4HDQB

Crystal structure of the ternary complex of krit1 bound to both the rap1 gtpase and the heart of glass (heg1) cytoplasmic tail
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
164
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Krev interaction trapped protein 1
total genus 54
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdqB00
3OESA 4URXR 4WZ6A 2OCBA 3U3KA 1Z3IX 1Z6XA 1R10A 1VYUA 2OBNA 4WXPA 1ETUA 2Z43A 1IOZA 2ZI4A 1OFIA 3AEZA 4JMPA 2ONJA 1NN3A 5DHFA 3S1AA 2IYLD 4ASUD 1R7RA 4UXJA 2JEOA 1K6MA 3NWJA 2QAGC 4PAQA 2JJ8A 1RRGA 2FU5C 2F9LA 3HR8A 2PMDA 4I4LA 2QU8A 3CM0A 3GJ5A 1EWQA 3EG5A 2G9NA 4A4DA 2MMGA 2A30A 8OHMA 2GEVA 3GLFB 2JLVA 4NE2A 3VU9B 2LKCA 2BMFA 2A5JA 1H8EA 1W2GA 1Z06A 2W6JD 1PJRA 3VKWA 4C3ZA 1CR2A 1FTSA 1H65A 4BEBA 1JB1A 5GJVC 3CB4A 4H9GA 4BE7B 1EGAA 1KDRA 1Q0UA 3KX2A 1G41A 2CLDX 2QBYA 2YWEA 3CLVA 2REXB 3CUEF 3X1XA 2BJVA 1Q20A 5DIFA 3TSZA 3NBYC 3VU9A 3DM5A 2ZXUA 3MMPA 3NH6A 4P0TA 6Q21A 3THWB 3B7GA 2AK2A 3EC1A 1FUUA 2W6JA 2FFQA 1E9DA 4LGMA 4EPVA 1EX7A 3B1WA 1DAEA 1UFQA 3GLFE 2XZPA 3QG1A 3LNCA 2XTZA 4TSFA 3OIWA 3FKSD 2WWYA 1S96A 4MUBA 3KB2A 1M7HA 1S4QA 2XTNA 1WRBA 3EIHA 1IHUA 1NP6A 4FMDB 2GXSA 1ZM7A 2G88A 4IKEA 2GAAA 2A5GA 4HSEA 1P2SA 3ZIAA 4EAQA 3KUCA 2O8FA 2JASA 4NDZA 5HCNA 3TAHA 1SZPA 1X8LA 2DWPA 1XTIA 3KJHA 1E1QD 2F6RA 3P26A 3QF7A 5DO9A 1KNXA 3KFVA 1P2VA 1FMLA 4M1OA 1XTJA 4URUR 2BBWA 2CLCX 3NEJA 3SE0A 5EZ5A 1DOAA 2B7CA 3FPAA 5FTKA 2EFDB 1KI6B 4TYQA 5KTYA 3ONWA 3ICEA 2YWFA 1E2JA 3QVUA 3EPHA 1BH2A 1A4RA 1S8FA 2QPTA 1L4UA 2AFHE 3BH6A 3K70D 1N6RA 3NVAA 3FKQA 3RS7A 4AK9A 3U7EB 1OB2A 2IS1A 4R2IA 1P9WA 1SVWA 2V1UA 3TAUA 2NZ8A 3KL4A 3MUFA 4B3FX 2ZRHA 3WHKA 2Q9AA 2FFHA 4PZZA 3THOA 4B32A 4YQFA 2LCFA 3J81k 2NO7A 1J99A 4A92A 1Z08A 3N70A 1UADA 2J87A 4EJSB 3QKRB 3VX3A 3L8ZA 3RS5A 4D81A 1XZQA 2FA9A 1Z29A 3HU2A 4PHGA 5BYKA 3QQ5A 2XB2A 3W6NA 5JWRA 4JSTA 4B3DA 1AKEA 3KJIA 4DCNA 5F9FA 2ANBA 2P5TB 1XEFA 4JLDA 4QRHA 3RC3A 2AKYA 1VKJA 2CCKA 3X1DA 1OXTA 3Q8XB 2XOKD 2GDJA 1DAHA 1NSTA 3UMSA 4FCVA 1HE1C 1A7JA 3KQKA 1SXJE 3B2EA 1BYIA 2YZ2A 3BC1A 3GPLA 3C14C 4F7WA 1ZBDA 3RANA 2B92A 2VBCA 1VIYA 1Z6YA 3B85A 4NL4H 2OM2A 2XNSA 4DB2A 2VF8A 1DAMA 1MABA 2IS4A 1GITA 2HT6A 4CW7A 2ZJYA 5D3MA 5KHOC 5FPYA 4ZIRA 2J0UB 5FOSA 4IOMA 2GWHA 3U5ZB 1AZTA 1T3HA 3BOSA 3CR7A 2ZRIA 4PANA 3AUXA 4Z8YA 4DDWA 3O8RA 1R6BX 3QI2A 3ZD6A 5FTJA 3HYRA 4BFWA 1E2HA 1P75A 1VCIA 4MA4A 3QPUA 4A6PA 1DPFA 2IUTA 4NMMA 1OYWA 5EE0A 4BLPA 3AF0A 4LJ6A 1E2DA 2RGGA 3I3SR 2NO1A 1J8MF 3EZ2A 3QPWA 3NDBB 1OIXA 1JJ7A 1US8A 1ZU5A 2P5SA 3B8HA 3PEVA 4K46A 1MO6A 1K5DA 1KMQA 2HDNB 2GJ8A 2VP2A 4JLBA 1BKDR 4CYMA 4Q03A 3EZFA 2D06A 3C5CA 4ZI2A 4IEEA 5TMPA 3PFIA 2WJIA 2W83A 2ZRKA 3IHWA 1COWD 1KJYA 4A2WA 4CEJB 2OEPA 3SYKA 4LK2A 1TPZA 1T0JB 3A4MA 2G1JA 2QA5A 2WICA 4V0KA 4QGFA 4F92B 1CIPA 1P7CA 5DGXA 3ZGXA 1T8TA 1TEXA 2WKPA 4URWR 3SYNA 3K0SA 2WPDA 3TMKA 4OI4A 3CKLA 1I4TD 3U4QA 4XH9B 4K8OA 4YDHB 1E1RA 2YINC 1TTTA 3RS3A 1CLUA 2C5LA 4DIDA 3NG1A 3P4YA 4OQXA 3NDPA 2FDCA 3AF4A 3CPHA 4XSHA 1SKYE 5GJCA 1BMFD 1KO1A 3RWMB 1U8ZA 4RD2A 3I5XA 2D74A 3L2OB 3NH9A 4LSGA 2AN9A 1GL9B 3PEUA 4A82A 3THXB 2WAYA 2XSZD 3K53A 2KJQA 3WBJA 4B3XA 3T5GA 2ZI3A 1XCPA 5JCPA 1RFLA 2AD5A 4IHQA 2A5DA 1T4GA 4JLOA 4EPYA 2Y8EA 1Z28A 1NG9A 3C4JA 5UKDA 3HU3A 4QFMA 4EJSA 1R8QA 1TQDA 1N25A 3LWNA 1XPUA 1ZMXA 2QSYA 4IDQA 2ZJOA 1IONA 2FE4A 2W00A 2J7PD 2YJTD 2AKAB 4CDGA 5AK0A 2ZITA 1KSJA 2J7KA 2WAXA 2J41A 3LVRE 4IJMA 1CF4A 3HPQA 4W5JA 3AVYA 2J0SA 4Q18A 2NOAA 4KVGA 5BN3A 4Q02A 2IS6A 5DSZA 1YHNA 1XNJA 1O3YA 2HCJB 1XJ0A 2MMCA 2OG2A 1LW7A 1XXHA 4B71A 2GJSA 5KYKA 3NHBA 5G3ZA 2J59A 2PX3A 2QG6A 4XWAA 3FMFA 4DCVA 2ZJAA 4QKQA 2J1LA 1JPJA 2IYUA 1ZNXA 2WWGA 4LCBA 5H8WA 1U9IA 2CJWB 2JIZD 2PT5A 3O8BA 2BOVA 4JLVA 2IA5A 4CVNA 3AF3A 1QHIA 2O0HA 4JLJA 1YRAA 5CK4A 4HLUA 3K0CA 3D3QA 2JLUA 4Q1EA 1GIAA 4JZKA 1AM4D 2ZJZA 2Q0HA 4P31A 1NRJB 4B3BA 4DSNA 3T06B 2HYIC 5JFGA 2G77B 3HPRA 2JJ1D 2GJ9A 2CBZA 4II7A 4KCGA 4FWTA 2FGJA 2NPIA 1P72A 1G18A 2O52A 1G7TA 1YR9A 2EFEB 1G9XA 3GP8A 3HYTA 3QBVA 5CJ2A 1N6PA 2YWHA 4FMCB 5CLLA 2CVHA 1KK0A 1T0HB 1E2LA 4IOJA 1DADA 2ZE6A 4OBEA 3A4NA 3K0AA 1NJGA 3OAAD 4IW3B 2IYXA 3L82B 4KFTA 3TSWA 2WWXA 1KDPA 1SHZA 1YU9A 3WMFA 4QJ3A 3QF4A 3PVSA 4MGYR 4MRSA 4K81B 4Q1FA 2ZVPX 4RD4A 1YR7A 2QY9A 1P4SA 3MWJA 4B6FA 3AVVA 2ZE8A 1Z63A 5FPKA 2KWIA 1UKYA 4B76A 1S1CA 3EPLA 2O8BA 3K9NA 4ABYA 2TMKA 2OV2A 1WBDA 3R9XA 1M2OB 4MDFA 2P6NA 3X1WA 2O8CA 4YC7A 1BO6A 5GJBA 4B73A 1TL7C 521PA 2C77A 3GLHE 3LRPA 2Q9CA 4HDCA 3U7FB 2PLRA 1XD9A 2C8VA 2JA1A 1F2UB 3SEAA 2ZU6A 2BVNA 4JS0A 3TLXA 4HZIA 4QHSA 3VHLB 1CJVC 1KIMA 1IJEA 1MV5A 5JHHB 4LJ9A 5JWHA 4D4KA 4IVPA 3IO5A 1E69A 4KLNA 1XXHE 2IYVA 1II8A 1HT1E 2GKSA 3QKSA 4HLUC 5G41A 5KSYA 2NMVA 4RJLA 2WWHA 5J4HA 3FE2A 2VHUA 2CL6X 3NEYA 3QXXA 2BMDA 4MGIR 4F91B 1FX0A 1E96A 2WPDD 3DOFA 1I2MA 2QMOA 4X8OA 1NG1A 2CNWA 4AY2A 3VQTA 3LH5A 3BFVA 1E0KA 3GLHB 3MJHA 3V4FA 2DYKA 4ERNA 3UATA 3B13B 4JBXA 1DVRA 3UANA 5DI3B 5FBVB 1CJUC 4KI0A 1GL7A 1G20E 5IDVA 4MKHA 5C18A 1UDXA 3SBEA 3PR1A 2EU8A 5K8LA 2ZQ5A 1XZPA 2CNWD 