 4A73A 4P84A 1U4OA 3I6MA 1GYPA 4CLEA 2YVUA 3KD2A 3S8EA 1W5SA 1QDLB 3GMTA 1MRZA 3HYLA 3QKIA 4IDGA 1U3UA 4IDDA 4TOIA 1CZKA 3KCNA 1JNYA 5JFOA 2HCBA 3N05A 1LW7A 4O8CA 5AJXA 5ILGA 1G18A 1OH8A 2KW5A 3T7CA 5F5LA 3BQMB 2IYTA 1F0NA 3E23A 3H8JA 4PLYA 1Z38A 4U00A 4PCAA 2CB9A 5DOZA 5J1TB 5KIAA 3DOFA 2KPOA 3N3AC 2JFNA 3AT1A 2O23A 4WNIA 2CDRA 4P34A 4KHPB 1ZM2A 4DDKA 5AW3A 5EXEA 1ESZA 2Q4BA 3C3CA 3QENA 2DUUA 4OK6A 1N5RA 4CFZA 1XZIA 2GTPA 1RQGA 1BD3A 1V8PA 1UAYA 2O3TA 5HXAA 2C3OA 3KX2A 2YVAA 1V71A 2EC5A 2BHSA 2XUGA 3UMFA 1G8SA 2YY7A 2IDZA 3EC2A 2WVGA 2A5GA 4OHBA 2QYHA 4WFIA 2Z6QA 1UBNA 4MULA 2HIMA 4HWPA 2EXXA 4BMOB 4IMIB 4KRYA 1NYRA 3NNSA 2R97A 2IEGA 1VB3A 2EZ4A 3O2JA 3OZIA 2YUTA 5DEOA 2Q0XA 1PJ2A 3A9VA 1YHYA 1K8ZB 3DD5A 1YUMA 3ENQA 3IOMA 4NS4A 5BOSB 2P6RA 4EPTA 1BE8A 2B1RA 1KJYA 2XMSA 2FZVA 1BHSA 1U0RA 3F6EX 3R41A 2BZ0A 4DTIA 1NYLA 5AVXA 2QMYA 5ICCA 1Y8ZA 3MCAA 4WZAA 3R7BA 3KKMA 2CDNA 2NV6A 3GZNB 4MLCA 2WM8A 4K6GA 4WOKA 4Q37A 1ZBDA 3CYFA 3JQDA 3MMPA 4DAOA 4LYHA 4LCBA 4N5DA 4N5NA 1AH2A 3S2ZA 1ZVVA 5B36A 2BTQA 3AG5A 3GVCA 1VMAA 4IF6A 5AM1A 5E6UA 4BWGA 1IM5A 4LK2A 4EJFA 2HBRA 3M33A 4RW0A 2R3SA 3KHSA 4AP6A 1WABA 1PEYA 3FTDA 3NW9A 5DW0A 1AZLA 3V6LA 2ZRQA 3GJQA 1G20E 1P2TA 5AKIA 1FQWA 2Z3WA 4N8DA 1N9GB 3GVIA 3P2EA 3PS9A 4RADA 4B9AA 5B4VA 1J70A 3D4NA 1PJSA 4B3GA 1NLUA 2FOIA 2A88A 1F5SA 4OJQA 3MQ4A 3EXFB 1OQAA 4YUAA 1SHTX 1CUEA 1DL5A 2FLWA 1C9JA 3ZCTA 1HURA 2DPHA 2E0IA 1I6LA 1XYGA 1CZNA 4HN9A 4BO7A 3DKVA 2HLPA 4CKEB 4DOMA 2WWVD 1RKXA 3A58B 3NBZC 2QP3A 3UMCA 2EJWA 1NOJA 2W93A 3BE5A 3CLRC 5E2BA 1D8AA 3KWJA 3C4QA 1SO8A 3CTPA 3LK7A 4GI3A 1ADCA 3NBMA 3NATA 4G5SA 2F6RA 2Q4DA 1ZIDA 4OMDA 1HZJA 1XZ8A 1Z7BA 2HCJB 2V5AA 1A2KC 4U4AA 5TVGA 3TIFA 2GTIA 2OQIA 2DQSA 3CUWA 1OGJA 1OAOC 1RYDA 3EGIA 3WLJA 2IHYA 3MB8A 3F73A 2EW8A 4O3MA 1PZXA 3OEHD 3TD6A 6YASA 1Z18A 2H0AA 2M6KA 2FZCA 3MOSA 3NHUA 1X0VA 1O7JA 1L5VA 3MFQA 5ULLA 4NXMB 4X93A 1AB5A 3WRYC 4F46A 1GXSA 3LPMA 4V2UA 4REQB 4JUCA 2PFGA 2ZSIA 1PGJA 3NH6A 3RWMB 1HDZA 1M2OA 3BL6A 4XWAA 1LK7A 1X7HA 4PG4A 3GEBA 5PNTA 3KYCB 3CZ5A 2OCAA 3WB9A 4B4DA 1S2NA 1HT1E 2UVPA 4B45A 3K15A 3KS9A 