4HDQB

Crystal structure of the ternary complex of krit1 bound to both the rap1 gtpase and the heart of glass (heg1) cytoplasmic tail
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
164
Chain Sequence
b'MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krev interaction trapped protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
total genus 54
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdqB00
2ASEA 1R6BX 4LYHA 1WB9A 5G3YA 5AUQA 1UDXA 3AP3A 4IFEA 2NQ2C 4GOKA 1G8YA 1PUJA 3CRW1 1E9DA 2D2FA 5FR1A 1U9IC 4CYMA 3N2IA 2QPAA 5IHPA 4D4KA 5FOTA 5HCNA 4KVGA 1UFQA 1MO3A 4Q4JA 5JRJA 2B7CA 5EP1A 4AWXA 2N46A 4NCJA 1JJ7A 4OQMA 3ZJYA 4PC3A 3EIQA 3HU2A 3TSZA 4ERNA 3TJZA 4ZDJA 2Z6VA 2I4IA 2HV8A 2J7PD 4GMXA 1UAAA 4CEHA 1W2HA 2QSZA 3LWNA 3NVAA 3GJ7A 1ZAKA 3HDTA 4Q00A 1Z07A 4Q01A 1RC8A 3SR0A 3KXKA 3T1QA 3W90A 2PEZA 1VG8A 4RD0A 2KBFA 2WMOB 1KNQA 3QBTA 3KFVA 3L2OB 4NYMR 1KO5A 1ZBDA 2CLSA 2OM2A 3KUDA 3OE7D 2HYIC 1JECA 3KTAB 1I2MA 3WXMA 4Q7LA 3LA6A 1WA5A 2D3WA 4I1UA 4MRPA 1UM8A 3QE0A 2R6CA 1GKYA 2OBNA 4A6PA 3ZYCA 4G5QA 2ZJYA 3A36A 2I1VB 3BRWD 1KY2A 3P27A 4B3CA 2ZSEA 3PENA 1G41A 3AV0B 3CBQA 4KV9A 3FKSA 3SE0A 1AM4D 2MMCA 2GZDA 2WAXA 3PQCA 3ADBA 1GUAA 5JI3E 4A8JB 2EFHB 4B74A 1TMKA 1W2GA 5FTNA 4B2IA 5C18A 3AVWA 4HAWA 4OI2A 4AYTA 4ZKEA 2IF0A 1ZC4A 3HYTA 3FDIA 4PAMA 4JLKA 2AX4A 4JVLA 1P9RA 1G19A 4QJ3A 4A36A 4BFSA 2FA9A 5F2EA 1XXHA 4QM7A 1E32A 2OILA 4US0R 5C4MA 5KSYA 4LUCA 2XTNA 1PLKA 2WVJA 5EE9A 4JLDA 1ANKA 1E2FA 1CKEA 2OCAA 4LYJA 3B13B 4WXPA 4DLTA 4OHYA 4R98A 2D74A 4PO1A 4I1VA 1EFTA 1L4YA 5ANRB 2FU5C 4YMWA 3UG7A 4LCBA 1Y3AA 2C77A 3L43A 2XZLA 2ZJAA 3EASA 4BFZA 4QNMA 3NG1A 3ZVMA 2OAQ1 4HB0A 3H0KA 1CLUA 2B92A 1OH8A 3CRQA 5EE3A 2NGRA 4C30A 2XITA 1XMSA 1ZINA 4DCSA 5FTKA 2QQ0A 2FH5B 4HDCA 2NO9A 5DI9A 4PX9A 1OFUX 2VA8A 3IEUA 3QPWA 4BFUA 4AKIA 3B2EA 2WZQA 1AIPA 2D7DA 1FPMA 2G0NA 5DGXA 5JWRA 3NEJA 4ASUA 1OFTA 2GCPA 1VCOA 2Z4RA 4V0NA 1CIPA 3LW8A 1NSFA 1UF9A 2YJTD 1YR8A 3I8SA 1KJYA 3ADDA 2GEVA 2FE4A 1TF5A 1KDOA 1TUEA 2JJ1D 4F93B 1Q57A 2ODWA 3PV0A 1W0KA 2P2LA 2ZS7A 4O3MA 4ZDIA 2OSBA 5J47A 5FBRB 1E0AA 1HQCA 3MFYA 2F3RA 3IPXA 4RJLA 4CVNA 1CRQA 1H8ED 1E0SA 3B6EA 4LJAA 1BYIA 5GVSA 3NKVA 3AVQA 1KI6B 4ILEA 2FSFA 2XB4A 2ZTSA 1G7RA 1N3BA 3TR5A 5FUWA 2Q6TA 2W2TA 821PA 1G7SA 4B34A 2KSQA 1GITA 1W5TA 1E2DA 1L2TA 3LW7A 4IW3B 4Q9JA 1JPNA 2YYZA 3IDQA 4URYR 4KO8A 2QGZA 4LI0A 4ON9A 3U7HB 2VF8A 1U2RA 3GLHB 2DR3A 4HLUA 3FWYA 2LCFA 3NBFA 4Q47A 5GJVC 5FOWA 2GBLA 3LV8A 3SU8A 1GOTA 4TL6A 4RD1A 1SGWA 3JVUA 5AUOB 4HYYA 1UKEA 2QUZA 1IXRC 5BYKA 4TMXA 4KJZA 4P4SA 5DH9A 2FPLA 2ZE7A 1XTJA 1HE8B 4G0NA 3KFXA 2P3SA 3DM5A 4OL0A 3GLGB 3VQTA 2CEAA 5CLLA 2R6FA 5FOUA 1XD2B 3KZ1E 3HU1A 4ACBA 2Q21A 2PL3A 3AKYA 2C99A 3O8BA 2RHDA 4AC9A 4DSOA 3HPQA 4NKRA 4DCNA 5LB4A 2JLSA 2V7QD 4NCNA 3N2EA 1E4YA 1NVWQ 1KK0A 1U0LA 4PTLA 5AJWA 4M4SA 3Q8XB 1NBMD 4TYYA 1G4UR 5DSZA 3QKRB 1KOFA 2QAJA 2OXRA 1K6MA 5KDLA 2CDNA 3T1OA 2E1RA 2LKCA 3B1WA 2XNDD 1OH5A 3K09A 1G8FA 2ATXA 2CMKA 4YMSA 4IVPA 1DELA 1GTVA 3OIWA 3O8RA 1CS4C 4TN1A 3PUXA 5GJBA 1TF7A 4DT1B 4OHXA 4UNPA 1GNQA 3AF1A 3U6BA 1Z8FA 4MITA 2W0MA 4HAUA 3L8YA 3REFA 4C7OA 4KFRA 3O47A 1W48A 4E07A 4GP7A 4Q5IA 1ZUHA 4F4JA 1P2VA 3SYNA 5KO2A 1NI3A 2BEJA 2PEYA 3B5JA 3BH6A 4B6EA 4MDFA 2NZ8A 1QG4A 1ZUNB 1K5DA 1D9ZA 3LX5A 3FHOA 1P2TA 3E70C 1NMZA 3FGNA 1W36D 3GEIA 3OIUA 4ZDWA 3W6PA 2CNWD 2IYRA 2BBWA 1RJ9A 3NHAA 4ESHA 4HSEA 5JJKA 2QPOA 4Q4LA 4TWZA 3BORA 5HKKD 3ND9A 1P61B 3IQWA 5JFGA 3CPEA 1YKSA 1CJVC 1VG0B 3ZIAD 2QT0A 3W8NA 1MV5A 3V4RA 2ZS8A 2EFEB 2XZOA 1QHIA 3KKMA 2GJAA 4DCTA 4EAQA 2O0HA 3ASZA 4IEIA 1KSGA 1Z6AA 2FZ4A 1E1RD 1UADA 1W0JD 1OH7A 5JWOA 1A4RA 2X19A 5KTYA 2ZE8A 3MWKA 1C4OA 3WRXC 3KUCA 4XTRA 4MRSA 2VHQA 3RS4A 1P6XA 3S1AB 4XJXA 1Z6GA 1VYTA 3O8DA 1OYYA 4MYTA 2ZI4A 4FMBB 3VR1A 4URVR 2QE7D 4K81B 3PR1A 3LVRE 5BN4A 4B3BA 3OEEA 1NRJB 1XCMA 3L0OA 3OHMA 5AUPB 1ZW6A 4DSNA 5BW8A 2XJ9A 2IXEA 4MDEA 4JLPA 1G6HA 2ZE5A 1GL7A 2X77A 1OFHA 1S8FA 3RS3A 1XP8A 2HUPA 3EWSA 4V0ME 4ZKDA 2DWPA 1E9FA 3H1TA 4TLBA 3SJCA 4DDVA 2RMKA 1SKQA 1R4AA 4IOJA 2GCNA 1BIFA 1ONBA 4LJ9A 2ONJA 2JLXA 3KTAA 4BLTA 1XD9A 1KI9A 1MABA 3AM1A 4BLOA 3LFUA 2F1HA 2RGAA 4PPQA 1M74A 3NC1C 4OHZA 2OCPA 1ZM9A 1JXOA 4S35A 3OIYA 3KKNA 2XXAB 2ZR9A 4B2LA 2VP9A 3ADKA 2G83A 3IO3A 3OFNA 4Z8XA 2H5EA 4IXNA 4LPKA 4IHQA 2GZAA 5J4LA 3RANA 1F48A 2J45A 2JCSA 1ESNA 5G41A 5HTKA 4PQRA 1LW7A 5EUMA 3AKCA 3DKVA 3P1JA 4EJSC 5B58C 3T1TA 3B7GA 2R2AA 3F5FA 4FI3C 1RW4A 1YR9A 2IBMA 3T35A 5FR2A 4DLUA 1SHZA 2FWRA 4NE2A 4B3DA 3U3MA 2IWHA 1P2SA 3D6TB 1O87A 5HZKA 2O8BB 1T8UA 3CNOA 1FQKA 3NBYC 1US8B 3VFDA 2G9NA 2IS2A 4PC1A 3Q7QA 3QSYA 4GSYA 3WNBA 1QVAA 2DFKB 4P4TA 2ZUDA 4MA4A 2YINC 3LH5A 4BPBA 3K0CC 1E2GA 4M1MA 1OIVA 1NJFA 3FTQA 5CDFA 5KYKA 1UBCA 4MRRA 3TR0A 2PCLA 2IYSA 1F2UA 3VNVA 2OFXA 2JLRA 2EU8A 1QRAA 4U00A 2CLDX 1NY5A 3BE4A 4AD8A 2ZJBA 1IJFA 4RZ2A 3P26A 1CU1A 1IN4A 1XFAA 2Y8EA 5E4FA 3VR3A 3PUVA 3W5JA 4M1YA 4C0SA 5IT5A 4B32A 2QMHA 2ZYWX 5FUYA 3GJ3A 1T3SA 4R9UC 3K53A 1AKYA 1XX6A 2ZYVX 5ELXA 1E1QD 2VEDA 2B8TA 4PC2A 1JAIA 2RHMA 1GRQA 2G6BA 