4HDQB

Crystal structure of the ternary complex of krit1 bound to both the rap1 gtpase and the heart of glass (heg1) cytoplasmic tail
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
164
Chain Sequence
b'MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krev interaction trapped protein 1
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdqB00
2ODWA 4Q9IA 2G9NA 2FMXA 4LV8B 2WAXA 1JR3A 2C03A 1XJCA 1XTIA 3BFXA 1WP9A 2J3EA 5JECA 1VG9B 4M9SA 1H8HD 2GJKA 2CBZA 5BN4A 4TYYA 2J7PA 1HE8B 2ZS9A 2WZQA 2ZU6A 5EUQB 3GLGE 1E32A 1AKYA 2AK3A 2QORA 2R44A 3VR1A 2ORVA 3LQQA 1WE2A 4NE2A 2Q0HA 3GLIE 4Y0VA 3HP1A 3W5JA 1EESA 521PA 2YWFA 4TYWA 2W83A 5KNBA 4W5JA 4PFSA 5CYPA 3X1YA 4C0AC 3QNUA 2B7CA 4UKDA 2EWVA 4PANA 3B85A 4LC1A 4QXAA 3UATA 2Z4SA 3CLVA 2WWXA 4Q4AB 2JLRA 2PZGA 5JWOA 4DB4A 1T5IA 4PTLA 4B76A 1FZQA 1YR7A 2XNSA 4LDJA 4JLDA 5FPHA 1OXXK 5IF9A 1XD2B 4PAOA 5FR2A 5FTJA 5HPYB 3KQNA 1QF9A 1KSFX 2CCJA 2OFWA 2VF8A 2ZRBA 5EXSA 5DNYB 2VP4A 5EP4A 2HXSA 3CZQA 3D8BA 2RH5A 4N3NA 3D31A 3IHWA 1M7BA 2QQ0A 2V6JA 5SZKB 5H8WA 2QG6A 1SQ5A 1DADA 3SU8A 3UXMA 2QMOA 3SOPA 4DLWA 4RSGA 4CF7A 2PJRA 2X1VA 5KNCA 3SYKA 4NCKA 3OEED 3P20A 2VH5R 2EU8A 4RKFA 4OQLA 4M1MA 2G1KA 3LLUA 4XOIA 4D80A 5JLJA 1R8QA 5A4JA 3AEZA 4KBFA 1D2EA 4TL7A 4B73A 5CB8A 1FQJA 4JZKA 1RPZA 2OG2A 1FW6A 3BS4A 3T15A 3KKQA 2FF7A 1N5JA 2ZE6A 3ZZ0A 4MRSA 2IYRA 3OE7D 2A7QA 4YMSA 2WKQA 2R2AA 5CIWA 2A5DA 1E2MA 1XXHA 4XSHA 821PA 5GJVC 1ZD9A 3I61A 4GSYA 1P5ZB 4NL4H 1KK0A 1FL9A 3LNCA 4V0ME 2B6HA 5BWMA 2XAUA 1TF5A 1Q44A 2HXYA 2DFTA 2W6IA 2O8DB 1XBTA 3DMNA 5L3RA 3ZIAD 2ZM5A 1XTJA 221PA 2DYKA 3B6EA 5FPTA 3GMTA 4UJ3A 4Q9LA 2JLWA 1Z6AA 3SEAA 1AQUA 2HEIA 2J7KA 1CJTC 1WMSA 5FUWA 3AF0A 1W44A 1FPMA 3VKHA 1JB1A 2Q9CA 5C1BA 1WBBA 1Z0FA 3QKRA 4HLCA 1XB2A 4XVRA 2JDIA 1SULA 3E5HA 1AS2A 3FHOA 5CJ2A 1XZPA 4B44A 5LBIA 4TTPA 3AKCA 4PPFA 1NMZA 1KMQA 1Z83A 3QXCA 4Q1BA 2BWJA 2QL6A 1NVVQ 4DRZA 4RJLA 3HU2A 5EE9A 5CM8B 1JR3E 1MO6A 4QBIA 1Z0KA 3T61A 4D6PA 2RAPA 1RVDA 4KODA 2C04A 3K0CA 1E0SA 4GNKA 4RY2A 3KQKA 3BWDD 1ZU4A 4QG7A 4D81A 2IS6A 2A5GA 2CNWD 1KO4A 2F43B 1E98A 4HDCA 1W49A 3F0TA 4OJQA 4M4SA 4G5SA 1GNRA 3QKUA 1FQKA 1ZD8A 1P3JA 1DAMA 4LBVA 4BE7B 1OYYA 4DLZA 3THWB 1FOEB 3BE4A 3C41J 1V43A 1ZJ6A 3M4YA 4NKRA 1ZM4A 1N6OA 4C0QC 1I2MA 1KY3A 4RCYA 2EFDB 4OQXA 2RGXA 4H9GA 3L0OA 3OIVA 5FBVB 5E4FA 2XB4A 1QHSA 5JWHA 3HWSA 3FGNA 4AG6A 1OH8A 1LF0A 1ZRHA 5CM9C 2ZJ5A 3FMIA 3PFIA 1F2UA 1KIMA 1VHTA 4A8JA 4Z1MA 3FYHA 4NYIQ 2QBYA 4AYWA 3FHCB 4X8OA 2VP0A 3L8ZA 4B71A 1T9HA 1VPLA 1P62B 2BBTA 3B5JA 1TQ4A 1KDRA 3TBKA 2IYLD 3GPLA 2ZS7A 4ZI2A 1SXJD 2XJ4A 2ZIAA 1SXJC 2CEAA 1CJKC 1R6BX 2E9SA 3LDAA 4UNPA 4XD7A 4NCHA 5FBRB 4B3DA 1S8FA 3MFYA 2ZU0C 3AVPA 1Q1EA 1PLLA 1NKTA 3EARA 4ARZB 1ODFA 5FH9A 4NMMA 4B3GA 3D7MA 1VG1A 2DY1A 5K8TA 2CJWA 3PCRB 1GDDA 2OCBA 3FTQA 4ZPXA 3VHXA 2Q3HA 5GADl 1KKMA 1XTQA 1RC8A 3QUSA 1XD8A 3BH6A 1NIPA 1ZUNB 2AFIE 3T34A 5EXTA 4UNRA 4DDVA 4KFUA 2QUZA 2FSIA 3ZVNA 2QP9X 2GK7A 2GA8A 4QKQA 4GZLA 1L2TA 1ZCAA 2GAAA 3A1WA 1G6HA 2JJ1D 1XXHE 3BAFA 1GIAA 4IOLA 4LI0A 3AGPA 5SZJA 4D0GA 4R71A 3L0IB 3K09A 5KSPA 1UAAA 3LX8A 2VBCA 2KBEA 4TMKA 4UXJA 5E7MA 1M2OB 2W2VA 5C2JB 2GZAA 3RABA 3MJRA 2IEYA 1T3HA 3T35A 2VHJA 4A82A 5TMPA 1GNQA 5FTLA 5EP2A 5HE9A 4S35A 2O8CA 3EG5A 4C9BA 4CEHA 4PO8A 5KSYA 3WHKA 4Q02A 3QKTA 4JMPA 1E1RA 1YU9A 4D4KA 1L4YA 5DE3A 3SR0A 1E2FA 1R8SA 3REFA 1E79A 2V54A 3Q3JB 4B3FX 4IW3B 2FDCA 5JI3E 3BOSA 4A0RA 3G82C 3AP3A 5JRJA 2ZRFA 2QAGA 3QXJA 2ZRAA 1UM8A 2GZHA 2ZVPX 5KUTA 1GRRA 1SXJB 4JLPA 4LYJA 5EZ6B 1NJFA 1X1RA 1R4AA 1A2KC 1GKIA 3A4NA 1VYUA 3U61B 3AVWA 3B13B 1M7HA 3PVSA 4DC9A 4IHQA 4P4SB 3VX4A 2IXFA 2I4IA 4EPTA 3L8YA 2WWFA 4NYMR 3B2EA 4A2PA 1UPTA 4JLAA 2RGCA 1MV5A 1N6HA 3UWOA 3WNCA 2V55B 4LHZA 1NN5A 3AKYA 4QJ3A 4C0SA 4B3CA 1NBME 3OEEA 4NCJA 3TE6A 1OH5A 3I4LA 1MO5A 3AVVA 4P32A 3NKVA 2ZQ5A 3DHWC 2FOLA 1GUAA 1R5OA 4FWTA 3A4MA 2PX0A 4LHWA 3EW9A 3UMRA 4F7WA 2G77B 4DSOA 4UNNA 4OK6A 2EQBA 4OI4A 4DSUA 3R9WA 3NXSA 2C9OA 2FH5B 1S2MA 2ZYWX 2Q6TA 4UJ5A 1VIYA 2V9PA 2W0SA 3OE7A 3TVDA 5J4KA 1M8PA 2H92A 4NCIA 3B82A 5CK4A 4XSGA 2FFHA 4Z8YA 2NQ2C 3IEVA 1HQCA 3WMFA 4DCUA 2PBRA 2YOHA 2ZI9A 4MH0R 3U2QA 1FX0B 4E03A 1LVGA 2OXRA 5LD2B 2ATVA 2PEYA 2VO1A 3TVTA 3U4QA 1E2QA 3P26A 5G3YA 3ZIAA 2HF9A 1I4TD 4PAQA 4US1R 3TR0A 4RFSA 4X8LA 5JEDA 3DVLA 2IL1A 2FSHA 4TMTA 3EIEA 4DLUA 2IT1A 3U3OA 3G0HA 1P2UA 1OE0A 4D26A 2QRNA 4BZQA 2JLYA 1JPJA 5EE3A 4EFMA 1N3BA 2HV8A 1X8LA 4OJKA 2GKSA 3EA5A 3NC0C 4DSTA 2YC4C 4Q4LA 2BCJQ 3JVUA 1TTTA 3LQRA 1R2QA 2VHUA 5CB6A 3ZJYA 1XEWY 3RRMA 1Z5ZA 2UVQA 2ZEJA 4HZIA 2AR7A 3RSLA 1Z2AA 1KI4A 1G5PA 4L8GA 1SKQA 2WWHA 4MYTA 4PC1A 5J4HA 2J9RA 3WP1B 3AVXA 5L3SB 2YOGA 2FX3A 1A7JA 4YDHB 1DVRA 2IHYA 2HT6A 4XJXA 3RC3A 2BDTA 1E1QD 3FDIA 3ND8A 4B6EA 2F1JA 4PX9A 2ZS8A 4URXR 2O8EB 3R7WB 4PQRA 1KZ7B 4O0MA 2GEVA 2C8VA 1Q3TA 1VCNA 1Y63A 3RHFA 4PHGA 1D8TA 3L0PA 3R20A 1YKSA 1OPXA 2YKGA 1S1CA 3UWKA 2JIZA 1XPUA 2EFCB 1KI6A 2A78A 1ZM9A 5CK5A 4LWZA 5DISB 1W2HA 2C98A 3W3ZB 4F91B 3RS0A 1YRBA 5JFGA 3KQUA 3IIJA 3FMOB 2JCSA 4RD0A 2RCNA 1B23P 1Z0DA 1RFLA 