2P2DA 3N1UA 4PZZA 2WWHA 1WDKA 1PTJA 1YL6A 4GUDA 4ZVTA 5GQSA 5JHHB 1I2DA 4A3SA 2IYAA 1VRVA 4KDCA 1VZ3A 1WV1A 4C6SA 5CA0F 5CA1B 4PSVA 2R48A 5BT8A 4N76A 2VSNA 3FUXA 3C85A 5FL3A 4KNYA 2N3ZA 1NP6A 3U0BA 5JBNA 2OMKA 1RS0A 1VKRA 4V0NA 2A57A 1RQPA 3Q7EA 4GMHA 2J0UB 3IQEA 3ZWQA 4EUNA 4ER7A 3QPDA 2Y4NA 2WSBA 4P86A 1MAUA 1SC4A 2OCLA 1GTG1 3ROGA 5AVWA 2VHVA 1R7RA 4JP1A 2ZJ0A 3KEFA 2FN3A 4MR8A 3D3JA 3FGNA 4OHVA 4UHHA 4M1OA 2O06A 5C1IA 1QG4A 4Y0VA 5I7VA 1XU7A 2TECE 1UINA 2FN9A 3DVLA 3EIWA 3M3PA 1NP7A 2PO7A 3QE3A 1IXSB 2FWPA 3LT0A 3Q8WA 1USIA 4OQPA 1I6MA 5KTRA 3DLBA 3NWEA 4CU2A 3DV0B 3L1JA 5E3IA 3OWXA 3GFQA 1IEXA 2V8BA 2BEJA 5DTJA 2CJWB 4BO3A 4R7GA 1CS0B 2J07A 4TKVA 2XIQA 3X1MA 4DPMA 5C8ZA 1BZYA 3U1TA 2I8CA 4XOIA 5IKEA 4BMSA 5B7QA 1XMSA 3EW7A 3K2QA 4C0XA 4I4NA 4IHJF 2ROQA 2RB5A 4Y9TA 1PT7A 2C4MA 3N5CA 4TMXA 2A7QA 5E1MA 3T5TA 3WYAA 5FIUA 4DFDA 2QT0A 1LI5A 3KZ1E 1C1XB 1E1QD 2YXEA 3COSA 5T7BA 1O95D 4WJZA 4AY6A 3ER8A 3NVAA 4FDTA 4F91B 1UZLA 1S89A 4K9RA 1K08A 1WOMA 1HTTA 2W90A 4OHRA 3T5BA 4RPJA 1IHUA 1BW9B 3K9NA 1EFHA 4M0EA 2YYSA 5JWHA 2WY2D 4TWIA 1P0CA 3O03A 4J1SA 3ROFA 4A7PA 4C87A 1ZOLA 3Q5DA 4M53A 4W9NA 2B1JA 1EBUA 4Y2SA 4KLCA 2CVZA 3WR5A 4Q7MB 3E6AA 4V2IA 2PLRA 3W9SA 3AUTA 1JDBB 4A2QA 1FVHA 1YBMA 3HHPA 1BKYA 2HSJA 4I99A 2O52A 3WYFA 1P2BA 1E59A 3K8ZA 1B2LA 1C3OA 1ATZA 3B5EA 2Y6UA 3CF2A 2J3HA 2ZQ5A 1RWNA 4LBVA 1PJ3A 3LTEA 4JAVC 5KQLA 5LMZA 1NG9A 3OQIB 1RZ3A 4KQEA 4Y6OA 4TYQA 3ZVMA 4UBMA 1KJZA 2FSVC 2HJ9A 5A7FA 3U44B 2AKAB 2NNLD 4L4UA 4XIFA 2JH3A 4I5DA 4EG0A 5LJIA 1IBMB 2P0AA 2VPZA 3GO4A 3KKOA 3QLJA 4JVOA 4C9BA 4EDHA 1EUZA 5MN6A 5A04A 3H5AA 4EYKA 1CQIA 3K9QO 3U61B 2I2WA 2EP7A 2O8NA 3HQ4O 3NNDA 4DLYA 1DG1G 3HWSA 4C5CA 5IKMA 2PMEA 2Z43A 4S1WA 2GQ0A 4AJOA 4GFDA 1XRPA 3FSJX 1JGTA 2ST1A 3B5JA 3N8IA 1SCJA 3O8LA 4JP2A 4ZQHA 4JUAA 4AZ3B 4Z1OA 4KLNA 4J7AA 2RKOA 3L8ZA 2WIJA 4UM9B 2IVZA 1LJUA 4YQZA 4J76A 2A0KA 4BPRA 1H8HA 2HSGA 1HQCA 1W2GA 3LA6A 1PVDA 4N39A 2Q45A 1KOFA 1YDHA 4TS9A 3RB8A 3F4BA 4AD8A 3EBOA 3FNQA 3QWIA 1AKMA 4MUHA 5SY9A 1WPRA 3L02A 5IAEA 4RD1A 2CFCA 2BONA 3H17A 5D85A 1HYQA 4WGGA 1ZHOA 1ZEMA 1LNQA 