4HDSA

Crystal structure of arsab in complex with phenol.
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
338
structure length
333
Chain Sequence
SLLQATVAKIMRPDTVIKDQVKTKLAGVLQSAGSLGRLEDMVEQYAGITGELNPALPKPCMVVASADHGVARRVVSAYPIETTIHMTANYLISQGASANAFANFCGADMVVVDMGVAGDLSYVPGLWHRKIAYGTQDFTEGPAMTREQAIQAVETGIDIVNDRVKHGNRCFCLGEMGIGNTTSSATIVGAFTGLAPEKVTGRGSRLKTKMEIVGRALAVNKPNPQDGLDVLAKVGGFELGALAGVILGSAANRCAVVIDGLNTTAAALIANVIHPLSKEYMFASHLSGEPAHSIALRQLQLEACLELGVRLGEGIGASMVVDMLYVAIKLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ArsA
publication title Structural Insights into the Function of the Nicotinate Mononucleotide:phenol/p-cresol Phosphoribosyltransferase (ArsAB) Enzyme from Sporomusa ovata.
pubmed doi rcsb
source organism Sporomusa ovata
molecule tags Transferase/substrate
total genus 125
structure length 333
sequence length 338
ec nomenclature ec 2.4.2.21: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02277 DBI_PRT Phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1610.10 Mainly Alpha Orthogonal Bundle 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 4hdsA01
3.40.50.10210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hdsA02
1JHXA 4KQKA 4HDNB 1L5KA 4HDRB 1JHQA 1L4LA 4HDKB 4KQHA 1L5MA 1L4BA 1JHYA 1L4KA 4KQFA 4KQGA 3L0ZA 4HDMB 4KQJA 1D0VA 1L4NA 1JHUA 4HDRA 4HDNA 1D0SA 1L5NA 4HDKA 4HDSB 1L5FA 1L4HA 1JHRA 1L5LA 1L4MA 1JHPA 1L4GA 1L4FA 1WX1A 1JHOA 4HDMA 3U4GA 1JHAA 1L5OA 1J33A 1L4EA 4KQIA 4HDSA 1JHMA 1JH8A 1JHVA
chains in the Genus database with same CATH superfamily
4Z49A 1XKXA 5J23A 3LW8A 4FDMA 1ZGCA 4ZREA 2P4SA 3WAKA 4BKPA 1R0XA 1ORTA 4L6AA 1DAHA 2UKDA 4GF5A 4O5OA 3KCQA 4MWTA 4P80A 4RZ3A 5EZYA 1CY2A 1E4VA 1POWA 4NBKA 3A28A 2BHTA 4X41A 1J39A 1PX0A 1W85B 2UU9B 1CWUA 4YP6A 1GGNA 2ACWA 3AEKB 3IUBA 1G60A 2X76A 2KHZA 3NKLA 3U7HB 2IOHA 4DSOA 3P4UA 3PIRA 4R69A 1AQYA 1L5LA 3W8DA 2PT5A 1J09A 3EJ6A 3SS9X 2ZIZA 3SIPA 5IH7A 2HCJB 4LBWA 3T9FA 1SKQA 5IDXA 1AV6A 2ORWA 2HTEA 1Z6YA 5G0TA 2NUPB 4GKBA 1H3FA 3CM0A 4Y2TA 5F9MA 1JDBC 3SYTA 1JFVA 1LPOA 2R48A 3NJ8A 4I9HA 4UUQA 3BD7A 5GONA 2Z43A 1QKKA 3DFZA 3NTUA 5KTOA 3MUNA 4MVJI 3T5AA 2QTCA 1N77A 3KR9A 5AK6A 2NU6B 3AB8A 3RUAA 5AW7A 1MH1A 4UJ5A 1ZNYA 4QE3A 3KTAB 4KZPA 4MUXA 1I9CA 1KMQA 4MQBA 2ZJ6A 1DO8A 4NH0A 5SY4A 2CNKA 3RC8A 5CA0B 4Z1OA 4MAAA 3BWEA 4W82A 3MJ4A 2XSZD 2YIJA 4GZMA 4HF7A 4FBLA 1JKJB 4TTQA 