2OZEA 3QY0A 4NYJQ 2CVHA 3NEJA 1NSFA 1XX6A 2IYVA 2R65A 1CS4C 4P4TA 3RYTC 3AM1A 2FE4A 4V0OA 5AJVB 3GLHA 2GRJA 2ORIA 3EWSA 2DR3A 2FGJA 4HAXA 2O0KA 1KI3A 1VECA 1DAKA 1NN0A 1JAIA 3BK7A 4MYCA 1C4OA 1LS6A 4V0KA 3I5XA 1JEDA 4KVGA 4AD8A 1IXZA 4LX0A 4O3MA 1GNPA 2WWYA 1H65A 1X8JA 2GK6A 2C2HA 4JJKA 5HZKA 3CIOA 4HUTA 1E96A 2Z0MA 2QP3A 3AF2A 3MWYW 3QXSA 1U0LA 1XD9A 2H8KA 4O25A 2UKDA 3T1QA 2AL7A 2R6CA 4US0R 2G0NA 2ZITA 3P1JA 1KNQA 3A8TA 2PX3A 2X19A 3MLEA 1GWNA 3K0AB 2RGAA 1ZINA 2EYUA 4II7A 1UF9A 1GITA 2SHKA 3GJXC 4DBLC 3CNNA 4B2LA 2GCPA 1JEEA 1W48A 3IIKA 4ACAA 2ZRHA 1E2HA 3CO5A 1GILA 1L8QA 5FTNA 4LOAA 4U7DA 1FX0A 4PQFA 3NIBA 4V02A 5G41A 4PC2A 2J0UA 4YLGA 3BGWA 4B2PA 3IQWA 1XCMA 3CONA 4C7OB 3PUZA 1CR4A 4ABYA 3LVRE 3NVAA 2GEUA 2ZE5A 3VU9A 5GJBA 1XEFA 4TMWA 4LBZA 4DCTA 2J0SA 2BV3A 3OEHA 4PHFA 4QHSA 4B74A 2QTHA 3GEEA 3VR2A 2KJQA 1M74A 1W0JD 1DO0A 2CLSA 2PEZA 3LWNA 4IVPA 4Q1DA 1OSNA 4XTCS 3FKSD 2ZROA 2ANCA 5GVRA 4QGFA 1E2IA 4FN5A 3DL0A 2YNMA 2EFHB 1EFRD 4RFVA 1BH2A 4CDGA 2W2TA 2QPTA 4X8MA 4LCBA 3NWJA 2GWHA 4DLRA 1LF5A 5LPNA 1G8YA 2ZUBA 2YVUA 2R9VA 4TYQA 1GL9B 3CBQA 3CRQA 1VIAA 1W1WA 2ZJOA 2OILA 3KXKA 4QRHA 5FOWA 4DZZA 1S4QA 2ZSEA 4S2EA 5CITA 3EZ6A 2G6BA 5M04A 1Z6GA 2ODNA 4M53A 1VCMA 1Z6TA 2BC9A 3R9XA 4JBYA 3FHTA 4BLSA 2XZPA 3K70C 4DT1B 4OKSA 5AWFC 3ZS9A 4A6PA 4JVNA 1NMYA 4N0EA 2LKDA 3QG1A 1FUUA 1BYUA 2V8OA 3CWZA 3QXHA 2WPDD 4M1YA 1OH7A 2Z6VA 1W46A 3B8HA 2OFXA 3I1FA 4Q4JB 4XVUA 4V0NA 1U81A 3GLGA 4C30A 4D0NA 1HY3A 1SXJE 1DAFA 1KOFA 4QBGB 2AXNA 4R2HA 5EUMA 1KSJA 4B43A 1XTRA 3CW2A 5EE0A 3KJIA 2X8AA 421PA 2V1UA 1P9RA 1LFDB 3GLHE 1OIXA 1ZCBA 3GJ8A 4LYFA 1BO6A 1OYWA 4G5GA 1RYFA 3QQ5A 4Q03A 4XIGS 3ZLJA 3MGCA 1KMHB 3ADBA 1UBGA 2VSFA 4IFBA 2QY9A 2WJGA 3IO3A 4KHZA 3I73A 2NPFA 1U8ZA 4YMUA 1TEXA 1GRNA 4A6XA 1SHKA 1Z06A 4M1SA 4EQ6A 5DYIA 3T1VA 2ZE7A 3M0EA 4EPYA 2C78A 4P31A 2AKYA 1HURA 3U60B 1CRPA 3PEVA 2WJYA 2IC5A 2J1LA 4L5BA 4HAVA 1C9KA 3Q7QA 4AK9A 2PZEA 4G1UC 1CF4A 1XNJA 1ZNYA 1G3UA 2HJGA 1T91A 4IOMA 3U3KA 3VKWA 2IHBA 1D9ZA 1W4AA 1ZAKA 2CDNA 3PV0A 4FMDB 4I81A 4WBSA 1E6CA 2GEDA 4FINA 1S9DA 2HUPA 3QVUA 2XITA 4WA7A 4URYR 3K1JA 3ZVMA 2WICA 2FNAA 4PPQA 3KX2A 5DN6A 4BFZA 2IUTA 2IS2A 4IOKA 1K8RA 4P0TA 1E2LA 4WOPA 5EXPA 4IEIA 2XB2A 4QHYA 1KGDA 3CF6R 1IN8A 1XJQA 1X86B 1E9EA 6Q21A 2ZREA 5CLLA 3OIYA 3N2EA 1PVOA 1E1QA 3AP2A 2WHXA 2RHDA 1XU4A 2R6FA 2QA5A 1K5DA 2ZRIA 1AS3A 4TMZA 4K81B 5B64A 1TF7A 4JL6A 1SHZA 1P75A 4FMBB 2QPOA 4HAYA 4TWZA 1KO8A 1G8FA 2IS1A 1TU3A 2V7QA 3IUYA 4KO8A 4Q1CA 1EGAA 2I1VB 1LY1A 1X1SA 3L43A 4EJSC 2DCUA 4Q21A 3K9LA 5JEEA 3KDSE 1LTQA 5D3MB 3ZVLA 2W58A 1E99A 5KO2A 3MD0A 2ZI6A 2ZPTX 4MKFA 5HCNA 4FI3C 3K9HA 2OESA 1QHHB 1RRFA 4MQBA 1OIVA 1ZC3A 1KZGB 2BEKA 4BLQA 3VR4A 2J41A 5H68A 4HDOB 5P21A 3A1TA 4CEJA 3RRYA 3SI7A 1XMVA 3L82B 3OESA 4WZAE 2VP9A 2QP4A 4ZV4A 1SVWA 3B1XA 2IXGA 4TTRA 3ZZTA 5JJKA 1M6NA 4WXRA 2FFBA 3C5CA 2P65A 3HJNA 3V9PA 4OL0A 3QVVA 3W9YA 2RGEA 2WSMA 3LLMA 4UXHA 5FI1B 1F3OA 4HLDA 4HB4A 4DLTA 2JJ8A 1J99A 3ZQ6A 2IYSA 1I2DA 4R7ZA 5AJYA 1JR6A 3MAAC 4RVCA 2X2EA 4LJAA 3WBJA 2WJHA 1WB9A 2BBOA 5C18A 1GKUB 1US8B 4URZR 3SJAA 4Q1AA 2ZRKA 2BMDA 4B48A 5L3QA 2ANBA 4DCNA 3Q8XB 5G53C 1UEJA 1AK2A 1QVAA 3LXRA 2OUKA 4YXWD 3KKMA 3KUCA 5DIFA 2FEMA 2GETA 4JL5A 1FTNA 4TSFA 1IHUA 3QIAA 4PZYA 5IRCD 3RC8A 5GVSA 2NZ8A 3GFPA 3SN6A 4ZCIA 1FTSA 4YQFA 2W6JD 1MRSA 1W4BA 4PZZA 3WNBA 4QHTA 4EJSB 5D3QA 3AVTA 1XEXA 3BJIC 3V4RA 1IY2A 4TL6A 2GCOA 1R5BA 2G83A 2DWPA 4M1OA 3THXB 3NBXX 2IX3A 4JL8A 2D7DA 1J8YF 4JBWA 3QF7A 4ZO4A 1W0JA 3ADKA 4OHYA 1GRQA 1WQ1R 1YR9A 1GAJA 2QROA 4MKHA 4OI2A 1S9HA 4NTZA 3C4JA 1TUEA 4LC0A 1MR3F 4HI0E 1OH6A 5IHPA 2ZJBA 1ETUA 1EFRA 1G4AE 3OIWA 3U3MA 3P27A 2A3RA 4AWXA 4B3BA 1AS0A 3OFNA 3EPKA 4FMCF 4TL8A 1R7RA 1F2TB 1Z08A 3CR7A 4HZUA 2VF7A 4GDFA 1MO3A 4A15A 3CWQA 4Z8XA 3U44B 2FPMA 1NI3A 1KTVA 5GJCA 1KDOA 1E2KA 1TQ2A 4JT4A 5IDVA 4Q7MB 3CKLA 4LJ8A 1XTKA 1U0HC 3BFVA 5EP3A 3B1WA 5FOUA 4LUCA 3SC3A 1P73A 3VKGA 3IDQA 2BBSA 3C7KA 3FE2A 2X2FA 3LV8A 1GVNB 2XTZA 4GL2A 1ZD1A 1T5LA 3TQFA 2FWRA 2RGNA 2WPDA 2YOFA 3D3QA 3LW7A 2OSBA 4PHHA 4DIDA 3KZ1E 3PUVA 3IIMA 4NONA 4OBEA 3RDPA 3PG5A 3PJRA 4LRWA 1ZNXA 1PLJA 1U9IC 3SNHA 3C8UA 2Z83A 4Q01A 4UNQA 3ND9A 4QL3A 1OW3B 2A30A 3ZD6A 2BMEA 5KDDA 4DLVA 2ATXA 3QKSB 2PZFA 2ZAOA 1JALA 2HYDA 1P6XA 5J4VA 1I4DD 2IA5A 4TZ6A 2I3BA 5SZHB 1D6JA 3A37A 4M0LA 2QENA 4CT5A 1KI2A 1C1YA 1NL3A 2H16A 4MGZR 3WMEA 2FFQA 5JCPA 1QHHA 3CX6A 121PA 3S1AA 4EAQA 4YC7A 2ZRJA 2F55A 2AWNA 3EAQA 1KSGA 5JSZB 4ZDIA 3ZD7A 4Z51A 1N5IA 2QAJA 4I4LA 3I3SR 2CL6X 4BLRA 4GOKA 1E4VA 3BH7A 5EE5B 3W8NA 1JJ7A 4JVMA 1SKYE 1OXTA 2AFHE 2CL7X 2FZ4A 4LGMA 1NBMA 3T1TA 4JLVA 1N5KA 2BCGY 1T3LA 3WRXC 1J90A 3BORA 1WDTA 1L4UA 1N6RA 4KFSA 2GBLC 3EZFA 3SZRA 2WSSD 2GJ9A 3GLFB 1OKKD 2MMGA 4PC3A 4PPGA 1N6IA 3IO5A 4TLAA 5KOYA 4J0QA 4NYMQ 1T8TA 1US8A 4AIIA 4AI6A 2K5UA 4HAZA 2PMKA 1VTKA 1JQJC 1WCV1 2XOKD 3GFOA 3IHLA 4LYHA 4Q4AA 4RZUA 2BKUA 4RZXA 2XNDD 4KSBA 1RJ9B 5EP1A 1WF3A 1XD2A 4WXPA 5A0FA 4F38A 4E09A 3QG5A 1O3YA 1EX6A 3CPHA 4NH0A 4GI7A 5HE8A 4XVQA 3J81k 3FOZA 1II8B 4PPNA 3UMFA 