2WJAA 4F04A 3H75A 3KKZA 2Z9BA 5KYUA 4LUCA 2P3QA 3II6X 3RVNA 1WHTA 4ENUA 4YYZA 2GF2A 4RNCA 3UUFA 1PT9A 3O91A 5L7WA 1K7EB 2C2MA 2ZWAA 1M34A 5JDIC 4O4HB 1WLSA 1XLTC 2CVQA 1R6XA 3KPJA 3BZBA 2I3ZA 1J2EA 3E8SA 4AFNA 2C9OA 5HEKA 2Y71A 2PWAA 4FR0A 1C1HA 3DMNA 1H5NA 1WA5A 4OV6B 1B6SA 2VF4X 1MOPA 4LV5B 4AXXA 4OBXA 2JGJA 3NJ4A 1PHPA 4EUKA 5KQPA 3EXHC 4TSFD 2VDMB 2UXBB 3G0OA 4B17A 2YQZA 4XPIB 1JIVA 4J0JA 1ORTA 3HRIA 3WGVA 2QV7A 4IV8A 5AUNB 5IM5A 4H3HB 2X3UA 2IJGX 4LRQA 3EVBA 2JH8A 1OX4B 4YCBA 4E94A 3BIOA 3VDXA 5ADHA 5L8VA 2EIHA 2F8SA 4F4CA 1QZTA 3DBHB 2ECOA 1JT9A 3IAUA 4HL6A 3C1UA 5HW0A 1GPYA 2GDZA 3VPHA 3OMWA 1KGDA 3UGQA 5BYKA 4ZCRA 5EUCA 5KWEA 4DUGD 2BJHA 1NR5A 5T3UA 3AX6A 3ZC3A 1FFCA 1IZ0A 1VGRA 2PVSA 4II7A 3FTQA 4QLOA 4XQGA 1L5WA 3W9YA 4WCVA 2CFRA 4JBNA 4S2EA 1DLJA 4EW1A 2UDPA 5FNVB 4OHUA 4QXPA 3CW8X 4ZQEA 5HDQA 3D1VA 1WW2A 4M1QA 4BTLA 1CJBA 2FPIB 2FUG1 3HEMA 2XGMA 2C5GA 1P18A 2P1ZA 4JB0A 3EZ9A 3AP2A 3EARA 2WFLB 3CSDA 1U5BA 2BGJA 2RJNA 5IANA 4DRZA 1ULSA 5JD5A 3NOVA 3F5SA 2RK6A 4F4HA 5I9MA 4YPVA 3RAEC 4V0OA 4M22A 4CXMA 4TL6A 2JJMA 2ICAA 1UBLS 2HJRA 4Q9AA 1N0UA 4QYIA 4R1UA 2PL9A 1CY7A 3SHWA 3I6BA 1Y3CE 3TR0A 2O7VA 4R9NA 1CRZA 4YO8A 2UZIR 1FMTA 4JWTA 4ZK2A 4X71A 5JDCC 4II3A 3GYBA 4CKXA 1BYIA 1F8YA 2X7JA 4EI8A 1JJ7A 2Q9BA 1QH1A 1KO8A 3AETB 1GG2A 4YP1A 1KJJA 2P75A 2YW9A 3Q3JB 5CXQA 4UMEA 4QBIA 1GUYA 3GRVA 5GY7A 2PYDA 3U7QA 1U0TA 4RA6A 4XOUA 2OV4A 2YR0A 1AS0A 2PT5A 1MPXA 2IUFA 1IB6A 3QU5A 4D3SA 1HEYA 2HK6A 5CTJA 4OBWA 4YBRA 4JXJA 1PL8A 3ZHQA 2IHTA 5I5GA 2BMFA 5K3FB 3T3MB 3I8SA 1QS0A 5LBTA 3UANA 1YS2X 4ETIA 4F5YA 1YRYE 4ZQBA 4NBWA 3VSAA 1NUSA 4QNNA 1N2EA 1PWXA 1RFLA 1TQ6A 2OHXA 1KJ8A 3PU6A 1ZWKA 1XP5A 2DHDA 4AUKA 5B57C 4B3RB 2SCUB 2FMIA 3IIEA 1MOZA 3E5NA 4HWGA 4I55A 3GDOA 1SVLA 1OFGA 3M83A 1L1EA 2PX4A 3JQ8B 4FHFA 4M99A 5D7NA 2DQ4A 4YPFA 2EKQA 1AXRA 4LRYA 4IXWA 3EAGA 4C7KA 4QDUA 1XHLA 4AURA 5FT9A 5AHXA 3MGCA 2X4LA 2IXAA 4N5LA 2O1XA 3TRDA 2ZR0A 2WPNA 2JBAB 3AY0A 3BULA 4O4JF 3MJSA 4WL0A 1XCLA 2G3YA 2PGAA 2Q2NA 1E58A 1MV5A 4AKSA 4ENTA 4V1CB 3RD5A 1TT7A 3V9AA 2GHTA 2XMRA 3Q88A 4BLWA 1N6OA 4BNGA 1FNBA 3NP9A 