3TTTA 2BFNA 3SZGA 5J3JA 2O8FB 1EJ0A 3OCUA 4KPGA 3U0BA 1NMXA 3QFRA 4P98A 3KUUA 1IL0A 4RPIA 2NVBA 2PKQP 5IM4F 2WP8J 4BGUA 1Z0FA 1UKCA 5T6MA 3BQ9A 4AK9A 5B3LA 5JSYA 4TM7A 3CRNA 2XVAA 4ALKA 1H0KA 3UMGA 4HT3B 4UHHA 3ANTA 3D0RA 1GLNA 3FFXA 2PL3A 4KCGA 1CUFA 1FL9A 1TZ2A 3BWVA 2BAGA 3G8BA 5EMNA 1C4OA 1VJCA 3RASA 4NESA 5JD4A 1DCFA 4YFVA 1WZNA 2XT6A 5CK4A 2WA2A 4C4PA 4NPAA 4PZUA 1FSPA 2HBQA 4O4LF 4Q03A 3WK6A 1FP4A 3GL9A 1I4DD 3TBKA 3K6KA 2AEMA 1K86A 1P72A 4JDUA 3CTMA 3ROZA 1RAAA 4ES6A 1IQ0A 3O8LA 3EMBA 2O1XA 2QENA 2O2GA 4BX3A 2FKNA 5BW4A 1K7CA 4G8JA 4CKEA 4N5IX 3GHHA 4HLQB 3WWZA 4KRXA 3F6PA 4N5NA 2GETA 3KQNA 1Z4KA 2XEDA 3UMRA 1N34B 3PNVA 2HGSA 1JJIA 1IE3A 4HGRA 3M83A 3GROA 1WXHA 3RFVA 4B76A 4ZOQI 3AY6A 2FPWA 5A3QA 5BYKA 5LYJB 2HRCA 2HZ7A 5EVCA 4XM0A 3ROXA 3W1EA 1DT3A 5JSFA 3DBLA 1SZPA 1Y5MA 2VWPA 4U9HS 4AZWA 4A6DA 4O63O 4DFDA 4L0DA 4Y9UA 4WY2A 4YS6A 1F3LA 3A1NA 4MINA 3PF8A 4PZ0A 4UNRA 2MR5A 4XKJA 3DGFC 4P3NA 4DPLA 4UULA 1KY4A 1HT0A 3RK0A 1UXOA 2J4CA 2QA5A 3DZDA 4IHQA 3DP7A 1I01A 1PEKE 1YR1A 1KFEB 2C9YA 1BFDA 1U9IC 1UKBA 4LAFA 3STUA 4IGIA 5A9SA 4BE4A 1YFKA 4DIOA 3LI2A 3PG5A 1HQCA 1XZQA 4ND8B 4R54A 4WWHA 5JSHA 2ZIXA 3CZMA 3OCVA 2I8LA 2R62A 5CMLA 4YRRA 3W6ZA 4Q4CA 3H3JA 3ZY3A 5KDOA 5A3VA 2P6UA 5B7NA 1P39A 5DCUA 5D7BA 2YWBA 2YQZA 3R20A 2OFPA 4XA8A 2R9VA 1QQAA 1NVVR 2GZAA 3VH3A 2JGLA 5HQJA 1L7MA 2FUG1 1Y3HA 1FTGA 1MEEA 2NPFA 1D6MA 4E21A 4C03A 2V7XA 3CUWA 5FRDA 3BA1A 4BMPB 3DGEC 2P8JA 4Q9DA 4LC1A 3NZEA 2JFBA 2Q6KA 3OOYA 2EATA 4PO9A 5CTJA 4CYMA 3VAYA 4TT3D 2PT6A 3ELWA 2FRDC 4F3YA 3GCGA 3VKGA 4H60A 4X8OA 4UZSA 4LNUA 1W87A 1NFFA 4EENA 3SOPA 4H59A 5HPYB 1MPXA 1QC5A 2JIOA 1QHYA 3H9BA 3ADDA 1EESA 4FM9A 1XXHE 4CFYA 1I36A 1GG5A 2O6LA 2OAEA 6YASA 3H4IA 4K6FA 2GPSA 2GK3A 2ZCUA 1H42A 5FWXB 5LB2A 4ND4A 5E9AA 1OYYA 2C5AA 1TF7A 2MT9A 1Y7TA 3AVWA 2VTEA 1MEJA 5ICFA 2HA7A 4HXGA 3QU9A 4RVOA 3SX0A 4PPQA 2X8WA 1MEOA 2QDKA 2DPLA 2R8ZA 3FMIA 5DJ5A 3VU9B 4LVCA 3PFCA 5DISB 1N5MA 1OAOC 2W43A 5EE9A 3CGWA 3RC3A 3MPOA 2WE8A 4E4YA 1GXSA 1R0BA 2DFNA 2V1XA 5EHIA 3WOHA 3OX3A 1F0YA 1A76A 3IOCA 1E2IA 3GB9A 5FR2A 1RWPA 3QMWA 1NV8A 2P79A 3V1MA 1H0SA 1FP2A 4ID3A 3RRXA 1Y3DE 3IJRA 2NTVA 3QEOA 4JJGA 5TQ2B 5LMUB 3TI7A 2VZ8A 3IB3A 4KRGA 2GZMA 5HR5A 3M5DA 3T3NA 3EIHA 1WKCA 2A5FA 2JGRA 3ETHA 2YBDA 4HNTA 1VPTA 1H5QA 3ZDEA 3UPUA 3D4BA 1RM0A 2R6HA 1JHVA 2FN4A 5CM9C 1PR4A 3GJ5A 1IYZA 4P36A 2A5DA 1ZLYA 2SKCA 3NIGB 