1Q0UA 1SVLA 3RLFA 4N1AA 4JS0A 2HCBA 2O5VA 4YDSA 5G40A 2REXB 4EJSA 4JJZA 1PJRA 1ZIOA 1E2JA 2VIIA 1NVXQ 5EXXA 1XMIA 4BQSA 3PEWA 1S96A 3UIEA 4W9MC 1EWQA 4QGHA 2X77A 4Q7JB 1IJEA 2OM2A 2KBFA 1JAHA 4ZCMA 5DI3B 1YHNA 3VR6A 4DVGA 3B9PA 2P5TB 3KKNA 5TY0A 4PR0A 3W5IA 2QE7D 3MWKA 5EJEA 2ZI3A 3IEUA 4TQAA 1MO4A 3VMFA 3ETLA 1NIJA 1GP2A 5L8VA 1Q3HA 1CTQA 1H8HA 4E22A 1XWIA 5J5CA 5LD2C 2O8DA 3AB3A 3U7FB 3H0KA 5JWRA 2B92A 5AK0A 3K0FB 2AWOA 2GILA 3EZ9A 1RW4A 3F8TA 4MKIA 3KQLA 2CK3D 3UKDA 1S3SA 5J47A 3D6TB 4CEIB 5KNDA 1NVUQ 3EXAA 2JATA 2OT3B 2J87A 3M6AA 4JYCA 2IUUA 5B30A 3Q72A 1TL7C 1YE8A 3PQCA 1HQYE 2VL7A 4TZ0A 2GJSA 3E70C 3HR8A 3WYGA 4BFSA 1V5WA 2KE5A 4K46A 1N0WA 5TB5A 1QVRA 3UPUA 1DE0A 4F4IA 1G5TA 2YC2C 3QKSA 1GOTA 1QHNA 2KWIA 4US2R 2DWQA 2Q3FA 4I1OA 1JECA 1P72A 1XMSA 2ZJ8A 3VR5A 2DBYA 2D06A 5EQTA 4LV5B 1HE1C 1AZTA 3K8YA 2F43A 1ELOA 1R0XA 3VNUA 4TN1A 1GZSA 3QEOA 4LHYA 2QMHA 3THWA 3TQCA 5JSZA 3TAHA 4PSVA 2QM8A 5FTMA 2IBMA 2ODEA 1FFHA 5HTKA 3TIFA 4Q47A 3EASA 3RS7A 1TADA 2A5YB 1G64A 1VCOA 4JT2A 2P6UA 4R98A 1HEIA 4ZIRB 4PZLA 4BRUA 1GL6A 2YJTD 2H18A 2OCAA 1TUIA 1ZC4A 1G7SA 1JPNA 2D4HA 2ORWA 3H84A 2OE2A 4A4DA 3KFXA 3I5YA 4ILEA 3GLFA 2GCNA 2IUSA 4Q4HB 3WYFA 2BMJA 3V00A 5KYKA 1YZQA 3BBPA 3TNFA 4QBHA 1ZP6A 4PSAA 3AVQA 5BW8A 2NGRA 5KTYA 3Q9LA 1CXZA 1XPOA 2JLSA 2GJ8A 3SDZA 4U5XA 4HAWA 4PXAA 2B7BA 5ANRB 1RJ9A 3WNDA 5B57C 1SZPA 3T5DA 4TT3D 2DB3A 3LVQE 3BB3A 4DSNA 4Q7LA 2WM9B 4BEJA 4ARZA 4O2RA 1LS1A 3WYAA 2FJUA 3GJ5A 1P60A 4JLKA 1CR2A 4O2LA 3RSOA 1EG7A 1II8A 3NBFA 3FMFA 4A2WA 1HTWA 2O8BB 1HT2E 1U9IA 3ASZA 4CVNA 1X8KA 1R10A 1U2RA 5DO9A 2FPKA 4NPHA 4OI0A 2FFAA 4MRNA 1ONBA 4JLNA 1E9FA 2JLUA 3LAWA 4TYNA 1E2GA 2OBLA 4D4LA 3THYB 1OT3A 1BKDR 1Z47A 2AHOA 2NO0A 2FGKA 3EZ7A 4L16A 5FFMA 4BLTA 1D9XA 3A1UA 2JJ2D 4OQFA 1RKBA 1DPFA 2CNWA 2YINC 5FI0B 1A1VA 1EFUA 1TAGA 1EWRA 2G3YA 3KKPA 1N2CE 1AGRA 2BEJA 2D7CA 3F5FA 3OAAD 2GXSA 1OFTA 2E87A 2I1QA 3W6OA 1FP7A 2VLIA 4BFWA 2GDJA 5BXQC 2ZANA 4ERNA 5KSOA 4RD6A 3BERA 1B0UA 1YZUA 4HUQB 4Q5IA 5BYJA 2A5JA 2ONJA 3U6KA 1WRBA 1DELA 1LNZA 4LHVA 1NNEA 1N25A 1XJ0A 4G3XA 3EIHA 4I1SA 4URVR 3UG7A 4MRPA 2P67A 4MYHA 1COWD 1CJUC 2ZRNA 5DHAA 2PLFA 3K0FA 4TQUS 2QSYA 2GBLA 1U8YA 3QXXA 2QTFA 2XXAB 1VCIA 3QF4B 2ERXA 2UZIR 2PJZA 1G7RA 5FUXA 4MDEA 5FOSA 1DG3A 4V0LA 4UNSA 1KJYA 2FSGA 3NBYC 2L0XA 2G0TA 1SXJA 4PQYA 3U5ZB 2O8FB 1GL7A 4D82A 2ODBA 2XNDA 3MMPA 1JBKA 3I72A 2XJ9A 1TNDA 4EFNA 4A1FA 1AGPA 1Q21A 5LB2A 4AKEA 4E07A 4P4SA 3R8FA 2N1BA 4CRWB 1Z8FA 1Q1QA 4WW0A 1UFQA 4Q18A 1Z0AA 3GLIB 4C0LA 5FTKA 3SBDA 1R0WA 4KVAA 2H1LA 4KFTA 4QFMA 5KU1A 1P2TA 4B47A 1YR8A 1W5SA 1E69A 1ZW6A 3HYRA 721PA 5TXGA 3WY9A 2RGDA 1Z2CA 4RCZA 3LX5A 1OHHD 1MKYA 2WMOB 1DEKA 4L9SA 4M22A 1MABB 4N0DA 3TH5A 4NP6A 4TLCA 4C3ZA 4TMXA 1RYHA 1UJ2A 2JJ1A 3PR1A 3B1VA 4IDOA 3LBHA 1NKSA 4FCVA 3GLFE 1Z63A 2KI5A 1HYQA 2VQSA 3QI2A 1II9A 4QGGA 2ZR9A 3W90A 2QE7A 2OHFA 4BFXA 2YWHA 2WV9A 4DCVA 2J7PD 4DB2A 4HEJA 2W00A 4NCNA 1G8HA 2YWEA 1E9DA 1F6BA 1G3IA 3ZVRA 4EPRA 1G7TA 1SVOA 2QNRA 2EYQA 2ZSFA 3H1TA 1GM5A 3UK6A 4HLQB 4UXIA 4PHTA 2IK8A 2Z4RA 1KK1A 2GF9A 3QJYA 3NH6A 4LK2A 3IQXA 3KXLA 3GJ7A 4B2IA 5TVKA 1W0KD 4MGKR 1TX4B 5HCIA 2XEXA 3I8XA 1TMKA 3LD9A 4LJYA 1UBFA 3VAAA 3P32A 2WTUA 2GAOA 1OFUX 2D3WA 4L9WA 2CXXA 4Y0AA 4F4CA 2XGJA 3CH5A 2F9MA 3L0SA 3T1OA 1UKEA 2PT5A 3EX7C 4TYPA 1MT0A 2OCPA 2F9LA 5DYGA 4GOJA 1D5CA 4IDQA 3CUEF 5LB4A 3VR3A 1NY5A 4DKXA 5CDFE 2GZDA 4JLOA 3BH0A 1OB5A 4CGZA 1E0AA 2GVDC 4XWKA 5E7IA 2HYIC 4RKEA 1Q1BA 2GXUA 1T6NA 5L3SA 4HLUC 5BN5A 3BB1A 4QM7A 1ZUIA 4NZYA 5JZVA 1E3MA 1IM2A 2WVJA 3TAUA 3UMSA 1G5RA 1D2NA 1II0A 2P0EA 4HUQA 3A6PC 2FZLA 1JJVA 2IYXA 3MG9A 1Z28A 3GCGA 3QENA 4LJ9A 1KKLA 1XMJA 2QGNA 2O8EA 4DEXA 1E2NA 3R7WA 1BMFD 1FMJA 2AD1A 2ONKA 3CB4A 4MGIR 3NG1A 4M9XA 4NYJR 3ICEA 1AQYA 2WKRA 1DAEA 1G19A 1G8GA 2GVZC 1JQLB 3FMPB 1S3GA 4XH9B 4ZKEA 2D2EA 3QBTA 2JGNA 1CKEA 5TDHA 3KL4A 3B9QA 4OI1A 1F48A 2H7VA 4LJ5A 4DJTA 5DH9A 1NRJB 4MRVA 3DDCA 3JVVA 1KHTA 2OLJA 3GP8A 1UDXA 4KFRA 1T4GA 1KO7A 3T5GA 5HR5A 4JVSB 3X1XA 3PIRA 1J2JA 2GXAA 2O8FA 3SJBA 4TLDA 1PLKA 3T06B 4JSTA 2QMUA 2BM1A 2JDID 3DKPA 3KTAB 2ZXUA 3AKDA 3EC1A 5TV2A 2BJWA 2OLKA 3QOFA 3BC1A 1K5GA 1XZQA 3ADCA 3TSOA 4BLOA 3U7GA 1ZBDA 1Z6XA 1Z0IA 3NH9A 3TUIC 1M34E 4RD4A 4PAMA 2H17A 3N70A 2IW3A 3NHBA 4D0LB 1M1YE 1A2BA 2KB0A 3KJEA 3LXXA 2JJ2A 5J40A 1RIFA 1G6OA 4M21A 4BFTA 5JBQA 3RWOA 1Q20A 4TLEA 4U00A 1XDBA 4DDUA 1G41A 3HYTA 4D2IA 4B3XA 2IEZA 1VKJA 3DZ8A 1N0VC 2P6NA 4CZ2A 2ZR0A 3K0AA 3WMGA 4POAA 1IONA 2G1JA 4QGAA 4B34A 5DI9A 1UKZA 2FG5A 2VHCA 2MMCA 2ZRPA 2OXCA 5FBQB 1IXSB 2IYQA 2ZSAA 1QDEA 1I4LD 1UDWA 2HF8A 3QSYA 4C0KA 1PZNA 3WXMA 1XXHB 5F3WB 1OXSC 2DFKB 2VHTA 2WIAA 2V6IA 1AKEA 4CYMA 1GKYA 2CHGA 3FFAA 2ZJZA 4C7OA 2ZRLA 5JS7A 1W2GA 2ZYUX 4QBFA 3LH5A 2PCLA 1DARA 2OBNA 1CR0A 4HB0A 4YONB 3X1ZA 2Q3MA 1RRPA 2NO1A 4NHOA 1QHGA 1G3MA 2AN9A 4EPXA 1Z0JA 4WVFA 5B58C 4HB3A 2QRZA 3MJHA 4BZXA 2AD5A 2MSEB 3BIFA 4KSCA 3KKOA 2WJVA 3AF4A 3QKRB 2OBMA 4M9ZA 4OQMA 2QPAA 5FOTA 1KO1A 2MSCB 4RZ2A 1OF1A 4A0HA 4G01B 4ESVA 2Z43A 3UANA 2ZJYA 3ADDA 4URUR 2VP5A 