4EI2A 5DB4A 4GI2A 3TR6A 1JALA 2QRVB 2Q1WA 4N0PA 5H0IA 1Z39A 3C97A 3E9EA 4P38A 4OHYA 3WRWA 1ZCFA 2Y0BA 2YFYA 3PHIA 4HQNA 3IXLA 1G7CA 3CFYA 4PONA 4PZEA 4C7XA 3X1JA 3IOBA 3E35A 3ESBA 2IE0A 4WUVA 5K6AA 1YF3A 1FFYA 3ON5A 2C4WA 3EZGA 2YJNA 3ILYA 3FNEA 2ZPUA 4WXPA 3WSVA 2GJ4A 4CFYA 2ATIA 3P4UA 1QZ3A 1BSVA 4R7ZA 1QCYA 3STUA 1JV2B 4YJFA 4UUNA 4HEA1 4UCFA 4QQKA 1ZOOA 1N8TA 4W7IA 4RIFA 4CVNA 1H2FA 4WEOA 2DJ5A 1WMFA 1QCZA 2V9ZA 3PT9A 4MHOA 3RSFA 2ZBVA 5HUHA 4U7FA 2GI4A 4EZEA 2O8CA 1E3SA 4NZOA 3H3JA 1VBFA 3CRMA 4EKYA 2PKXA 1NC1A 4YUVA 5JNVA 1M7GA 5HJ5A 1I5RA 3WTBA 1UFRA 2ZI7A 5A4FS 2EIXA 3KVYA 1E2BA 5IKPA 4HRYA 5FWDA 3U37A 4GR4A 4NTZA 2Q9CA 3CLTD 1GTMA 1ZMBA 3G7SA 3LK6A 2OZKA 5LQUA 2HRZA 2P2SA 4DV3B 1A8UA 4LYFA 1QO0A 1FRZA 1W4AA 4RS4A 3MELA 4Q4JA 2A9KA 4PRLA 4B2PA 4GKJB 4D25A 2GHRA 1V25A 3KJIA 2XAUA 4FE3A 3EVZA 5IXSA 5DYGA 1E2HA 2VBIA 3GLKA 5EHIA 5GONF 3DOOA 4LJAA 1QM5A 2ZRAA 3I76A 4KEAA 3G82C 2ZUWA 2OSBA 3AUFA 4N47A 4U02A 2Q50A 1JEYA 5LMCA 3BJMA 3MTBA 3OFKA 1ODTC 4NMLA 4BE9A 5KNDA 1RJDA 1MF7A 2MR6A 3IIMA 3KRTA 3PFKA 5EY5B 1N2ZA 1EVZA 3FPJA 1QYDA 4EARA 5ESWA 2OBBA 1VP9A 1CU1A 1I13A 3KDSE 1JWAB 4F12A 3DTVA 5CK4A 1WAMA 4ENPA 2RAFA 3GIDA 5BPHA 3AYXB 1Q95A 2DPMA 2OAEA 3HB1A 1JIUA 2RH5A 1PYDA 4CZ2A 3U7GA 3WB2A 1JI3A 4MMYB 3J81k 2RAVA 1G8GA 3C6KA 2R25B 3DR5A 3V00A 3ZI4A 3I05A 1S3FA 2V7VA 1XZLA 3OOHA 1E20A 4EEKA 2R5NA 4QAJA 3GLTA 4D8UA 5BW6B 3UKJA 4QRIA 4C6TA 2JLVA 5I9TA 2IVFA 3PUKA 3IMKA 3OG9A 5DYTA 1L5NA 4EHKA 3I5YA 1DAIA 3BS4A 3UWDA 2GSWA 2CV0A 5BWCA 4BKMA 5DGDA 2QORA 2OAQ1 4B4OA 3VUFA 3NDRA 1IOZA 4ES6A 4P5DA 3QLVA 1A8HA 4QOGA 3BL8A 4NICA 5JALA 5LDDC 1KKLA 1G41A 2GASA 2QU8A 4NYMR 3R6DA 4K9SA 3W6OA 2HUPA 3W4IA 3QUAA 2VPTA 4FI3F 4O2BA 2Q2OA 1MXHA 2YHSA 4X20A 1N57A 4E1BA 5KWJA 4OMCA 4M0PA 3WHKA 4ALLA 1AM4D 1X8LA 4Q3LA 3D3QA 5JLJA 2AEFA 5SV2A 4W5QA 2ASEA 1ML3A 3RKSA 3KL2A 1D1TA 1CUJA 3VPGA 3UH1A 3VR4A 3UCFA 1KO1A 5DBEX 3EXIB 1JSXA 4KR2A 1EFUA 3LX6A 1NXXA 1DS6A 4DMUB 2IX3A 1GPUA 5BXQC 3FNHA 1I2BA 2FMTA 2XVYA 3NGXA 1VMDA 2ZIFA 3CTMA 1SC9A 1LSOA 3M6VA 3PTLA 4LZOA 5C8XA 2OAP1 4IZOA 5JTTA 1JPNA 2I03A 1G2OA 4ER0A 