3E5HA 2VHUA 4RV9A 4X1OA 5CB6A 4W5JA 3L5KA 5CBPB 4YRCA 4KO1S 5BSUA 2ZTHA 4F9TA 2FG6C 2NIPA 2NSLA 4QVGA 1FB5A 4YH1A 4FB4A 3RRYA 4E6PA 2DWUA 3VPCA 5JHHB 5JCOA 1JNXX 1T0JB 1ZU4A 1ONPA 1XYGA 2I4NA 3QXCA 4GUAA 3TH5A 3SQOA 1ZH0A 2W2LD 1UK8A 2HI0A 2XCTB 4OXRA 3U4QB 3CINA 1HMPA 3W7VA 5IXSA 1ZD3A 1CUIA 2RJ3A 2RH9B 4X64B 2E48A 1LJLA 1RVV1 3BQNB 2FUEA 2R8PA 4HUTA 4OQPA 1T3GA 2VOJA 1OKKA 4GBGA 1UANA 3KFXA 1RVDA 5DOZA 4CNQA 1P17A 1Z25A 2GJSA 3ZE9A 1JYEA 1N1EA 3R3JA 1HNZB 5HZGA 2N1MA 5GVSA 1R0WA 4DVGA 2GVNA 3H5VA 1X1EA 3P97A 1XRMA 4ZZ3A 1QOZA 4NHEA 1S7CA 5EJ5A 1DIHA 2ADMA 3BE5A 2A6PA 2I4TA 3DR5A 2RCNA 1FJHA 1S96A 1W52X 2J5XA 2KLHA 3R7WA 2RI0A 3S28A 1P0IA 4D4LA 4EY6A 1DINA 3JX9A 4RLFA 3ZKAA 2DSTA 4C6TB 3IDZA 4ZIRA 5FHQA 2VC2B 2AQIA 2ZI6A 1EGVB 2HEGA 3B60A 3NOOA 1W2GA 1OI7A 3L6OO 3NHSA 1C1DA 4GI7A 1IUKA 3LD9A 4H77A 4JJ4A 5LA6F 2O2CA 1N0VC 4P81A 1N1MA 5I8ZA 5FUWA 3HUFA 5JQGF 4FHZA 3DZCA 4IWNA 5HGXA 3NHPA 4CQMA 5JZ9A 3TKYA 2QK4A 1XJ0A 3HFSA 3WS7A 4R40A 5CBKA 2FZLA 1R9NA 4JOCA 2PN1A 2O0HA 3HKBA 3DHEA 4M1TA 2FE4A 4A0FA 3AI2A 1H4TA 2Q0XA 2DBRA 3G89A 4RD0A 1XC7A 1K66A 2XWQA 1Y3BE 1DAOA 5CCDA 3U5TA 5C5EA 3PRHA 1L5ZA 4ESEA 4RAOA 2SCUA 2BD0A 3B8HA 3AF0A 2G82A 4ZJPA 5B6PA 1O7JA 3U60B 5K3EA 1ZVMA 2YNMD 4GLLA 4JELA 4H7FA 3RABA 1WU7A 3HBFA 4KO8A 1RBYA 1UL1X 2IKQA 1NQTA 2JGKA 3LCUA 2XYVA 3OX1A 1O8BA 4X63A 4TV8F 2NV0A 3WK7A 6CHYA 1VHQA 1SK8A 3MS4A 3QY0A 3RVQA 1EVYA 4OU5A 1FLAA 4LGMA 4A0QA 3CLSD 4UAUA 1JVBA 4C7BA 4MITA 3B3QA 2BFOA 3PDIA 2VDWB 3TVYA 4ROTA 1A2QA 2EJVA 5I9MA 1UBOS 2GO1A 4Q3OA 4GS5A 4A03A 4AL4A 4YAGA 5HKKD 3T1HB 4OLHA 5G4LA 1A4XA 2HT6A 3E0QA 3HUUA 1QTIA 4DV0B 5CIYA 3KZNA 3W3ZB 5HSGA 5KX5A 1P91A 4MV5A 1WPXA 2IVZA 4JUDX 1Z5UA 3D1JA 4HEQA 1KDTA 5EPEA 5JH7B 1E2PA 2GR9A 3T95A 3PLRA 4H27A 1IY8A 3DFMA 2DP4E 2QE7A 3KPWA 4LISA 2W98A 3G2NA 5LJLA 2XB6A 4YDSA 1A9YA 5CDSA 2X5XA 1QCDA 4L3OA 2JFHA 3HACA 3N3BC 1MOZA 1T5DX 4EITA 1YHNA 2I4MA 5JBQA 5EJEA 3L40A 4Q1EA 4IDNA 4G4GA 3I9KA 4ZRMA 5HIKA 2GEKA 4CEJB 4EYSA 1B0AA 1QB8A 2GF0A 5PNTA 2J45A 3BFKA 3KTFA 2W2NA 2X0FA 1ZK4A 5IT4A 5JZVA 4QOGA 3U0VA 1VIAA 1CUAA 1QO0D 3K8QA 4WN9A 2YL2A 2ZYRA 1T4CA 3I4FA 3MIZA 1V45E 4KKXB 5DWDA 4EHAA 4BVAA 3NEJA 2JLYA 5DSXA 4RZIA 3H99A 4X1KA 1L4GA 7REQA 3GZTB 3IIIA 2C58A 3JD2A 1Y34E 1ZI8A 3GLTA 4ZEXA 3DA8A 1S8OA 1ZNWA 5EWJB 4F71A 2C07A 1I0IA 2NO0A 4FFOA 1R2QA 4YUAA 1I3MA 2QRMA 4RJ2A 5IW8A 1W5EA 4GX1A 1IMOA 2VYVA 3LRXA 