2ZYUX 4QBFA 2GKSA 1Q1ZA 1RRFA 4KLZA 4QJ4A 5FPYA 5KSOA 4HI0E 3A4LA 4ZDKA 3REGA 4CZ2A 2ZPTX 3B1YA 1RRPA 4J0QA 2XNDA 2CL0X 4LJ5A 4KSBA 1JR3E 3B82A 1XZQA 5BWMA 3V4FA 1GM5A 4IDNA 1G17A 2VRWA 4AURA 1N5KA 4EDHA 3EZ7A 1YZGA 5TDHA 4CEIB 4DB4A 4IRUB 3AVOA 1XMVA 1X3SA 1R0WA 2WSSD 4XD7A 4MGYR 3NDPA 3K0AB 4TT3D 5GJCA 5HE9A 3SQXA 1KMHA 3QXCA 1JQJC 5FTJA 1KSJA 4RFVA 5J4VA 2NO7A 4GRAA 1KYIA 3L0PA 4LV8B 5C1BA 1OFIA 4LHVA 5EP4A 3QXSA 5P21A 1JAHA 3H2YA 2K5UA 2J9RA 2D4HA 2P0EA 1GKUB 1G16A 2CK3D 2QMUA 3QXXA 4PHHA 3WYFA 1VTKA 2G3YA 4KYUA 4HB4A 3CB4A 3RVBA 1VIAA 1M34E 4JT4A 4AIIA 4LHXA 3QPUA 4D0NA 1E99A 1BMFA 2BBOA 4BEJA 3RWOA 5JRZA 2HXSA 2ZRHA 1R5BA 4GT1A 3TIFA 3RSOA 5DHAA 2FJUA 2QAGC 4P4SB 1G1MA 3CKLA 1CJMA 4K8OA 4Q48A 1ZM3A 4GPTA 3WY9A 4FCTA 4A2PA 4US1R 4XH9B 4CEJA 2JATA 2P6RA 3VKWA 2CL7X 4NBSA 5JCPA 4WZBE 4PHTA 2ZETA 4AKHA 3DMNA 2IXFA 2GXQA 3GCGA 1Z29A 3SFZA 1IQPA 2R6AA 1GDDA 3BOSA 1Q21A 3E2IA 1Q44A 3TUIC 2ZSFA 3MGCA 2OCBA 3TAUA 1KZGB 3SBDA 4FMDB 1P60A 2CHQA 3TQCA 1ZIPA 4BQSA 4POAA 4KSCA 3LXXA 4Z54A 4XSGA 3A4MA 1QDEA 3HP1A 2H92A 1YQTA 5AJXA 1IN8A 5JECA 2XOKA 4D25A 3KB2A 2OLJA 2F9LA 3QF4A 4KFTA 4LZZA 3GLFB 4WAUA 4DSTA 4EPTA 3W9YA 3HWSA 3R9WA 4YQFA 1TU4A 2GXUA 4TYQA 4MKGA 1SVKA 3T12A 3I73A 3EARA 5DLQC 3T61A 3AGQA 1P62B 1TQ6A 2ZR0A 3IBGA 1G3MA 2C04A 1QVRA 2DWQA 1RYFA 1E96A 3RAPR 4AYWA 1VDZA 1OXTA 1YZUA 1D8TA 2ORWA 4KBGA 1D2NA 2OFOA 1UKZA 3TUJC 1E3MA 1HTWA 2BKUA 2IHBA 3I3SR 3L8ZA 4EFMA 5JEDA 4IJMA 3T06B 1XU4A 3I8XA 1BH2A 3QBVA 3M1IA 1DAFA 2WJJA 4M1WA 4U5XA 3NH6A 4B2PA 3GD7A 2HYDA 5B64A 4C2UA 1Z0DA 2EYQA 4B3GA 1N5JA 3GJ6A 1QG2A 2WJGA 1KI2A 5CLQA 4EJSB 2PZFA 4Q21A 1YVDA 1H8HD 1T5LA 1EESA 2FSIA 2GEUA 2IHYA 3KQKA 2F43A 2PJZA 1Q1EA 2FSHA 3DVLA 4DHEA 3MG9A 1T0HB 1J8YF 1CTQA 2MSCB 2JLZA 4PHFA 4EKDA 2MSEB 3C16C 1LF0A 5K8TA 3EC2A 3PVSA 3U4QA 1KI8A 1SKYB 2HCJB 1V5WA 1IAQA 1AN0A 2REOA 3MJHA 4A2WA 1MT0A 3TSOA 3VR4A 4IDQA 3S1AA 2V4ZA 4B6FA 1F60A 1EWRA 1ESMA 3NDBB 2OEPA 4M8NE 4ARZA 2VSXA 4BLSA 4BUJA 5DIFA 2OE2A 4ACAA 1E2MA 1Z5ZA 4QGHA 2TMKA 2W6JD 1TF2A 3R8CA 1SXJA 4ABYA 1WQ1R 2I3BA 2WBLC 3PUZA 1KO8A 1L8QA 3QF7A 2HEIA 5UKDA 4F4IA 1OIXA 2G0TA 5A0FA 3EA5A 4KHZA 3W8RA 1ZUIA 4YMUA 4BWYA 3LQQA 1OXVA 1HA3A 3I92A 2DHRA 3K8YA 3QNUA 3OE7A 3FKQA 3GFPA 1XXHE 3L0IB 2QTHA 3FMIA 1BOFA 4TLCA 1EFCA 4MGKR 3BERA 5KNBA 3DKPA 3NWJA 5FI1B 4NPHA 5J5CA 1R0ZA 2QA5A 2OFWA 1KNXA 5HZHA 5J4YA 4IOLA 2DFLA 5CYPA 2GJKA 2VQSA 5L3SB 3QF4B 4DUGD 1FMJA 2FFAA 2XAUA 4Q4JB 3WMEA 621PA 4Z8YA 3ADCA 3DM9B 1FMLA 4AYXA 5EE0A 1MO5A 5KPDA 1N6PA 3BH7A 4G5OA 4JLMA 4Q1CA 2OCYC 5JWHA 2WWXA 3OEED 3B1XA 4K46A 3GLGA 2WSMA 4H9GA 5FFMA 2J0UB 3VR2A 1Z28A 4RY2A 2AN9A 3PCRB 4HUQA 3K70C 3CF2A 1JB1A 1ZD1A 4UXIA 1KI7A 1P9WA 1XDBA 2BC9A 3VR5A 3U44B 1Z2AA 2QORA 2R6DA 4GZLA 5AWFC 2RKOA 4JL8A 3AUXA 3F8TA 1N6IA 4G5SA 4DLZA 1KO1A 1M6NA 4P31A 1AK2A 4TSFD 1P4SA 4M1TA 1NLZA 2OLKA 1H8EA 2CK3A 1IM2A 4P3YA 1E9CA 1PLJA 4NU0A 3W6NA 5M04A 1JI0A 1AZTA 1F2UB 2IS4A 1T5IA 1JEEA 2R9VA 1R8QA 2H17A 1A5TA 3ICQB 2AR7A 2ZS9A 4UKDA 3CX7A 3VHLB 3ZQ6A 5LD2C 4LWZA 1KK1A 2AFIE 4N0DA 4B73A 3ZD7A 5F3WB 4FXPA 1DO0A 1NKSA 1XEXB 2ZRPA 4FIDA 3KQHA 1AS3A 4OI0A 4KXFB 2BM0A 2IYYA 2D2EA 2PZEA 4S2EA 4FN5A 1TEVA 3KDSE 2IK8A 2QG6A 4LJ6A 4LBWA 1GNRA 1XJCA 2OXCA 2C98A 2WWFA 4ZIRA 2BBSA 2YOHA 4ESVA 4LK2A 2XSZA 2HT6A 1NN1A 1SXJB 3NC0C 3WYGA 4G5GA 4FMCF 4LV6A 3F0TA 3TBKA 1AJEA 3BGWA 4GOJA 4OK6A 4TL9A 4M1KA 4N0EA 3BH0A 1TU3A 2C2HA 1WCV1 3H4MA 1RJ9B 2IEYA 3TUZC 1VPLA 1N6LA 3LRPA 2WOOA 3I61A 2ZYTX 4TL8A 1MH1A 3CRMA 2BMFA 2WWGA 1P7CA 3OESA 4QGFA 3AF3A 3OAAA 4DSUA 3R9IA 4NYIQ 4NYJQ 2P65A 3NH9A 1Q20A 1E1QA 2CJWA 1RVDA 1XTRA 2GWHA 3EC1A 3TQFA 1UKYA 2ZI5A 3M4YA 3CF6R 2DPXA 4ZCMA 3U61B 1Z0FA 4JYBA 4RCZA 2H16A 3HR8A 3PEWA 2ZXUA 3CR8A 4JBWA 1RYHA 1SVSA 4LPSA 1ZP6A 2F1RA 3GLFA 2IUTA 5SZKB 2P5SA 3ZZTA 1GVNB 2GF9A 2WPDD 4U02A 2P6UA 4JBXA 2FGJA 2WAYA 4DEXA 1GWNA 3UATA 2HDNB 1ZNYA 3LBIA 2J87A 3MWJA 2W2VA 1SVMA 4A4DA 1TQDA 1IY1A 4L9WA 1FQJA 2DFTA 1KDPA 3MWYW 4PR0A 1YHNA 2ZU0C 2IL1A 3FFBA 3CX6A 3R7WB 4C0QC 4C2TA 4UNNA 1M1YE 1NSTA 2HLDD 2J59A 5FPSA 3U7EB 2FDCA 2JLWA 2O8CA 1E2KA 4TQ9A 1G18A 1P75A 3KJEA 1W5SA 2XX3A 4RKFA 1JR6A 3UANA 5D3MA 1L7VC 4E09A 6Q21A 1F2TA 3BS4A 2A9KA 1AQYA 3FMOB 2CVFA 2F9MA 2EW1A 3RS0A 3VX3A 1N6NA 2RH5A 2KJQA 1G5PA 5TARA 2XSZD 4OBEA 1M2OB 2ZVPX 1P5ZB 3LX8A 3NBZC 1JJVA 4HDOB 4M9ZA 4Q7JB 1KI6A 4QGAA 2GJ9A 1W36B 1Q3HA 5G53C 4CF7A 3CNLA 2FFQA 4OI4A 1DO2A 4Q7KA 1X8LA 1HH4A 2GK7A 3EZ2A 5JJLA 3JZMA 4IOKA 1COWA 1T3LA 1T6NA 2FSGA 2FPKA 4LGMA 3GLHA 1N0UA 2QU8A 1TPZA 3G82C 5DE3A 3ZGXA 2J7PA 4RKEA 3U3JA 4QOSA 3R9XA 1YR6A 2JDIA 3CIOA 1Q22A 5HR5A 2A5JA 1T4GA 4I1OA 3B9QA 4DC9A 5H68A 4GOXA 5JS8A 1ZU5A 4DZZA 5L3QA 4IKEA 2C8VA 1C1YA 1ZU4A 1N6HA 2ZAOA 3I4LA 1HQYE 2IYXA 1JPJA 1UPTA 1E9EA 3KKQA 4FMDF 2FEMA 1FFHA 1FNNA 1XF9A 3RS2A 4OQLA 2X2FA 3DEFA 5C46F 4RVCA 5TY0A 2FZLA 2IT1A 3TH5A 3UMFA 3EW9A 4C4PA 1XEFA 1Z6TA 3LVQE 4JLAA 4M22A 3WHKA 1HEIA 1DAGA 1JALA 2AWNA 1NY6A 2N1BA 1S4QA 3GLHE 1S96A 2O0KA 3X2SA 4TMWA 2IYLD 3T1VA 4MRVA 4RFSB 1LY1A 4AI6A 1ZIOA 1W0JA 4EPVA 4WBSA 3P4YA 