4GOND 1R0WA 1EFVB 1PWYE 2O0LA 4KE6A 3SSMA 5FWYA 1YZ3A 3Q12A 3RUFA 1VPLA 4TWRA 2LGJA 4L9AA 1CE8A 2IDMA 3H83A 3DD1A 4AJ2A 5JSQA 3H84A 4DHEA 3AB8A 1V37A 3UJNA 3NVDA 1VKJA 1J09A 2OYSA 2CL7X 3QXXA 4DMCA 1WUTA 1E32A 5KAMA 2XNHA 3QY9A 2R1TA 2O3SA 1Q15A 2Z30A 3H2SA 1WNFA 4Q7KA 2SHKA 3ESAA 4BVFA 1XYYA 2ODTX 1CZUA 1TL7C 4BV8A 4QQFA 2QSZA 3WG9A 5GTDA 1U11A 2QI9F 1JMYA 2VA9A 1KAGA 4OHKA 1U9ZA 4V0KA 4YDHB 4YMSA 3WC4A 4CMGA 1PR4A 1KS2A 4UPDA 4ZOLB 4RTQA 4NBRA 1FXSA 3ZDAA 1GVNB 3A28A 1NHWA 4YI3A 5HCUA 4HLNA 5FAXA 3ZHYA 1T2AA 4BVEA 2H7VA 4MJLA 1DLIA 4GD3Q 5H8WA 1Y3DE 3MK31 4RS3A 3GGDA 3WOHA 1U90A 3O4RA 4MUFA 4N7BA 5CBPA 4HAZA 3BFJA 1JEQB 3IDQA 4LXUA 2WZBA 1R0ZA 4HK4A 5DHFA 3N2KB 1B1CA 1ND5A 2JA2A 2JK1A 2VJMA 5IDXA 1BEZA 4U2EA 2OXEA 2XOKA 1H5QA 3CX7A 1EG2A 4I9FA 2CUTA 5G4KA 1K3UB 2A2ZA 4X94A 3DOIA 2HY7A 1C0PA 2Q4EA 2Y93A 3TYXA 3EDCA 3AZPA 4ZU1X 1QHXA 1IWBB 2PWYA 5ALDA 3Q9UA 4DM4A 4RVCA 2GCOB 3BTOA 4B4WA 2ZQZA 1HYHA 1OAAA 4MS1B 5JZOA 1K6EA 4GI5A 5B3LA 5CDTA 3S29A 5CFNA 4MKXA 2I33A 4MGIR 3UN1A 4AULA 1K6JA 2JEOA 1EWKA 4E5SA 3PD7A 2R8ZA 3AU8A 3A2MA 2RGAA 2IS6A 2ZKIA 2N9UA 3KTFA 1T9DA 3AOEA 2PSEA 4TTJA 1G16A 1KEVA 3I4FA 1X1RA 2ERXA 3ETLA 5JXGA 3MXTA 1SA0A 4AIIA 2WNSA 1XL0A 2HLDD 2ZVPX 3GOHA 4D4MA 1X7YB 3IBGA 3QPCA 3IMGA 2A1UB 4M49A 4CL2A 4BVAA 2NUPB 2W11A 1YA4A 2Q2VA 1IPFA 2EJVA 2QLBA 1QQBA 3VX4A 2OY0A 3KZOA 5CLIA 4MV7A 1O97D 4Q21A 1R50A 2YVLA 4XUEA 1OW3B 1PR5A 3KOMA 1AHPA 2PX0A 1JXOA 4MCJA 3W2FA 1SCKA 4G2TA 4BZXA 2WNIA 1N5JA 4RH3A 1AXEA 3VYTB 1V3QE 2CK3A 2FDCA 4N49A 3FGZA 4UNPA 4Z1MA 4C4OA 4E2YA 2G67A 2TMYA 4QJ5A 1E0JA 5FTLA 3G0IA 1B0PA 2P1DA 4N7RA 4DE5A 4ZYUA 2W6QA 2WYHA 4M37A 4QO8A 3IPRA 3AVTA 1O08A 3HB9A 2ZSEA 4BBPA 4BKRA 2IYQA 2ZZKA 3ESRA 3VNRA 3F71A 3FFXA 3A9WA 3LQFA 3C8MA 3P97A 4NBNA 5KCMA 2ZM5A 4BUZA 4IDFA 5G3ZA 5DOVA 4MKRA 4C5AA 3RANA 1XTTA 2B34A 3LF2A 5FYDA 3SIWA 1Y48E 5AKLA 4F93B 5JSZB 3WNVA 2J6HA 2PGXA 3EEFA 1GL3A 4E7OA 4EWLA 3ECAA 1K5DA 2CHQA 3I5MA 2LPMA 4ZAYA 5MN5A 2JFVA 5JW6A 3I6IA 5JSHA 2VCYA 10MHA 2B5VA 2FH5B 3N7UA 1KQPA 3EQ6A 1UBHS 3OLYA 4QG7A 3AW8A 3U7IA 3ROEA 3OOSA 4W1RA 1TYZA 4HEHA 4AYTA 