2NX2A 1B3RA 4P3PA 1XO1A 3LBHA 3I04A 2Q5IA 1QZXA 5DBHX 5DSZA 5GZ6A 2G28A 4HOYA 4QGAA 3EIOA 1VB5A 2WDZA 2WM3A 1WDMA 5F1PA 1MA3A 4AURA 3OKFA 4N5DA 2LTAA 4QT0A 4HVTA 3GWZA 4OHRA 4TN1A 4O29A 1OBFO 3UH1A 4BFXA 4MV9A 4W5RA 4MP6A 1G4HA 3BMQB 4R51A 4NXNB 1YK1A 4RCZA 1IRIA 5EPOA 4ZO8A 1CZLA 2NXNA 3L1IA 1DQNA 1EE2A 4CIXA 2GKSA 1EUZA 2I1LA 4GKVA 2CY0A 2IQIA 4UDNA 1W85A 2C98A 3I32A 3R0VA 4BWFB 9ATCA 1HLPA 4KDCA 4WY5A 4YMVA 4HPJB 4XFDA 5TLSA 1PNTA 2F9MA 2QU7A 3QJYA 4A8HA 1EJ2A 1GUDA 3AZQA 2WHEA 4BQFA 1JEAA 2QAJA 4WUVA 5DN9A 5CX1B 4JI1B 1TVEA 3KR1A 5EEGA 3NT5A 3VSBA 5DM70 1RKUA 3NFRA 2QZSA 3F67A 3VR6D 1QAQA 2QS9A 1EAYA 2ODTX 2NUPA 3LH5A 4J0GA 2Q99A 3OZTA 3LIIA 4MW0A 5JWHA 1GR0A 3VYVA 1H2RS 1OWLA 4ZU1X 4AJHA 1BXRB 3KP1A 2JH8A 3DVRX 2CJYA 2C5HA 4BIIA 4G81A 5HTOA 3E22B 1YZFA 3R2JA 4RGYA 3TGWA 4GX2A 4AMUA 1ECFA 1WZ2A 1ADFA 1BHO1 1X9GA 5L3RA 1LF5A 1DMRA 2CMGA 2NU6A 1A72A 3GFSA 4B4OA 1VLMA 3DMDA 4NTZA 3ENNA 3PL1A 4R1OA 1U1EA 1YQXA 1J8QA 3KTAA 3PC8A 2YRFA 3KLOA 4GBED 4YJGA 3PQCA 4R2IA 3SZRA 5JWOA 3W5DA 4YUYA 3SK0A 2ZUVA 2BGGA 4EHIA 1JDUA 3OVMA 3PJEA 5CA0A 2WR8A 2XNCA 1TTTA 2DY0A 3K0CC 3TE7A 2DJIA 1IBCA 1RHQA 3HVIA 1G5RA 2R6CA 4BEBA 1XR3A 2O8FA 3VU0A 1PUJA 1FMJA 2NN3C 3HNPA 3VNAA 3SJZA 4NNJA 3PWZA 5JJKA 1T10A 4MJ7A 2ZRNA 4EJ2A 2BFEB 3PYXA 5G40A 4G0PA 2TYSB 3JQGB 1AXEA 1OZ0A 5T64A 2ODWA 3TW0A 1H2XA 1KDPA 3JD0A 2B25A 4QM7A 2UUCB 4OB6A 1L7PA 3GUHA 5BN5B 5PGMA 4E6EA 1XPJA 4ZVQA 2XYQA 1BDJA 1GITA 2H6EA 2JATA 4HNSA 3O0DA 4Q19A 1PD1A 3GGDA 5FUYA 2QG4A 1GUYA 3PGLA 1NJGA 4GI5A 2XY4A 5EERA 3P20A 3QVOA 1N6OA 5JI2E 3MF4A 3KDSE 3ZHCA 3B1KA 4FFVA 4JJKA 2VDJA 1KEZA 3NRJA 1FJ2A 3NB0A 2VRBA 3QVXA 4MV1A 2Z2IA 1VSUA 3OEED 1L6RA 1ZK0A 4PPYA 5ARBA 1L8OA 4EP1A 2UUOA 3BRQA 1JE1A 3LYLA 2OXRA 3HDGA 4W4TA 5GTDA 4BMNA 1T6ZA 1Y3FE 1GG2A 2QI9F 1FXWF 1WUKS 4NMWA 3UA4A 1D0IA 3B1JA 3EXFB 4FYVA 3OJCA 1F3OA 4AIIA 3RAFC 2M6SA 3MS2A 1Y6GA 1Z33A 5HCIA 4FQ7A 3A58B 1N6RA 1Z8FA 3HE3A 3HN6A 2M6RA 2ZRJA 4UUNA 1O6FA 1GA1A 4I4CA 4D9FA 4IFIA 3LECA 3GCWA 4LQDA 3UTDA 2O23A 2IL1A 5TPZD 1HORA 1DAEA 4AMGA 1VSQA 5DB4A 1TA9A 5FOSA 3BCSA 4I14A 3V2IA 2DR2A 4XTCS 2ZYGA 3S68A 5LDHA 1TCUA 4P08A 2I7CA 2Q7OE 2HK8A 4Y6OA 3SCZA 2FR8C 4A92A 5KNBH 4HDCA 4ND8A 1P7WA 5FWNA 4NIMA 3RUCA 1AKVA 4TTAA 4YMLA 1BHJA 1E3DA 2XMQA 3HWX1 4CIDA 2H4WA 3NEAA 2JLRA 1U31A 3C7CB 1FYEA 5HCNA 2FVYA 8AT1A 2Y0DA 1ZUD1 3LLCA 4G2TA 2N47A 2P41A 5LLSA 4GZ5A 3CLVA 