2J0VA 2Q6TA 3G0HA 3N2EA 3GLHA 4NYJQ 1OW3B 2NG1A 3O8DA 4B6EA 4Q9LA 4NYIR 4G1UC 1ZYUA 4TYPA 3E1SA 2IUSA 4B3CA 5L3QB 5TVKA 2ZJ2A 4MGZR 3AUYA 3I73A 5JJLA 1KAOA 4LBZA 1W4CA 3FHTA 2HYDA 1UM8A 4RFSA 3LLUA 2V7QD 1OXUA 1UBCA 1ZUIA 5KDDA 3TUZC 4Z54A 5JLJA 3FMPB 3O8CA 1II9A 1VG8A 4MYTA 2KSQA 4H1VA 1P73A 2VIIA 4LV8B 3T61A 3ZZ0A 4HAUA 1N5IA 4L9SA 1ZU4A 3ZLJA 3DMNA 4IXMA 2ODEA 4QG7A 3IEVA 3E70C 5C4GB 2AWOA 2KB0A 4JYCA 2QTFA 4BFTA 2A2ZA 4L8GA 1TADA 1K5GA 1Z8FA 1RIFA 4O0MA 1E2IA 1KHTA 2GK7A 4OQNA 5KNBA 1N0VC 2F3TA 4JKIA 4V0NA 1KO8A 4C0SA 4FMCF 3FDIA 1CRPA 1Q21A 2ZVQX 2JCSA 5JEEA 1U81A 4A2QA 4HUQB 2R6CA 1N5KA 3RVBA 5KUTA 2LWIA 3M0EA 3OAAA 4AURA 2I4IA 3QIAA 3K70C 1IQPA 3GJ3A 3FGNA 2QZ4A 5J4VA 3F0TA 4XD7D 4HB4A 1P2TA 5KPJA 4PQFA 4OHXA 1EXMA 1NMZA 4DB4A 4GMXA 1WBBA 5EUQB 4D0LB 4OHWA 3ZZUA 5KNCA 221PA 4AKEA 3EWSA 1P5ZB 2P6RA 4LV5B 1CKEA 4ON9A 4WBSA 5BWMA 3KFXA 1DAKA 4DUGD 2WIBA 2ZYUX 2B21A 2B7BA 4MQBA 5ELXA 1JJVA 3B1ZA 3KZ1E 3FMIA 2UZ3A 1GL6A 2RKOA 4TLBA 4X8HA 3SZRA 1DEKA 4BLOA 3KKNA 1JXOA 1T5LA 3B60A 5H68A 3VMFA 4QBIA 2PZFA 5TXGA 2GXAA 1ZM3A 3THWA 2EFGA 1WMSA 1Z22A 3LA6A 2WMNB 1G16A 3BS4A 4AC9A 4M9QA 1G8HA 3KXIA 3IPXA 4Q4HB 3RS0A 1HY3A 4IRUB 1JR6A 5IF9A 1Z0JA 4PHTA 4E03A 5E95A 4PQRA 4TZ6A 1E2QA 2IHBA 3QY0A 2RGNC 4TN1A 1SULA 1Z6AA 3TJZA 5TDHA 1RKBA 4QHTA 3MD0A 2O8FB 1NN1A 3OIUA 1HURA 4U02A 3IQWA 4YDSA 3I92A 5FBWB 3U3RA 2ZM5A 1R5BA 1X6VA 4DDUA 4IDNA 2PJRA 5CYPA 1KGDA 1G17A 4ZPXA 1FMJA 2NQ2C 1DE0A 1JBKA 1OSNA 4GT1A 2EFCB 3SHWA 1XMJA 4ZDIA 2HT1A 2ZRNA 2BIFA 1E9FA 2HJGA 4MRRA 5SZJA 1OH7A 2ZETA 2R2AA 1W46A 2CMKA 3LBIA 4KSCA 3KQHA 1S3GA 1XF9A 4LI0A 4QM7A 2IX3A 1TUIA 3TW8B 2J46A 1S9DA 1JNYA 4ZI3A 3RABA 1LFDB 2WJGA 4AYWA 1XBTA 2BV3A 3GEEA 4DRZA 3ECCA 4Y0AA 4LJ5A 3ZIAD 4DLWA 3M1IA 4EDHA 1QG4A 4PSVA 3D6TB 4PO1A 4LPKA 4PXAA 2PEYA 5C46F 1FX0B 2QP9X 3FFAA 1GNRA 2X2FA 3LBHA 3VR4A 4TMWA 4LY6A 2ATXA 1ZW6A 4JVLA 4TZ0A 4MRPA 1AA9A 1G3MA 1T3SA 2Z4SA 5KSPA 2GTPA 2O8EB 4Z51A 4AKHA 1XFAA 4M1WA 4GFDA 1XPRA 1DS6A 4QBFA 2BBTA 4HAXA 2XAUA 4FCTA 1U8YA 3M4YA 1E9RA 1SVMA 2H7VA 1GAJA 3TIFA 4NHOA 1CXZA 4GNKA 5KU1A 3LX8A 5CJPA 3RS4A 1ZCBA 2QPOA 2F3RA 2VHJA 3R8CA 3RLFA 4Q66C 4DUGA 2IXGA 4JIMA 4PZLA 3CRRA 3E2IA 5FL7A 3H2YA 4RFVA 4MGKR 1HV8A 1E99A 5JI2E 4I1VA 3AKYA 4UJ5A 1PUIA 2ZR9A 2OESA 1R5NA 5ANRB 4BFVA 3PJRA 4W7SA 1E3MA 1GRNA 5CDFA 2QAJA 2WSSA 4HEJA 3MLEA 4XVRA 1FNMA 4KYUA 4B34A 1FP7A 2CK3D 4AG6A 3KXLA 5FOWA 5FTNA 4FIDA 1VDZA 1XEWX 1YZLA 4TLCA 4XWOA 3C41J 1TNDA 3F8TA 1Q22A 4BWYA 1NSFA 2FN4A 1VYVA 2P65A 1ZP6A 4ASUA 1JALA 5G40A 3VX4A 3HU1A 2J45A 5JJIA 2XTMA 1P62B 2YOHA 1XD2A 3B6EA 4A6XA 1W5TA 4LX0A 3B1XA 3R9WA 1MABB 2ZREA 3DHWC 2H8KA 1OFUX 1MOZA 1JR3A 3DKVA 2WWWA 4JJZA 1CJTC 4Q1DA 4CEJA 1TAGA 1JAHA 721PA 4JL6A 5LD2B 3F5FA 3SFVA 1G7SA 1XMVA 2ZRAA 1N6NA 5C4MA 2A7QA 4MRVA 4HB3A 5J5CA 3TGPA 2ZRFA 2ZJ8A 3CH4B 1VMAA 3RAPR 1FPMA 1COWA 4PAMA 2OCYC 2XITA 2Z6VA 2ZS8A 3Q7PA 4C0AC 4JLMA 4DLSA 1F60A 4DEYA 2FFBA 4RD3A 2BHRA 4NBSA 4TTRA 1M8PA 3GFPA 5M04A 2O8DB 2H57A 1FZQA 1QHXA 3VNUA 2QGZA 3G82C 1W49A 3BXZA 1PV4A 1KSHA 1LTQA 1EFRA 4D4LA 4M1MA 4ZO4A 5FBQB 1R0WA 5AUPB 1QHHA 1X1SA 1YR6A 4KODA 4B47A 2EFHB 1N2CE 1X8JA 5E4FA 5LPNA 4C0BA 1NVUQ 1LY1A 2CEAA 4A9AA 5EE9A 3AP1A 1KI6A 3CH5A 1A2KC 2DWOA 4TSFD 2ATVA 4X8LA 3BAFA 1KMHB 1F5NA 3ZYCA 5IHPA 5JWOA 1IY1A 2WWFA 4FMBB 5LB2A 1Z6TA 3B9PA 3KKPA 4QNRA 3UMRA 4TMXA 3VFDA 3NKVA 1E1QA 2ZPTX 2V8OA 2G83A 1ZINA 3B1VA 4EFMA 4HDQB 2IEYA 2XJ4A 3ASYA 5BXQC 1RE0A 3EIQA 3KUDA 5KNDA 1ONBA 3K9HA 3CF0A 4I1OA 2YYZA 1TU3A 4KU4A 1LB1B 2JIZA 2KBFA 2C99A 4MKIA 5EE5B 3WXMA 3CWQA 1FNNA 5EZ6B 3U3MA 1ZNZA 1W36D 1CR1A 5FUXA 5L3SB 3B5JA 4R98A 1TUEA 2HEIA 4LBVA 2XGJA 4TL6A 1ZNWA 3OFND 3IKJA 4NYJR 2QROA 3DKPA 4NKRA 4EPTA 3HP1A 4BZXA 3NBFA 3C8UA 2ZEJA 3K0FB 2QUZA 4KV9A 4P4SA 1E9EA 2BEJA 2IT1A 4N0EA 2HLDD 1D2EA 2G1KA 1Q1ZA 3GJ8A 2EVWX 2QM7A 2QEQA 4HAVA 1EG7A 4KJZA 3TUIC 3V4RA 1WB9A 1MH1A 4A1FA 1SXJA 3RWOA 4C2UA 3UMFA 2ZI7A 4EIWA 2CCGA 2WSSD 3ZVMA 2RGBA 2R62A 4F4IA 4JSYA 2O8EA 3NBXX 2D7DA 3CBQA 3QJYA 4MKFA 1XJCA 4IXNA 2WTUA 4ZDKA 4GP6A 2C04A 3EPKA 2GCNA 2KBEA 1GWNA 1W4RA 2IYQA 3I5YA 2BBOA 2EWVA 2FSGA 3JZAA 1XDBA 4IFEA 4JBYA 1H8HA 4L16A 2ZRPA 1PLJA 3RS2A 4TLAA 5FI1B 4C30A 1JI0A 3BFXA 4GMDA 1ZIOA 3LXRA 5FOXA 2H92A 1JECA 1E9AA 4A0HA 5KDOA 4A0RA 3WP1B 4E22A 3V00A 2I3BA 5AUOB 1GOTA 2QQ0A 2ZYVX 2FSIA 1D2NA 2C98A 3SR0A 4QM6A 1C4OA 1NVVR 4JKYA 1XEXA 1CBUA 1G21E 3NBZC 3RHFA 1UF9A 3UK6A 2GF0A 3ZZTA 1DELA 1KSFX 3EW9A 4LJ4A 3KQLA 1IAQA 2N1BA 3T1TA 3OZXA 4DZZA 4JVSB 3WP0A 4D0GA 1OE0A 2GESA 5GVSA 4YLGA 2Z4RA 2CE7A 2BJWA 3TR5A 1KKMA 2FSHA 4Q9IA 2O8DA 1FW6A 1N6KA 4KLZA 1G8YA 3IEUA 1V43A 4L9WA 4LRWA 4V0ME 1RC8A 4YMSA 2QBYB 4KFUA 3K0AB 4J0QA 3GFOA 2JLSA 4MRNA 3T12A 4P4TA 4HLQB 1JXMA 3UXMA 5J4KA 3KQNA 4B2PA 4QJ5A 4V0OA 2JAQA 2WJVA 1CS4C 3I32A 3I8SA 3FMOB 4CT4B 3KQUA 3QEJA 2XXAB 3ND9A 4PO9A 5FPTA 2C9OA 3AVPA 3X2SA 4M9ZA 3Q7QA 5JRZA 4MUAA 4FINA 1D9ZA 3HR7A 3T5DA 4LC1A 1EFCA 1PLLA 1CU1A 2QT0A 2WKRA 3GJ7A 1UBGA 3SOPA 4Q9JA 4FI3C 4ZKEA 2IBMA 3IHLA 2C95A 4C4PA 2QAGB 1NBMD 2FFAA 2ZSEA 3BBPA 1ESMA 