1E2LA 3HPRA 1VIYA 1NMXA 1ZM4A 1SULA 2JLQA 4NCKA 4PPFA 2H8KA 2QQEA 2UZ3A 2R65A 1OHHD 4C7OB 2HCBA 4XWAA 1NLFA 4HZUB 3I5XA 2QP9X 4D0LB 3QXHA 2H18A 1KI4A 2REXB 1IY0A 3ZIAA 2IYQA 3U3OA 1P72A 1J70A 1G3QA 1U81A 1QHYA 4MQBA 3R7WA 2QI9C 1G7TA 1Q1QA 2O8CB 1OF1A 1Z0KA 4DVGA 2AD5A 3VU9A 3WMFA 4X8OA 2C03A 3BFVA 2RGEA 4CEHB 2BCJQ 5TXGA 1LS1A 3IKJA 4NONA 3RRYA 2J5XA 5FUXA 3B78A 4QBGB 5EXSA 1KSFX 1OLOA 4CEIA 3X1XA 3NBXX 2QROA 4KYIB 3RABA 2G77B 4EPXA 1UJ2A 1P73A 1S3SA 1NIJA 5C4GB 3NHBA 2AWOA 2NTYC 2F55A 1NIPA 1HUQA 1XPRA 1II0A 3GJ8A 4URZR 4LC1A 4CT5A 4BECA 1KK2A 3M0EA 2GESA 1VECA 5H1YA 4TYPA 1DAHA 1U8YA 4ZPXA 2V55B 2WMNB 1UDWA 1G5RA 3PJRA 4TYNA 1FX0B 4X8LA 4A0FA 4BLPA 4RCYA 4GZMA 4Y0AA 4A8JA 2AXNA 2Q9BA 2E87A 5BN5A 5FBQB 1R10A 1H8HA 3RC8A 4F4CA 2VBCA 1WDTA 3BFXA 3ETLA 1G64A 3EG5A 2ZJOA 2MMGA 4US2R 3I1FA 3QOFA 1IY2A 3FOZA 1N25A 2C5LA 4IDPA 2ECKA 5JHGB 1E9SA 3I5YA 1FTNA 2C9OA 4F38A 3V9PA 5EXXA 3Q7PA 3HR7A 3UWKA 3J81k 4C0HA 2QM7A 1NJGA 1XCPA 2PT5A 1N6RA 1G7CA 1EFRD 1SVIA 1U90A 2C9YA 4DLYA 2XXAA 1FTSA 4D81A 3KKPA 4H1UA 2FOLA 2X1VA 1F6BA 2HT1A 1XJQA 1QHGA 5CIWA 3RRZA 3AVTA 3DPUA 2P67A 5FPTA 1T0JB 5KHOC 1YE8A 2ZI7A 3SJAA 3V00A 4TLDA 3A1TA 2GAOA 3W34A 1W7AA 3B9PA 4B44A 4JKIA 3DL0A 1MO4A 2B7BA 2ZEJA 3CH5A 4MKHA 1E2PA 2ZU6A 4OK5A 2Z43A 2QGNA 5DHFA 1A82A 5EE1A 1KO7A 4Z51A 2JLYA 4JLBA 1E79D 3GPLA 2Q9AA 3QKTA 1ZCBA 1G8HA 2NZJA 1I4LD 2JDID 2ZAMA 4JLVA 4QGGA 3WRYC 3IIKA 5D3QA 2ZSDA 3SEAA 4ZI3A 4MYHA 2BCGY 5AJYA 1L4UA 1WP9A 4Q03A 4A9AA 1Z0IA 3UMRA 1EGAA 3AQ4A 1W0KD 4KVAA 2IX3A 2JIZD 1LV7A 2EFCB 5FL3A 4CT4B 2JIZA 2C78A 1CBUA 3TVDA 721PA 4DBLC 3GFTA 5F9FA 2GTPA 3IO5A 2DYKA 5H70A 1T9HA 5LB2A 3Q9LA 5EXTA 4TSFA 5A5GA 1RFLA 1HE1C 5FUVA 1OIWA 1E79A 4XSHA 2GJSA 4Q7MB 4BGDA 1MRSA 2GVZC 3L0SA 4EPRA 4OJQA 3I32A 1I2DA 1K8RA 4TLEA 4BFTA 5IRCD 3MD0A 2VP0A 1KHTA 3CR7A 4M9XA 4URUR 1ZD8A 1HT2E 2NO0A 5GJWC 4YMVA 1DAIA 1PUIA 1JXMA 2IF2A 3WYAA 4PZLA 5EJEA 1XCGB 2DB3A 1GZSA 4R2HA 5BN3A 1OYWA 2WIAA 1ZNWA 2IW3A 3MCAA 4A0GA 1W4BA 1XEWY 2BOVA 3VR6A 4Q9LA 2RGCA 2P5TB 3BAFA 1JQLB 1Z0JA 3RDPA 4LYFA 3RC3A 1AKEA 1EX7A 2WIBA 4UQOA 121PA 4V0OA 2A30A 2LWIA 2HF8A 1G5TA 1U0HC 2YC2C 5IK2A 2R6GA 2YWFA 4LSGA 1CXZA 3K9NA 2WWWA 3CX8A 1E2JA 1XRJA 2Z83A 5AK0A 3P4XA 1ZJ6A 4C0KA 1EXMA 2JJ2A 2DWOA 4IVRA 1J90A 3C5HA 4KCGA 3UMSA 2O8EB 4L4UA 3TKLA 4PXAA 2XZPA 5FOXA 2BEKA 1GL6A 1X8JA 3P32A 3IIJA 4A6XA 2F6RA 1EWQA 2J41A 1VHTA 2O8DA 3VHXA 4KBFA 2JAQA 4TTRA 4W5WA 5TMPA 1N6KA 1I4TD 1XTIA 2EFGA 4I99A 5EUQB 5JEEA 1T3HA 3LBHA 5BXQC 3U7GA 4V0KA 4LYAA 4PZZA 1YZNA 5FL7D 1XTQA 2WTUA 5KNCA 4NHOA 3QKSA 3W3AA 4DIDA 1VG9B 1Z83A 3DMDA 4B71A 1SXJD 2QPTA 2QP3A 2Q9CA 2QAGB 4JLOA 1G9XA 2W6JA 1B23P 3NTUA 2UKDA 4EUNA 1GP2A 1II8A 2FFHA 4MGIR 3B1VA 1G3IA 1OV4A 2YHSA 1GRRA 3SYLA 3VX4A 1WBDA 5EZ6B 3ASYA 4QBIA 4Q4AB 2V6JA 4A0RA 3H84A 2GJ8A 3A1UA 3CW2A 3HJNA 3Q85A 3RRNA 3MUFA 2PLFA 4AY2A 2YWHA 2A5FA 3P20A 5A4JA 3BBPA 3HU3A 2QY9A 2ZROA 4GMDA 4A0HA 3SZRA 3LLMA 1E2EA 3EWAA 1IN6A 1OHHA 2KB0A 2JGNA 5G3ZA 3VMFA 4PQFA 3LY5A 4V0MA 1UEIA 2WWIA 2CE7A 4D2IA 4F92B 2IYUA 3C14C 3QKSB 1YRAA 1DS6A 4EQ6A 4DLRA 2Z4SA 1DVRA 4L8GA 4LBVA 1YZKA 2QM8A 2IS6A 3MMPA 1P9NA 3WHLA 2C95A 1D2MA 1LNZA 4KU4A 1N0WA 2ZITA 2D62A 3K0FA 1KAGA 1HY3A 3I72A 2Z0MA 1CJTC 2RAPA 1OJLA 2VP2A 3GEHA 3G0HA 3RYTC 4M1SA 3KJHA 4EPWA 5EZ5A 1AA9A 1SKYE 1HV8A 4O25A 2CL6X 2FFBA 4PANA 2A78A 3UPUA 3BIFA 4UJ3A 1XEXA 2W00A 3E5HA 4JL6A 2GEDA 4B76A 2CXXA 3NIBA 1OSNA 2GCOB 3CZQA 1RE0A 1R0XA 2XOKD 1DG1G 1MRNA 3FHCB 5KPJA 2RGBA 4ZV4A 4Q02A 4Z1MA 5KDOA 1N5LA 5J4KA 4AKEA 3FHTA 4I1SA 5B30A 4URWR 1Z6XA 3SHWA 3VU9B 2BMDA 2GF0A 2L0XA 4Q19A 5TVKA 1FZQA 4GP6A 2VSFA 2I1QA 4QHTA 4FCWA 2V8OA 4G01B 4LOAA 1LTQA 3DHWC 1YR7A 3BB1A 1LFDB 1ODFA 3U4QB 2CJWB 5KNDA 1NVVQ 1Z22A 3A6PC 2C96A 1FUKA 1W1WA 2BWJA 2A7QA 1G20E 4NH0A 2ZRJA 2F43B 1E4VA 3CLVA 3PITA 2F1IA 4DRZA 4QRHA 2UVQA 4M53A 5FOVA 3CM0A 3C4JA 5CM8B 1XB2A 4JSYA 2JASA 4JMPA 1OXUA 4NYMQ 421PA 2IUUA 3QG1A 3JZAA 4R7ZA 4YDSA 4TZ0A 3LDAA 2OZEA 2VYFA 2W6ID 4MRNA 4RD6A 2PMKA 1TX4B 1Z47A 1FX0A 4I4LA 1XWIA 4PPNA 1Z6YA 4DKXA 2AXPA 4G5RA 3FFAA 1ZCAA 2HLDA 4RZ3A 2ZE6A 1DOAA 4WIAA 3GLGE 4AKGA 3WP1B 4DDTA 4XWKA 5DNYB 2ZR7A 4F7WA 4HDQB 2O52A 4HLCA 2XEXA 2AKAB 2YVUA 1A2KC 3K0AA 2EVWX 3D31A 4BRWA 4DLSA 1XTSA 1VCMA 4PO9A 4HAXA 1KMHB 2WSSA 4KLNA 4XD7D 4DB2A 3TAHA 2ZRLA 1M7BA 2J46A 4RD2A 4KFUA 4YXWA 2QTFA 4XTCS 1VHLA 2YOGA 2GZHA 4D82A 3SI7A 4EIWA 1ZRHA 3DOEA 3EA0A 4QL3A 1RKBA 3ZS9A 4B33A 1E2NA 2C9CA 4A8JC 1ZYUA 2V9PA 2GBLC 1VYUA 1E9BA 5K8UA 4Q1BA 4TL7A 1Q12A 3EPJA 3T34A 2B21A 1KDTA 3SBEA 2GNOA 1FL9A 1DPFA 2ZRKA 5KSZA 1W4RA 3SFVA 1TEXA 2IA5A 1XEWX 3UG6A 3WMGA 1S0UA 4P4UA 1Z3IX 3AH8A 5JCZA 3GLIB 2AKYA 1W47A 4PFSA 3KXLA 4DDUA 1PJRA 1LS6A 3EPKA 3NXSA 4M21A 4FWTA 1XPOA 3IHLA 2VO1A 1UEJA 2Q3FA 1FUUA 4MKFA 2XJ4A 4WVFA 2VF7A 3U44A 2EWWA 2OO7A 2V7QA 1SXJE 2NG1A 4UJ5A 3A4NA 4OKSA 4RD4A 1CJKC 1XXHB 2J0QA 2F3TA 4V03A 2GK6A 3SDZA 1E69A 1XMJA 2VL7A 3OEHA 1U94A 3PG5A 2QNRA 4BLRA 1VKJA 5EP3A 5JS7A 2NMVA 1IN5A 1YZTA 221PA 4JBYA 4D0GA 2O8EA 4B35A 1AS2A 3U3KA 5AJZA 1I4DD 1WRBA 1ZVQA 3IIMA 