1CB0A 4K6GA 1XB2A 4TWBA 1Z7YA 2X58A 3KIPA 3D0QA 5DM60 3KSBC 4JB0A 4CQNA 1WQ1R 4GMGA 1KK0A 4KWIA 1STOA 2E7ZA 1PF7E 4FDTA 2R65A 4J1SA 4BP1A 4EHDA 4ZCIA 4MWOA 5IJWA 3OPVA 5JTTA 3IPYA 3GFRA 2YKGA 4BN4A 1W36B 1LC3A 1AUOA 1TQHA 2W2TA 2CL5A 1W76A 1WLSA 1WXDA 4TXHA 2VXCA 2ZVPX 5LL6P 1VBFA 1M2JA 2M98A 3ZJVA 2YV5A 2JIQA 1I3KA 4I0WB 1CZNA 2R3SA 2BMJA 1GQ2A 1JR2A 3KQPA 2RK4A 3IDOA 5CDUA 2NTEA 3CY6A 2HDOA 3WFIA 2FDRA 3WWCA 1UP4A 3ZOKA 1IB6A 5TQVA 1OWOA 2WSMA 4DA9A 1JLMA 3GMIA 5AVXA 5AM5A 3LGXA 2ZDGA 3QX9A 4LJ7A 3D5EA 3JQFA 5K0EA 2PMKA 5FWXA 4CV1A 1ZP6A 1ZVJA 3LXRA 5D7NA 5E0KB 1E8NA 3T34A 3TLEA 3RF7A 1XCJA 4MGEA 5IFKA 3FCUB 2OOKA 3OFSA 5A7HA 3ZGXA 3MNFA 5EKSA 3D6MA 1YR3A 1T2NA 2XF2A 3L84A 2AZMA 1NBME 1ILEA 1YOBA 3PD7A 1Z13A 2AUTA 4R9SA 1AHHA 1DBPA 3L07A 3VMMA 1HOTA 1RBQA 1DX9A 2C8VA 3I2JA 4LZLA 5DK4A 2WTEA 2YUIA 3QITA 1Q0TA 1J21A 1E64A 1W94A 4F6RB 3AR2A 4NYJR 5K8IA 4WADA 1QDEA 3EUEA 2AXNA 1QF7A 2OFOA 2YN4A 5KJ1A 2C92A 3LA6A 2OWDA 3DOUA 4J4HA 2EFJA 5KS2A 3PWSA 3IB6A 3SG0A 4DDTA 1FUIA 4LBVA 5HUQA 1O0BA 5TQ2A 2ACKA 3VRHA 3EW7A 4JSYA 4LZOA 3BJRA 1G19A 3HV0A 3JQPA 4Q37A 4YREA 3AUXA 1T0BA 1XRNA 3CN7A 4FEGA 3RPEA 1K7YA 4R3NA 4LPKA 1R4AA 3P2KA 1N0WA 5C0OE 3UWSA 4CIBA 5KYUB 3AVOA 1G21B 3C70A 4UU1A 2K7ZA 2CCJA 3AG6A 1IEXA 2GJAA 3AFMA 3DL0A 3N59A 4X92A 3TSOA 4BO1A 5KEIA 2JFUA 3PHHA 5G3ZA 4DLVA 2BKVA 2Y0PA 1NHWA 4BO0A 2SNIE 2XUQA 2Z5FA 3FROA 5CBPA 2GXAA 3ZCTA 4ZQBA 2ZI4A 4N5HX 5IM5A 4GBMA 4JJAA 3FSEA 4AKSA 2YWJA 2ZR9A 4WCFA 2W2XA 3HGQA 3V4VB 1XTJA 1NLMA 1E59A 3JAKB 2HYDA 1BJTA 3O2SB 1GAJA 4OD0A 4TTIA 1EXVA 4QU9A 1Y5NA 3JVUA 1OBVA 4C4OA 5TDHA 2XWPA 1S8FA 2XKBA 3MSCA 2UZ1B 4GLOA 5EUMA 3U4QA 2VYNA 1PR0A 2DHEA 4M9XA 4QU0A 5KQGA 1DJMA 1P2SA 5EHXA 3UWKA 3O9ZA 2VTKA 4WZZA 5IN4A 1VJDA 4OCZA 4C4XA 5B58C 3T5MA 1TF5A 5F73A 1ADGA 2EKDA 5D5HA 4CHGA 3H2BA 2PO5A 4TS4A 5C3MA 1FFCA 4X3PA 4K03A 4JVNA 1CW2B 3PCXA 4MZDA 1FMTA 4F2DA 1RT9A 3T1TA 4DDUA 4E33A 4LOHA 1GPLA 1I2AA 1T5BA 1Z6PA 1A3CA 4JKYA 4C6TA 4OIMA 2WYIA 2J67A 4JYBA 5AICA 1R0SA 3K9QO 1TCVA 2XNJA 5AOAA 4D98A 3L4BA 7MDHA 1UZLA 2R0QC 1YHZA 1ORRA 2XGOA 4AUNA 3GLFE 3CT4A 4FCVA 2Y1EA 4HYYA 3OD1A 4CE6A 1CR2A 2DULA 3O8NA 3C3PA 4DLZA 1PG0A 3TF5A 2VWQA 2Y1DA 1ICEA 4Q1AA 4AY2A 4I2NA 5U4QA 3S81A 2ROQA 3BREA 4PANA 2Z1NA 1LI4A 1YJAA 2FWIA 3PRJA 2K4MA 3QXSA 1SUPA 4A23A 4UM9B 3VR2A 3KXKA 3CRRA 3N3AC 4I4TF 5CH5A 4HAVA 4Q9JA 4BNFA 1TQ6A 2JIRA 4TYWA 4NBWA 4XEUA 