3DMDA 5HM8A 1OYOA 2E21A 4PV7A 5JCPA 1CCWA 2RARA 2C5BA 3VJRA 3KQUA 3HSYA 3OAAA 4JLDA 4P35A 5DT2A 3IALA 3KQNA 1A7KA 5BNTA 3VO2A 1O03A 4FGKA 2H85A 3L5OA 1IOVA 4LOAA 1KDZA 3TE6A 5BQFA 3Q9LA 4M54A 4WNCA 3UB3A 3FD8A 4YO7A 1XCJA 4TV9A 2XDQA 5DP2A 4JJ4A 1KBZA 1CY8A 1MJ5A 4OXXA 2G40A 2DBRA 2Q2QA 4EHFA 4NZZA 4WCFC 5IK2D 1NFFA 2Z98A 2WKRA 2F00A 1Y7PA 3OTQA 3P0EA 2FPPA 4L95C 3ZQJA 3DHVA 2NOAA 3CRQA 1OI3A 4FTWA 1QANA 2P78A 4MUXA 5HA5A 2MT9A 4LXXA 2C9CA 3LP5A 3U0VA 5IAOA 1R18A 4CKBB 1EAMA 2Q5HA 2RG1A 3P2MA 4GR9A 1KDVA 5ALZA 5B7PA 4ZV9A 2ZJ5A 5KWIA 4UJ5A 2CLKB 4IIVA 1E69A 2CLLB 2W48A 3IP9A 3MWGA 3O8DA 3CLSC 1T5SA 3AEKB 1CY6A 2XUPA 3OE1A 4LCJA 16PKA 1JPJA 2YZ2A 3I04A 4MWEA 5J4HA 3S1AA 1TTPB 1WZIA 3IDZA 1KA9H 2GBGA 1JHOA 1U7HA 3PUYA 3WO1A 1LWNA 1HZZC 4OUDB 4B7AA 1OVMA 1K75A 3SS8A 4INJA 1J22A 1DHTA 1AMUA 1GA4A 2PTGA 2QPAA 2E37A 1U65A 1N8NA 2A9RA 2XOXA 2IUUA 4EOGA 3OTOB 3C5EA 2HA4A 1YDEA 2AG6A 2CW5A 1ZUNA 2LCFA 2X6RA 3QYJA 5K0ZA 2N42A 1UKEA 2XZPA 4H0FA 2ABWA 2PKCA 4P8RA 1AIPA 4TV8A 2C8VA 2ZRJA 4F8JA 3KPYA 2ZU0C 3FJYA 5CJPA 2FUKA 4HLUC 3L7DA 2I67A 4LWQA 1VKHA 2OO5A 4Y6QA 3Q7PA 4AECA 4QM6A 4JI7B 3ZLUA 3UGKA 2H4FA 2VATA 2ZBEA 3OLQA 1EQUA 2W6ID 4JUIA 1T29A 4O8ZA 4RVOA 2R8EA 2QQ0A 2NU7B 4OKSA 4YALA 3T61A 5EA2A 1RBZA 1PK9A 5A05A 2RHOA 1FP2A 3BK1A 3R5FA 4Z99A 3GLRA 3TN7A 4MDFA 3E1GA 2D3TA 3LX5A 4DMRA 5FEMA 4HJXA 3GP3A 4M86A 4P4TA 2QB5A 4CIWA 3LCVB 3NWPA 3QKSB 3D1LA 2VNAA 3JQAB 4GI7A 2YHUA 5BSVA 5KOYA 3PKJA 1LDNA 4DGSA 2D3WA 3RKRA 5JBQA 3RRBA 1DCKA 4E13A 1SXQA 5HM6A 2H3EA 2BWJA 3ZHBA 4E03A 4GPEA 1H1TA 1CFJA 3BICA 1RXYA 1SBYA 1FYDA 3NS7A 4KN6A 4OI1A 1WIWA 4GS5A 4DJ5X 5LU9A 3IQHX 2X42A 4QRHA 4X6XA 4TWJA 1H4VB 3LYUA 1NN5A 4FSHA 1VKZA 4W4TA 4JKIA 5HP4A 2VPIA 2IV7A 4X24A 2AB0A 2BEUB 5B12A 4KXWA 4YRNA 5JRZA 3A3PA 1RI3A 2EW1A 2A9OA 2ZBDA 5E9AA 4YEDA 5LP6A 2C9BA 4AQ7A 4Z4FA 5LQRA 4PFJA 2QW0X 1JDVA 2VTDA 2OCKA 1QG2A 2G09A 2J6CA 3MJ4A 1QC5B 2IYLD 2F3PA 1ZI9A 3P9SA 1XZPA 1Y8RB 2HI0A 3UG7A 2YVKA 5DGHA 1HH4A 2BEWA 2XF2A 1A5AB 2ZIZA 3IFSA 4O29A 4MQFB 4GM1A 2QMUA 1C9MA 2GHIA 1ZD8A 2NIPA 3DMTC 1N5DA 2V0NA 2I1QA 1DPFA 2DTDA 3NTXA 