2FEOA 2HLDD 4LV6A 2D2FA 2VP6A 1KDPA 1NY6A 5J4YA 3I8SA 3TSWA 1NF3A 3E1SA 3W6PA 3RRZA 4M8NE 2HT1A 3DOFA 4A2QA 1YZNA 1H8ED 1JNYA 2BKEA 2ZRDA 1YZTA 2ZETA 3OF5A 2J0QA 2DFLA 5IK2D 2FPLA 4DT1A 2O0JA 5AJXA 621PA 3LA6A 2CE7A 1U0JA 3CNLA 5FPKA 4JKYA 2YHSA 3MWLA 4MDFA 5A5GA 4K8OA 3AF1A 3ZS8A 3HPRA 4Q4JA 2J45A 1QBKC 5AJWA 2VYFA 2CCGA 4DCSA 2VRWA 3KQHA 1P61B 4Q48A 5AR1A 1S0UA 3K0EA 1E1RD 3TR5A 1N6KA 4FD2A 2PH1A 1IY0A 4LBWA 2V1XA 1E79D 2MSDB 3KB2A 1F2UB 1CRQA 4A8JB 1IJFA 2QBYB 1KMHA 2NG1A 4PC7A 3DOEA 4L15A 4IXNA 1CLUA 1W0KA 3KJGA 3EPLA 4AYXA 2QAGC 1G17A 2NTYC 3NHAA 3PUWA 4OK3A 2REBA 3KTAA 1QHXA 1Z07A 2QEQA 3W34A 3AVYA 3CRRA 1ZIPA 4TLBA 2RHMA 4H1VA 3O8RA 1J8MF 3CPEA 3L2OB 4G5RA 2BVNA 4G0NA 4A0FA 3KXIA 3FKSA 4EPVA 1E9RA 1L7VC 1TPZA 3DKVA 2CJWB 4FXPA 3X1WA 3RAPR 2WOOA 1VHLA 5EZ5A 4KV9A 1Z22A 1VYVA 1DAIA 3SJCA 1PUIA 3X2SA 4NBSA 1TU4A 2BJVA 3PEUA 4U02A 1E2DA 3AF3A 1BYIA 1M7GA 3ZQJA 2WWWA 2ZUCA 1UADA 5H70A 2FU5C 1SGWA 1R5NA 3Q5EA 4HSEA 4CW7A 2ERYA 2XTNA 5DGXA 4HLUA 2J59A 3CRMA 3F3YA 3ZDQA 1T0JB 5KHOC 4KYIB 2WKPA 1FP6A 4DLXA 1PV4A 3ZZUA 4JLMA 3Q85A 4KCGA 1XPRA 1WXQA 1NN3A 1XFAA 1KO5A 3AVUA 1E94E 3WBKA 5F2EA 3EC2A 3DM9B 1BMFA 2W0MA 4Q66C 2O8CB 2XZLA 4JSYA 1EFTA 3ICQB 1BOFA 1IN4A 1U8AA 2GHIA 2GF0A 1HV8A 2P2LA 5CJPA 4IDHA 3TJZA 2IF2A 1ZVQA 2IWHA 4CEHB 1D2MA 1P2SA 1E9CA 2RGGA 2UZ3A 2C9CA 2HCJB 4ASUD 5BYKA 4F93B 1AIPA 3EA0A 3H2YA 2HJVA 4QNMA 1KI8A 1YZGA 5JI2E 1XEWX 3U7EB 4YMWA 5D3MA 1ANKA 2OV2A 3IBGA 4BFVA 2EFEB 5B2ZA 1E0KA 1KK3A 2OAQ1 3AH8A 3TLXA 5G3ZA 4IDNA 2QAGB 1YVDA 3RRNA 1BIFA 1ZNWA 5TARA 3KB1A 3OZXA 3CNOA 1Y3AA 2IXEA 1G3QA 2C5LA 4WZBE 3DMDA 3TW8B 2ZI5A 3LRPA 1A5TA 3C15C 3B7GA 2J46A 2JLQA 4E5UA 5H1YA 4DWJA 3ONWA 3DM5A 2JLXA 1IXRC 4DEYA 1VMAA 2QTVB 2QM7A 4G5QA 3CPJB 2CE2X 3BB4A 5JHHB 3GEHA 4IKEA 4WIAA 1P9NA 3CF2A 2AKAB 4XTRA 1OFHA 5JCZA 2Q21A 1XP8A 1KK2A 3EPHA 1YQTA 2C95A 4RD3A 5AJZA 2F1HA 3LBIA 2BHRA 3GJ4A 4OHXA 1E9AA 2EFGA 1KI1A 4W5WA 3R9IA 3VFDA 3LY5A 3THOA 1W5TA 4IFEA 2XSZD 4BGDA 4C4PA 1QZXA 3Q5DA 4KJZA 2H5EA 5IT5A 2W2XA 4QM6A 1KI7A 2PMDA 2OAP1 4PC6A 4LZZA 4C0BA 2P6RA 4LSGA 3CZPA 4M1WA 2F1IA 3EPJA 1W36D 1W36C 4AY2A 4PO9A 4GBMA 2IWRA 4BECA 2IYZA 2NZJA 4JIMA 1N6LA 1KJWA 3AV0B 1NVWQ 2RMKA 3AKEA 2JIZD 2R6GA 1W47A 2ECKA 2HDNB 4EDHA 2QT0A 4IRUB 1SVMA 4HATA 1VDZA 2B8TA 4Z54A 1BS1A 1KY2A 1XTSA 3U4QB 4MUAA 2AX4A 3THXA 4P3YA 4ZDJA 4RFSB 3GJ6A 5FL3A 1AN0A 4ACBA 4YMVA 1OJLA 3CRW1 4DUGD 4DIEA 4I1VA 1KNXA 1G1MA 1KYIA 1ZYUA 3EZ2A 1U90A 3NDBB 1Q22A 4M2LA 5FL7D 4D4MA 4MUBA 2VSOA 1K6MA 3ASYA 3TW4A 2ZUDA 1E9BA 2LKCA 2C99A 4QJ5A 5JJIA 2QGZA 1LB1B 3X1DA 1UEIA 1F2TA 4JYBA 2HLDA 5JMTA 1P9WA 2JASA 2GXQA 3I92A 3U44A 4ZCLA 1QHYA 1UBCA 1TQDA 4KAXA 3A1SA 4MKGA 3QPVA 1H8EA 4TL9A 3VNVA 3AUXA 1AA9A 1NJGA 2EVWX 1KSHA 3CH4B 2F1RA 5IK2A 5BQ5A 2NPIA 1AJEA 3O8DA 3RNLA 1AZSC 1NVVR 3BFKA 3W3AA 3IGFA 3SHWA 3K53A 4ZKDA 1IOZA 4Q19A 3SQXA 3V4FA 2FN4A 4RD2A 1HA3A 3RS5A 3K9GA 3W8RA 4F4JA 1DTSA 2DWOA 4FWIB 3HU1A 3MRSA 5SZIA 1KDTA 3SJZA 2ZJAA 2OO7A 1Q1ZA 1ZNZA 4DLSA 2R6DA 4YXWA 1W36B 4EIWA 1NP6A 2TMKA 4LBYA 3TMKA 1NLZA 1N0UA 4JBXA 5EE1A 1GFIA 4A9AA 5DHFA 2LCFA 5KDOA 1EFHA 3ZGXA 1KI6B 3G5UA 3OEHD 2W6JA 3U6BA 2LWIA 2IS4A 3N2IA 4QNRA 2A2ZA 1IY1A 1SVSA 4CIDA 2EWWA 3UG6A 2Z5FA 1CU1A 4FMDF 1HT1E 4B35A 1G3RA 4OHWA 1YJ5A 1IBRA 2R8RA 2NO9A 1HUQA 2YZ2A 4GP7A 4OYHA 5DLQC 4AC9A 4MGYR 5AUQA 4D25A 1FNNA 2ZE8A 2OCYC 1Z3IX 3GLHB 1MRNA 1G21E 1EK0A 2QU8A 4IVRA 3HU3A 1XCGB 4LHXA 3OHMA 1W4CA 4X8HA 3M1IA 2D74A 1XF9A 1ESMA 3PITA 4EKDA 1UBEA 2CVFA 2WJIA 1Q12A 4IOJA 2V3CC 4M9QA 4BLPA 2ZTSA 3A58B 3CF0A 1TEVA 1KAOA 4GMDA 3DZDA 5KPDA 3RS4A 4I1UA 2RB4A 2YV5A 4XWOA 4BFUA 4KU4A 1J70A 4ZI3A 1E2PA 1SVKA 3DO6A 3RANA 3SHFA 4AG5A 5C4MA 1SVIA 2PLRA 4C2TA 1A4RA 3PUYA 2H57A 4IDPA 4D4JA 5KSZA 1TQ6A 4GZMA 1GTVA 2ZR7A 4LJ6A 3TRFA 4NYIR 4UQOA 1CR1A 4Q1EA 3AP1A 3TUJC 4BZPA 2AXPA 4ESHA 4URWR 2KSQA 5E95A 1OXVA 1P7CA 2WBLC 5F9HA 4CT4B 2DFNA 3SFVA 5L3VA 1DG1G 4YMTA 5F98A 2J0UB 4ASUA 5HKKD 5FBLB 3GD7A 2NIPA 3TGPA 1AM4D 3VU9B 4C0JA 3EWAA 3PUXA 4MITA 4ZDKA 2B8WA 2CHVA 2WAYA 5FUYA 2N42A 3P4YA 4ON9A 5DI3A 1NLYA 4XWAA 3CRVA 5AUPB 1S1MA 1NSTA 4NU0A 4KBGA 4Q1FA 1CEEA 1F60A 1G18A 1G9XA 1LW7A 1QHIA 3H4MA 4TTQA 5CDFA 3SFZA 3LW8A 3FFBA 3IPYA 2WOJA 4L4UA 4HB2A 2G88A 3HPQA 5E3HA 2RGBA 3FPAA 4RD1A 1OLOA 3LO5A 1KAGA 3QPWA 3LBNA 1OIWA 5FOVA 3B1YA 1CJMA 5JS8A 3REGA 2PCJA 1IN7A 2DHRA 3Q7PA 3MSXA 1Z6YA 2NO6A 2XTMA 3C16C 5DN6D 5J4LA 5F9FA 1E9SA 2VPPA 3O47A 2IYTA 2ZYVX 1CJVC 2WSSA 3VTKA 4DDWA 4C2UA 3TKLA 2BIFA 4QOSA 1OKKA 5GJWC 4CEIA 1IQPA 2XSZA 3PENA 5UKDA 2REOA 1DOAA 4FMCB 4BEBA 2CLDX 5FPYA 3FVQA 2ZSDA 2XOKA 3BD9A 2VEDA 3A1VA 1IAQA 1PUJA 2NOAA 5CLQA 3GLGB 4OK5A 1X3SA 5LDDC 1F5NA 1RZ3A 2WIBA 3NBZC 4OHVA 3U3RA 2O52A 2V7QD 2V4ZA 3GEIA 2GNOA 3AVOA 1G8PA 3A4LA 5JHGB 3B78A 4Q9HA 4G5OA 1N6NA 4RZ3A 4Q00A 4BASA 2XX3A 3I62A 3KUDA 3WHLA 1RRCA 1Q57A 2C9YA 2WWGA 3CM0A 4HAUA 2QSZA 1G16A 3MCAA 4DUGA 3VQTA 5FUVA 4EQ6B 2R6AA 3QEJA 1UKVY 3W6NA 1JR3D 4JLBA 4Q9KA 2EW1A 2OEPA 4GMXA 2J0VA 2NMVA 2YWGA 2F7SA 2NO7A 5FL7A 4ZIRA 2ZJ2A 2JAQA 3FB4A 4QJ4A 1ZM2A 3KJHA 