1LVGA 4Q01A 2BDTA 3V9PA 1Z0AA 1KZGB 1OIWA 4OL0A 4DSTA 2D62A 4IVRA 1HQYE 4TL9A 1ZCAA 4PC2A 2ZR7A 4JLAA 3OFNA 1DAIA 4LHZA 2VRWA 4NTZA 4HZUB 2E1RA 2YKGA 2OXCA 1CR0A 2Z0MA 1IBRA 5E7MA 3K0FA 2JLWA 2C78A 3FTQA 4Q19A 1II8B 3QKSB 2R9VA 4PC6A 821PA 1A82A 3K1JA 5HKKA 2V54A 2FPKA 4DVGA 3QPVA 4PZYA 2QT1A 5P21A 4ZCIA 1WF3A 4KAXA 4C0QC 3KKOA 3RC8A 1QZXA 4Z8XA 4UNRA 1ZD9A 1DG1G 4Q1AA 4QHYA 1G4AE 4MYCA 5D3QA 1HT2E 1U8AA 1HA3A 2QSZA 3DZ8A 2OBLA 3W34A 5KSOA 3A6PC 4KITB 1R0ZA 3PCRB 3AVUA 4ZCMA 3EZ9A 2O0KA 3DOEA 3K70B 1OXXK 2B6HA 5K8UA 2VP6A 1IN6A 3Q5EA 4Q4LA 4TT3D 2AHOA 1VPLA 2REOA 4OQLA 5DI9A 1FUKA 1E0AA 3GLGE 1RJ9B 3U44A 1U9IC 4D4JA 1Z0KA 3CONA 3T34A 1UDWA 1IN7A 1JQJC 3WY9A 3DEFA 3UPUA 1E2NA 3IO3A 4D6PA 3X1YA 4IDHA 1XCGB 1QHGA 3I62A 2WJYA 5L8VA 1KO7A 1KO4A 1SXJB 4DXAA 1JEEA 4WIAA 3W6PA 1N0UA 1MO5A 3CRVA 5KO2A 2DB3A 2GF9A 1OHHD 4RVCA 1W44A 3IQXA 4B35A 3EXAA 4GZMA 3RRZA 3AVTA 1ZC3A 4ESHA 3K9GA 3P20A 1FTNA 1HE8B 3L8YA 3SN6A 4PR0A 1SGWA 3WRXC 4XD7A 2G0TA 4LHVA 5C2JB 2ZJBA 2XXAA 1QHSA 1RZ3A 1XEWY 4HAZA 4BLTA 1IN5A 2H1LA 2VHTA 2R6AA 1NBMA 1DO0A 4BASA 2BMJA 5AWFC 2QPAA 2RGNA 3ICQB 1VHLA 2OLJA 5CIWA 4XJXA 3SHFA 2OUKA 2VP9A 4UXHA 1GNPA 4LHWA 4URVR 3MRSA 2ANCA 1GDDA 2GHIA 2WIAA 1RRFA 3IPYA 1G6HA 2Q3FA 2CL7X 5DHAA 2QI9C 1ZC4A 1KAGA 1B23P 1CP2A 2AL7A 3ZS8A 2HF9A 4QGGA 3PEWA 1M7GA 2G6BA 1OB5A 2VSFA 4EPRA 5K8TA 3IIJA 2GJAA 2PT7A 2IYZA 1DBSA 5C1BA 1G8PA 3MWLA 3R9IA 1W47A 1ODFA 4BZQA 2BMEA 1G7CA 3AVXA 2H5EA 5E3HA 4U00A 2ZYWX 1IJFA 2WMOB 3AF1A 4EUNA 2CLSA 4O2LA 2DFNA 4M9SA 2IXFA 4B3GA 2D4HA 2OAP1 5H1YA 2OE2A 4JLNA 1EFUA 2GXUA 3QXSA 1C1YA 3IGFA 4IVQA 4Q9KA 1M74A 2BWJA 3MWKA 1KI9A 4DKXA 4A2PA 4PC1A 4CEIA 3IBGA 1SVIA 1Q57A 2SHKA 3WYAA 1CRQA 3U3JA 2Q3MA 1ZM4A 1W4BA 3A1UA 4QL3A 5FL3A 1BYUA 3PXGA 2EQBA 3T1QA 3ADBA 1PVOA 2QP4A 1I4DD 1XD8A 5EQTA 1BOFA 3B9QA 2J7PA 3VKHA 4DIEA 121PA 5HCIA 2FH5B 4LJYA 1XX6A 2B8TA 2C96A 2DFTA 3T1VA 2JLQA 3NC0C 3D31A 1D5CA 5AR1A 1GTVA 3VNVA 5CDFE 2FZLA 2VHCA 4HLDA 4NONA 4DDVA 2J5XA 1A5TA 3OEEA 1YJ5A 4D82A 1AZSC 1TMKA 3R20A 1XP8A 1P60A 3UKDA 4BUJA 5BQ5A 2ZUCA 4RCZA 1XWIA 2G3YA 2K5UA 2WKQA 2ODBA 4KBGA 1AK2A 4WAUA 1OXSC 1NY6A 2ZU0C 4UNPA 3REGA 1YRBA 3CX8A 3U3OA 5SZHB 1PUJA 2ZUDA 1YKSA 3DDCA 4PHFA 4AKIA 5AUNB 1EESA 2Q21A 2C9YA 3A4LA 5EXPA 5EXTA 4LJAA 4AKGA 2PBRA 1UKZA 1KY3A 3TQCA 3OE7D 2FOLA 4BLSA 3SJZA 4POAA 5LBIA 3U7GA 3D8BA 3SQXA 4A8JB 3SC3A 3FFBA 1GZSA 2O5VA 5FUVA 2KI5A 3IILA 4IOKA 4TMTA 3WNCA 3GD7A 4B2IA 5L3RA 1P61B 1G3UA 2OAQ1 4CIDA 4GOJA 1J90A 2ZI6A 1NVVQ 2XNDD 5CB8A 1U0JA 2PCLA 2R6DA 4NU0A 4F4JA 4A15A 1S0UA 2D2FA 2ODWA 2ZAOA 4URYR 3AH8A 1AS3A 3R7WB 3AB3A 2XX3A 2EW1A 2VSXA 4HB0A 3HWSA 5KOYA 2O8CB 4M21A 2RMKA 4OI2A 1TF2A 5JJKA 1GKUB 1N5JA 2E9SA 2JJ2A 3L0SA 4HI0E 3LV8A 1VG1A 5L3VA 1OT3A 3T1OA 2VF7A 3U6BA 2QP3A 2WJHA 3BERA 2E87A 2GNOA 2CL0X 1GUAA 2W0MA 1RRPA 3R7WA 4BQSA 5JRJA 1Z2CA 2L0XA 1W0KD 4NCHA 3U7HB 3QVVA 3K0CC 1YZNA 4C0LA 2IC5A 4KFSA 2JJ2D 3MSXA 2DY1A 5CM8B 4LHXA 1U2RA 2LKDA 2QNRA 5JS8A 4E07A 4JYBA 1IXRC 2NO9A 1T6NA 3WMGA 3DZDA 5FR1A 3H1TA 4M8NE 5F98A 1MO4A 3SU8A 2EYUA 3IUYA 2XB4A 1ZM9A 1KDOA 1D6JA 1TEVA 2GA8A 2IF2A 2RHDA 2UZIR 3CRQA 4QNMA 3PENA 1GM5A 2ZSDA 2FPLA 3C5HA 5BN4A 3BH0A 3H86A 1W48A 2WM9B 4FXPA 2RAPA 4MYHA 2X19A 3CF2A 1MO3A 3OEHD 3EARA 1WQ1R 2OHFA 4V0MA 3SYLA 4AIIA 4KHZA 4RZUA 2F55A 4QJ4A 5DYGA 2ZIAA 1WP9A 3GEIA 4FN5A 1W4AA 1Q3HA 5DH9A 1TU4A 1JQLB 4MH0R 2QQEA 1S2MA 1KI2A 1G8GA 4IDPA 1NIJA 2MSDB 4Q21A 4Q4JA 5JS7A 3EIEA 4TTPA 1OLOA 4HDOB 4ITRC 1D8TA 1P6XA 2QE7D 1QBKC 3I1FA 1N3BA 4Q1BA 4P4UA 3DPUA 4PC7A 1FFHA 2FEMA 5TV2A 2ASEA 3C15C 3SJCA 2ZANA 3WYFA 2RGAA 2I1QA 2R6FA 3Q85A 1KI1A 4M0LA 4C0JA 3LX5A 4Y0VA 1Q3TA 2QM8A 2ZS7A 3TQFA 2H18A 3R8FA 3QXHA 1NL3A 4Q7JB 1ZNYA 1UBEA 3AGQA 4IDOA 1NF3A 2XSZA 1JPNA 3IIKA 5L3SA 1GRQA 2FV8A 4DLZA 2WHXA 4Q7LA 5IK2D 4TYNA 1P2UA 2PX0A 1F3OA 2F7SA 2R8RA 4LHYA 4OHVA 4PHHA 1N5LA 2BCGY 2PL3A 3UWOA 2IYRA 2AFIE 4RY2A 2REBA 3QXCA 5D3MB 2QENA 1S1MA 2CXXA 1L8QA 1OIVA 1SVKA 4JL8A 4TMKA 2IW3A 2Z83A 2BC9A 2IYYA 3RRYA 2XEXA 4DLYA 3B1YA 1Z0DA 4V03A 2B8WA 3AGPA 3EWAA 1MR3F 1W36C 1H8HD 1D9XA 621PA 3I72A 1YZQA 2FWRA 4ESVA 3BB4A 2ZI9A 4BEJA 1KNQA 4UXIA 1XTQA 2BM0A 2CJWA 5DLQC 1GSIA 4G0NA 5F2EA 5DN6D 4RZ2A 2NZJA 5KSZA 4DC9A 4C9BA 2ZTSA 4JT4A 3BJIC 3FHOA 3K9LA 1GILA 1BIFA 4BRWA 4HUQA 2XZLA 3GMTA 5CK5A 2OFXA 2FJUA 5G3YA 4QBGB 2OT3B 1OFTA 4DCUA 2D7CA 3FB4A 3CR8A 4PX9A 3AF2A 4WOPA 4OK5A 1U90A 3QOFA 3P32A 2QORA 1E1RD 1EX6A 1TQ6A 1XTKA 1OKKD 2BEKA 2P67A 2QTVB 1T9HA 3NIBA 1QHNA 3AM1A 3AVWA 1CULC 1GFIA 4S35A 3PUXA 2W6ID 5JI3E 4BFXA 5AUQA 4X8MA 4QGHA 4A8JC 1KKLA 4DLTA 1ZVQA 4C7OA 4GDFA 1OYYA 1N6IA 1QG2A 1RYFA 3KXKA 4N0DA 1UKEA 3PUZA 2VSOA 5IT5A 3W3AA 1FOEB 5JZVA 3UG6A 1UEIA 2IL1A 2N46A 2KE5A 4V02A 4MYUA 5E7JA 5EJEA 5JECA 1B0UA 4XTRA 3WNBA 4CT5A 4D80A 3THXA 2C03A 4YMWA 1ZM2A 5CITA 3VKGA 2AXNA 4GZLA 3P4XA 4N1AA 4WXRA 3TH5A 1G3RA 1SVLA 3UG7A 2F1RA 2GZHA 4DBLC 1SQ5A 2QE7A 3FKSA 4NH0A 2FMXA 3A1VA 1OH5A 1L7VC 3MJRA 1N6OA 4RZ3A 1E32A 3DVLA 4XIGS 5A0FA 3EC2A 3PITA 1G291 2Q9BA 1Z07A 3QXJA 5AJWA 4PQYA 1Q1BA 3RDPA 