2IWRA 3SOPA 4QNRA 4KAXA 4II7A 4UXJA 5DYGA 4OI1A 3TSWA 2PJRA 1XTKA 4OQXA 3KQNA 3CRVA 3ND8A 4CRWB 1T8TA 3JVVA 4YONB 1SZPA 1U98A 3MSXA 4PQYA 4ITRC 4O2RA 3QIAA 2ZJ2A 5K8LA 3CUEF 3OZXA 2CCJA 2ZREA 1CR4A 1QHNA 4BFVA 5LPNA 2X2EA 1TQ2A 2OAP1 4RZUA 3SJBA 2NOAA 3M6AA 1Z08A 3RS7A 2PX0A 4QG7A 4CW7A 2XB2A 5JJIA 3T5GA 3OIVA 4N3NA 1P2UA 2QENA 2V1XA 2H7VA 4PSKA 1U8ZA 2YC4C 1W46A 2OG2A 3T15A 4KITB 2QMOA 1SXJC 1DAEA 1S9HA 3VNUA 3D7MA 2EWVA 2QN6A 1NN3A 3C41J 1KJWA 4LV5B 4Q18A 3OFND 1M8PA 3EIEA 2ZJ8A 4DEYA 1OPXA 3DO6A 5DI3A 1E2QA 3EX7C 1S1MA 4HUTA 3AVVA 1ZM7A 5GVRA 1NP6A 1P3JA 1W4CA 2DBYA 2BHRA 3L82B 1S1CA 3RS5A 4JVSB 5E7IA 2XTMA 4DUGA 4TT3A 3WNCA 3UWOA 5H8WA 3X1DA 1T91A 2VP5A 2B6HA 3CWZA 3VTKA 3THXB 4Q4HB 4QJ5A 4EFLA 3O8CA 4AK9A 1S3GA 4D80A 1GNPA 3ZZ0A 1ETUA 3KXIA 2ZI3A 3TK1A 5GADl 1G8GA 2WJYA 3EZ9A 4GI7A 4LBYA 4MYUA 1QZXA 2PMDA 2MSDB 2QBYA 4MGZR 4Q1FA 3THYB 4IOMA 1RRCA 1N2CE 1D6JA 2PX3A 1KSHA 3ZVNA 1VG1A 4FINA 3IEVA 2ZANA 1OE0A 4PHGA 1UBFA 1N5IA 4QM6A 3AF4A 3NEYA 1SVWA 3K0SA 1CEEA 1YRBA 1FNMA 3A8TA 3SYKA 3W3ZB 3R8FA 4NTZA 1VCIA 1E1RA 2ODNA 4XVQA 3ECCA 3LXRA 4YXWD 1Z2CA 2CCKA 3X1ZA 1E0KA 1KI1A 1DEKA 3AEZA 4TMVA 3WNDA 2ORVA 1SHKA 3AKEA 1DE0A 1W4AA 3B8HA 2YNMA 1F2TB 4XWOA 5E7MA 2CBZA 2NO6A 2BV3A 4R2IA 3RWMB 3DOFA 2FNAA 1II9A 1MO6A 2WKPA 1IN7A 2FX3A 3R20A 2NPFA 5HKKA 1W36C 3TMKA 2QBYB 4XVUA 2WV9A 1D2EA 1YU9A 4AG6A 4EJSA 4PSAA 1BYUA 1R2QA 2CNWA 3QKRA 4QKQA 2ERXA 1OXXK 5G40A 1U9IA 5FPKA 2R44A 2J7KA 2H57A 4JVNA 5DISB 4URXR 1B0UA 4Q9IA 1GIAA 1UKVY 3LAWA 4TQAA 2VP6A 4G1UC 5JMTA 4IXMA 2VSOA 3AB3A 3K9LA 3BXZA 3U5ZB 1KDRA 1QHHB 2CCGA 2O0JA 2ATVA 2BVNA 5J40A 1XNJA 5AR1A 3SNHA 2J0UA 1NMYA 3BB3A 1W49A 1TQ4A 3EXAA 2ZRIA 1N6OA 3IPYA 1R5NA 4OYHA 2BJWA 5KU1A 1MOZA 4B3XA 1G4AE 5FBWB 2ZRGA 3RLFA 3TLXA 2IYWA 1EX6A 1EFHA 1GAJA 2Z5FA 4JL5A 4W5JA 4BRUA 1W44A 3DZDA 1VCNA 1EFUA 1ZC3A 4Q1EA 2FGKA 1IJEA 3MJRA 2WJIA 5CM9C 3IQXA 3D3QA 2B8WA 2FG5A 3QUSA 4JKYA 4YC7A 3TRFA 3BJIC 3D8BA 4JSTA 5CJPA 3SN6A 4PC6A 1KJZA 3TNFA 3TGPA 1M7HA 1GKIA 1G8PA 2NO1A 3QQ5A 2BBTA 4Q4HA 5FI0B 5F98A 4M9SA 1CULC 2FMXA 2E9SA 5SZIA 1SVOA 2ZRCA 4JLJA 1DARA 4CDGA 4P32A 4C0BA 4PAQA 4DWJA 5L8VA 1EK0A 4YLGA 1AS0A 1E94E 4LJ8A 4M0LA 2OV2A 1KI3A 4TYWA 1NVXQ 3RSLA 5FTMA 5L3SA 3SS8A 3SHFA 2IYVA 4QHSA 3ZH9B 5C2JB 2BDTA 2DY1A 3BWDD 3QKUA 4HZUA 3SJZA 2GXAA 4LRWA 2ZUCA 2PZGA 1A1VA 1US8A 2PBRA 5BYJA 2KE5A 3IUYA 2YWEA 1JNYA 2AL7A 2ZI6A 4GFDA 1BMFD 2IS1A 5HPYB 2QRZA 5B2ZA 2ZRBA 3Q5DA 4WW0A 2XNSA 3GJ0A 3MLEA 4GL2A 4NYIR 3ZD6A 4DIEA 5CB6A 1IHUA 1A7JA 3AVXA 1OT3A 5CB8A 5CIQA 5E3HA 2WKRA 2RGNA 5LBIA 2VHCA 4FMCB 4LHWA 2GA8A 1V43A 1FOEB 4LHZA 3A1SA 4KFSA 2HF9A 2YKGA 1IBRA 1E9AA 4DLXA 2JLVA 2KBEA 1NBME 1R5OA 1E9RA 2RGGA 4OQNA 1NVVR 8OHMA 4ASUD 1WBBA 3GJXC 1J99A 2V54A 1MKYA 4LJYA 2QAGA 5JLJA 3QEJA 3N70A 2QMEA 2H1LA 1A2BA 3TVTA 1FP7A 4A92A 4FD2A 2R8RA 5B57C 1QHHA 4DJTA 1U99A 1U8AA 2N42A 3ZQJA 2O5VA 1E6CA 1D5CA 2OHFA 2ZQ5A 3GJ5A 1CRPA 1CR2A 1X8KA 1GILA 2IEZA 1BS1A 5FL7A 1NG9A 4ZIRB 2ERYA 3TE6A 1J7KA 4DLWA 3A58B 5EP2A 3PEVA 5CYOA 1KTVA 3ZVRA 3UK6A 4AG5A 2VHUA 3KL4A 4D4JA 1E2HA 1ZNXA 2EFDB 2WICA 1G3RA 4P0TA 4A1FA 4Q9HA 3WBKA 3CWQA 4BASA 3DZ8A 5CDFE 1KIMA 2O8BA 3W5IA 1K5GA 4D26A 1NBMA 4JT2A 4C0AC 1RRGA 2ZSBA 3UXMA 4H1VA 1G291 1R0YA 3UIEA 3GFOA 4HLDA 1GSIA 4QHYA 3WBJA 3GJ4A 4XVRA 3BK7A 1G3UA 1TTTA 4IDHA 2ZRDA 4X8MA 3GMTA 5CITA 4IVQA 5IK2D 4GBMA 1KAOA 2VP4A 4DLVA 2QSYA 4I81A 4HLUC 1VMAA 5KSPA 1C9KA 2DCUA 2HXYA 2WKQA 3Q3JB 3BC1A 4V02A 4M9QA 1SVLA 4DT1A 2BM1A 3ZZUA 1AZSC 1PLLA 1E0JA 1PZNA 4RD3A 4B48A 4MH0R 3GP8A 5L3QB 1ZMXA 2W6IA 1KMQA 2QL6A 1DG3A 3QG5A 1QF9A 2J3EA 4KI0A 4DDWA 2ANCA 3AUYA 4RZXA 4NDZA 1G21E 3DDCA 3ZVLA 5KOYA 2SHKA 3FVQA 1LVGA 1NVUQ 1X6VA 1YZQA 2D7CA 4QXAA 3ZDQA 3IGFA 3K0EA 3CF0A 1D9XA 1PV4A 4HAYA 2VPPA 2J1LA 2VLIA 4ZO4A 1F5NA 4CIDA 5FPHA 2A2ZA 3K70D 1TL7C 1CF4A 2ORIA 4ZCLA 3AGPA 2GXSA 3BFKA 3ONWA 1RZ3A 4OQFA 3CRRA 4TTQA 1KY3A 5F9HA 1BO6A 2IXGA 4MKIA 1J2JA 2RGNC 2REBA 4Z1MD 2OT3B 3FPAA 1H65A 3GQBA 3F3YA 3THYA 3B60A 4BZXA 1DAKA 2G1JA 2OESA 4D4MA 3FMPB 1DAMA 2QT1A 2YWGA 1UBEA 1Q3TA 4HLQB 2RCNA 3MWLA 4JS0A 2WJHA 1KZ7B 4F91B 2LKDA 5DYIA 1Z63A 4G3XA 4TTPA 4NMMA 1KO4A 1KKLA 2O8DB 1RIFA 2QE7A 5E95A 1IXSB 4UXHA 3AVUA 5JSZB 2WOJA 3ZS8A 3Q72A 1EFRA 3PUYA 3CH4B 1F3OA 3LQRA 4C0JA 1GRNA 1HT1E 2QEQA 4B75A 4OHVA 3CPHA 4BFWA 1Y63A 2WWHA 4BLQA 2Q0HA 4FWIB 5JHHB 2NPIA 5EXPA 1OB2A 5TB5A 1KGDA 3EAQA 2PH1A 3VKGA 3K9GA 1G6OA 4EPYA 3AVYA 1XD8A 1OKKA 4JLNA 4PZYA 2D06A 3FMFA 1II8B 1MABB 4RSGA 4FCVA 3EZFA 3MRSA 5CK4A 5L3RA 1XJ0A 4ARZB 2ZRFA 4TMKA 3KKOA 2RGDA 3K9HA 4HB3A 4QC2A 4UNSA 4RFSA 2A3RA 3T5DA 4E22A 2A5GA 2QP4A 3WP0A 2PLRA 3QVVA 5BQ5A 4Q1DA 2VIIA 3AP1A 2ZM5A 2CHGA 1TUIA 3QENA 3EPHA 1IXZA 4JJZA 5DN6A 4A82A 4C9BA 4FW9A 2JJ8A 3G5UA 4Q1AA 1Z0AA 4TMZA 2AK2A 2ZI9A 3FYHA 4UNRA 1CR1A 3HYRA 3U7FB 2CVHA 3VAAA 4WZAE 1X1SA 2W58A 4UNQA 2GDJA 3QVUA 1GL9B 1DBSA 3SC3A 1XBTA 2XGJA 5FTLA 3QI2A 2PCJA 5SZHB 3N5CA 1E98A 2WJVA 4WOPA 3FE2A 3C15C 1UBGA 4PAOA 3BB4A 4NP6A 4O0MA 1S2MA 4EQ6B 3RRMA 2V6IA 2BMEA 2YV5A 3AF0A 4OHWA 3K0CA 1LB1B 5FBVB 2V3CC 2ZUBA 