3VHLB 4AKIA 3SYLA 1ZM3A 1P2VA 2A9KA 3TUZC 4R2IA 3K0SA 1MH1A 2IYUA 4BFYA 1JI0A 4GT1A 4B33A 1G4UR 3A36A 3B60A 3HR7A 4FIDA 4Q4HA 1NLFA 5KPJA 2QMEA 3AQ4A 4DXAA 2ZRGA 5HZHA 1T0HB 2CHQA 3WRYC 1N5LA 3OIUA 3IKJA 3GJ3A 1NN1A 2DPXA 2CK3A 4FCWA 3PXGA 5DSZA 3TSZA 2XZOA 1G291 2F3RA 1DAGA 5K8IA 5K8UA 1MOZA 2E1RA 1LV7A 5E7JA 1NG1A 2PT7A 2CLCX 4C0HA 1OXUA 2FSFA 4R9UC 4DDTA 1XCPA 2O8BA 3VX3A 1GG2A 2BOVA 1FMLA 8OHMA 5ELXA 1NMXA 3C14C 2FA9A 4GOXA 4TSFD 3ZH9B 4GFDA 4MYUA 4KLZA 3NEYA 4QC2A 4DHEA 1G7CA 4GRAA 2IYYA 2Q9BA 3HDTA 4I99A 4EPWA 3AGQA 3THYA 3O8BA 2GJAA 3GQBA 2BM0A 2C77A 3K9NA 3DPUA 1U99A 1W4RA 1ZU5A 2JLZA 1CP2A 4MRRA 1VG0B 1J7KA 2WJJA 3CX7A 4WZ6A 2F6RA 2ZRCA 1YR6A 4H1UA 1IN5A 4BPBA 3IILA 3JZAA 3BXZA 1FUKA 1N6PA 4IVQA 3RVBA 3SBEA 2Q9AA 3P4XA 1E4YA 2VP2A 5K8LA 1ZM7A 1YZKA 2FV8A 5JJLA 4CEJB 3OFND 4W5HA 1RE0A 4ITRC 2GTPA 2ZSBA 3FKQA 3I32A 3RS3A 3RS2A 3H86A 3DEFA 2QQEA 2VTKA 4OQNA 4ZDWA 4P4UA 4AURA 1NG9A 1JXMA 4HDQB 1HH4A 2W6ID 2AK2A 2Y8EA 2XXAA 3K70D 1VYTA 2QT1A 2ZI7A 3QF4A 2C96A 5AUOB 5JRZA 1DS6A 4TMVA 3SQWA 4AKHA 1YRAA 1ESNA 1JXOA 4KLNA 4Q7KA 4LPSA 3T12A 1CULC 3ZYCA 4EUNA 4IXMA 3LFUA 1KI9A 2RGNC 3BRWD 4B75A 1E2EA 1SKYB 4JLJA 1Z29A 4TT3A 3NDPA 4FW9A 2ZAMA 4KYUA 5L3QB 2PL3A 1DAHA 3N5CA 3NC1C 2B21A 5C4GB 1VG8A 1EX7A 3GLIA 2P5SA 2CMKA 3SS8A 2J5XA 2QI9C 5C46F 4FCTA 1DBSA 5HKKA 3CR8A 1QRAA 3TK1A 3K0CC 1T8UA 1ZUHA 2BBWA 2QN6A 1MABA 4LJ4A 1XEXB 3RWMB 4LJ7A 4F92B 2GCOB 1UKYA 1ZMXA 3WP0A 3PEYA 5FBWB 4KI0A 2ASEA 2WWIA 1GSIA 3NTUA 4JVLA 2VA8A 1WA5A 4DLYA 3GJ0A 4AKGA 1FNMA 4AYTA 4P33A 2OFOA 3OAAA 4IEEA 4KITB 2VSXA 3QPUA 5FOXA 4LYAA 3U7HB 2JEOA 2R62A 4PSKA 3U3JA 4LY6A 4OHZA 1NBMD 2O0HA 2A5FA 2GESA 1W7AA 3QE0A 4A36A 4A92A 4HZUB 1O87A 4WAUA 5CIQA 5BN3A 4M1KA 4Z1MD 1T3SA 1OFIA 1RRGA 4A8JC 3IPXA 4MA4A 1COWA 4GPTA 5FPSA 1QG2A 4BRWA 4B6FA 4IJMA 2CL0X 4V03A 4KXFB 5FR1A 3R8CA 3K70B 1CBUA 1U94A 1R0ZA 3MWJA 2JLVA 1IN6A 1TF2A 4XD7D 3AUYA 2N46A 1E0JA 3EIQA 3FWYA 1R0YA 2ZRMA 3SYNA 1U98A 3O8CA 4NDZA 4Q9JA 4W7SA 2QZ4A 1EXMA 3SE0A 4V0MA 1OV4A 1G20E 4BUJA 2VHQA 1EFCA 1KJZA 3C5HA 4A0GA 4GP6A 5AUNB 2WMNB 5CYOA 1QG4A 1XRJA 2ZYTX 4JKIA 2CCKA 1DO2A 3GFTA 3JZMA 2RKOA 4PO1A 2IF0A 4LPKA 2P3SA 4BWYA 1P4SA 2ZI4A 1X6VA 2D62A 3MUFA 3KFVA 4EFLA 3B1ZA 1A82A 1OHHA 4HYYA 5KDLA 1CIPA 1YZLA 2BMFA 2F3TA 2ZVQX 4TQ9A 3E2IA 2IYWA 2JA1A 2YYZA 3ECCA 3IBYA 3K09C 4M1TA 3S1AB 3CX8A 4B32A 1OB2A 3QBVA 1WBDA
chains in the Genus database with same CATH superfamily
1IOWA 1WM1A 2ODWA 3OCUA 4GX5A 3LQYA 4NFSA 4Q9IA 4ZI7B 2FMXA 4LV8B 4RQUA 4I5EA 2DPYA 3C1OA 1PS8A 4CFSA 3HEMA 3EMDA 1XTIA 1ZW1A 2V59A 2Z2IA 5L3ZA 1DZ3A 5AKKA 4R8RA 4F5EA 5JECA 1OLUA 1VG9B 4U9IS 4AJ4A 1H8HD 1C7FA 1Y3IA 2CBZA 2ZJ0A 3A6HA 4JNCA 4TYYA 2J7PA 1C8VB 3OX3A 2NO4A 4DLBA 3JQCA 5KYGA 1KH2A 1NC1A 3NOXA 1GT91 2UVDA 2QLFA 4NSNA 1E32A 2P8JA 3MTAA 2L82A 4GMKA 3FOCA 1EQUA 4J0KA 5IBRA 2CD9A 5SY9A 5BVHB 2ORVA 1YDWA 3VOAA 1XU9A 3ER6A 1XJWA 4RANA 2J4DA 1TYZA 2XZDA 2J08A 1KVTA 1ZA2A 1ISHA 2LBPA 3LYAA 1RAGA 1X0XA 3U1TA 3VPAA 2VDWB 4PYQA 3HV2A 4F96A 1DWUA 3JYHA 1DC4A 4MKXA 4PIVA 3RU7A 4ZN6A 4I9NA 5KNBA 4TYWA 5FKJA 5FO1A 3FI0A 3X1YA 2B7CA 4N49A 9LDBA 3F4KA 4CR6A 3B85A 4K26A 5HFNA 2Z4SA 5A4AA 3EXG1 2WWXA 4V3CA 1UMDB 1P2BA 3L0DA 3RRBA 2HK7A 1NQAO 1FZQA 1J23A 2F4NA 1OXXK 3SLRA 1G42A 5EEHA 1D1QA 5DWQA 2LW7A 3DWFA 3I52A 4UUPA 2W2KA 5C8YF 3OMWA 2LPMA 4U7JA 5EP4A 1ECFA 4OMUA 4ZJZA 1KJNA 4I6GA 1AVTA 2IUFA 3KR0A 5D6NA 4BATA 5SZKB 1K75A 1PL8A 1L6IA 2AOXA 4MDYA 4EL5A 5F51A 4XFDA 1G55A 2Q5EA 1NATA 2ZULA 3H9QA 4GZ5A 4W9NC 1UH5A 3SU8A 2JHAA 3UXMA 2QMOA 5BR4A 4RL4A 4RSGA 4Q39A 3KAKA 2IWRA 2MCFA 1DIOB 3NGLA 5KOJB 3OEED 4OA8A 4AS3A 3D6UA 1XT6A 3A3YA 2PSEA 3AT1A 3O93A 4MUFA 3HGMA 3H11A 4OQLA 2B3DA 1VFNA 3BIWA 4XOIA 3M9XA 3VO8A 4AQ7A 3J7AC 3O7WA 1FVHA 1SCDA 1ABEA 3AEZA 3HGQA 1D2EA 1LI7A 4KBFA 3ZWKA 2ETXA 5CB8A 1UJNA 2XT9A 4EX7A 4JZKA 4W63A 2OG2A 2NTNA 4ZHQA 4WZZA 4PNHA 3BS4A 3T4XA 2ZB3A 2AFIA 2AMFA 3ZZ0A 3OF3A 1ZGCA 1BXKA 2CD7A 3OE7D 4N5HX 4C04A 3GLGE 2JARA 1CZUA 1GQYA 4P34A 2WKQA 2R2AA 2ZCJA 3CLKA 3PNQA 4EF4A 4OATA 3D4NA 1Z37A 5K3EA 4BP8A 1ZD9A 2QRUA 1D0SA 4UASA 1XTVA 1K97A 3NRBA 1QOZA 4NL4H 1KK0A 2R2GA 3LNCA 5ALTA 1HZZC 4FEGA 4I9UA 2B6HA 1L4MA 1LW6E 1XYGA 3LPMA 2XAUA 3B5EA 2QQGA 2HXYA 8GPBA 5AVVA 4UREA 5LP6F 4EA8A 3H7AA 3SQNA 3OPYB 3ZIAD 4BQEA 5JNUA 4WFIA 3N9IA 1YZHA 1EK1A 2PD4A 4GVPA 1Z7GA 2A4KA 1YI1A 2JLWA 4PIMA 1OOEA 3R9KA 5KKNB 2HEIA 4RA9A 2PK3A 3IUJA 3I45A 4ZVTA 1JB1A 3U80A 3KS9A 4EG1A 4PGGA 1U3TA 1R37A 3JQ8A 3AKZA 3KLNA 2IVFA 2QM0A 2BHNA 4HLCA 1CE8B 4XVRA 1AMUA 4PG8A 1SULA 1Z4IA 1O96B 1SG0A 4U9HS 4B44A 3GFSA 2OO5A 3VZCA 2PH7A 3TDKA 3AKCA 2OPHA 2OLEA 2I7TA 3CR3C 1XRLA 3HFSA 1NQOA 4DRZA 4RJLA 3RHSA 1JR3E 2CYCA 1X80B 4WESA 3T61A 3IQHX 4FS8A 1FFXB 1SUBA 4KODA 1K0UA 2FZCA 1FRZA 2Y92A 4LF4B 3KSUA 4FJ1A 4ARAA 4PNPA 4D81A 3ETNA 2R8EA 3GFVA 5DM70 2AYXA 4HDCA 1CZOA 2NTVA 3AM5A 1JEQB 5DLEA 4DR1B 4UNIA 2E3JA 1GNRA 5ITSA 1FQKA 3BMXA 1DAMA 4BE7B 2W37A 1N8SA 3K30A 4DLZA 2FUNB 3BRCA 1PYDA 1GUFA 2R8ZA 3O2SB 4U6NA 2XPCA 4Y2GA 3EAGA 4O63O 3UB3A 1RKVA 4C0QC 1I2MA 