1FNCA 5A3JA 2Q0HA 4UJ3A 4PO8A 2CF5A 3D8RA 1ZJWA 5BPHA 3EXHC 3IE2A 1XZLA 2ZM5A 3BVPA 4G1FA 5H7XA 3F47A 5BXQC 3ZD7A 1VG0B 1YMQA 3LHDA 4LZPA 1MFPA 1UC4B 2VKQA 1EDBA 1JKMA 4QAJA 3VOBA 3TTWA 2F43B 2WQ6A 3DC2A 2EW1A 1JEQB 1SXJB 3ZHOA 4DT1B 3OLYA 4YUVA 4R0MA 2B0CA 1PLJA 5EIAA 1U04A 3LMKA 3TIIA 1QZUA 3K70B 5CFNA 1SCNE 3EMDA 1A5BB 2XMSA 4XVHA 3VNUA 4FIDA 4DV3B 3UJ9A 3FGPA 4RSHA 1A5AB 1W1UA 1AUQA 4YHHB 2IBSA 1LA2A 4YASA 1E9FA 5JNVA 3BJIC 3AL0C 2VCEA 5L3ZA 3FZYA 1TPZA 2QVBA 2VG8A 2W00A 3E3NA 4Y1RA 2K6GA 3A3YA 5JS7A 4QOSA 4LXYA 5AXCA 1T1JA 3DO5A 5BMVB 1DXOA 3W3AD 5JH7A 2QVLA 1WBBA 1F9AA 1NDHA 1YDGA 3S6JA 5IUNC 4MLPA 1Q7CA 1VKOA 2IE8A 2IHZA 3WV5A 1NXVA 4ZODA 1SEVA 3CNQS 5FLYA 3V33A 2O0MA 2PX4A 3D5QA 2Z5LA 2CXHA 1X1DA 5A5VA 4IJVA 2EYQA 5KYKA 2L17A 3PUJA 2OGTA 3FYCA 4B44A 5I9SA 4DREA 4OA5A 1TLTA 2I1QA 4JMLA 1SVOA 3V1LA 3WLRA 2A0WA 4KYTA 2BHSA 3EUWA 2QD4A 3P8ZA 2V4UA 4U6SA 4AU1A 4BPRA 3EGOA 3G8AA 3L4EA 2X8BA 1ZD4A 4CEJA 4IDDA 2O50A 1MT0A 2F3QA 5MHTA 1UPFA 2CXSA 3AHFA 4BFSA 1UR5A 2Q6OA 2VHJA 1NW9B 1M1UA 4KK3A 3HDYA 3A4LA 4IX1A 1T1EA 1GY8A 2RB4A 3OF5A 3QA9A 5ILGA 4FDAA 4R9NA 2B36A 2FZKA 3FUTA 4EYQA 2FETA 3ZEAA 3FJYA 4GSKA 2YMPA 2X5NA 5EWJA 3WGKA 3GGGA 4WL0A 4LJ5A 3EEYA 1WUJS 1JJAA 2WA1A 1T5LA 4YIHA 3CRQA 2ZJZA 4WZBB 2OCXA 5FBZA 5KTKA 1Y6ZA 3PYLA 4DCVA 4DQLA 2KB0A 3CPJB 1Y33E 3PZRA 5KVAA 3CG0A 3JU3A 2ZI7A 3A6DA 3ML1A 1E5QA 3X1YA 4FKZA 4YRBA 4IOMA 1X9IA 2ZR7A 2ZTMA 4LXXA 1FFXB 3VJLA 3VPBA 4ZCRA 1H8HA 4BX2A 4G5SA 4E13A 1GCGA 2CXRA 4L51A 3W1VA 2P9HA 2PUVA 2VBIA 4YALA 1YVDA 4JUBA 3BMQA 5JSKA 4AUKA 4B3IA 2BMFA 1KBOA 1DJNA 3SQWA 3FYUC 1NXTA 3USZA 5IJZA 3HTXA 5IYZF 1Q1QA 5DHFA 5KJ6A 1XRPA 2JBWA 3D9QX 1RWNA 1DJQA 3O4HA 1H0RA 4HLDA 4C4RA 4M89A 1KNXA 4R2MA 1PYGA 4MWSA 4E1BA 5DP1A 3D7KA 2W83A 2HLPA 1NLZA 5CX1A 5JPIA 2DYKA 3VC2A 3D1LA 5F7OA 1E3IA 5G1OA 2QN8A 3I2GA 4YRIA 2ASEA 1FRZA 4G56A 2PKXA 1KYVA 1N57A 2BFBB 3EZGA 2KLBA 3EMVA 4GYJA 3LX8A 3T9AA 1MW8X 4AI6A 5ITZB 4PLWA 3VO2A 3E22A 1KORA 3NPMA 3A11A 3P5SA 3KRTA 2WQ7A 2M1XA 2ZIUB 1F38A 1M73E 3DV9A 4QHTA 3I2HA 2B92A 2GWRA 4QXRA 1KMIY 2ZAYA 1O1YA 3THXB 3IIEA 1TDJA 5E4TA 3ZNQA 4DABA 1CVIA 3PFFA 4TTSA 4B47A 2PX0A 4B8ZA 4TMXA 4FUTA 3SDZA 1D0VA 2QN3A 3F78A 5FQOA 3KQKA 3OEYA 3OQ6A 3WY9A 1FVHA 2BGLA 1Q7EA 4DC0A 1FS6A 4Z1MD 2A0UA 4WLVA 5B55A 1K8XB 5ECGC 2ZUCA 3WZMA 4X97A 1ZIXA 4BECA 1EK1A 2CUTA 3O8CA 4EHNA 1TKBA 4CTKA 2HWYA 4MB0A 2ALJA 2EZTA 