3OESA 1OT3A 4CI9A 2RGBA 1GZ6A 4QBTA 3RIEA 2IZ6A 3ZWDA 1S2OA 1MLDA 1H2XA 4Q3OA 1KYZA 3TLJA 1TQ8A 4ER3A 3R4VA 1WPGA 3GJRA 1NAIA 3ZD6A 2IIVA 1TC2A 4XYMA 4G25A 5C5DA 3LC0A 2H2AA 2Q49A 2LCQA 2YV3A 4FDLA 4J91A 1GNLA 3D4LA 3S70A 3VISA 4ZHQF 5KNDH 3EPLA 2FJUA 1X9GA 2EZUA 4DZRA 2FRDC 1E94E 5C1OA 2QAGA 3IOCA 5TXGA 5HSGA 4YRRA 4X95A 4O2LA 4O3FA 3NAZA 2OVFA 1TK2A 1YR9A 3VA7A 2AGVA 3OQNA 3T7SA 1WSWA 1N7JA 1F2VA 1JIIA 4J49A 2YCBA 1CUBA 3PPWA 5EE9A 4LYDA 2ZYGA 4N6GA 4Z54A 4ZIRA 4HMQA 5TRTA 1XN4A 1RT9A 1BD4A 3FOFC 1MGPA 1R3DA 5JEEA 4DC0A 2WTMA 4DXAA 3HFSA 3K5IA 3NLLA 1W94A 1CYDA 3EPRA 2IOHA 1XZQA 3EHDA 5JVDA 3EZ6A 4I7EA 1NTRA 1WXIA 1F8FA 2GO7A 3PRHA 2Z57A 1NRJB 2PGJA 1DI0A 3NBXX 4I0WB 1RHJA 4OH7A 4PHHA 4L22A 2VTBB 5B1IA 4H6PA 2BPOA 1E3WA 3VH3A 3EFOB 4DN6A 1T6NA 4J29A 2ACWA 3DV9A 3L43A 3GD7A 2AI1A 1CUFA 1MO4A 1P4HA 4FZ3A 3LQRA 4OSEA 1YJQA 2BFPA 1P5FA 4E5MA 1IFXA 2DQKA 1ZVKA 3L0PA 4V3CA 4XYBA 3LUKA 1O6GA 5ALMA 2OZPA 5FA8A 3UMSA 2X8WA 3UV3A 2A1TR 4DCUA 5K8JB 2MSDB 1E64A 3KKPA 1LPPA 1Z82A 2YWBA 3QVOA 1T1IA 5IBQA 3E8MA 3TCKA 5KMGB 3ZD7A 3D7NA 3KALA 3LTNC 1U8AA 2WT4A 3K09A 2UUCB 5KYWB 3PUZA 2BLNA 1T3ZA 4GOKA 4NU8X 1P5JA 1G7RA 4YJ3A 2C2BA 1N8SA 3HJUA 5DX1A 1T4BA 1DXHA 4JJ6A 1KBOA 4BAZA 2OOKA 5DI9A 4L6IA 1XXLA 1BNCA 4KFCA 4B84A 5E4JA 3QZUA 3DKPA 3G8BA 3TZQA 1EVLA 4LXIA 5JAIA 3EVNA 4J94A 2REXB 4QXMA 4AN0A 4UUMA 3PC2A 5EYPA 3P9IA 2AN3A 1CJSA 2F8MA 4FXOA 4IOMA 4UEJA 1QNFA 2AUTA 1KHHA 1V2HE 1IQPA 2C8JA 3NVMB 5WRFA 5IN4A 4I50A 5A03A 2DAPA 2G1AA 1W93A 2PGDA 1X7ZB 4ISBA 5CVEA 4LKRA 5HOEA 3NIGB 4ESOA 5KX5F 2VDPB 2CL0X 4P6VF 3OQBA 3EFEA 4P0TA 4P3XA 2C4TA 3ONEA 1US8A 4XUGB 4U3JB 2A33A 1L4HA 1TO1E 3UHJA 1KY3A 1VL8A 3MNFA 4RLFA 5ISMA 3ASZA 1F4PA 3CGWA 4KQKA 5DV9A 1VPVA 3GJ7A 1Q1GA 3SQOA 2C78A 2FVXA 4OL0A 4R1PA 3SC2B 4D3ZA 1RLTA 2JIMA 4PRZA 1RLUA 3NQ41 1NN3A 3N07A 3M6AA 4HVAA 3MJDA 4RTSA 1ORRA 3N59A 4R1OA 5CH5A 5CT5A 4DCMA 1IUPA 2VYFA 1TF5A 4RF3A 2ZATA 1R16A 3F5MA 3MEQA 4BATA 4DG8A 3ZU2A 1BQEA 3KK0A 1FDIA 4FJ1A 3ZY4A 4DS3A 4EJMA 1LC3A 3MG9A 4N9QA 5EQJB 5ALOA 4DLPA 1ODJA 1VJGA 3O3NB 4L73A 3LQQA 5CT4A 1Z13A 1W49A 3BEOA 4G0MA 