1KVQA 2QD2A 3AUKA 3GLKA 4RCYA 4YCJA 4PG6A 5JD3A 2HDOA 4KNVA 3BF8A 4JI4B 3NIGB 3NHWA 4LRUA 1ZK3A 2C29D 3HA5A 2R87A 2GJ4A 1P80A 3ADOA 3LHKA 2OORA 1NX6A 5DTQA 3AR7A 3ZK8A 4ZQFA 2WF6A 2NTEA 4DNXA 1KIMA 3UK2A 5A4KA 4X8OA 2GN6A 4EO4A 2ZBEA 1NW4A 1XVTA 4LDRA 1P62B 5JNVA 1B1CA 4RZQA 3V34A 5I9SA 2YJ3A 4ZI2A 4YJGA 2IJGX 2P4SA 1WUJS 2CEAA 3I9MA 2E9SA 2W5UA 3RBAA 4S0ZA 1JZQA 3TLEA 2M6LA 1GNSA 1D4FA 1WMAA 4ESOA 1E7WA 4GKJB 1P0IA 3ENNA 5IP5A 3TG2A 1Q1EA 3EARA 3PSHA 1ST3A 5T8KC 1ODFA 4ARZB 4NMMA 4Q24A 1WW2A 3C3EA 2GAJA 4KUEA 5J5AA 3T3GA 1KMCA 2NP6A 3WS7A 1R8XA 2H1FA 1MC8A 2J48A 4DY4A 5K8TA 3PCRB 1GDDA 3FTQA 2WNHA 2F62A 1XVIA 1FDUA 4UUOA 3QUSA 3D0RA 1V35A 1UXOA 2HPAA 2O05A 3D2BA 1I4EB 4GPBA 4TTTS 3U4GA 2BN4A 5EXTA 3M5DA 3TZBA 4XR9A 5F33A 2QUZA 3ZVNA 3QJ5A 1ZH8A 3PYMA 5LWHA 4DIOA 2EJWA 2W2LA 3HUTA 5PNTA 1ZMOA 3VPBA 1RLUA 4GZLA 2GAAA 4AURA 3D7KA 2JJ1D 1AHPA 2OZKA 1BZYA 1T8YA 3LDGA 4BMVA 4KEAA 4R8MA 4ZEMA 1MIOB 5I9LA 4EF5A 3OQ1A 3LX8A 1PNRA 3WYEA 1P44A 3OPYI 5E7MA 1R9GA 2NUAB 3RABA 3MJRA 1NTOA 1VE5A 4GUDA 4M0KA 5TMPA 4OQ4A 3MTGA 3TLAA 3FPFA 2ZLBA 5HE9A 4S35A 4YV0A 3VYWA 3EG5A 1V1JA 4AZ3A 1C1XB 1F0NA 2NZXA 4YRZA 2WP0A 3UJHA 5AVQA 4D4GA 5IANA 1QP7A 4QO8A 2ACWA 4JMPA 3E81A 1NXTA 3JQEA 1YU9A 5E9JA 1WZNA 3ZHOA 4D4KA 1V0JA 3PB3A 3R77A 3SR0A 3N0TA 2TSYB 3UMBA 1E2FA 4EJ2A 5DFAA 3UTCA 2JBHA 1N77A 2V54A 1XTUA 2BFDA 3Q3JB 4WNIA 4YFVA 1ZUWA 1EFVB 1NVTA 1DRWA 1ORTA 4K5QA 3KQWA 2FDCA 1B6RA 3GHYA 3IAM1 4CM6A 3G82C 3WFJA 3GJSA 1UBHS 2PRYA 4DOMA 1K4KA 1T0PA 4C01A 3PX2A 5JD6A 4X65B 2ZJ1A 5KUTA 4JBIA 1GRRA 1SXJB 4HQKA 4LYJA 1CE8A 1SXGA 1HRKA 2WU4A 1XDUA 3NYIA 4NZ9A 4OYLA 1NJFA 4Q3AA 2W7TA 4PYRA 1O96A 4URHA 1A2KC 3A4NA 3V4OA 3V8MA 3UMJA 1UP4A 1IK6A 4K6GA 1O6GA 3B13B 4FBGA 4HX9A 4LGCA 3JZDA 1NYRA 2CY0A 3WDMA 4N39A 2I4IA 3KOMA 1Z68A 3JASA 3T9EA 5JANA 1X80A 3PDIA 3ZWXA 3C24A 2R7KA 4OQQA 4GXRA 4AJPA 5KC9A 3FWPA 4D3YA 2Q5LA 2A94A 1C8LA 4EEXA 1YSCA 5LZ8A 2VPQA 2FR8A 3CVJA 1ZD3A 1N5RA 1YONA 1MAAA 1XAHA 3I76A 3IMKA 3EQ6A 3T7KA 3WNCA 4LHZA 5KQLA 5TMEA 2YMLA 4B3CA 1ZMRA 3RVQA 1EQ2A 1RPAA 1W73A 2O2SA 4WDQA 3WYDA 3AVVA 3NKVA 4FNAA 2W2NA 4DMCA 3F6YA 1JDVA 1EZ4A 2AN5A 1R5OA 1YL7A 2G04A 3EMVA 4BBZA 4FWTA 4LHWA 1RT9A 2BY4A 2VHYA 1QYWA 1D4AA 3UMRA 4F7WA 2ZR8A 3RYCB 1TQ8A 4M8SA 2IV7A 3UWSA 4OI4A 4J49A 1QZ3A 2VAWA 3GZ4A 4IQ8A 1KPIA 5IPFA 5DBIA 4QYWA 3S2FA 5CB0A 1PKXA 1XTPA 1QH8A 1VIYA 1J2YA 2V9PA 2XQVA 5K51A 4GEKA 1HFWA 4P2GA 4MVCA 3F6RA 1Z8HA 4Z8YA 3C3YA 2Z2YA 3V2GA 5A5FA 1I24A 5KNBH 3WMFA 3A4TA 1KRXA 3CXRA 3U4HA 1F9EA 1UMBB 2X5KO 4E03A 1LVGA 1NBOA 1FE8A 2YZMA 5D5HA 4BVLA 1FRQA 4E33A 1SZJG 2AQHA 4R0MA 3G6WA 1V7ZA 2GN4A 2ATVA 5KKAA 3P26A 4ZO9A 1IVSA 3L1UA 4ZQEA 4HY3A 5EUBA 4US1R 1I1QB 1TM4E 4CTNA 1ZISA 4XM2A 4OBXA 2N0SA 3KVRA 2Q29A 1A5ZA 5HOEA 1V8PA 3G0HA 1P2UA 4Z9XA 2DFDA 1U1DA 3ZN2A 2EW2A 4JDUA 1OVGA 2DP4E 3WFIA 3ISJA 1WDMA 1YCFA 4HCJA 1BDJA 2BCJQ 1IBKB 1JDJA 5KC8A 4NU5A 4AMGA 2Q1XA 2DF8A 3B3FA 3NCTA 4ZARA 1R2QA 5HTOA 3DDWA 1JTVA 5TT1A 1NWCA 4O2AF 3RRMA 2YJZA 3F3SA 3GLTA 1MDFA 4F85A 3SPXA 3AR8A 4U7FA 3VVCA 4CLRB 3V4RA 5G02A 3U31A 3LYLA 4KQ6A 5AP9A 4L8GA 1SKQA 1NONA 5DRTA 3WGNA 5JYEA 2C0CA 1NBEA 5KBYA 2IHZA 3ZK9A 1SC1A 1PS9A 3OOJA 3O3CA 1YMQA 2YOGA 2FX3A 1PJLA 2HBQA 3F98A 4RSRA 1ORRA 2QTTA 4BLUA 7REQB 1N5OX 3DHVA 1DVRA 1U2DC 3CEMA 3OU2A 4H7EA 4K6OA 2G9QA 1ZAYA 1F4LA 2J3MA 4MJLA 2HLHA 4B6EA 2XTAA 4ZYVA 1C1XA 1D03A 4KFCA 2O8EB 3NDJA 1ZVJA 2J6BA 1TAQA 3R7WB 1QGAA 2JBAA 4E88A 1CHDA 4B6PA 1JYEA 3D2AA 2V0CA 3NOQA 1H94A 1H3FA 3IEPA 2XD4A 4WQMA 2P9YA 3VZSA 3JWPA 1ECPA 4R54A 1YKSA 1S1CA 1RWQA 2C0PA 4W7IA 4JCOA 1XPUA 2EFCB 4DMUB 1OX5A 2QE6A 5CK5A 5DBOA 3LLCA 2C98A 4KVFA 2ZTHA 1YS1X 2WYHA 4LE1A 3RUDA 2Q2NA 4X92A 3RS0A 4ZMBA 4D8TA 1D8AA 4UDYX 2ZZNA 3AUJB 4B7XA 4J94A 2IYOA 3ZW7A 4BZZA 5AI9A 3WADA 1Z0DA 1RFLA 2J8ZA 2UZ1B 4YCDA 2WB4A 3O9MA 1T5HX 3QY0A 2CVHA 4I5FA 3UJ6A 3V32A 1NSFA 3S1SA 1WV0A 1B8VA 3WB9A 3ZNPA 3MS4A 4X1YB 2BCEA 1IJKA 2EKBA 5AJVB 4QBTA 5ETJA 3EWSA 3GRKA 2DR3A 1MZPA 4HAXA 1IBSA 1OQAA 4H1TA 3OHPA 2PHZA 1NN0A 3DZGA 1NUSA 2L2QA 2ZTUA 2MSLA 1RWNA 2XVAA 3UA4A 4DF3A 2A86A 3I5XA 1JKIA 5I7SA 2EIXA 4PZAA 1BHJA 1VP9A 1IU9A 2V4MA 1IXZA 3AXSA 2OCIA 1GNPA 4G86A 3HJUA 1SUWA 2R97A 3IOCA 4JI8B 5DNDA 2Y1CA 5IKMA 2PWZA 5HZKA 2M1ZA 3WJAA 2AOVA 2W9XA 2Z0MA 2QP3A 2HSZA 1X1AA 3CRNA 3P9KA 2AN3A 4GNRA 4G0PA 1BA3A 1XD9A 1UUFA 1VMEA 4XWTA 1FCJA 4KTTE 2DHCA 4TSKA 2BMVA 1GRVA 2AL7A 4MINA 2G0NA 1XTZA 2ZITA 3E9RA 4QIHA 1G8AA 1UXGA 1YIDA 1L8LA 4HQ6A 4L27A 4Z3DA 1KYYA 1VL8A 4OB8A 2OBFA 3QZUA 3CQ9A 4II7A 2FZGA 4H17A 3L5OA 2C4NA 5IVHA 5JQGB 1EDEA 5B6IA 2GCPA 3IIKA 2ZBVA 4R1OA 2JIDA 5H3CA 2PRZA 4RORA 4GE0A 4NZZA 2AR9A 3A9TA 1L8QA 2E4UA 3CO5A 3E1KA 3LQ1A 4LSWA 4N8SA 5BT9A 5IN5A 3U39A 2VQ3A 3A28A 1ODKA 1BWSA 2XXBA 3BGWA 4G65A 2CSXA 1DX9A 1XCMA 4C7OB 3PUZA 3HN6A 1VKRA 4Y9UA 3VU9A 3IAAA 4A6EA 4UHKA 5GJBA 1OI4A 2OAEA 4ZGWA 4DCTA 4UVHA 2BV3A 5EZYB 4DMGA 1X77A 4G81A 4PHFA 4EGQA 4DQXA 2RB5A 2FMFA 4UW9A 5ICMA 1YQUA 3GEEA 2KJQA 4JLUA 1O4WA 3DOJA 1W0JD 3NBUA 1DO0A 2O50A 4R81A 4RKRA 5BXYA 3X0DA 4Q1DA 3FKSD 