3R44A 3ZE7A 3I5MA 4QJ5A 4D8VA 4HLUC 1K5PA 2BFEA 2IEYA 4HRAA 1A5TA 1KO1A 1PTJC 3JQGA 4PTZA 2C5FA 3KKKA 4Z4IA 2XCIA 5BW6B 4HQLA 3LCCA 4PYQA 2P4HX 3BD8A 4OM7A 4RZHA 2OP1A 2C42A 5E2IA 3W34A 4D0GA 4E31A 5HZKA 4ZPXA 1SIOA 4UC0A 3GRKA 1Z4JA 3QSGA 3DT9A 1NHGA 4HAZA 1YASA 1YQ9A 1G98A 4Q1VA 3RU7A 5AKLA 3WL5A 5F23A 2AVNA 5J2UF 3COZA 5BOSB 2OEPA 3AMVA 4JBXA 5ISMA 1X1CA 3NETA 3LPNA 3TZ6A 1LJ8A 4DXHA 2B9EA 3L8HA 3CGGA 2YV1A 5DNVA 2YWEA 2V74B 1OAAA 1FVFA 1TQ2A 2YFQA 3F5MA 2XYRA 4L1KA 2AG1A 2PK3A 3KZMA 1NT2A 4IYRA 4WX2B 4QUIA 4WE3A 3JASB 2RHMA 1Z6TA 2OBYA 3WLEA 5J4VA 4OAOA 5AHXA 1WETA 2JI4A 3I01A 4YAJA 3TQSA 2FFRA 3ONNA 5IJ0B 4EPRA 5KOIA 4ATNA 4LWQA 3EXFA 1EZZA 1UBEA 3FNQA 3HZZA 4IMRA 5H5JA 3O83A 2EFCB 2O7SA 4MUYA 3U16A 1GHTA 2LRHA 2IK8A 4YJ3B 3CCBA 1CHNA 2PV0A 2CHVA 3DFKA 1OBCA 1Q17A 3F5DA 3OF3A 4FDVA 4K3VA 3VKWA 2PQ0A 5GINE 1ZVVA 1AS2A 3MXOA 2A7XA 2IPOA 3ZWOA 3FZGA 3GJ8A 4DUGD 3N07A 4ZDIA 2AN4A 1YDWA 1QS0B 4XJSA 1JB9A 2B99A 2DWOA 3DNPA 5G0VA 4B85A 2A5YB 4WKGA 3HR4A 5DLQC 4BVJA 3PEVA 1C3JA 4KMSA 4UUOA 3GOHA 4IVPA 1YCHA 2J0QA 3QNWA 2LIPA 3OZGA 4HNAB 4OFZA 1V8BA 3FDXA 4WFKA 3AHHA 2WY2D 1ZVQA 4Z9YA 1IHUA 5ALIA 3KJEA 2FUNB 2HO4A 1WNTA 2NZ8A 5AI6A 4ZVPA 1TT5B 2TMGA 3EGVA 4HGZA 4QDUA 2AFIE 3JQBC 2A0FA 4H1WA 3QPCA 5EYPB 4M0DA 1G8KA 2JAQA 2HCBA 1QFJA 2ZB7A 3BF7A 3IVXA 1HQDA 4G0ZA 5D5PA 3RLFA 2Z3ZA 3NNSA 4IWYA 3TLAA 4C7KA 3F49S 1Z2NX 4PZLA 4GPZA 1PZGA 3BK1A 4BEJA 1R4NB 3HCAA 2XIQA 2V03A 2WINI 2ECKA 3PUHA 4CM7A 2FUCA 2OKGA 2PXHA 2IIVA 3OIVA 2WPNA 2ZJOA 2CMKA 3M7IA 4BMCA 1A8PA 4BMDA 1F5NA 1BCSB 1U0JA 3QSYA 1EGQA 1SMKA 1I94B 4IHJB 3DM9B 3STTA 1GDHA 1QH8B 1Z8DA 3FUCA 1GUAA 2FSGA 4KDEA 2XD9A 2H51A 1Q6ZA 2PBFA 3WA7A 4CF3A 2J7KA 3JQ9A 1NSFA 4IX9A 4P4UA 1Q77A 5IMSA 3RQSA 2RHOA 3DB1A 4PZYA 3IAAA 5J59A 4EX7A 1OJ7A 2ZSAA 2ORYA 3OURA 5THXA 3NBMA 1FFSA 4QT4A 1X3SA 3AFOA 3CEJA 4RH0A 4C78A 3DOFA 2LR0A 4JSTA 2D3WA 4XYGA 2PH3A 2H2WA 3LXUX 3C7AA 3FYTA 1UUFA 1NRXA 4UATA 5FNZA 4G1UC 2OA0A 1RJEA 3WB2A 1WUIS 3ANMA 2SKDA 4XIJA 4IP0A 5EQDA 5D00A 3TX6A 3GFVA 3BL6A 1SY7A 4Z51A 4B3RB 4CM6A 4OJQA 3RO7A 4BVHA 5JZMA 4RD4A 4YV0A 1N5JA 2DPMA 2XRFA 2RC5A 2M6KA 4FFNA 4F6RA 1EFRA 2ZWPA 2G8LA 3KM0A 2ZCJA 4GOLD 2J09A 2BGKA 2JJMA 2P4UA 4JNCA 4H35A 2R11A 1AXRA 1PVOA 3EVEA 3DD5A 2B1JA 3M5PA 2XQIA 4H1VA 4G4SP 3DBRB 3SVLA 1M2NA 2BMAA 1SWWA 3WWOA 1KJQA 1R4MB 2JCSA 4GWKA 3HXQA 1Y7PA 5CH8A 3BXOA 1Z7GA 3SM3A 2WPDD 3EFOB 3OIGA 