2CHVA 5FBLB 3TW4A 3KB1A 3AVPA 5AJVB 3TW8B 4PSVA 4A15A 3X1YA 2ONKA 2W83A 4CGZA 1IONA 3GLFE 1OKKD 2GETA 2GVDC 5JZVA 2YZ2A 3K09C 1WXQA 2RB4A 2OUKA 1LF5A 2G1KA 3CONA 4HEJA 1JBKA 3QPVA 4KODA 1NL3A 4MUAA 5CJ2A 2GRJA 2DFNA 2FF7A 3LBNA 1R8SA 2YOFA 2O8FB 2ZRAA 5J4HA 2ZSAA 2ZRMA 3LD9A 4IEEA 3UKDA 1OH6A 1Z06A 4JVMA 3KQUA 1GG2A 1TAGA 3PFIA 4LHYA 4B3FX 1AGPA 1CR0A 5JSZA 1FW6A 4BEBA 2QZ4A 2W2XA 4V0LA 4JIMA 4QBHA 2BIFA 4BE7B 1BKDR 1NLYA 4JZKA 2G88A 1NKTA 4LJ4A 5LDDC 3THWB 1J8MF 4Q9KA 3RNLA 4JYCA 2NIPA 2VHJA 4C0LA 2XTZA 3THXA 4LC0A 4C3ZA 4DXAA 2JLUA 3ZLJA 4R71A 2FN4A 4LBZA 1ELOA 3U6KA 2ANBA 1AQUA 4X8HA 1WMSA 4HATA 1TNDA 4M2LA 2FPMA 3I62A 2VH5R 4L5BA 5KUTA 1Q1BA 1WE2A 3PXGA 4YDHB 1COWD 3H86A 4GNKA 1PVOA 2JJ1A 4OK3A 3CZPA 2IUSA 3LO5A 2UZIR 3X1WA 3CO5A 3KJGA 4HB2A 4WA7A 4TLAA 4E03A 3QXJA 1QBKC 1JR3A 1CP2A 2ODBA 3OEHD 1QHSA 1SQ5A 4PO8A 5HCIA 4CEJB 2R62A 1AGRA 4O2LA 5L3VA 3MAAC 2WWYA 1M7GA 4LX0A 4NL4H 4DCUA 4EFNA 3THWA 4GDFA 2IC5A 2ZJZA 2CE2X 1DTSA 1MR3F 5KDDA 1NG1A 2W0SA 2ZIAA 3W6OA 3LLUA 4IDOA 4HAZA 4L16A 4Q66C 4HUQB 521PA 1KK3A 1OXSC 1YJ5A 4U7DA 3KQLA 1OW3B 5AUNB 4ZI2A 1S9DA 1XMIA 4Y0VA 1GFIA 3AKDA 4TQUS 4BFXA 4JJKA 2HJVA 1JEDA 3KJIA 4OJKA 5K8IA 4BFYA 3K70B 5IDVA 1X86B 5FH9A 4MUBA 1XZPA 2J0VA 2VTKA 5CK5A 1ZNZA 2RGXA 3GEEA 2WM9B 4PC7A 2EQBA 2Q3HA 5EQTA 4XIGS 4E5UA 4D4LA 4LDJA 2QRNA 4LJ7A 3U3RA 2JJ2D 2KI5A 2WPDA 2IYTA 1HURA 1CJUC 1YZLA 4W5HA 2BMJA 2QTVB 2X8AA 2ZRNA 3Q5EA 4HAVA 3B1ZA 4NYJR 4WZ6A 4XOIA 1DADA 2ZJ5A 2A5DA 2F1JA 3GLIA 4NCIA 1OB5A 4LY6A 2EYUA 1XD2A 3A1VA 3FB4A 3RHFA 2JEOA 2Q3MA 4ZCIA 1IOZA 3CPJB 3A1WA 1O3YA 1FP6A 4BZPA 3VKHA 4B47A 2O8FA 2CLCX 2OBMA 2VHTA 4M1OA 3OAAD 5TV2A 3U60B 2V1UA 3U2QA 1NNEA 5HE8A 3K0FB 2ZVQX 5LD2B 4L15A 1NN0A 4WXRA 2ODEA 3FKSD 5E7JA 3E1SA 3QY0A 2OBLA 3C7KA 5EE5B 1XPUA 1HYQA 4L9SA 2J0SA 2AD1A 2AHOA 2HJGA 4W7SA 4IFBA 3EIHA 5DO9A 4NZYA 3SQWA 4P33A 4HZIA 4B43A 1WF3A 1KKMA 5JBQA 1R7RA 1ZD9A 2BKEA 3A37A 1NF3A 3C5CA 3PUWA 3EPLA 1Q0UA 2WHXA 4BZQA 3KX2A 4W9MC 3GLIE 3PEYA 5DN6D 3K1JA 3ICEA 2AFHE 2JA1A 2F7SA 1TADA 2PT7A 3EZ6A 3BD9A 2GCOA 1JR3D 3QEOA 2A5YB 1U0JA 4DCVA 2GAAA 4N1AA 3PEUA 4PPGA 5SZJA 5DI3B 3LNCA 1ZM2A 4YMTA 3CNNA 4NCHA 4QFMA 4D6PA 2BJVA 3IBYA 2GHIA 4Q4AA 3AP2A 1EG7A 2KWIA 3C8UA 3IHWA 2IYZA 4TMTA 4A2QA 1QHXA 1X1RA 4MYCA 2FV8A 1NN5A 2AK3A 3OF5A 1RPZA 3IILA 2FEOA 5IF9A 3PIRA 5JI2E 5D3MB 3QJYA 1E2IA 2GILA 1N0VC 3THOA 3B85A 1VYVA 3AF2A 5FOSA 4TZ6A 2P6NA
chains in the Genus database with same CATH superfamily
5TGDA 2ASEA 4K3VA 3D8UA 4LYHA 5EWJA 1YR1A 5FXMA 5G3YA 1CDZA 2XWPA 3GOQA 3HRIA 4PBSA 1UDXA 4X1YA 2PPVA 5IHPA 3ORFA 2D2FA 4II3A 2EOAA 5F5LA 3DYBA 5BMOA 4ZC1A 4KVGA 4DJ5X 4Q4JA 1GGMA 1NPTO 3K20A 2FUEA 3FG9A 4YCJA 3CEAA 1JIJA 5EP1A 1PFGA 5HX7A 1CQWA 4NZPA 1JJ7A 1YGYA 4C4TA 3P9QA 4CR8A 4EVQA 4U1RA 3NTQA 3EIQA 4E6PA 2AHRA 2SKEA 3HU2A 3TNYA 2B36A 4DUYB 4ZDJA 4KQFA 2J3KA 1MH9A 1GV0A 2HV8A 3BTVA 3MGBA 1BE1A 1ISIA 2E4AA 3AEQB 1ZXLA 4GMXA 3SK0A 2WUGA 1WLSA 3NVAA 4PHCA 1Z07A 2CN1A 4HDSA 3T99A 3GGPA 3T1QA 4ZQHA 3R7SA 3F3SA 3V33A 1DEHA 3W90A 4D5EA 2IHZA 4DUPA 4Q3DA 2KBFA 1H05A 2BEVA 3DULA 1E1CB 4JJ8A 1KMIY 3UMMA 4UHBA 3OE7D 4RPCA 1UC8A 3WXMA 1I2MA 5CVVA 2YRFA 1WA5A 2D3WA 1XOIA 2Y1OA 2ZT7A 4MRPA 4NAVA 4DREA 2Y2UA 2R6CA 4LQLA 3K5WA 1JDUA 1KP2A 2BUCA 3HMQA 1TM3E 4OAQA 1X8XA 2Q3JA 3HY6A 3CLRD 4BQNA 3ZYCA 4G5QA 4IX9A 4NAHA 1I01A 2I1VB 4X3OA 5C53B 1EJ2A 1GYQA 3P27A 4XB6B 5HK8A 4YPOA 4E5PA 1ORVA 1WXWA 2XKAA 2P30A 2VWHA 4LXTA 3TLZA 2BCEA 3AV0B 3F5SA 4I5DA 3SE0A 2BFBB 2MMCA 5K3CA 1FFSA 1A04A 2HQRA 4QDKA 2GYWA 3E3MA 4B3TB 2G7ZA 2WAXA 5EJFA 1GUAA 4L2IA 1SIWA 2F64A 2H63A 3C7TA 3RUPA 3PXDA 1R8XA 3NBUA 3U7QB 2V0CA 2WEKA 5DHUA 1TMKA 1TCVA 2W2OA 4CIWA 3AVWA 1H2HA 4DLPA 2GPBA 1JKFA 3BTSA 3GV0A 2IF0A 1ZC4A 4PAMA 4M8SA 4CFSA 1B2LA 4PYOA 1DI0A 3DD1A 4MR8B 1ZN2A 4QJ3A 2FSPA 4WESA 5J23A 2FA9A 1JV2B 1XXHA 4JP5A 4TN5A 5F2EA 3WZMA 5J2TA 2PR2A 1LPOA 5JCOA 4ZV9A 3DEAA 1E32A 1UKBA 4XIIA 4RDXA 2XE4A 4M8IA 3WGVA 5KSYA 1PLKA 3UO8B 3MN1A 1PD0A 4P4GA 5IZ4A 1ZXXA 4JLDA 2N75A 2JFGA 2VT7A 2H2DA 2HA0A 2Q3EA 1GQYA 4PG6A 4DM7A 2ACVA 3N8IA 3DG9A 5AT1A 3LECA 4DLTA 3BWVA 1YKGA 2QTMA 5BOSA 2BFDB 2O8CB 2VJOA 4FYHA 4I8XA 3LQFA 4I1VA 2W8BA 4PO1A 2ROQA 4YMWA 1WCIA 5HW0A 1CZHA 2AJCA 1Y3AA 4HD8A 3RKUA 3L43A 4G1VA 1UMCB 3EASA 3I52A 1GG8A 4QNMA 5HJ2A 3OPNA 4HB0A 4FC7A 4PZEA 3PC6A 1EBBA 2FP4B 1ZUD1 4BEVA 1N5OX 1E6UA 4HL6A 5EIOA 2AH5A 1Z8DA 1HNWB 4GZ3A 3TB4A 5CUQA 2WU0A 1UJ4A 1XMSA 5TGTA 4C4AA 3GP3A 4TRJA 2EGHA 2B6NA 4JN6B 2Y1CA 1TIPA 1OFUX 3EBLA 3ZOZA 2VA8A 3UHPA 3MS2A 1QHFA 3U26A 1C1DA 4AKIA 1W4ZA 4MZDA 4PLHA 1WMEA 2WZQA 2WSLA 3ZTWA 1LVUA 2BKAA 4YJ2F 3DGFC 1EEHA 1AIPA 1BDJA 1FPMA 1ZONA 4PNZA 2OAGA 3C3XA 1OFTA 4R1OA 4EJ6A 1R4NA 1VCOA 2AS0A 2D8AA 2Z4RA 3LW8A 4Z4HA 1XZCA 2GN9A 4HTAA 5ENDA 1UF9A 4MVXA 3CVXA 1S8NA 1YR8A 1HFJA 4DDHA 1Q5PA 1U7DA 2QUKA 1O8BA 4UU1A 4QOHA 2C2KA 1H6DA 4O59O 4D8WA 4D4GA 2IEBA 4IH4A 3NB0A 1E1CA 2JNWA 1W0KA 2ZS7A 3V2IA 1XZAA 3TZKA 5J47A 1KS9A 1RWKA 1FFDA 1Z7EA 2D4AA 2M32A 2VRCA 5FBRB 3UJBA 1HQCA 3RADC 4YLEA 3RFTA 5A02A 4OH7A 4LJAA 3EEOA 3DAOA 