2DHQA 1IOVA 4K8RB 4L8WB 4QGFA 1ZZEA 4FN5A 4M89A 4HP8A 1THZA 1M9NA 2BTOA 4CDGA 4C08A 5K4GA 5B1SA 1W4LA 6CHYA 4B6OA 1V1RB 3FNIA 4KUHA 4DLRA 5LPNA 4HXGA 3RUIA 4ER3A 1G8YA 1E60A 1WQ3A 2G07A 2ZUBA 2FRDC 1JEOA 1SM4A 2R9VA 2YVUA 3HXKA 4JHLA 3MJCA 3ZE6A 1TEZA 2PQ0A 3GCWA 4DZZA 4JCCA 2YV4A 3EZ6A 1G8SA 4PLHA 2JEZA 1JFVA 4ZZ0A 1VCMA 3MK31 4RK1A 1BE0A 2XB6A 1LNSA 1EHYA 3ORHA 1E3WB 4DCGA 2LTAA 3K6JA 3HDVA 1V16A 3JRWA 4HAOA 2IXAA 2YYAA 2LRHA 4PCVA 1UFRA 3ZDBA 1U7TA 2LKDA 2YYSA 3FJYA 3QG1A 4PU0A 5FA5A 3EFHA 1BYUA 2JGKA 2V8OA 3CWZA 3ZY6A 2FETA 2GERA 2WPDD 1YFJA 1SUSA 4B80A 1OH7A 1W46A 3BA1A 2K87A 4INJA 1QFYA 1V9SA 2AFHB 2QN2A 2B0JA 1DRVA 4QAJA 5DYYA 2BKXA 2DMRA 4GAEA 4QVKA 1YBMA 1P33A 3CW2A 4FR0A 2FQXA 2X8AA 3KJIA 421PA 1P9RA 2EP5A 5BV8A 1OIXA 3GJ8A 4LYFA 3V8PA 1BO6A 1JR2A 5HVNA 3NHRA 4XIGS 4C4SA 2W6OA 2A1UA 3ADBA 3OT1B 1ZRNA 2EFYA 4RV9A 1XZFA 1G6KA 3DZHA 4ZREA 3IO3A 4KHZA 1F2DA 2E5WA 1KP2A 3LI2A 4UQPA 4U7TB 4A6XA 5HKOA 4X1YA 1WMBA 1AHHA 1N3LA 3INTA 5DYIA 2X23A 2DCMA 3TOSA 4BTVA 4R01A 4L0DA 4YJ2B 5FWYB 3QRWA 2IP4A 5FJJA 3OJ0A 4UU7A 4PLGA 3FFTA 1VL2A 4PYOA 4UCWA 1TJ5A 1Q0LA 2OC4A 3QVMA 5LZ2A 1C9KA 2P9HA 5ELMA 3GUCA 1E2UA 2I76A 3QHQA 2HJGA 3EUAA 1POXA 1F0PA 3OPQA 4GIBA 1D9ZA 3WL3A 3T52A 4WBSA 4YCCA 5LQCA 1S9DA 1KU0A 2HSDA 4WA7A 3TFOA 3V7YA 3ZVMA 2CNOA 4FZJA 1DT5A 2IS2A 2VZ0A 5AVWA 4Q0MA 1P1IA 5BP7A 2F3UA 4QGBA 5IUKC 3BVPA 3WNZA 1WUYA 3EEQA 4B87A 2HTEA 1KGDA 4WDRA 4NESA 1EDDA 2XB2A 1DZIA 1X86B 2HXGA 3H2BA 4ND2A 1AGXA 5A71A 3WZMA 4DPLA 5LVAA 3RJ9A 3G6KA 3N2EA 2X0JA 1PVOA 4KO3S 4MUYA 1SAYA 1CX9B 2AW3A 3UMGA 2RHDA 1XU4A 5GONB 2ZRIA 1YZYA 4K81B 5HZGA 1TF7A 2JL1A 4X20B 3VHRA 4CQLA 5KTMA 1K1EA 4JL6A 4DMLA 1IHOA 3IURA 1ZIXA 4FMBB 4RKYA 2I71A 4EY8A 1G8FA 5EJ8A 3H8WA 2V7QA 5JD5A 1GTJ1 4RSMA 1YOVB 3RR2A 4EJSC 4IVNA 3JWGA 1N7HA 2AYZA 2WU8A 2ZTLA 3IAM6 3K9LA 1DTWA 1RAAA 2C4MA 2XF2A 3NO4A 2VHEA 3O4HA 3OOEA 4K40A 1XA3A 2VCEA 3ROEA 4R40A 4XRGA 2W58A 1BEZA 3BMOA 1FTYA 2ZI6A 4MKFA 1WXFA 2OCXA 4KXLA 4M8LA 3RROA 2A35A 2GYWA 1SUEA 2I3GA 4COKA 1ZD2P 3HVJA 3KOOA 4O2BB 3VR4A 4BLQA 2YCLA 2J41A 2ODTX 2GLUA 5FLEX 5KQGA 3A1TA 3GVCA 2OOKA 3SI7A 1XMVA 1K08A 4WZAE 2QVGA 2VP9A 2FPXA 4IUYA 2P68A 2QP4A 4UBMA 5LLDA 1L4NA 2VRCA 3VO1A 1O94A 1GQ2A 1KAMA 3B1XA 5KHAA 1KE2A 2WE7A 4PGAA 1WETA 3WWOA 3O8QB 5T4HA 1P5JA 2GSWA 3QVVA 3TWOA 3ZDZB 3DBRB 3AF6A 3I3OA 5I9MA 3LLMA 4RMIA 4TS9A 1I32A 4N6OA 3A3PA 1E62A 4S3MA 4HLDA 4OG2A 4K2AA 3W3AD 3ZQ6A 3V1NA 5IHXA 4W6ZA 5KWEA 2ZJ7A 5D1HA 4E31A 4RVCA 4LJAA 4O2AB 2WJHA 5IUJC 3ZHYA 2BM9A 5C18A 3E5NA 3PCTA 3SJAA 5YASA 2I1WA 4RH3A 2ZRKA 5HKLA 2P1ZA 2H59A 3HY6A 3AL2A 4WN3A 3V3KA 4OHRA 3GMIA 3M6XA 1MD9A 1MVLA 1HG1A 5G53C 4F4FA 1PGNA 1QVAA 4RACA 4BJ5A 3BMCA 2HL6A 2OUKA 3KKMA 2IOQA 2IY9A 4FE3A 3M6IA 4JL5A 3H2ZA 2AFVA 4TSFA 4ZOLA 1IHUA 3GPCA 4AUMA 4PZYA 4F86A 5FAKA 4HH0A 5IRCD 2NZ8A 3RC8A 3VR5D 4ZCIA 1A2OA 1U2TA 2Y6VA 5FNZA 1XZ8A 2FUCA 2MINB 3AOGA 2O2IA 2Q45A 1MRSA 1W4BA 5H81A 1B14A 1QDLB 3IVCA 5ALUA 2I3ZA 3IDSA 1DDGA 2A3NA 1T1GA 2OHGA 2XGGA 4I4TB 4L8LA 3HVIA 4P93A 3BZUA 1JG7A 3IE1A 4I1PA 4TL6A 5I7OA 1CDZA 1R5BA 3OPNA 1O77A 3NBXX 1IQ0A 1DKPA 1VPEA 1ZOSA 2OFPA 4JL8A 3PPWA 1YB5A 3O92A 1AHNA 4TZKA 1FX1A 4OHYA 1XQ1A 1SVUA 1YCDA 2Z8XA 3T4UA 5MN4A 4RULA 3GZNB 4I3GA 2HF7A 2QVCA 3T3NA 5I7AA 1AT1A 4RW0A 1RAFA 5D5PA 3R1IA 1I8TA 3GT7A 1SK8A 1GA1A 4IJKA 3H5RA 4JWKA 4R1PA 3RJTA 1UJCA 2MU1A 4KGZA 2BKAA 2VT7A 2A3RA 1E1CB 4DA9A 4AWXA 2CT8A 4MB0A 2RBKA 4TL8A 2UU9B 1R7RA 4HF7A 4HFJA 4HZUA 5E7QA 2Q50A 5EVJA 2J3QA 3OICA 1DEHA 3IVRA 1M6EX 1NI3A 2C1XA 2IV3A 1Y7PA 1E2KA 5KVVA 4B5KA 1I1NA 1YL5A 3B51X 1W75A 4C89A 2GPBA 4WOKA 3G7SA 4XUCA 4LUCA 2UYGA 5DHTA 1P73A 4L50A 4UUAA 4OMDA 3C7KA 1PJCA 3FE2A 4ZAGA 3MCZA 3IVXA 4H7DA 1Q84A 1Y8QB 4LNAA 2YOFA 5GONA 2OSBA 1X0VA 4DIDA 3F49S 5K8VA 4X20A 4KUGA 4U6SA 1I7QB 2FOXA 3IIMA 4MTLA 4OBEA 3VXKA 1FFGA 1T9BA 4R69A 1QHFA 3A6DA 1AKNA 1OZFA 3B9RA 1QUFA 3GNSA 1CFJA 2JNWA 1ZD5A 3EQ2A 1T2DA 4LZWA 4PTYA 4X3OA 3SNHA 4CUKA 5C1IA 5JVDF 1A5AB 1YOVA 4UNQA 3BF7A 4V24A 1CPYA 3IQDB 4FHGA 4QL3A 4RTLA 3IKMB 4LNUB 3ZD6A 5LYJB 4NFYA 1SCQA 3GU3A 1JALA 3BBLA 1FFAA 4UOQA 4DMFA 1CUDA 1OWLA 2NVUB 4CT5A 1KI2A 1GCAA 1JPUA 2P6OA 1P19A 4QDZA 2FFQA 3WMEA 5JCPA 2VXYA 4Z4CA 2WEKA 5CH3A 8LDHA 4YV2A 3WGOA 1LQ2A 1NA5A 3FAKA 2B8EA 4DILA 3M6LA 4PBRA 1JGTA 4YAUA 1YJXA 4O2BA 4REOA 1QCCA 4WKBA 1N8TA 4Z51A 4I4LA 3MWGA 1OA1A 1NUQA 4LCEA 2RHGB 3ABSB 5JTUA 5CVCA 3OKPA 3DFIA 5FQNA 4O02B 5HDBB 4NH4A 3HL0A 4P7BA 1JJ7A 2QVLA 2BGRA 4RAQA 5EIBC 4L22A 1U2GC 1ZY2A 3O8QA 4BCDA 1FS4A 1TZKA 4M98A 4DV7B 2FZ4A 2V7EA 3QOWA 1NBMA 3DBRA 3T1TA 2LXNA 3DGFC 3UJDA 3USZA 1FNDA 2BCGY 4FYMA 1J90A 5BT8A 4MP6A 1CQIB 3H97A 1PI3A 1TVKA 1N6RA 2PFGA 1A88A 3LT4A 5A6SB 4QUHA 2I6TA 2GJ9A 3MPUA 4Q05A 3UGTA 3HVKA 3OJFA 4G97A 4PC3A 1WLSA 1QYIA 3IO5A 3WB1A 1K88A 2WG0A 4AIIA 4AI6A 2JH9A 2PMKA 1JQJC 3GFOA 4Q4AA 3RC7A 2PRSA 3RWOA 3WOHA 4E94A 1W6UA 3I12A 2WTXA 3KZXA 1JG1A 3OQBA 2VG8A 1RJ9B 5EP1A 2FK8A 4C88A 1Y8RA 1WF3A 4R1UA 1R18A 4B5LA 5FRDA 1XD2A 1N1EA 2Y3IA 3JR7A 3WDSA 3ZWAA 4RPCA 4E09A 3QG5A 3IKVA 4AJEA 