1SKQA 3SFZA 5JMTA 1FL9A 4US0R 3U4QB 3CPJB 3LW8A 3VR3A 4DDTA 1Z0IA 3KDSE 3SQWA 1E2MA 2CHVA 1XMIA 2YOGA 5HE8A 1E2PA 2W2VA 4G01B 3PUWA 1RYHA 3G5UA 3KKQA 3PQCA 4G5QA 4AI6A 3ZQ6A 1UPTA 4NYMR 3LFUA 1XB2A 1XJQA 3E5HA 4RSGA 4M22A 5FTMA 3GQBA 2P6UA 4S2EA 5CIQA 3T35A 2GCOB 1VYTA 4BRUA 3U6KA 4D26A 2A9KA 2D2EA 2JJ1A 2ZYTX 1YZGA 5BN5A 2JLRA 4P32A 3EAQA 5DI3A 5HKKD 2DHRA 3DM9B 4M1KA 2ZJ5A 4LYFA 1AJEA 4LWZA 1Q12A 2HLDA 3KTAB 1SXJC 3MGCA 4M9XA 1QDEA 5IRCD 4O3MA 3EX7C 3ZD7A 3BK7A 4PPQA 4YMUA 1ZD8A 2FNAA 1E4VA 2W2XA 4P4SB 3PG5A 4PSAA 4RKEA 4AYXA 3TSOA 5J40A 4D25A 3OHMA 1GVNB 2WWIA 3FWYA 3LO5A 4UKDA 1ZUNB 5EXSA 1LNZA 4DLUA 1KK1A 1E2GA 2ZI5A 2ERYA 2VTKA 1A1VA 1SKYB 2X1VA 5DN6A 4NPHA 5J4YA 5FUYA 4YXWA 4DLXA 5FFMA 2FX3A 4ZKDA 1JEDA 2FF7A 2AXPA 3GCGA 3K09A 1E9CA 4M1SA 1EK0A 1JR3D 2F43B 5EXXA 2DR3A 2HF8A 4JLKA 1LF5A 1NVXQ 1ZD1A 5FOVA 5JSZB 5AJVB 4NCIA 2WBLC 2WSMA 3IIMA 5FPSA 1GKYA 3PV0A 1VCOA 4OJKA 4EKDA 4YXWD 1RW4A 4MDEA 5FL7D 4ACBA 1ZAKA 4H1UA 4F4CA 2J9RA 2A5YB 1NBME 2ONKA 3C7KA 5EE3A 4A0GA 1J7KA 1H8ED 1KY2A 4A8JA 3K0EA 4GL2A 5DE3A 1VCNA 1DAFA 5BYJA 1ZUHA 5CYOA 4Q7MB 1BS1A 1SVSA 4HLCA 1AIPA 1QRAA 3W6OA 1NN0A 3ASZA 3D7MA 4RD1A 5FI0B 4OHZA 2RCNA 1TQ2A 3ADCA 3LQRA 3A36A 1NVWQ 4NZYA 4M1YA 4JLPA 3W5IA 3VR1A 4B43A 1UAAA 3CX7A 2GVZC 2WOOA 3X1ZA 3I8XA 4LYJA 4Q4AB 1WCV1 3AVQA 4OI0A 1F6BA 1UJ2A 2GBLC 2OO7A 3QF4B 3IBYA 5SZIA 5CLQA 2HCBA 3A1SA 1PLKA 3AP3A 4TWZA 1I2DA 1MRNA 4HYYA 1X8KA 1D2MA 2YV5A 5TARA 4BFYA 1NKTA 5J4LA 2IYTA 5CM9C 1XMSA 1IN8A 2CDNA 3ZQJA 2JLZA 4FD2A 3KJGA 3KKMA 3QSYA 2F1IA 1RVDA 1G1MA 1XTSA 4LUCA 3ZVNA 4CGZA 3NTUA 4D2IA 2C2HA 1VTKA 4V0LA 1DG3A 1X86B 2IWRA 5A4JA 1IM2A 1HH4A 4AYTA 1EFHA 3ZVRA 1E79D 4C0KA 3AKEA 5L3QA 3CIOA 4XVUA 3GFTA 2OILA 1OXVA 3Q72A 2GZAA 4DWJA 2IHYA 3FHCB 1E2FA 1YE8A 2ZE7A 3UIEA 3QUSA 1JAIA 2R44A 2QMEA 2ODNA 2IEZA 2I1VB 2NO6A 2WV9A 3CZQA 5E7IA 1X1RA 1LS1A 4E09A 1KI3A 1G3QA 2J3EA 1F2TA 4FWIB 4PSKA 4PPNA 3RYTC 1OF1A 2GAOA 3GJ0A 4RFSB 3TBKA 4EFNA 4EQ6A 1NNEA 2X8AA 4XSGA 1Z2AA 1U94A 3L0PA 3F3YA 1I4LD 1Q1EA 4OQFA 4CEIB 2ZRGA 5B30A 2A3RA 2GXQA 4WVFA 3NXSA 5F9HA 1G19A 2XJ9A 2FG5A 3QE0A 1U99A 2V6JA 3JVVA 1Q44A 3LAWA 1G5PA 3RSOA 4R2HA 1TF7A 2GCOA 4DEXA 2RH5A 4W9MC 1LV7A 4XVQA 3EASA 2VP0A 3A37A 5AJYA 3JZMA 2ERXA 5JEDA 1W1WA 3AP2A 1WA5A 3PUVA 4JJKA 4BFSA 4DCSA 4CEHB 3REFA 4L5BA 5JBQA 4W5HA 3SBDA 1L4YA 4L4UA 1W0JA 2FSFA 1W7AA 2DCUA 1XXHB 2ZSFA 1CEEA 3C16C 2GCPA 1N6LA 1ESNA 1X3SA 5J47A 4A36A 3CRMA 1ZJ6A 3N5CA 2ZUBA 1M6NA 1ANKA 1IXZA 1IXSB 4U5XA 5EP4A 4WA7A 5EP3A 2UVQA 2R65A 1GP2A 2GETA 3H84A 3QBTA 1O87A 4RKFA 2ZSBA 4YMVA 4P3YA 1E4YA 3WMEA 2R6GA 4QXAA 5KPDA 1HYQA 2ZE5A 3U60B 2DFLA 4I1UA 5GADl 1W0KA 2VYFA 1Z83A 5FR2A 4BFZA 1AKYA 4US2R 2A78A 4R7ZA 5CB6A 4GOKA 2VHQA 2IK8A 2JGNA 4AG5A 1E9BA 1F48A 2GBLA 4L15A 5JSZA 3TE6A 4DHEA 2F9MA 1AGPA 1L2TA 2AR7A 3U61B 3K09C 4GI7A 4M4SA 2JDIA 2H17A 2VEDA 3RNLA 1R0XA 3FOZA 2QMHA 2DBYA 2NPFA 3W90A 3CNLA 1NN5A 3EA0A 4F38A 2XNDA 2IYWA 1G3IA 2NGRA 1OH8A 421PA 5HR5A 4KSBA 1HUQA 4B75A 2YNMA 3CNNA 1QVAA 1V5WA 4KXFB 2HXSA 1KTVA 1KI8A 5HZHA 2ZAMA 1XD2B 4LPSA 4OHYA 1YZTA 2F1JA 4DT1A 2FPMA 1E79A 2HV8A 3EA5A 3CW2A 2BCJQ 1FQKA 4B2LA 2AK3A 2N42A 3O47A 3GJ4A 5GVRA 3CO5A 2GZDA 4Q1CA 2PEZA 4FW9A 2GK6A 2PCJA 2WZQA 1QF9A 3BH7A 3LLMA 5FBRB 4IFBA 1VCMA 1F2TB 4N3NA 2P2LA 1DAGA 3FVQA 1F2UA 1N0WA 2VA8A 1M34E 4JVMA 4O25A 3UWKA 3WNDA 3WRYC 3OIVA 1R8SA 4Q4JB 1KZ7B 3EZ7A 1E98A 4EPXA 1JR3E 4OYHA 1WXQA 1MT0A 4TT3A 2W0SA 2ZS9A 1QHYA 4ZDWA 3TRFA 3DO6A 2GVDC 4YMTA 1OPXA 1DO2A 2V3CC 2XZOA 3WBKA 4KVAA 3M6AA 2UKDA 2ZRDA 3TKLA 3Q5DA 3GLIE 1T5IA 4G5GA 1XTRA 3KTAA 2V55B 4TL7A 4UJ3A 2ZRLA 4GBMA 3MG9A 2X77A 3SDZA 2OBMA 3BIFA 2HUPA 3TK1A 2QGNA 2OFWA 5HE9A 3L43A 4TQ9A 2VP5A 4BLQA 2JATA 2MSCB 3ETLA 1G5RA 4HATA 3AVOA 2CCJA 2GRJA 4LOAA 3GLGB 1P9RA 2VQSA 4MKGA 2X2EA 4TQUS 3TR0A 1YVDA 3Q9LA 3BRWD 4DSOA 1KJZA 1KO5A 2AX4A 1T91A 2ORIA 4C2TA 4YONB 3EPJA 4LJ8A 1G7RA 1PZNA 5FH9A 4LBWA 1ZRHA 1GRRA 3RRNA 4LDJA 3GLGA 2ZRMA 1KK2A 1M7BA 3MAAC 1UEJA 3W8RA 3P27A 4Q7KA 2MSEB 3I61A 5LB4A 4ZDJA 2QRNA 3QKRA 1U0LA 3H0KA 2JDID 4WZBE 3KJEA 1CTQA 1A2BA 1J70A 1XEXB 1MKYA 2DFKB 4P33A 5H70A 3ZVLA 3AKCA 1VECA 3L0IB 3WHLA 4AWXA 1XCMA 3LQQA 4BECA 2DPXA 1E0JA 1OHHA 4M1TA 3CX6A 4B48A 1G8FA 4UNSA 1FQJA 2QRZA 5K8IA 1NMXA 1T3LA 1W5SA 2RB4A 1II0A 1SXJD 4QC2A 5FOTA 4EPWA 4M53A 4PPFA 3QG5A 1M1YE 1NLFA 3GLFA 3DMDA 3LXXA 1P9NA 2O8BB 3VAAA 3LDAA 1YR8A 3SJAA 1NIPA 1KK3A 3B78A 1J8YF 1XU4A 4ZIRB 1SHKA 3A1WA 4PO8A 3EZ6A 4IOLA 4PC3A 1AS2A 1IY2A 4LZZA 2PMKA 3AV0B 3CF6R 2HXYA 5A5GA 2W58A 3BFKA 1FP6A 1R4AA 1G5TA 3TUJC 2QMUA 2J0UA 4GPTA 1E2KA 2YVUA 3TVTA 4EFLA 1AGRA 3N2IA 1SVOA 1QVRA 3W9YA 3LW7A 5B64A 1OKKA 1K8RA 2FEOA 1KSGA 2BKEA 2RGXA 4Q00A 2ORWA 4OK3A 1QHHB 5EUMA 3DL0A 2D3WA 1XRJA 2FZ4A 5DYIA 2BM1A 2YC4C 4GSYA 5FUWA 4OQMA 3LD9A 1NI3A 2ECKA 4ACAA 1DARA 4AD8A 4WW0A 2EWWA 4JT2A 3PUYA 4XOIA 4TYYA 4G5OA 4UQOA 5FPHA 3VTKA 2VPPA 4OJQA 5HPYB 2Z5FA 3W5JA 1BMFA 4GOXA 3GLIB 4O2RA 2IYSA 3TNFA 4BLRA 5TB5A 2RGDA 1Q1QA 3NC1C 4I81A 1NKSA 4JL5A 2PJZA 2RGEA 5AJXA 3VR6A 4R71A 3A1TA 3L0OA 2P3SA 1TF5A 