3PFNA 1L3BA 3USCS 4LISA 1FU8A 3NKVA 3AVQA 4BFLA 1H2XA 4ILEA 4WZAB 1HK7A 4JHXA 4RXMA 3UH0A 2DTEA 4Q0MA 1KH3A 3WLMA 3C3MA 2VEOA 4EY4A 4X65B 4Y30A 4B3HA 4MRAA 1G7SA 4B34A 5CPFA 1G59A 4HRAA 4W5OA 2VJBA 1E2DA 3QVKA 1ZJ4A 1DZIA 2J85A 4YRCA 3UICA 4CLHA 3ZW8A 3IE1A 1CF9A 2YYZA 3EXFB 4J1SA 1R0KA 1ZL2A 4URYR 3R6WA 4D0GA 1E7YA 1RM4A 1X0XA 2DR3A 3D2CA 3FWYA 2AE1A 3L4KA 3NBFA 4Q47A 4UAUA 3VZDA 3LV8A 4WXYB 1GOTA 4H1HA 2RH4A 4RD1A 2Q9UA 3ET5A 1LJUA 1IXRC 4JMLA 3ETDA 1YB1A 4P4SA 4LKRA 1HE8B 1XVUA 2XRYA 4LDRA 2JLBA 3WGHA 3QTLA 1H3FA 2VAPA 3EZXA 1OX5A 4LJRA 2P8SA 4ACBA 1U7PA 3H11B 3AKYA 2AF3C 1EVKA 2XQIA 3O8BA 1T5OA 1YBFA 1ZQ1A 4LFCB 1JSLA 5JOQA 2VNHA 2WV7A 3EOZA 3HPQA 1XCLA 3EVTA 3KQWA 3O8OB 4FPXA 1PFVA 4NKRA 3MRVA 1QRTA 1ATIA 3U4IA 1DQRA 2PMFA 3LUKA 4QVIA 1CUVA 4HKTA 2E5LB 3HBNA 4YCDA 5JMPA 1VJGA 4BP9A 4DV0B 3T5AA 4AW9A 2Z4TA 1FLAA 3JYPA 1IJKA 2HCRA 3Q8XB 4LN1A 4C4SA 3QKRB 4J4TA 1QBGA 2OXRA 3T1OA 2CDNA 1GDTA 2E1RA 2YHIA 3AB8A 3VSDA 4UPDA 4UTZA 4PZPA 4CV1A 4RIFA 1OH5A 1G8FA 4YMSA 4IVPA 1RYMA 4AQDA 1UBKS 3DJYA 4MDYA 4FM9A 1D2GA 2H0AA 2VAXA 2J6BA 2ABWA 3PUXA 3CF4G 4GECA 4WPGA 5FIUA 1F38A 3SDBA 4OB6A 1QFYA 1MNAA 5KHAA 2W0MA 3R74A 4HAUA 3CTMA 1H3EA 1RQ7A 3OZDA 1KEEA 2RJOA 3W5CA 1QTIA 2VOJA 4E07A 1Q0LA 3T7CA 2XMRA 4I9GA 3UGKA 3JY6A 3V2UA 1VDMA 1P2VA 3SYNA 2XODA 2BMAA 1JN0A 2VJNA 1E6LA 1W5EA 2Q1TA 1QG4A 2GTIA 2RC6A 3A3KA 2YN2A 3R3JA 1DUIA 1U2SA 2EQ5A 4PLPA 1B2RA 1TYAE 3VZCA 3GEIA 3DBRA 3BRQA 1KYYA 3NHAA 3NTRA 4UZFA 3CKYA 5BN4B 1QQAA 3B38A 1OWNA 4TWZA 4M89A 4RV9A 2HK8A 3I76A 3IQWA 4JI1B 3OPXA 3UWPA 3ZNQA 4AIRA 5JANA 1TO2E 2JCVA 2XB8A 4PEVA 1C3EA 5EJ7A 2DLCX 1VKHA 2EKZA 2C7QA 4UU7A 1Y1KE 3SF0A 4DM3A 3ESXA 3BL8A 4MWZA 3RW9A 1BJRE 1QHIA 1YQGA 5GY7A 3E1KA 3G5LA 3L9XA 5EJ2A 2XZOA 4KXUA 2O0HA 1E1MA 1KSGA 1Z6AA 1G5QA 1E1RD 3G1UA 4R16A 3CLRC 4LRXA 5JWOA 2X5XA 3ONNA 3I6YA 4ZVRA 2FPGB 1Y81A 2SICE 3RVDA 3MEQA 2PV0A 1X9HA 5F2OA 5ADUS 1ZIDA 3X2FA 3WRXC 1CS0A 3RTBA 2PE5A 3JTMA 3GFQA 4MRSA 2VHQA 3VR6H 1IBSA 4UHCA 4XJXA 5IYZB 1YVUA 5D7BA 5IZCA 5JTUA 5CU7A 3M6MD 3SZLA 2MR6A 4XGQA 1OYYA 3NAZA 3KBOA 1NXPA 4MYTA 4DOMA 2F00A 1YDFA 3P9YA 4N7JA 4QOJA 2QE7D 4K81B 1MAHA 1ZQ9A 2QLBA 3LVRE 4Z7OB 4B3BA 1HSZA 3ZWAA 2HSDA 5KNDD 4R05A 1ZW6A 4QTUB 2IUYA 4EDFA 3TW6A 2PH3A 3IDFA 1ZH4A 3A06A 5BW8A 5J3JA 1RM3A 3B48A 4Q9NA 2FXIA 2X5OA 3JATB 1KBQA 4X84A 1BE8A 4JQOA 2OMKA 1DUSA 3RS3A 1OGIA 2HUPA 3L49A 4IIEA 4Q3CA 2VNJA 3N7AA 5GMOA 4QYTA 1EVIA 4DDVA 2ADFA 4V0RA 4H3VA 3GGCA 2P2DA 3C70A 4H7PA 2GCNA 1G20B 3ET4A 2ONJA 1NZDA 3GGSA 3HFJA 4BLTA 1XHFA 4R1SA 1FFBA 5I9TA 2Q1YA 4RIIA 3AM1A 2FR8A 1B73A 5KNBD 5EQDA 3LFUA 2F1HA 2O2HA 5IVHA 5K05A 3NC1C 4OKNA 4OHZA 2X8LA 3EN0A 1JXOA 5BUSA 5B3LA 4PPYA 1T6ZA 2ZR9A 3Q11A 2VP9A 1D03A 3ADKA 4D0SA 2EKBA 4ZOAA 3MSCA 4QVGA 1T5SA 5IVIA 1Y34E 3ABSB 4IHQA 4K2AA 3AL2A 3QMMA 3EEYA 1Y7HA 1VHQA 4I4NA 5J4LA 1SU7A 2OCXA 2WTEA 1PTKA 2IIVA 4R8MA 2XCTB 3I6QA 1Y6JA 3R40A 3O0TA 5EUMA 3U7QA 3TF5A 1WSWA 2IU4A 1U2EA 3UJ8A 4JYZA 1EHCA 2VDJA 3P9NA 4LFAB 2QVXX 4JOSA 4EJSC 3V3KA 4EG5A 5JAIA 3EFOA 3H9BA 3B7GA 2JFNA 5I9MA 4JCCA 2XXJA 1QG6A 1V2GA 3H1AA 4IV8A 1SHZA 4B3DA 4IKOA 1FIUA 1ZITA 1P2SA 3BQNB 4JJFA 3D6TB 3DBHA 2BFPA 4PYIA 4DQDA 3FCOA 1QAQA 2G8NA 2NTEA 2JFXA 3CNOA 3KZVA 3U40A 4W8HA 3D2BA 6ADHA 4A6EA 2ORYA 3NWOA 4MV5A 1H0SA 2PO7A 5FQOA 3PTLA 4MGEA 4KSYA 3NHPA 4KYVA 3LUBA 4P4TA 1IZ9A 3AFNA 1XKQA 1NYTA 4ZHQB 4J29A 1RFGE 1YCFA 2BFCB 1OIVA 1NJFA 1YS9A 4MP3A 2J5BA 3ZX5A 1F2UA 5F76A 2GWRA 3THYB 5FWXB 1JF8A 2JLRA 3IQHX 4DRYA 3F8WA 1QRAA 2NWQA 1SG6A 3VR0A 2E4UA 4R9RA 2HBQA 3DXZA 1PDOA 1A71A 1CS0B 4L0CA 4WFQA 4BVGA 5C80A 2EW8A 1SA0B 3PQ6A 2OLEA 1V4NA 2A35A 4AN0A 2OQRA 4FHGA 2QMHA 3GJ3A 1T3SA 5EXDA 4BQOA 1Y8ZA 3RBAA 1AKYA 5HJ7A 3EDYA 1N3LA 2I87A 3E9CA 1JAIA 2XT9A 3AJDA 4E4YA 2O0MA 3L8EA 1Q19A 4PZCA 3IOMA 5E7QA 3F5QA 4QBFA 4EW3A 1R12A 4KLZA 1M0SA 3N74A 1C0EA 3P0FA 3O4IA 4NOLA 3ZJ5A 5FEMA 3REGA 3ACCA 3GMIA 2ZPTX 2ZTLA 2P90A 4FKZA 4H0NA 4LXIA 3WGZA 4J0QA 4LOIA 1MJNA 1O4WA 2WYUA 4TLMB 4F9GA 1QH0A 3DHEA 3QIVA 1JR3E 1R3UA 1XZQA 3W8EA 4IDNA 1G17A 2VRWA 1Z4PX 4JXJA 5JAPA 1UBMS 1U8EA 4CDRA 4JI7B 2FEKA 1YZGA 2FMHA 4QUDA 3CSSA 5FBKA 2P27A 5JYDA 2FZEA 2JANA 4XVHA 5HGJA 3TSCA 5DGIA 4IRUB 5LQSA 4B0OA 1X3SA 1R0WA 1V9LA 2WSSD 3L8FA 4GX2A 2QQGA 1I3NA 3G6KA 5HE9A 1JDNA 1CQXA 3AJ8A 3H5LA 4JUAA 4IJWA 5PGMA 4BDTA 1KMHA 1JQ3A 5FTJA 1KSJA 1V26A 2JFYA 4RFVA 5DEOA 2GZSA 5LQKA 3A3OA 4FE3A 3L0PA 1OFIA 1SUCA 3PFCA 4LHVA 3QXSA 5A3VA 3GRCA 3ZE9A 1XZLA 4DMRA 1KMCA 3FDXA 4QUJA 2OOSA 2X4GA 3QXXA 2LIPA 2QMUA 3MWEA 4PHHA 3WYFA 1U5BB 4WH0A 3O3OB 4OIMA 4UDYX 3F2IA 2KPOA 2NXEA 4RS4A 3QPUA 4UE6A 3AG6A 1V6SA 3UW3A 3VVCA 3SWWA 1CNEA 2ATEA 2AX3A 2W11A 4G86A 2IYPA 4NBWA 3SR4A 4ZHSA 1AXGA 4YJHA 3OWXA 2FKAA 2HXSA 1LCIA 1R5BA 3QBEA 5DHSA 3TIFA 3RSOA 1ZMTA 4X44A 4P4SB 4A27A 2Q5JA 1XCBA 1E3TA 3ANYB 4PX2A 2CLLB 2P0AA 4BMZA 4M76B 1YTLA 4I1IA 2G72A 2HI0A 4J0EA 4K8OA 5JRDS 2AIRA 3LE8A 3FY4A 4XH9B 3BGSA 3VO9A 4CEJA 1YRHA 4CLOB 2I7VA 5CA1B 2ERCA 2UXDB 1A4XA 2Q5HA 2ZDGA 4MW9A 1U7TA 3TZEA 3GCGA 1A1SA 3DCNA 4K6MA 1Z29A 4FX2A 3F6BX 3E2IA 