4GI7A 3KVVA 3D1JA 1O1YA 3MXTA 3WMRA 4PBSA 1Q0UA 1SVLA 3I8OA 3UFXA 1DQNA 4N1AA 4M49A 3RLFA 4H27A 2HCBA 4DUZB 3JVDA 1XMXA 5IYZB 3AERA 4JJZA 1PJRA 2G5PA 4HWKA 4I4TA 1WXHA 5DXJA 3L7AA 1S2DA 3ET5A 4A73A 4F60A 4RH0A 4XCVA 1NVXQ 4WKCA 4FGJA 4BQSA 4D1YA 3ORSA 4EY3A 3QMPA 2XQIA 2F3SA 5CLIA 1O54A 4QGHA 1Y80A 4Q7JB 1F5SA 2C3PA 2OM2A 2R1UA 2LUOA 1C5KA 3BXXA 2YS7A 3X1KA 3VBEA 5DI3B 5FCDA 3WRVA 2AZ4A 4C7KA 3GZNA 1MORA 2P5TB 5DCYA 3U37A 4I4NA 5K5EA 3C4QA 4KR0A 4DLLA 2QE7D 4AN0A 4QLBA 3MWKA 5ICGA 5C3UA 4MVJD 3IEUA 4TQAA 2EZ8A 4YWJA 3WGGA 1PAUA 1FLNA 3SICE 3GA0A 3VMFA 4O4LB 4QREA 3LZCA 4OJYA 5CTJA 4DYHA 1Q3HA 1CTQA 1H8HA 3K9FC 4E22A 2C92A 3CLUD 2X41A 1ZO8A 4X93A 5EQFA 1WVGA 1Y4UA 2NZWA 3U13A 3ESYA 5BW6B 3G1WA 1E1KA 3STVA 2Q4OA 1CQWA 4BZWA 2O8DA 3AB3A 3ET4A 3OZBA 3U4IA 4HYQA 5NULA 2B92A 3B2NA 1F1BA 1U31A 3K0FB 3EZ9A 3EEYA 2Y1XA 1M6YA 2AGVA 2CK3D 2H1SA 2XDQB 4X3CA 3NMUF 1Y8QA 3KHSA 5A4DA 4ZAZA 1QYRA 4YV7A 4TV9A 4LZOA 1V6AA 3L1KA 4HEHA 1CEYA 3M9WA 3PHIA 2MDTA 2D5BA 4J1TA 1X38A 1TL7C 1YE8A 3PQCA 1RABA 4ZOAA 3OZEA 4E5SA 2O07A 3E70C 2Q3BA 3L7IA 1V5WA 4KZKA 2IU6A 4BFSA 3T9DA 1LGYA 1Z7WA 2XNJA 3CCFA 5TB5A 1QVRA 1DE0A 2VPWA 3L8GA 5LYJA 4ZT5A 5SICE 1G5TA 3DBLB 1JE0A 1GOTA 1QVZA 3OCWA 1QHNA 2LV8A 1J1IA 2P2ZA 4F5YA 2KWIA 5BV1A 4NLLA 1P72A 1M8JA 2ZJ8A 1P3Y1 3CUWA 3WDKA 2D06A 3N2NA 1IZZA 3EFEA 4KVZA 2A0WA 3K8YA 3DZJA 4FU0A 2PJUA 1R0XA 2CLFB 3DVRX 3FF1A 1KYZA 3JD2A 5CH5A 3VOTA 1NMSA 2QMHA 3LZDA 3OP4A 4EHFA 1OGIA 3L6BA 4ECAA 3IV7A 4PSVA 4MWBA 1NYQA 3RVNA 3X1MA 2DG2A 3FCCA 4ZI5A 1NZJA 1ATZA 3AM3A 3WZLA 3EASA 1WX1A 4FGKA 4FM9A 3CA8A 1XCLA 2A5YB 1AKTA 4RX1A 2P6UA 3JQDA 2PMFA 5B7QA 1G0NA 1T1JA 1SCNE 3PGVA 1M34B 2Q7DA 5C51B 2FY8A 3V8QA 3D6AA 2YJTD 2O7NA 1QH0A 4J0CA 1X7YB 1ZC4A 5IKXA 3ZCSA 1PFUA 5L95A 4U0KA 3UENA 3OM0A 4PSCA 1N9GB 3RFTA 1BE1A 5A6SA 4NAVA 3P97A 2GYVA 5AHWA 3I5YA 1U0EA 2GCNA 3UY4A 4TXLA 4Y1RB 5CXQA 4G26A 4HFRA 4CF6A 2AI2A 1W35A 3TNFA 3UMMA 1ZITA 1PNTA 1ZP6A 1NI4B 2ETVA 4PSAA 1T8SA 1SU8A 2PU5A 4QBHA 3V1LA 4Z7JA 5MN5A 2YFKA 4R5MA 4OHKA 1WY7A 3MOGA 3MWDB 2JLSA 3JQ9C 4U5XA 1JIXA 4HAWA 3OOWA 5H5JA 1RJ9A 3FY4A 2DB3A 3S2EA 4TT3D 4R84A 1YC2A 3I23A 4Q7LA 3RK4A 4DSNA 5GMOA 5ERXA 3WIVA 3GJ5A 2BI8A 1P60A 3QGMA 4JLKA 1CR2A 3VDQA 4X64B 1WP4A 2SBTA 1AMNA 1Z16A 5F7XA 3SQMA 4M86A 2A0YA 3T4PA 1U9IA 4OUKX 4CVNA 4U39A 2WJ4A 1R10A 3GBSA 4LTDA 4D92A 4NPHA 3UHAA 5IYZA 3E4DA 3DE4X 3IJ5A 1ZUNA 4W99A 3T8YA 4YIHA 1G63A 4B4UA 1E2GA 3MTIA 4D4LA 1I3KA 5FFMA 3MF4A 3GQBB 1PUXA 2PRKA 2GHRA 3Q3CA 2XOEA 5E4TA 3LUGA 3CHYA 4BP3A 2JJ2D 4YRTA 5HKBA 3EDMA 4LG1A 3DMRA 4V0OA 1ZXLA 2IKQA 1A1VA 4TM8A 1EWRA 2G3YA 2YY5A 3AR3A 4RIEA 2BFPA 2HY7A 5A3VA 4JJ8A 3TCKA 5I4KA 9MHTA 5AW3A 2D7CA 3RSQA 4XYBA 2CFSA 3JYOA 1P4JA 1Z15A 1B93A 1OFTA 3AEYA 3M7IA 2I5PO 1RYNA 3UW3A 2O2CA 5CXSA 1GAEO 4ERNA 4KE7A 3N2YA 5BXQC 5KSOA 4P6VF 1YZUA 5GQSA 2J32A 2XDAA 2GBPA 3D6NB 1ZN9A 1UWKA 2Q3LA 1OI3A 2GN9A 1LNZA 1SEPA 2QT9A 1N25A 2XV1A 1TJ4A 1XJ0A 3N2LA 4G3XA 1CK4A 2AR0A 3ETDA 1FLAA 4P53A 2H65A 3U9SA 4RTMA 4F2PA 1L7AA 1TD1A 1Z9BA 3OG9A 3RI3A 2P67A 1W5EA 4L3VA 1UR5A 1CJUC 2ZRNA 3WNQA 4ZTBA 3FTCA 2J6CA 2PLFA 4HHEA 2QRGA 3EEBA 3K0FA 3B53X 5ELLA 3FDFA 3FWNA 2GBLA 3P96A 3QXXA 3Q3GE 1NOJA 1Q91A 2QTFA 4S2UA 4CIVA 2G1PA 1XVUA 1I2BA 2QS9A 1JAZA 2EL9A 1LBEA 2H7YA 1P0MA 4GXQA 3MB5A 5FUXA 2VZLA 2FPSA 1ZHHA 3IE0A 2PLNA 1NLMA 1TLTA 3S68A 2VF4X 2ID4A 4UNSA 3R7NA 1S7GA 4F3RA 2Q3EA 1U6KA 3L07A 4MIOA 5JDIC 4PQYA 4EWLA 3D4BA 1Z4KA 4O4JF 1DKNA 1WHTB 2ODBA 4D82A 3RVOA 3BT7A 1SNYA 2CDBA 2XNDA 3I72A 3DLTA 4GLOA 2R7MA 2CNBA 2JCXA 1UL1X 3F9RA 4HNRA 2EAUA 3HJAA 4G1MB 2N1BA 4CRWB 1YA6A 4X45A 1Q1QA 3LCUA 5LMZA 1UFQA 5K3SA 5HUQA 3GLIB 3B3GA 3NCHA 4QOFA 3SBDA 4AJHA 1WG8A 3EQZA 2GWRA 4J4TA 1JWAB 3H3FA 4YROA 2FLWA 4UU0A 4B47A 1YR8A 1FP1D 3KUKA 5KU1A 2QAIA 1ZW6A 4XGKA 1BGWA 3SHTA 721PA 1HEYA 4AY4A 3HO1A 1OHHD 1N2JA 2WMOB 3UKJA 3UXYA 2QJFA 1KXZA 2XMGA 1HE4A 1EVEA 1O0CA 2PUEA 1E66A 3D5QA 4C3ZA 1UJ2A 2JJ1A 3ROFA 3DO5A 1TM3E 1UT8A 2OMEA 3S1LA 3WI7A 4OH1A 1VLZA 2GM3A 4FCVA 1IRXA 5JLAA 2ZYRA 4R9SA 2VQSA 2QF7A 3QI2A 4G1BA 4JSRA 2IPOA 2XMBA 4WXMA 5IAJA 2ZB7A 3AG6A 4JI5B 1XC7A 3LDUA 2CV1A 1P0CA 4ZXPA 1VZ2A 1M34A 3OPVA 1J42A 5KQMA 1Y7TA 3LL4A 5D3KA 4HEJA 2W00A 1L5VA 4Y6PA 3WIOA 3GRCA 5DM4A 1TVMA 2EGHA 1F6BA 1G3IA 1K63A 3TTYA 3ZVRA 3JYNA 2NSDA 4JB3A 1XO1A 3Q7SA 1N9GA 5ER6A 2AOWA 2QNRA 3G9XA 5H80A 4BXOA 2ZSFA 5EMJA 4RY8A 4CQNA 2C2BA 1YE3A 5AFSA 2OZLB 4G0WA 1USVA 4PHTA 4PYLA 3PC8A 1EVYA 1QZTA 1CUHA 4X7RA 4J4BA 4LK2A 1VSTA 2O1WA 1L9XA 5TVKA 2B1IA 2VYNA 2VK2A 4R1TA 2FR0A 1D2AA 4ZOBA 2XYPA 3A32A 3GCXA 5IAKA 3UVEA 3S8YA 1TMKA 4H2DA 4PGHA 2Q8NA 1YCGA 4LJYA 3ROXA 4WGGA 1HNNA 2B35A 1TM7E 1X1EA 2R6JA 3VAAA 4IIVA 3FCOA 2IELA 1O97C 2CXXA 1FP4A 4JQZA 2P6PA 4MS1B 1SHUX 3BEDA 3CISA 3L0SA 4MR9A 4Z9AA 3T1OA 4AMYA 4EEZA 3EX7C 1DFGA 3ROQA 1K86A 4YUWA 2QRVA 5DYGA 4GOJA 1VKOA 3W04A 4EG0A 3W9UA 3SEZA 3GYGA 4EH1A 1LTHR 1RHMA 1PR9A 1OD6A 3G17A 2KW5A 5JSHA 1QV6A 1I94B 4JB2A 3LPAA 2FPIB 4BX3A 1EDZA 3ELYA 4KAAA 1UMCA 5HBGA 3ZHZA 1HETA 4WUVA 5E7IA 4PXYA 5DMHA 1T9CA 3ZTTA 1CEXA