4WZAE 3K8YA 1G6OA 3ZJYA 4PAOA 2H16A 4BZPA 4TL8A 4URZR 1R2QA 5FOUA 2OSBA 1KI4A 2G0NA 2NO0A 3HDTA 4GRAA 1OH6A 2EYQA 2GILA 3OEHA 1OFHA 1KYIA 5B2ZA 1KMHA 2YHSA 3PEYA 1W36B 2OCAA 2AWNA 3SNHA 2O0JA 2IS2A 1YZUA 5EE1A 1E9SA 4UNNA 1C9KA 3ND8A 5F3WB 5HTKA 1RJ9A 2ZROA 1WE2A 2V4ZA 2YOFA 5KDLA 5DNYB 2IUUA 2VLIA 2WJJA 3VR2A 1OJLA 3ADKA 4LJ7A 4CEHA 2J0QA 5EP1A 1Z0FA 4ARZB 2F43A 3Q3JB 4TTQA 3ADDA 3LVQE 1AN0A 5SZKB 1NY5A 3LY5A 2ORVA 1G64A 3A8TA 5IK2A 2PZEA 4Q9HA 1HQCA 1Y63A 1R0YA 4NYMQ 5FBLB 1AQUA 4QOSA 4KYIB 3MCAA 5G53C 4BFUA 3W8NA 2AD1A 4M2LA 5LD2C 3MWYW 5GJWC 4HAYA 2PZGA 4XTCS 2BKUA 4LV6A 3TW4A 5B58C 4Q47A 2PLFA 3U44B 1ZIPA 2F1HA 2IF0A 2JLXA 4DLVA 3PIRA 2CE2X 1KI7A 1W2HA 1Z47A 1N6HA 3QENA 5B57C 4KBFA 3W3ZB 1G4UR 2XOKA 1RRCA 5DISB 4PPGA 1OV4A 3I4LA 2CK3A 4DSUA 4IEIA 3CPEA 4DCTA 4NCNA 3JVUA 5TY0A 4B44A 1P3JA 4C0HA 1Y3AA 2WVJA 4U7DA 3AQ4A 1Z6GA 1US8B 1GG2A 4D4MA 3OE7A 1HTWA 2QL6A 4LYHA 3ZS9A 3BB1A 5JCZA 4TMZA 3H4MA 2NIPA 1CJMA 3BB3A 2GJKA 2W2TA 4BPBA 1E6CA 4FCWA 4UNQA 1U98A 4NP6A 1KOFA 4LBYA 1U0HC 1UBFA 4R9UC 2V1XA 4DJTA 2DWQA 3RSLA 3S1AB 4DT1B 4Z1MD 3SS8A 3BGWA 1RPZA 2YC2C 3MFYA 3NHAA 3THYB 2P0EA 4NCJA 4W5WA 4BGDA 1CJKC 3KB1A 4I1SA 1TX4B 1TQ4A 3WYGA 3VHXA 2OXRA 4GP7A 1WDTA 1HEIA 4B33A 2YWGA 4LYAA 4RD0A 3SJBA 4CRWB 4JVNA 4C7OB 2OFOA 2CHQA 3QNUA 2ZRBA 4Z1MA 3RRMA 4ILEA 4US1R 4KO8A 3CNOA 3THYA 3QKTA 4TYWA 2GEUA 4F93B 3CZPA 3AKDA 4Q4AA 1AS0A 3T15A 1EFRD 1J2JA 3ZDQA 4D0NA 2FGKA 2ZRJA 1NLZA 4NYIQ 1E2EA 4OK6A 3GJ6A 4Q4HA 4RCYA 1LS6A 1YQTA 3IDQA 2C9CA 1VG9B 4HZUA 5HZKA 4CZ2A 4Q48A 2OZEA 4PTLA 3GEHA 3BORA 1ELOA 3GJXC 2Q3HA 2BBSA 3OIYA 2RHMA 4JBWA 5EP2A 4MITA 5JHGB 4TQAA 4EQ6B 1GKIA 4DLRA 2QTHA 2CHGA 4G5SA 3CWZA 1S9HA 1VHTA 3BE4A 4G3XA 4TMVA 1XPOA 4ZV4A 2QAGA 4E5UA 4OI1A 3LBNA 1GNQA 4FMDF 4RZXA 3VR5A 4EJSC 2IXEA 2V9PA 3SI7A 4RD6A 2PH1A 1LF0A 2RGCA 2VL7A 1NJFA 3GLIA 2V7QA 1EWRA 2VO1A 1T8UA 3U2QA 2A5FA 4ARZA 1CR4A 2OLKA 2NTYC 4CF7A 5LDDC 1YZKA 1NLYA 4TLDA 2VH5R 1KJWA 1S3SA 1W0JD 4NCKA 2OCPA 3BD9A 2ZR0A 3A58B 2GEDA 1AQYA 3CRW1 1MRSA 4OKSA 3B82A 1EFTA 2VP4A 4G5RA 3FYHA 4HAWA 2JLYA 1VIAA 2V6IA 4PFSA 1DTSA 2QN6A 3P1JA 3HJNA 1KDTA 1NMYA 3OF5A 3OEED 4Q5IA 5AJZA 1IY0A 2WOJA 4B74A 2ZRCA 5FTLA 4HUTA 1E0SA 4A0FA 4HB2A 2CVFA 5BW8A 1IN4A 3BWDD 2IWHA 4TLEA 3ZH9B 3TVDA 2ZSAA 1UKVY 1Z5ZA 3QEOA 2HJVA 4I99A 4KFRA 4LC0A 4ZCLA 1VG0B 4QGAA 1R5OA 2W6IA 4QBHA 1E94E 4XWKA 3QKUA
chains in the Genus database with same CATH superfamily
3EXG1 3GZTB 3OKPA 4URXR 4WZ6A 1IBSA 2AFVA 3UH0A 4CFSA 3PDUA 2LW7A 1RPAA 3BWBA 3BXPA 3PR3A 1R10A 4WBXC 1XZFA 2P9CA 2Y2UA 2C1EA 2Z43A 3AOGA 3LHKA 1JLHA 3HY4A 5FUQA 4RULA 3UA3A 5LQKA 2X0IA 1OFIA 3MOGA 2R8ZA 3TNLA 2ORED 4N54A 3UJ8A 1DTWA 4JMPA 4Z5XA 1N5OX 2JFXA 3BDAA 5EMMA 4FW8A 2H1VA 3DOOA 2PZAA 4KUHA 3T5BA 1K6MA 2HD4A 1CPYA 2QAGC 4HS4A 2P40A 2JJ8A 1B7GO 4P58A 3HR8A 4F2HA 5DWVA 3UPDA 1U6IA 4O5AA 4IHJF 3V97A 4C01A 3SC2B 4EHKA 4DY6A 1CUUA 3TSAA 4KHPB 3QBDA 4P7KA 4KQMA 3V1MA 4RZIA 4WD3A 4GBED 2W6NA 1BXZA 4QUBA 5ICGA 4A4DA 1QQ6A 1K8XB 2GEVA 3RKSA 1LDEA 2J09A 3SP1A 2R3SA 1TZ2A 5KQLA 2HU7A 2O6LA 1QAOA 1WKBA 2A5JA 3DE4X 4P54A 1DXOA 1EM8A 2FQQA 2W6JD 2B8NA 4D46A 1FTSA 4LDQA 3UOWA 4DARA 1JB1A 2HBYA 3P9CA 3IAUA 3CB4A 1AB6A 2FSSA 3OE5A 1JVBA 3ZTWA 1G41A 4OXRA 4Z3KA 3PRKE 5JXJA 2BFFB 4CMEC 3PYMA 2BJVA 2A86A 4HDAA 4XGQA 1A5ZA 3NH6A 3UMJA 5DX0A 3EC1A 3SYMA 5CBPA 5JNLA 4DE5A 4LKRA 1FUUA 3JQ9C 4LGMA 1E9DA 5JO9A 1ZCFA 2W98A 2AEFA 5AW7A 4HBGA 2VNJA 4G65A 4F06A 4R8MA 4AMYA 3IEKA 1D2GA 3IKLA 2WWYA 3KPJA 4U2CA 3R3VA 1IHUA 1NP6A 3I12A 4FMDB 1VCHA 2G88A 3ZW7A 4HSEA 2KMLA 1OTHA 4RDCA 4EKYA 1TRHA 4JJ7A 3Q0IA 2H5LA 4UDOA 2BFOA 2P2GA 2O8FA 1J20A 5FBHA 2P0YA 3ET5A 1BE1A 4NDZA 5JJ5A 1GXSB 4PG6A 1TO2E 1N7HA 2OZKA 1R4NA 3UFXB 1E1QD 1FFGA 4N40A 2AOTB 3P26A 5F77A 1KNXA 2ASVA 4FBGA 5GV8A 3KFVA 1GUBA 1Z2OX 3W4JA 3U7JA 3BCSA 5B7QA 3MGGA 4URUR 1GTRA 4HDRB 1ZK3A 2BBWA 5LN1A 1A4IA 3FPSA 1SEVA 3BIXA 5EZ5A 1I01A 3QFTA 4CTKA 3ZWCA 2W43A 5BV2P 4ESEA 2PRSA 2L82A 4N8EA 5I7RA 1RACA 2L19A 2I8AA 4G8DA 4N0PA 5B7PA 1HNZB 2HL6A 2YWFA 1J56A 3HA3A 4ZDJA 3GT0A 4LNAA 1L4UA 2AFHE 1EUDB 3FUXA 5F21A 1N6RA 4DMUB 3NVAA 3FKQA 3KT3A 3F4KA 3U7EB 1OB2A 4CODB 1F4VA 5LBUA 1K8ZB 3OZEA 4F6RB 3KL4A 4IQ4A 3ZNQA 5B1YA 3NPMA 3WHKA 1SBHA 1T5OA 3WQHA 4BNNA 4MYSA 5H81A 1ZS9A 5JSHA 4J0JA 2NO7A 2GZMA 2Q62A 2J87A 1WBJB 4IM7A 3EFHA 4B84A 3VX3A 2PUEA 3NWOA 1XA0A 3MQ4A 3D8UA 3ZW9A 2R0QC 3FWNA 3PBKA 4J91A 2QF7A 3DEZA 2IU0A 2XB2A 6CHYA 5JWRA 3IUEA 4B3DA 2NO5A 3K32A 3P96A 4UMDA 3WIOA 2ANBA 2P5TB 4JLDA 4QYIA 3PHCA 4DA6A 3O2NA 4LRTB 3X1DA 4PLGA 1OXTA 4NE7A 5HBRA 4GXNA 2DKFA 3QEAZ 3HGQA 2CBGA 3L1UA 3NANA 4FCVA 1A7JA 4KQGA 2R5FA 1JDBC 4B0PA 2FLWA 3B2EA 3IMKA 4KACA 3KELA 4TUYB 1BYIA 4QO7A 3IDZA 5LOVB 4LMAA 1C3JA 2YYYA 3ONVA 2YZ2A 1LSUA 4YS6A 1RLOA 3C14C 3OWHA 3G1WA 3LUJA 2Z1NA 3G3EA 3IUBA 3I9FA 2HW8A 4DR5B 3ASVA 4HRVA 4E2WA 1VMEA 2SNIE 1XTZA 3AEXA 3NHSA 1VE1A 2R7AA 3TQOA 1M1NA 1LXCA 2AYXA 3EMBA 1TVMA 1DAMA 4CUJA 5KTPA 5T4HA 2IS4A 3R6LA 2ARKA 3PWKA 1X42A 3DTYA 1MNAA 3SLKA 5KHOC 3KYCB 2BZGA 4F04A 5EN4A 1EVYA 4HWGA 2QTMA 