3LM8A 1VBMA 3BOSA 3BPSA 1PGNA 1W581 2I62A 3DUFA 3RU2A 4ZHQA 4CL8A 4HVCA 4ZO7A 2XWBF 2OCBA 3I28A 3ICWA 3TAUA 1KZGB 4UQLA 1UK9A 2PGXA 3AHHA 2BH2A 2JFOA 1I9GA 1M72A 1MCZA 1B76A 1Z37A 1DXHA 2E5FA 2QJWA 3LXXA 2I2FA 4X93A 4EHHA 4Z54A 5K01A 1UWLA 4UASA 2DSNA 3CQ9A 5EIWA 2EZUA 2H92A 4NS1A 3ZVKA 4P22A 1FE8A 1IN8A 1PV2A 1WW2A 2XOKA 4MR7B 2OLJA 3GUVA 4WHMA 4N7RA 5EQJB 1OI3A 4ZVMA 3SGLA 3ST7A 3HWSA 4YHBA 2H1IA 4U9IS 4TYQA 1NBWB 3VPCA 3EGDB 2QZ9A 3BILA 3EHEA 3KQTA 4YGYA 3NKLA 5DLQC 3MAJA 2O3RA 4P53A 4Q15A 1YK1A 3AGQA 3H9UA 1P62B 3CJTA 1TJ3A 3I2GA 4U7GA 2HCFA 1J9ZA 2WKSA 1QVRA 4BKUA 2DWQA 4RETA 3WRWA 4C01A 3LUHA 4D0RA 1Y6ZA 1E96A 3RAPR 5HZMA 2C5AA 4DNOA 1OXTA 1YZUA 3W2GA 2ZVJA 1EHYA 4K7JA 4UU8A 5GOZA 1FQOA 4EHDA 5HWSA 2JD2A 2OFOA 2IKQA 2B1JA 1IN1A 2BKUA 3K5HA 2WSYB 4IVNA 4NQRA 1HGXA 3HJUA 4JP8A 3GEBA 1ZVMA 1CZOA 4IJMA 4NFHA 1XELA 1ZO8A 2VBFA 3U1VA 4BXOA 1BMTA 1XU4A 4JQSA 2HHLA 3FH0A 1KZ9A 2JGFA 4M1WA 4U5XA 1HWYA 2B34A 3IHTA 3ZUPA 3SIRA 5B64A 1AN9A 5E1OA 3EXIB 4C2UA 2EYQA 1ESDA 2B2CA 2WJGA 4IEFB 4EJSB 2JI8A 3P2KA 2MSKA 1YVDA 5DWDA 2Y76A 4I66A 1IDN1 2GEUA 2IHYA 4OP3A 4XEHA 3UMJA 2QRQA 4H0FA 5AD1A 3DVLA 4L6AA 1WMFA 4ZANA 3EH2A 5CVUA 4NESA 5DGCA 5A9TA 2Q6LA 4ILKA 4R31A 1VSVA 1KQGA 2EARA 2ZSUA 3DHVA 1IEXA 1WULS 3EC2A 1QP0A 4BVAA 1ZH8A 1KI8A 1X92A 2VHVA 4LW8A 1SZJG 5F3RA 1TVEA 4AS3A 2WZCA 3U80A 7YASA 5FI5A 3HN6A 3ZY3A 5IYZA 2PUGA 1F60A 2AEMA 1GQFA 2OHGA 3NDBB 3X0DA 4MHOA 3DT9A 4FDVA 1OASA 4KIGA 4ARZA 4EGJA 1LRJA 1Z6QA 3QQPA 3NTOA 1K7XB 3UJPA 1NI4A 1UWVA 4G9EA 2Z56A 4JR1A 1JMVA 1QQTA 4RLHA 5DGDA 3UJCA 2W6JD 4QZVA 4W1QA 3R8CA 3D8NA 3LKDA 1PJ8A 2BGIA 5BMVB 1GZ7A 2XQJA 2D0OB 1Y5NA 3NNDA 1TZCA 4GO1A 4ODIA 4RY0A 3VTZA 4PG7A 2XYRA 1ZJZA 1OIXA 2DUNA 2MIIA 1T2CA 4KHZA 1L5HB 1PQUA 1PU2A 4PYRA 2QZJA 2CFCA 4YMUA 1PD1A 2GO1A 3L6BA 5ALWA 1CQZA 1OXVA 1HA3A 3EVGA 3N8HA 3WQRA 1VC2A 3OE7A 3FKQA 3GFPA 1NKVA 3L0IB 1YI0A 3EUAA 5AOBA 5FBHA 5I9SA 5ECDA 2A7XA 2QTHA 1TB4A 3A4YA 4HMPA 4NV3A 3ZJTA 3GT7A 4LEIA 5TF0A 4TLCA 4Y1EA 3TQOA 1EFCA 2RBGA 4MGKR 5FTWA 3PC3A 1KDZA 3DKPA 2P78A 3ZWNA 1DKNA 4NPHA 1JQKA 1NBAA 5CTJA 4YQEA 4BMPB 5ED0A 3UM9A 3VISA 4N5NA 3PSHA 4G26A 2RONA 1ULBA 3MIIA 2VK8A 4N3GA 4E21A 1FVXA 1L7DA 4L4ZA 4WECA 5FRDA 1A4UA 1FMJA 1TT5B 1XDSA 2O2EA 2XAUA 3KWFA 1C29B 2GBPA 2IU6A 3GZ4A 4Q4JB 1CB7A 1DOHA 1E4EA 1EJ6A 4CTKA 4AYXA 1RMQA 1EFLA 1MO5A 3JQBC 1N6PA 3BH7A 4YFYA 5BW4A 4ER6A 3HKDA 4Q1CA 1HDCA 3CZRA 2OCYC 2E4XA 4R2XA 5DNDA 5H02A 4MQ4A 5JWHA 1OA1A 1K97A 5MN4A 3WV4A 2WWXA 2ZYHA 3E61A 5E4YA 4B8YA 3H7IA 1SCQA 4K46A 4EB6B 4GOMD 3GJRA 3VDRA 3B9RA 1OBFO 2FMTA 2ZUEA 1T9GS 2AN9A 2ZPUA 4KRFA 3RBXA 3K70C 2QRLA 3CF2A 3G0GA 4FFLA 3W0LB 3WDKA 2JGMA 2R7MA 3KZOA 1ZD1A 1XF1A 3GEMA 1AMNA 3P0IA 3ICQB 2GLTA 1KI7A 3WQSB 4HH1A 1XDBA 2BC9A 2R00A 4X7RA 2GMWA 1X7DA 3MHPA 3V32A 3DGEC 4F97A 1UMDB 4X6LA 5C34B 5A03A 4GZLA 3FGZA 3ED5A 3D3WB 3EXIA 3R3YA 4G5SA 2RHLA 5CG2A 4ZVLA 4PLZA 1TJNA 3RYIA 1ECPA 4TSFD 3DKIA 2KW5A 4I50F 2CXRA 1L7XA 1NLZA 1SUDA 4JBGA 4L1KA 1H8EA 1GPH1 3DPSA 3GB9A 4FS8A 2ZATA 4PNHA 4YXFA 3W6NA 4JJ7A 1AZTA 2HA2A 5ER9A 1T5IA 3VVBA 5JXIA 1V4BA 5BR7A 2FWMX 4R5MA 4MEJA 4UKDA 1U2QA 5ELMA 1JZTA 3ER8A 1VMIA 4GX0A 1GGNA 4ZT2A 5F3WB 4FYWA 5FP0A 1FUYB 1U9ZA 2F1OA 1M3SA 3COYA 3F71A 5DLEA 3OM8A 4OI0A 5LSAA 2CNDA 1AS3A 1ZI6A 1DC4A 4HDRA 2IYYA 2D2EA 1B1CA 3A9RA 1UT8A 2ZTUA 3KM0A 1E3WB 1QX3A 4MQFA 5KB3A 1TEVA 1VSTA 2IK8A 2LZ0A 4YX9A 2YXDA 4KN8A 2C98A 3C3DA 1EWTA 3CZCA 3ETHA 2H7YA 5IWCA 5KREA 2FAXA 5TQ2B 4H7EA 2XSZA 1NA5A 1SCNE 3H9CA 2I2DA 1UDAA 4P81A 4JIGA 4FMCF 4EYKA 1LBTA 4LRQA 4GOJA 1SJ9A 4TL9A 2F67A 2J3JA 3K5IA 3OKPA 3R3ZA 3BH0A 4M1KA 4RPLA 5HZKA 1RJ9B 2IEYA 1RZUA 3TUZC 1SO8A 2GPAA 4FGJA 3L6EA 3LQ4A 4D46A 2CFRA 5C7LO 3PDWA 1NNI1 1T5BA 2ON6A 3AB7A 4KR2A 3DE7X 5L95A 4QGFA 2LE0A 1TUGA 3AF3A 2C4VA 3OAAA 4PYLA 4WJZA 3R9IA 2ZLBA 4NYJQ 5J5VA 2FSSA 4C1NA 3K15A 3BG5A 1Q20A 1X39A 1J8FA 1E1QA 2LXNA 2V3WA 3FJYA 4HQLA 1Y37A 3FETA 3EC1A 4CM9A 1CUJA 1UKYA 2JIMA 2ZI5A 3S2ZA 4M87A 5JQGA 1I94B 4ALLA 4FUQA 2DPXA 4JYBA 4Y6GB 3GMSA 4R5HA 2H16A 4X85A 3HR8A 4TWRA 1HX7A 3T41A 1A0OA 2A1UB 1ZP6A 2F1RA 3RC9A 2XH8A 2IUTA 4UUOA 2P5SA 3OJLA 1NBEA 3N6RA 4G56A 3TAXA 3UFXB 1WPXA 2WPDD 4QQ8A 2HMWA 4JBXA 4IIJA 5AVZA 4Z4CA 3UATA 1JZSA 3FUVA 2QR5A 3LBIA 2J87A 3BZBA 3CFYA 3MWJA 1YQWA 3E9NA 2C54A 3N28A 4FYXA 4R84A 3OO1A 1IY1A 1KYTA 3P9PA 4L9WA 2ENWA 2DFTA 4FGKA 2PNJA 1RHQA 5I01A 2BGNA 3MWYW 3FYUB 2NUBA 1GPJA 1YHNA 2Y93A 2ZU0C 4X60A 4RQTA 1R6TA 3RYFB 2O48X 1U0GA 4OF4A 4C7VA 2Y9MB 3WWDA 5FPSA 4PWYA 1YDMA 4OBWA 2JLWA 1BU8A 1NTRA 1YC5A 1E2KA 1P75A 2VWPA 4L3VA 3SP1A 3EISA 1ZGBA 1W5SA 3NGLA 4KAJA 3GUHA 3IEPA 5IDXA 2I5PO 5D3MA 3SX0A 1L7VC 3UANA 4C76A 2R8ZA 3DBLA 2W2PA 1T9ZA 5REQA 5DBFA 5CAEA 1X1EA 4J7UA 1ESCA 2GARA 4M8LA 4UM9D 1AQYA 2XTAA 2X15A 5T6BA 2EW1A 4EBFA 4YO8A 3RS0A 5EJ9A 3K9FC 4PGGA 1N6NA 2RH5A 2KJQA 2O5EA 4OBBA 1L3CA 3TLBA 3NPMA 4XARA 2EBUA 2ZVPX 1NRIA 5JZMA 1P5ZB 1V8OA 2DTXA 3HR4A 1DG9A 3K2IA 2D1QA 3HZOA 3LX8A 4JQZA 4M9ZA 1JJAA 4Q7JB 4QGAA 4XDZA 1JKJB 4RVGA 4LHEA 3KS9A 3FPCA 3L7AA 2YWJA 3QLVC 4ZA2A 2P9ZA 