3QPBA 3AVUA 3RODA 2H1OA 1C30A 5EL0A 2WU3A 4PWYA 3PNBA 2FQYA 2O05A 2XR1A 4LZJA 2I1VB 1A71A 3SXJA 1BX1A 1B00A 1RWWA 4LFAB 1P0IA 3GEDA 3E61A 2VHTA 3KPUA 3O74A 3E3NA 4QGHA 2G77B 4FN5A 3TSZA 4QPJC 2VQEB 2D0DA 1EZ4A 2VYNA 1K0UA 2Q8PA 4I9HA 4AZSA 3IV6A 4G6ZA 2PWZA 1EFLA 1QIHA 2PKQP 2QN6A 3LWNA 4XDGA 5JWOA 2WIGA 1P7YA 3UOGA 1N1GA 3D2BA 1OXXK 4PSAA 5TC4A 1BS9A 1N33B 1G9XA 3MGKA 5EP2A 4PSDA 3ADCA 3SFZA 5I3ZA 3WJ7A 4GHWA 2DETA 7ABPA 2WZCA 5GM2A 1EVKA 3USES 2GN8A 3A70A 4MI9A 3GUYA 3CUSA 1YUNA 1R66A 2GN0A 3S7ZA 2ENWA 4GX2A 3DT9A 4FLFA 2COKA 3T3PB 3WSWA 1CUIA 2AC7A 2QTMA 3NHRA 3NT2A 4YASA 5J2UB 3RR2A 1G55A 3GLFE 4KYUA 1AA6A 2HRCA 4GZLA 3QLUC 3VU3A 4DABA 2QTHA 1ONBA 2IKQA 4N3NA 2XXAB 2Q3JA 1T13A 3S5JA 4ZT2A 1USWA 5FBRB 3SF8B 5L3QA 1QB7A 1QO9A 3FAZA 2G80A 3T8YA 4AN4A 3LLSA 2X9LA 4WGFA 3EWIA 3V1TC 3WKAA 4UU7A 1KJIA 3AMVA 1BRMA 4D3YA 4IGEA 4EP1A 5IT0A 3I2JA 2NVOA 2ECPA 2FN4A 3BH0A 5BVHB 3I6QA 2C1XA 4WNAA 2A5DA 2Z3ZA 2HT1A 2LIVA 1IJEA 1KI1A 1YZFA 2HQSA 2FW7A 3HN6A 3A6KA 2VP6A 2B0CA 3F4KA 3LUCA 4H7IA 4OGFA 5I9BA 4C06A 2DVMA 4EW3A 1LFDB 4ZI5A 2WV9A 1KZHA 2X5OA 3R8XA 2G5PA 3W8DA 5I4IA 3OTIA 4MYHA 1IN1A 2R00C 1TF7A 4OHPA 5LQAA 1ENOA 3CU5A 2J33A 5A5GA 2IYUA 5B1DA 4O25A 1PLLA 1XCBA 5GINE 3C15C 2AOTB 5EHZA 2XSZA 3CZAA 4R41A 5G0SA 3S28A 3NAQA 1RYFA 3ES9A 2FP4B 5KYXA 1DQZA 1GCOA 3GA7A 3JD2A 3I9JA 3ELDA 4WX2B 3A6LA 3QI2A 1Z6XA 2RI0A 3R3HA 3ANMA 2GYWA 4O2AA 1UJCA 1VJTA 2A4KA 3IJEB 5FTNA 3WFIA 1DUVG 3EWAA 3G0DA 3KT6A 4A8JC 3GD5A 4ASUA 2HV9A 4REOA 4EQ6B 1C9EA 2R60A 3IAM1 3V8RA 1U9IA 2VWQA 5EJ7A 5EJ2A 5NLLA 5LYJA 3KWFA 1Z2DA 4JA2A 3CGGA 1ZJZA 3SEFA 4LYJA 2ATEA 3AVOA 1ZVJA 1OV6A 3FX2A 3QJYA 4MW5A 4CNBA 1KKMA 2HQ1A 4GF5A 2DERA 2NSLA 3J80A 2W2KB 3IE0A 2HEGA 1MH1A 4RESA 3SIPA 3K6SA 3ZJYA 2Z0MA 4YRMA 2X7XA 2IYSA 1QDEA 5AKJA 1IBKB 1W4ZA 4FGWA 2PQMA 4PPYA 3LBIA 4A15A 1TMGE 3RS5A 4TS3A 2GZHA 3OJXA 3VU9B 4KXUA 4EBBA 2ZAMA 1FW8A 2XUHA 1WDWB 2BZSA 2QROA 3OZWA 3W3AD 1L3BA 2FZWA 2Q3BA 4OLFA 1Z0DA 5CA1F 1TM2A 2EAUA 1L3CA 3A4LA 1LBIA 4GMXA 4YRCA 3F9CA 5TQ2B 4KR9A 2VXYA 3PCXA 3KELA 2HIHA 2FEXA 1XJQA 2CXRA 3CZ4A 1KFKB 5M29A 4HGOA 4P