2B4KA 4IOMA 1AZTA 2WNHA 4LRQA 2VJMB 4PANA 4MW9A 4DDWA 4YYZA 1Q6YA 1DBQA 4JYAB 3M6IA 3CG4A 4HP8A 3LQ4A 4MA4A 2J8ZA 1ZGBA 3I64A 3QPUA 4BJ1A 2VT2A 1EUYA 1A9RA 4KR2A 4KMOA 5EE0A 1I13A 3AF0A 1SUFA 5HHTA 4G07A 3QVOA 2GPBA 1AY0A 3DNMA 2I2FA 3LPMA 3DZCA 3DZFA 2NO1A 1UDBA 3GYGA 2V45A 3QI7A 6PFKA 4PCUA 5JW6A 4IH1A 3NDBB 1ZU5A 4JI8B 3NP9A 3NASA 1MO6A 5I47A 2ZBQA 4ABTA 4UATA 1DT3A 1E8NA 2E21A 1MCZA 3RUPA 3L07A 5AT1A 1QFJA 1X70A 4CYMA 2AG5A 1BZYA 1T0IA 3G17A 3C5CA 3GN2A 1XCLA 2NU8B 2MR6A 1OWLA 3ZY4A 5TMPA 3EOAI 3IHWA 1COWD 1KJYA 4IDBA 3R0JA 3BMNB 4I50B 4YRTA 4E2ZA 2CLKB 4H17A 1VB3A 3S3TA 1C50A 2G1JA 4RTPA 2OP0A 2WICA 2DG2A 4ER6A 4F92B 5DGXA 1P7CA 3ZGXA 4BAZA 4D8VA 4BNGA 3ANYB 2IYPA 2CLLB 3SYNA 3WVNA 3TMKA 4MPPA 4ME6A 5TRTA 1LCIA 3GCZA 4G9GA 1FP1D 1GUYA 1GR0A 4FYJA 4YDQA 1SC1A 2YINC 4L4SA 5CA0A 3CVYA 3UJ6A 1CLUA 2NYUA 3PS9A 1ILWA 1AV7A 2Z08A 1DC3A 3P4YA 3D7KA 4RKYA 5BQXA 1AV6A 4A8TA 3EOBI 3R7NA 4CLEA 4DR7B 1YQ9A 2HTFA 4RK6A 3W5DA 2OGWA 3GZNA 3PKJA 5JQGF 1JJBA 3I5XA 2XAAA 2WFLB 3Q10A 3WHPA 1D1SA 3HCFA 2PS1A 3KOXA 1CDOA 1VI2A 2E0IA 2C2MA 5EMLA 2WAYA 3KU4A 4P7GA 2JHCA 3THXB 4CIBA 1JFRA 2LPMA 1Q17A 3WWDA 3OQNA 4EMSA 1H6DA 4Y2GA 1RFLA 3PXAA 1QU2A 1MW9X 1VBKA 2PVCA 2YJGA 1NP3A 2E4VA 2GZ1A 2XZDA 1NG9A 4FS3A 4M86A 1RM0A 3HU3A 1Z8DA 1N2JA 2GARA 2PM8A 4PLHA 5AHOA 3ROFA 4WY2A 5JDCC 2W4IA 1ZESA 3JWPA 1MFZA 4MQUA 1XPUA 2QSYA 4HVCA 3I2KA 5EOVA 3PDWA 1L0BA 4IDGA 1IONA 3T4EA 3KZMA 4TX1A 3SSMA 3S5UA 2QVZX 3HLYA 2BAGA 2LR0A 1BE8A 1KL7A 1THZA 1S7CA 3WDMA 1XLTA 2CYAA 2G09A 1XFDA 2WK1A 1CUGA 4UUBA 5BW6B 3ZD9A 5LQNA 3HZRA 4W5JA 3U9LA 2PRZA 4Q18A 1FX1A 4RADA 3ETCA 3D8RA 2V6GA 4AJLA 1H42A 5LQUA 3A3YA 4JGBA 1IXKA 1O3YA 1I10A 1P5JA 1Q15A 1XJ0A 1XNJA 2A57A 2HCJB 2R00A 2LTAA 2OG2A 3I4FA 3UWPA 4BQQA 1XXHA 3IT3A 4B71A 4MV9A 2GA9A 1P18A 3C97A 3QWAA 4OAOA 4P36A 4PZAA 2OB2A 2J59A 1K6EA 1U04A 4DQLA 4QKQA 2GPAA 1JPJA 2HLPA 2HPVA 1RKQA 2DJIA 4O2BF 4JXJA 2JIZD 2NUBA 3AW8A 3C98A 3WWPA 3O8BA 3BMOA 5K8CA 2IA5A 4A27A 3AF3A 3NAGA 4DRYA 2O0HA 2AW3A 2HMAA 4JUAA 1MGPA 4WDQA 4XB6B 4HLUA 3K0CA 1R0SA 1LJUA 2JLUA 4Q1EA 4JZKA 1J1UA 2C4MA 1AM4D 3PHGA 2BRUA 1R6VA 2ZJZA 2ZTHA 3HDHA 3HKCB 3VJMA 2SKDA 3N87A 4DSNA 2FRDA 5HDBB 3HBMA 4HDKB 3K2BA 3WB0A 4ZJUA 5HUJA 5JFGA 1TA9A 4DJEC 4C4SA 3SQLA 2CBZA 2RI6A 2VTBB 2FGJA 1P19A 3AFOA 5CT6A 2O52A 2Q5QA 1G7TA 1PL6A 1M2JA 1V4NA 3AOEC 4KPUB 3VOTA 3W7VA 1G9XA 4X9XA 1R0CA 4I2VA 4M55A 3CRZA 2X6QA 3RSSA 3GP8A 2CV1A 3HEMA 1JZSA 3C48A 1L5KA 5LLTA 2HCRA 2IHTA 5LL6P 1KK0A 4NV0A 1HDRA 1RHKA 4FSDA 4IOJA 4LAFA 5IC5A 4F45A 3CZAA 1XE3A 2QYTA 1KYQA 5FUBA 4MV3A 5CA1A 1NUQA 2HWKA 2I3DA 1NJGA 3M3HA 2WWXA 2DT5A 2YY5A 3G2PA 4E4RA 1YU9A 3QF4A 4MGYR 4UDXX 3ZHTA 5M34A 4K81B 3Q7EA 4CF6A 3KOUA 2QY9A 4PYOA 1W4ZA 1IG3A 4RD4A 3AVVA 3JARA 3WB1A 2KWIA 1SAYA 1T26A 2GEBA 2R8XA 3EIUA 4GPEA 5GJCA 3V1KA 2QX8A 4Y9SA 5D3KA 4EZIA 4PGAA 3E4CA 3VU8A 5HS4A 4O4LB 1WBDA 3DLBA 1F8FA 3QVMA 4MUJA 4MDFA 1IPEA 2PGIA 4B3IA 3X1WA 1GCIA 2Z2KA 4INZA 2NZ2A 5IUKC 5CFPA 2DAPA 1WPQA 2RGYA 4B73A 3GLHE 2F8TA 5L7WA 3PICA 3LRPA 2WF6A 2PLRA 4NS4A 1J9ZA 1NMSA 1C30B 1MU0A 4WKNA 2Y3IA 5LQJA 3M4XA 3TLXA 3DEYX 4NDAA 4HZIA 3BXXA 1IUNA 1WHTB 3J7AC 5IEJA 2DE0X 1CJVC 4Y98A 1KIMA 2O06A 3JPWA 1T4CA 5JWHA 3UJAA 4D4KA 4GO1A 3RIYA 3VPFA 1MC8A 4QBTA 4KLNA 4R0NA 1QM5A 3E8XA 4RY0A 3EPRA 2GKSA 4OOFA 5G41A 5CFQA 2AN1A 4D5GA 4YACA 2C4KA 5CFZA 1RWKA 5J4HA 3FE2A 1PT9A 2JJQA 4E12A 3NEYA 3TLAA 4S1PA 5L45A 3NVKI 1RP1A 1FX0A 1I2MA 1UL1X 3QEBZ 3ZXUB 4DS3A 5EJ8A 2P3LA 2E6KA 2I7VA 3OTQA 3BGOS 3F6EX 1E0KA 1NI4B 3MJHA 4DJAA 2DYKA 2J3HA 4JB8A 3Q98A 1VGQA 4JBXA 5AOCA 5FNVF 1DVRA 3UMBA 1KQ3A 1CJUC 1DT5A 2JFVA 1WCWA 1UQTA 3D7NA 1AG9A 3B5EA 5F5NA 5DDIP 3BGSA 3UMYA 5HKLA 2P79A 5K8LA 2NVWA 3ICVA 5I9MA 1GG8A 1ZIDA 4NESA 4QULA 2QR3A 2J0SA 3GLHA 4NYJQ 4BQFA 4GLJA 4B82A 2NG1A 1QGYA 4N65A 4ZEMA 4MS4A 5LVAA 1O5OA 4G1UC 1ZYUA 2FUNB 4OB8A 4TYPA 4S1VA 3S68A 4TTVA 3ROKA 3SG0A 1QLHA 3CW8X 2PUDA 4Y2RA 5TVKA 1SUEA 2CBXA 4C4TA 4GHWA 2D7JA 2DCMA 4LBZA 2QX7A 4MVJM 4MK4A 2PR2A 1W4CA 4BY9E 2BKXA 2HYDA 3S2SA 3QVSA 3EUEA 1I4EB 3ZTTA 1OXUA 4GYJA 3DBRA 4J03A 1ZZGA 4FQ5A 4Z54A 2DHDA 2CXQA 1II9A 1J1ZA 4NICA 1P5FA 2IXDA 3TPCA 2VIIA 4B87A 3BRWA 4JBLA 4IJ6A 3UA4A 2D5CA 4CMGA 1UWVA 1XGKA 2VDWA 4NC9A 4PVDA 3B3AA 3DMNA 4NULA 4W82A 5KCMA 2YMMA 1D3AA 1FRQA 1K5PA 2B2XA 2XYHA 4MWTA 5AI6A 4CG1A 4D56A 3PXCX 4KGXA 4YI3A 4TMYA 3TXYA 4L8GA 5KNBA 4HDSA 2ZB4A 1B6TA 4PX5A 2GK7A 2V0NA 3O9ZA 5F4ZA 4GGOA 5HX7A 5KJ6A 1CNMA 2NTNA 2V58A 4V0NA 3FDIA 5DWQA 1HG1A 2OXEA 3SLGA 2G9ZA 2R6CA 4LWPA 1WD5A 3DSRA 4KUEA 4II3A 4BP8A 3OAAA 2JL1A 4XJSA 2I4IA 2PTHA 1GAWA 1J07A 1RXYA 2R8YA 3GJ3A 5MN5A 4WY5A 2WTAA 5MFZA 2Q0QA 5J4VA 1XQ9A 2WC1A 5C81A 3K6SB 3EEOA 3JD1A 1HL7A 2P2CA 3NWPA 2O7SA 4GMXA 3CUVA 4I19A 3I2YX 4QAQA 5LWQA 3CLTD 4YB8A 4OHWA 3ZZUA 2Y1DA 221PA 4CIXA 3F96A 5KNCA 4HRYA 4BO0A 2A1TS 4JBHA 3EWSA 2VK4A 1P5ZB 1GU0A 2L18A 3NHLA 4LV5B 4CL2A 2HFKA 3HNOA 4J3NA 1IFXA 4LXQA 2DFPA 3GN1A 1CETA 2A4KA 4YP9A 10MHA 1VHJA 3WLFA 2WIBA 2XY4A 1RBMA 3OP4A 3G0GA 2JFUA 3FNBA 3O92A 4JYMA 2WG1A 2B21A 4MV4A 