3N0TA 4Y6PA 3DMTA 2O8NA 3CNLA 2FFQA 3DEKA 1DO2A 2A67A 4OI4A 4Q7KA 5K51A 1LI7A 2JL1A 4YK7A 1HH4A 4K6KA 4I55B 3RAFC 3OLWA 1EVEA 5ALLA 2EP7A 3A2MA 1JS1X 5T6MA 4LGMA 3FCAA 2LW7A 3PXEA 3THRA 2UYCA 5JS6A 2WE8A 4OIFA 2G5CA 2RG7A 3G0CA 2QU8A 4M0EA 2AG8A 4F5EA 2J7PA 1NXQA 2PYIA 4HPXB 1Z35A 3U3JA 5JZSA 4HNAB 4QOSA 2P6MA 1YR6A 1C9YA 3IAAA 2A5JA 2RK3A 4C43A 4I1OA 1EVYA 1DTWB 1UOEA 4I9FA 3S2IA 5JS8A 4JZYA 4DZZA 2OA0A 1XTPA 2Y9PB 2C8VA 2ZZKA 1YOVB 1N6HA 1YZVA 1ZU4A 2VYQA 3I4LA 1U2DC 1MZVA 3QU2A 3QUTA 1I2AA 2IYXA 4LF4B 3V4OA 1UPTA 2BM8A 3VNAA 3KKQA 1J9EA 2GD6A 4OQLA 2X2FA 5GV8A 1JEYA 4PIMA 5C46F 5TY0A 3T7TA 2IT1A 4RORA 3VYWA 3TH5A 1WD7A 3EW9A 2JIDA 4C4PA 2CYBA 1UBUS 4O1MA 1JE1A 4IIJF 5DYTA 4Z0HO 1Z6TA 2VVTA 2YN0A 3LVQE 4M22A 4UAGA 1EGQA 3L0YA 3LY9A 1E1KA 3UV3A 2H00A 1S96A 4HZGA 5DN9A 4QGSA 1ORWA 4GLJA 2I2WA 3TZ6A 4UMVA 4KDFA 4RFSB 1XC7A 4N4AA 2AN1A 4F4UA 2UV8A 4RENA 4FOLA 4J7XA 4EPVA 1W0JA 4WBSA 2CYCA 3P4YA 2AZTA 4X97A 3TIXB 1B93A 5K6TA 2YTZA 3KQVA 4HC4A 4L8WB 2QQEA 1YQXA 3WGIA 2R65A 2Z8YA 3H05A 3JZDA 2DBZA 4C0SA 2HCBA 4ROTA 2RH9B 5JAHA 4U39A 3VJLA 2DPGA 4BVHA 1YK0A 1YQDA 5DP1A 2PPLA 2BRUC 4K8RB 3VJMA 1OC4A 5I3CA 3NUQA 3NHUA 3OC6A 2V4UA 1G7TA 3A1FA 2EF1A 2PSFA 1OF1A 3CR3C 5HKLA 2Z5GA 2YXBA 2G04A 3VDXA 3FVVA 3GCZA 3I6IA 1PS8A 1KQFA 2F59A 1P2BA 3FPKA 2FMIA 3Q2OA 4HLNA 3M6XA 4F1WA 5KQGA 3WL5A 4IIGA 4QECA 5F51A 2H31A 4DIUA 3FR7A 2J5XA 4L51A 4QBGB 1T5DX 1L1EA 1OLOA 4M9UA 3RKSA 4J0FA 3RQSA 1QHEA 2G77B 1GD1O 1UK6A 3S2UA 2FJ0A 1UJ2A 2D54A 5F5NA 1XIVA 3WFIA 4I4TF 1T9BA 4QPPA 1NIJA 4N12A 5I7HA 1HG0A 3KK0A 5EHGA 3RVNA 4JI5B 3U3XA 4EG1A 1GCAA 1NIPA 1II0A 4URZR 4CT5A 2WHEA 2YWXA 4L8LA 4QUHA 3DKKA 4BBAA 4A16A 1NC1A 1LTHR 1SOAA 4I50A 4MR9B 4PWZA 5KJ1A 1M67A 1KAQA 2PUAA 1G5RA 3PJRA 3RC7A 3R1IA 1FX0B 3MWGA 4HQOA 4A0FA 2WFMA 1PR0A 3QVTA 3PWZA 1RYNA 2WPNA 3U16A 2Q9BA 1CRLA 2Z57A 2G4VA 2XDQA 1R10A 4EY3A 4ENPA 1IHXA 5A4DA 1TK9A 5BN5A 2IPXA 1FRNA 5EIHA 3SIXA 4M9CA 2MMGA 3WZ2A 1IY2A 3D7LA 4FGUA 1N25A 2C5LA 2H4ZA 4KDEA 5EJGA 2QJTA 4WKPA 1GPKA 1E9SA 1T15A 1CIJA 4RWZA 2ZDQA 1Z38A 4AT1A 4ZCRA 1D6SA 1K5PA 3GXOA 3J81k 3E53A 5CCEA 2QM7A 2QKYA 2VJLA 1M8KA 4QXPA 1S4MA 2EBHX 2AG5A 1ISSA 2R1VB 3ZY2A 1EFRD 4JBIA 1U90A 4RWEA 4GYYA 2NXWA 4D81A 3KKPA 1PL0A 2YFYA 3FDZB 1F6BA 3AVTA 1XJQA 1QHGA 2M9MA 3DPUA 1MP0A 1XCOA 2YIMA 3HB9A 3IB6A 2QB5A 3V7YA 5KHOC 2FRVA 2QU7A 2BFDA 4TLDA 4MJLA 2A1IA 5DK6A 1AKWA 3GA0A 2IHKA 1KZ6A 2B7BA 3A31A 1QDUA 3F7MA 1E2PA 3FPGA 3JQGA 4MKHA 5D8DA 5EIBD 3V48A 1ZN9A 5LYJF 3UZUA 4ZOLA 5AW7A 4X7MA 5GOTA 5HIKA 1K4MA 1Z62A 2PVPA 3T5MA 4JUBA 3KQMA 1G8HA 3DLPX 1S01A 1GUDA 2JDID 4Z9XA 4ZJPA 1E5LA 3WRYC 3IIKA 5D3QA 4RELA 1B6SA 4MYHA 5IVPA 5KX5A 3OE5A 3WHPA 2B1QA 5E3JA 1Z0IA 2X9NA 3NU1A 4TXHA 2TECE 3N0RA 4WBNF 1I5RA 1EGAA 5JSFA 1U0FA 2VDUE 2O3SA 3ZLBA 3WNZA 2RHTA 3UKOA 2FDRA 1E3IA 5FUMA 3CUYA 1P4AA 2E21A 4QTZA 1P91A 3HEAA 3TVDA 1A9PA 3GFTA 5K7SA 1FYVA 4AJKA 1WHTA 1MQ9A 4GSKA 1P7ZA 3FWNA 3GRAA 5H70A 3Q9LA 2FR1A 3OX2A 4FDLA 3REOA 4ENTA 4DC1A 5AK3A 5A5GA 1RFLA 3LT0A 3BJRA 3DBIA 3T5TA 4BGIA 4I2NA 1DXQA 3PYLA 4WBNA 5IDQA 1QS0A 2D0IA 1OI7A 2FDXA 3GNQA 4YLYA 3DDZX 1P0MA 3DEIA 3MS7A 1EWVA 4DNQA 3I32A 3D3NA 4DFDA 1QK5A 4MVJG 4YMVA 1NVMB 1VL6A 5TMBA 3ZU4A 4E15A 3OBBA 2IF2A 1PWYE 1W30A 3IT0A 1NF8A 2PN1A 1GZSA 4O6VA 1WUKS 4R2HA 3WLAA 4DYVA 1OYWA 5E8RA 2GS9A 1KFCB 4A0GA 3OZEA 2PD6A 3QYJA 1TM4E 2XVMA 1T4CB 5JY6A 4P3XA 3M9WA 1M34A 4R2KA 5CNJA 4ENRA 1J5PA 1AKEA 4LOHA 4UQOA 1MB9A 4QOFA 5BVHA 1G5TA 1U0HC 3ZZNA 1NW6A 5AM3A 3PXXA 3ZU2A 2P5UA 4DJAA 1CXZA 4JSRA 1UPBA 4KEAA 1HTTA 4KRGA 3TFWA 4F84A 4G37A 1G21B 1E1LA 4QO7A 5AK0A 5BMVA 1XWWA 2JJ2A 3AR9A 4IVRA 4M86A 2WUWE 2IYFA 2P9HA 3C5HA 4KCGA 1K3UB 4DQXA 1QP7A 1QO0A 2G80A 1S5PA 3GROA 3DEJA 3C3CA 3N0WA 2FQQA 5FOXA 5TSDA 5J2UA 3KQQA 2BEKA 2R6ZA 1RQ2A 3ZWKA 3IIJA 2P4QA 4DS3A 2HLHA 1QGAA 3AOGA 3FSEA 1JHOA 1KZ4A 1ZSVA 2GN4A 2JK0A 4Y2XA 3ZE2B 4D8TA 3HNPA 5DGTA 3EFEA 1NVBA 3HLYA 2ECQA 2A1TR 3EQ8A 3FNHA 2RHWA 3KVVA 3PR3A 1J1UA 1FTQA 3OQIA 5BXQC 1SBQA 1GGHA 4EEZA 4ZALA 1F8XA 3GR6A 7AT1A 3AM3A 3STXA 1XTQA 2VPIA 2X8WA 5MGBA 1IXKA 3QKSA 1Z83A 1ODJA 4B71A 2VPQA 4UHKA 4B46A 2I67A 2B83A 1B15A 3H2HA 1O8CA 4FJ2A 1SXJD 4DCGA 5JQWA 2Q9CA 2XF2A 4NBTA 5ICSA 1IUNA 2WD7A 1H2AS 4DR6B 2UKDA 3BRWA 4EUNA 4KQIA 4LFBB 1QSGA 4TOIA 3VZQA 4MGIR 4Y9SA 2X0EA 1C7FA 3BD8A 4NMHA 4RMJA 1ORHA 2C7BA 1C14A 4GQAA 3A3YA 4QBIA 5LYJA 5TS2A 4ED9A 3TG2A 2BHLA 1GN9A 2XMBA 1XAGA 4IS3A 4AY2A 5IC4A 4ZK2A 1Q84A 3AUAA 3WIOA 1X2BA 4EG8A 5A4JA 2MYNA 3W2FA 3BBPA 3HU3A 4JQCA 4RGYA 2H7XA 4PYJA 4J07A 5K3BA 3NYIA 2BAGA 2I7XA 3MLAA 4EUKA 2KB0A 2JGNA 5G3ZA 2CB9A 1CUYA 1QIKA 4PQFA 4R6WA 4YRJA 2ZM6B 3WWEA 4AQ7A 2BONA 3DXXA 2VKTA 4YYZA 4LZAA 4KE9A 3PE3A 4DLRA 2Z4SA 3FXAA 1DVRA 3N2YA 3MT8A 1W1UA 5F21A 4N6GA 4LVCA 1P9NA 4HVAA 5FUBA 4EQZA 1D2MA 3DZGA 1H2ZA 4KU4A 3G9TA 1YASA 2FW7A 4QXMA 2ZITA 2D62A 5D85A 5BSVA 3LNTA 1MB2A 3SSNA 2I33A 4QXOA 3Q7EA 5D3KA 1NZJA 2AFHA 3G0HA 2YJGA 3RYTC 2E1PA 4M1SA 3KJHA 3PZRA 2ZIVB 1K0UA 4HQNA 4MDHA 5CW1A 5EZ5A 1AA9A 4DAOA 2XUGA 1JDJA 2HJHA 1GCGA 1QTRA 3EGCA 4BKPA 4UPEA