4L4XA 4DA0A 2GN6A 1A9XA 1N1DA 4MQBA 4ZRMA 5BUSA 3B1ZA 1CERA 1AKQA 3TCKA 5T6MA 4IL5A 3D8SA 2Q0XA 4ZC8A 2G72A 5B3JA 1B8NA 4RTLA 1DMSA 3KKNA 1T5LA 5CXXA 3ZK9A 5A5FA 5REQA 5FLEX 4J94A 1QVZA 3VMFA 3TNDA 3UW3A 5G1PA 4H0NA 2GXAA 3THWA 2IH5A 3AR9A 3W6UA 1U0FA 5HF6A 1CUCA 1VL8A 2WMNB 4V3CA 3T6KA 1IOWA 1HKHA 1JH9A 4AC9A 5GQSA 1YS4A 4ARVA 5HBGA 4Q4HB 1SXIA 3HP4A 8ADHA 5FFNA 1HY3A 4IRUB 4EJ2A 1LQ2A 3ZWWA 4NCBA 4R05A 3GRZA 3MTDA 1YHZA 4TZ6A 2IHBA 4TN1A 1C9YA 1K8QA 2RGNC 3BTSA 1SULA 4JJ6A 2X7XA 1VMIA 3M9XA 4MMZB 2G76A 2O8FB 3DBVO 4HMPA 4U02A 3L3BA 1MB3A 4X84A 4JX8A 1R5BA 1X6VA 2VNHA 4DDUA 1Y81A 1O94C 4XFDA 1JR2A 1KGDA 3IAFA 4ZPXA 2CNNA 3SHWA 2PFSA 1JBKA 3G88A 1W5EA 1NT2A 2ZRNA 4MRRA 3W2HA 1P9OA 3GDGA 3IIIA 4HO1X 4OREX 5LQSA 4J4BA 4B4KA 4E3ZA 5BWOA 3KLNA 3LBIA 3W2EA 5IBCA 3PNMA 5D86A 5JFOA 1TUIA 3TW8B 2QRLA 2H2GA 4PBRA 5K0EA 1DI0A 4H4DA 3H2SA 4XWWA 2VVTA 2QWXA 3PA8A 4BMNA 5LQCA 3PU6A 3GW8A 2QVYX 3SSOA 2PUVA 4DLWA 2IZ5A 1LQTA 1HC7A 4LWOA 1JHQA 5U9CA 3MELA 9LDTA 4PXAA 1ADGA 3LHFA 3FFAA 4BJHB 1BDBA 2O3UA 3D8HA 1KQNA 3LBHA 4AO7A 1FFWA 2QD3A 2QN2A 3IVGA 5KU7A 1ZW6A 4JVLA 4HMOA 3SF8A 4ND8A 1RPTA 1AA9A 1YRWA 2Z4SA 3FCAA 1AQIA 3M6XA 3SXJA 3N2GB 3OQVA 1IU9A 1XNGA 2PGNA 2NX2A 5L4NA 3IJEB 1A50B 5E2BA 4MV5A 2DPLA 2QLJA 1VLLA 4GFDA 4G56A 3WA7A 2FUG6 2H1CA 2QTAA 5ECWA 1ZH6A 2I6TA 4G1MB 4NNPA 2OOSA 5AO9A 3KVOA 1PFVA 3PX2A 2YZGA 5DLPA 4HAXA 3ITKA 3M4YA 2PX4A 2W70A 2IZOA 2ZBPA 5AW8A 4BNDB 1EP3B 1TMOA 1XTTA 5BWNA 4NHOA 4GNKA 2OO3A 4AZ0B 2QTTA 2W2MA 3LX8A 1RD4A 5KB3A 1SIWA 4IJKA 3RS4A 1ZCBA 3T4XA 1G98A 1VRWA 2E3JA 3GRYA 3PYXA 1OFGA 2F3RA 2VHJA 1L7NA 3DTNA 3G13A 2YWCA 3LCRA 2WT9A 4Q66C 1XRSB 1CE8B 4DYHA 1HT0A 3H2YA 5KX5B 4MGKR 3TF5A 2ZSKA 3W4KA 1HYBA 2G7MC 1H1LB 1FFXB 2ZR9A 4KJXA 1Z7GA 1MJGM 1VMDA 3JQ7B 1LK7A 1YS1X 1NNI1 1L7OA 3DE5X 4M9UA 3D59A 4YWHA 4W7SA 1IVSA 1GRNA 5CDFA 1FLAA 5JVDF 1ADBA 5DCYA 3OQIB 3FPGA 1WOMA 2QZ9A 5ER9A 4XCXA 3OY2A 5BV0A 3HXLA 2AI3A 1EGHA 1U1EA 3KUUA 5FOWA 3WE7A 2X0EA 4M89A 2E5FA 2YNMD 4I55F 1UWLA 5F9MA 3ZCSA 4WZZA 2YFYA 3JASB 5IZ4A 1NW3A 2B1RA 3C41J 1X7ZA 3ZHOA 4FYIA 1Q22A 5BNWA 1ORWA 4BWYA 1NSFA 4E11A 1AF4A 1ZP6A 5CAEA 1JALA 2PLWA 1IUPA 3HTXA 2NXJA 2YH2A 5G40A 3WQSB 1C9JA 3VX4A 4IIEA 5IAEA 4DIFA 1DV2A 1M8FA 2BFBB 3N8GA 3WKDA 2YOHA 2Z3WA 4O29A 1XD2A 5GOZA 4A6XA 4LX0A 1FJHA 3LXMA 4ZVKA 4WBNB 1ZRNA 1L7AA 3DHWC 4HNAA 2E82A 2D5BA 1MOZA 4IYRA 3DKVA 3BJMA 4WWHA 3T7EA 2ZR8A 1E3DA 2C5SA 1FNSA 5HJ7A 1TAGA 1YD7A 4JL6A 3P2JA 3F5FA 3S1LA 1G7SA 2HY7A 2QRMA 5MN4A 3PCTA 1M0EA 3D54D 2A9QA 3I6YA 3KVVA 4NV3A 5NULA 4EJ0A 5FUVA 1TCVA 2ZRFA 3CH4B 2GSDA 2VH2A 3EGXA 3GL9A 4R41A 4WN3A 2VPQA 1VMAA 4C1BA 1FPMA 1KYVA 4PAMA 3S2FA 1UAGA 4Z4FA 2EDAA 2Z6VA 4F5WA 4IWNA 4C0AC 2ZQZA 2ZPUA 4JLMA 5FWYB 2PKRA 1T0PA 2Z6QA 2FFBA 4RD3A 2BHRA 4TTRA 4XAQA 3VJLA 3GFPA 1T34A 3P2IA 4G4JA 1U0GA 4IG4A 4RIEA 1VGRA 1DQRA 1FZQA 3WB9A 4JMLA 1GEGA 4J0IA 4U7FA 3BXZA 4DCPA 1DBIA 1V11A 3LY7A 1P0QA 1R0WA 3V8NA 4DBLE 3OD1A 5CCDA 5AVZA 2QJTA 2R5NA 3FRJA 1DL5A 3P45A 2HLNA 5E4FA 2WFMA 4O8CA 1L4NA 4U7PB 1NVUQ 4YAFA 1HLDA 2X76A 5DNUA 4RPKA 3STHA 1EDEA 2XQJA 3AP1A 4EG4A 3D3NA 1KIFA 1W8IA 2H2DA 4I8DA 1A2KC 1P0PA 1PNOA 4Q6WA 4L78A 5CH3A 5IHPA 1F5NA 2EIXA 2G5CA 2C94A 3TAXA 5F23A 1N2EA 4NU8X 1XPJA 1Z6TA 1XHEA 2NW6A 1ZINA 3B1VA 3PQ5A 4NK4A 1PGQA 1FVXA 2IEYA 2IOFK 2J3IA 3PP8A 3KV3O 5BXQC 1ONBA 2TMGA 3GH3A 4HTFB 2YYZA 3L8GA 3O2QB 4BLWA 2HO5A 5CU7A 4RK1A 2C99A 4R6XA 1GN9A 4WCFC 5EE5B 2NT4A 1FNNA 3LT0A 5EZ6B 5LZ7A 1ZNZA 1J0CA 1D4OA 4KPYA 1OD6A 4R98A 5TIIA 2VQDA 1TUEA 3MT9A 5IVDA 4YAGA 2CL5A 3DBRB 4GKBA 4WN9A 4TL6A 3ZBTA 5EJ4A 2WF9A 2ZJ6A 5EWJB 1GSAA 1QFSA 5I51A 1XU9A 1K3FA 4EPTA 4YCSA 2JAUA 4QU8A 3NBFA 4KWTA 5LP6B 2RHRA 1N33B 3C8UA 4AJ4A 4FMPA 1ZO8A 2V98A 2QUZA 2ZUSA 4P4SA 1E9EA 3UHOA 4C3UA 1O96A 2XUQA 1KEUA 3IXQA 2HLDD 3TNYA 1TVCA 1VKHA 5FHQA 3RVMA 1D2EA 5EQDA 4RDXA 1TFRA 4K6FA 1Q1ZA 4KQWA 2QM7A 3TQRA 2DBRA 2QEQA 2B25A 1NJ1A 4LOKA 2WJWA 1MH1A 1ZZEA 3BAZA 1IH8A 1L9KA 1OXKB 4A1FA 1UM9A 3RWOA 3E3OA 5HG0A 4FPXA 2PZLA 2XMPA 4Y67A 5K3FB 2EHJA 3RUCA 1FYDA 1CS0A 2D7DA 1DBPA 3OLYA 4XD2A 4AP5A 3KJQA 3RCBA 4GP6A 4X85A 3EPKA 4O2AF 2GCNA 1BDMA 2NO4A 3H1GA 3T7DA 4DQDA 3CXUA 1UFOA 2C9ZA 3FYUA 4IFEA 3H5LA 3UHAA 3AX6A 4KTTE 3KD3A 4RQBA 3SX2A 2IPLA 1PLJA 1F0KA 2IHVA 4G23A 4HAIA 4TLAA 4YECA 1XSEA 3NMUF 1GM5A 3BFXA 2R1TA 1ZIOA 3LXRA 4HH3C 2H92A 4QEDA 3T3DA 4QYMA 2OQRA 3VPAA 4A0RA 5KDOA 5C53B 2PE5A 4E22A 1RDFA 1EZ1A 4NNJA 4AF7A 1NBEA 4F9EA 3UOAB 1NUHA 1TOAA 3A9RA 4J9UE 5A4KA 4OU5A 4U7TB 4BVLA 4JKYA 1FFBA 3U56A 2VNAA 1M2GA 4KXWA 3EW9A 1UWKA 2WSYB 4D9NA 2XNKA 4U7JA 1QJ4A 3UJDA 4F96A 2G71A 1H0RA 1HDGO 2F67A 3FZNA 1F8XA 4JVSB 4W7IA 4AS1A 3M83A 4KDFA 5IPFA 2VHYA 1NBAA 3ZJ4A 5K6AA 4K9QA 4OIMA 1G8YA 3OFJA 1RC8A 4YMSA 1EP2B 2PGLA 3IHKA 4FFBB 3LHDA 4KFUA 1KE2A 5JSKA 2HGZA 3T12A 1HYEA 5CHYA 2D1SA 3KQNA 1ZNQO 1AKRA 4Y9DA 4V0OA 3RIHA 3BMQA 5FTWA 3I32A 2O2HA 1WVGA 5ENVA 1AHNA 5E4TA 4CT4B 5JMOA 4MB6A 3PUKA 3QLEA 3ND9A 4Y2TA 1HG0A 2C9OA 3PL5A 5DK4A 2V4UA 3QEMB 4M9ZA 3Q7QA 4FINA 1CQJA 3HR7A 3OQPA 5BSVA 5BUZA 1YUMA 2A59A 5EHIA 4Q9JA 3JWJA 1K7EB 1P17A 1NVDA 3GUZA 3LYUA 1DBVO 4MCJA 5JLAA 4ZKEA 3RNOA 3FWHA 2GOYA 2QAGB 2G06A 2ZGVA 4Q01A 4UUMA 1Z0AA 1UBUS 2VYVA 4OPMA 5KTNA 3RI3A 2ADMA 3HP7A 2PV0A 3I0ZA 4X7RA 4JI0B 2PRYA 4EX6A 5TEVA 2B0CA 3LDGA 4IJWA 3T9BA 1E6WA 1Z13A 2ZBDA 3ZCXA 5K1ZA 4CPDA 2AI2A 1TVKB 2EV9A 3TEMA 2QLNA 3QJGA 1GUDA 3P0EA 5JXIA 2ZJ0A 2OXCA 2Z0MA 1W75A 3NATA 3PSAA 4L9RA 3C6KA 5IDWA 4GRIA 3FTQA 3K3PA 2QTNA 3MF4A 4RPIA 4XYLA 4MS3B 5CX4A 3GCDA 3C70A 2R9VA 2ZYDA 1ZHOA 3GVIA 1X1AA 3E53A 2Y4NA 4L73A 4ZAWA 3GXBA 4D9KA 1YBVA 3RF7A 2FPKA 3RAJA 2QT1A 2I54A 2JCGA 1SG6A 4X71A 4E0BA 4KAXA 5BUQA 1J8QA 1QZXA 3S6JA 1B1CA 3D7SA 1SH7A 2UYYA 4BX0A 1RYMA 5DSXA 3HCRA 3QUCA 5D3QA 5HKOA 1HMPA 3GUVA 1U8AA 2HJSA 4KRGA 2OBLA 4FGJA 4KITB 2Q5JA 4ZN6A 4PZPA 4ZCMA 3DZGA 1A4UA 1I80A 5E9WA 4LE1A 3QSGA 4EB6A 3VDRA 2I7TA 1K0UA 3DAPA 4FOSA 1A8UA 2C7RA 4GWGA 2B6HA 2FN7A 1TYCA 2VYQA 3H9UA 1IN6A 3Q5EA 1JKIA 4H35A 1BNCA 4REMA 4V0SA 4D96A 1N78A 5AQEA 2V5UA 5BRAA 2FUEA 5A6SB 4BP3A 1DTEA 4CV0A 3K72B 1B6SA 3HHPA 4TLLB 1KH1A 1KYXA 3I1YA 5J3JA 5H02A 3U44A 3T34A 1G9SA 3WQRA 1UDWA 4KL8S 1EYZA 4NJEA 1U9CA 1J1IA 4L6IA 4HQNA 3WTBA 2O3RA 3WY9A 1O9GA 4EMTA 5M5BA 1SKBA 3C1UA 3KZCA 3PZBA 4L75A 3ZNOA 1PR4A 2ONCA 4XQ0A 3X1YA 2D13A 1RMQA 1TYAE 2WQZA 3OM0A 4FQ7A 2ZCJA 1KO4A 1SXJB 1KZ9A 2F64A 2XIJA 1JEEA 3M6VA 1AQLA 1MO5A 4BLVA 4DDHA 4BB6A 5C1OA 3VC3A 1XL1A 2QX9A 4LMPA 2VJMA 4FX5A 1Q77A 2FSVC 1G6KA 4PG4A 1JSCA 2JGDB 3N75A 4RK5A 1N2HA 3FTPA 4TWIA 3U7QB 5JZMA 1U2DA 3MMSA 4GPAA 4GZMA 4YAJA 4RFLA 1C1DA 1R74A 3AVTA 1K08A 3K9GA 4M0MA 4P2BA 4HKTA 2V65A 1PJCA 3MTQA 4DMHA 2FWBA 2K7ZA 4MVYA 1ULUA 3O3NB 1XLUA 2FG7C 4NZZA 4R54A 3H2ZA 5C7OO 4KAJA 2YWJA 4WFQA 1W9HA 4H16A 5JG7A 1C1DB 1QHSA 1RZ3A 1NA5A 1VPDA 3A0UA 3K96A 1B76A 3CNEA 1EQAA 3VZDA 2FOIA 3ZYZA 4EHLA 1FLVA 1U7DA 1TUBB 3OT4A 3LP5A 2QPAA 2HMVA 2OAEA 4U5QA 1N9GA 2C4UA 3VZCA 3P97A 5CIWA 3M6FA 1ZX1A 2WFAA 1V7CA 3L79A 1X9IA 2OUKA 2VP9A 3WDSA 4LHWA 4OHPA 1N9KA 2E5WA 3ZEAA 4G0VA 2IHZA 1UOEA 5AMXA 1BS2A 3RYFA 2Q3FA 3OPYI 3QHPA 2QI9C 3TLGA 1JIKA 2MU1A 2YNMC 2RHLA 3IKVA 1CRLA 2HF9A 3DP7A 4W1RA 1KA9H 1NR1A 2B37A 3DBHB 1VOTA 3DYIA 5FAXA 4Q4CA 1OB5A 2OV1A 3FPKA 1IVYA 1VXOA 4ALMA 3IIJA 2GJAA 3DOIA 4Y9RA 5DGHA 1SU4A 4BVKA 4RL6A 5C1PA 1G8PA 1ZOPA 3PC3A 3ZNPA 2JBAB 2QUHA 3ORFA 4H77A 1QK5A 3IFSA 3UWMA 3IBFA 4M7RA 1JYFA 2YMLA 1G7CA 4UMVA 2H5EA 3GZJA 4U00A 5E3HA 3T4PA 3T99A 2WF8A 5FQOA 1FQWA 3ZH2A 2NQTA 4JHXA 2OE2A 1QRUA 2JK1A 4XRRA 3QHQA 5P8WA 1INLA 1C1YA 3PD7A 4IVQA 4RGVA 4J0DA 4RK0A 3BIWA 3MWKA 3OURA 4EI2A 4GGPA 3G02A 4PC1A 5B6JA 4D3SA 4PLFA 4CEIA 3M6LA 2SHKA 2X2OA 3CH6A 3K5HA 4MXDA 4CCSA 2XHZA 1W4BA 4IFTA 3UWSA 4BFCA 2Q0SA 3PXGA 5LDHA 1P1FA 3T1QA 1PVOA 5ALXA 1LA2A 1SC4A 2PKQO 3B9QA 1QO9A 3DXXA 3FCYA 3PSHA 4OHMA 3VKHA 1YB4A 2AYYA 1GTG1 1ZISA 2FH5B 4RTNA 1XX6A 1G8MA 1YDFA 2WYOA 3UT6A 2DFTA 3KZVA 2ODQA 1RBZA 2WP0A 1OI3A 2JLQA 5CEJA 5FV7A 3R74A 3UW1A 3EULA 1E7MA 4E3WA 2EAUA 3QU4A 5AR1A 3ANLA 2R87A 3FOCA 1L5HB 1JMKC 2Q3CA 5EQFA 1N4AA 3CUWA 1USIA 3BMCA 2F1KA 1OY1A 1QFXA 1P2GA 1PX0A 2IYNA 2J5XA 3PQDA 4P80A 3I4CA 1JEJA 5ECGC 1AZSC 2Y27A 3QUQA 3R20A 3WIVA 4LKOA 3EXHB 1WKCA 1QQ5A 1ZJJA 3MGKA 4MR8B 5BQ5A 1X80A 4EDFA 4RIGA 2PWYA 1DDGA 4I4IA 1XWIA 2G3YA 3OKFA 1CFZA 2W90A 3QV1A 4MV1A 4UTNA 1MA3A 2ZU0C 3B48A 2R1VB 2J3MA 1XQWA 4OP3A 3F73A 2WM3A 1Z39A 3P5SA 1HTBA 2PBZA 5FIUA 1H0SA 1TO1E 4RGYA 4TRMA 4B34A 1ZIYA 2Q21A 2X9QA 2QRPA 3PC7A 3FOAA 2O14A 3A4LA 3PI6A 4D45A 2XB8A 3WQQA 1VLZA 3G8BA 2XBUA 2PBRA 4LJAA 4LTDA 3TQCA 1E64A 2FOLA 1ZPDA 2EF0A 4BLSA 3SQXA 1OWPA 5JR3A 2RAFA 1XQ6A 3D8BA 4ZVOA 3FFBA 1GZSA 2J08A 2WD8A 1S2NA 1JHPA 3WGQA 3VNBA 4U0KA 1A5BB 3CSUA 1PR5A 2QV7A 1ZVMA 2WZBA 3GLRA 3WNCA 4B2IA 4QX6A 4BN4A 4YP5A 2GTHA 1CY6A 4CIDA 3L01A 4CKEB 5KWIA 4R1SA 1J90A 2QXYA 2ZI6A 3ODGA 5LNK1 4P5EA 3D2BA 5CB8A 1QO0D 1WM1A 2R6DA 4NU0A 1Z5VA 2D2FA 2JC3A 3BK2A 3FH0A 1J06A 4WOCA 3WO1A 3JTEA 2JH3A 5IBRA 4LZJA 2G9UA 3EQ8A 2JCVA 3K9CA 3UAXA 3BA1A 4ZEXA 1LK5A 1QIIA 1XHLA 1TZKA 4M21A 2O8CB 1GPH1 5IXYA 1TF2A 4S24A 5AVSA 1VJGA 2VDJA 3GAAA 2N9UA 2WINI 3QX3A 5HKAA 3LV8A 2I2XB 4RIFA 2XUHA 4UUQA 4K9KA 4C08A 2VF7A 4KE9A 1I6MA 2BFBA 2FZWA 3W5UA 3TL2A 2E87A 2CL0X 2BUCA 3R7WA 3U49A 5LNK6 8MHTA 1R50A 3MRXA 2G4VA 2WNIA 4NCHA 3W77A 3FR7A 4NG5A 1FNBA 1BGVA 3QVVA 3U7HB 4E33A 1MEJA 3DBLA 4KO2S 5DGTA 3ZD8A 1X7YA 2YV4A 1LGYA 4TXJA 5CM8B 4JP1A 1U6KA 1U2RA 3ILYA 2CFRA 2FW7A 4I5IA 4PXYA 3SPXA 1LPAB 2KQUA 4CV3A 1TJYA 4K9SA 1YRLA 3QYJA 5DMXA 4E07A 4EJFA 2YYAA 2WAAA 1HFKA 1T6NA 4N4AA 4Q9AA 1YTUA 5FR1A 1J5XA 3EVNA 1YVEI 5HA5A 4QTTB 3QFHA 4ND6A 5F98A 1MO4A 1WW2A 1Z33A 3SU8A 1QANA 4GE3A 3IE2A 4LDNA 2UZIR 1ZH0A 2KS6A 4QNMA 3T95A 3UCXA 3ZR4B 3D5EA 5EJIA 1ST2A 1YJBA 1T3TA 2L42A 2R00C 2WF7A 2ZSDA 5JZOA 3AHGA 4Y6GB 5BWLA 1CUSA 2ZUVA 4MYHA 1A3CA 4H7FA 3WLAA 2X19A 2A0XA 4GM1A 2I4TA 4KR0A 3OEHD 5LP6C 4V0MA 3GOHA 5DBIA 3TJMA 3AR8A 1UAYA 4KHZA 4L50A 3UTDA 4PYJA 5K0GA 5DYGA 2Q3LA 4V2UA 1K9VF 2BGLA 1A76A 1AUQA 2VF2A 3G2OA 3GEIA 4FN5A 4K2AA 4MKXA 2ZULA 4IJVA 1G2OA 2XA2A 2XUAA 4MV8A 1KF0A 5DH9A 2R25B 1S2MA 1ZY2A 1L6IA 2QQEA