5GQSA 4JB2A 5ARCA 5KYUA 1G21A 3W5CA 1N5LA 3KLNA 1WUTA 5C8YB 2XITA 2P9CA 4L16A 5A4JA 2GM4A 4RTSA 3OMLA 1Y3CE 2IHYA 3FCCA 2BI7A 2FMIA 2O06A 4J0KA 1NP3A 3LDUA 4MYRA 4D9HA 3E48A 3R74A 1CQIB 3LBNA 4F4HA 1M1ZA 4TL9A 1I7LA 4E32A 3SMQA 4U8GA 1YRWA 2B4TO 4ICIA 2C78A 2QX8A 1XRQA 3JAKA 1M6YA 4ZEWA 1KHHA 1SH7A 4LVOA 4QQ8A 2D1QA 4B35A 3H6GA 4C3UA 1VE9A 3TAXA 4DR1B 5BXYA 1XDDA 1D7OA 3ZX5A 2UZ1A 3QE9Y 3BGVA 1NC1A 3BGSA 3CUUA 3UAXA 3W5VA 1VLQA 5J4LA 1WCYA 1UJ5A 2W4IA 2HXYA 4H4DA 4RTQA 4YJFB 1V3VA 3DO6A 4DEYA 3P32A 3B2QA 5T57A 2BMVA 1VI6A 2AR0A 3PFHA 1QX4A 2I66A 3CISA 4HFMA 4KV7A 3L0CA 4KL8S 4MX8A 4DCTA 4B7CA 3QIAA 5JY6A 1A71A 1Z08A 3ZCSA 2QD1A 1XMVA 3EIXA 3RAJA 1NNEA 3P0HA 4P53A 1DADA 4L73A 1AJEA 2Q21A 3OZUA 1G16A 4P6VF 5LUAA 1QORA 1RHJA 1J56A 1ZCJA 2HMAA 4OQ4A 5D3QA 3S1SA 3VPSA 1EFAA 1E99A 3N6VA 3B8EA 4P3OA 2H3EA 4XWYA 1WM1A 5LU8A 2OUIA 3G1TA 2QN6A 3SIWA 3SIRA 2P75A 2II6A 3EX7C 1CNEA 2FXVA 3FFBA 3W5HA 1NR5A 1PQPA 2FUKA 3OPMA 4C2UA 1K5DA 1HE5A 2W6MA 4JI5B 3HVUA 3AVUA 2DTDA 4YRFA 5IDVA 2V6BA 1USIA 4S0ZA 1CYEA 2F1KA 2AH5A 4FYJA 1QMGA 1F7VA 4O25A 3AIIA 4BGEA 1EXNA 1FQJA 1O97D 4ND6A 3T94A 3X0DA 4MIEA 3NVKI 1RI4A 3AFNA 4FFRA 5EZQA 3HA2A 3RS0A 2FEOA 3OQIB 4D9NA 2GLUA 3WXMA 7YASA 2J0EA 3PDJA 4AZ3A 3RK1A 3QU4A 2IX3A 2KSQA 3H0CA 5L7TA 2F43A 4UM5A 5JZSA 3UTCA 3MAAC 4Q3EA 1JEQA 1SXJA 2RKOA 4TS3A 1QIKA 1KIMA 4LOJA 5DM0A 4AC9A 3CX7A 4DT1A 3PHLA 5J4YA 5AQEA 5K8LA 3PUYA 1N2SA 1JHOA 3EHDA 3SC4A 4GQAA 5A0TA 2CNBA 4L4SA 5I7OA 2CXQA 2XR1A 5CIWA 2GQ0A 2WJZB 2VNJA 5K4GA 1JDSA 1P2FA 4YFYA 1I7DA 4RYDA 2FPXA 1XKQA 4HB2A 5C3UA 1V3UA 1LNZA 4ZDKA 1COWA 2R8OA 4ESHA 2ZP1A 1NSTA 1I4LD 5LP6C 5CFMA 1EIZA 3DPSA 4LZZA 1XTTA 1Y0BA 3IAFA 4O8ZA 5BMVA 1QFXA 2H29A 2IV3A 1NSYA 1X1TA 3WNDA 3OQNA 2FTKE 2QPOA 2ZVQX 3NR2A 4LNHA 2UVDA 3KB1A 4W9NA 5CGZA 4Q9LA 3TO5A 4O2AF 2ZYUX 5ELMA 3MMNA 3P45A 4I3GA 4MAMA 4NV3A 3DYIA 1KJZA 3ESRA 4AS1A 3LXXA 1VYVA 4DMUB 4MCIA 3UGQA 5I01A 2FPUA 4KKVA 2CDNA 1TZBA 2JFZA 2YMQA 3O93A 4YQEA 4HD8A 1LSSA 4P33A 4QNRA 1YKSA 3VM6A 3FMFA 1H1TA 3AVTA 3I1FA 3KLPX 3I92A 1KAGA 3FPJA 4KQGA 4YP7A 1AQ6A 3WISA 1WPGA 1CQJB 4Q4JB 4N82A 3H6KA 4GQIA 3S7ZA 5IC4A 2D1TA 2YNMC 4OI2A 4AJ2A 1VJ0A 4FOOA 1TEXA 1JSXA 4K40A 1EX9A 1YBVA 3DZGA 5EJ2A 1UBJS 3BB3A 3CVXA 1I33A 1YGYA 3CLSC 1H3NA 4LV5B 3DDNA 2ECFA 3FYDA 1S2DA 1IXKA 2H7CA 1NVEA 2BONA 3VZCA 1PGPA 1FUEA 3H9EO 3TCKA 3LHSA 2WUVA 4PIVA 1FFXA 1WL8A 1YRLA 2F3RA 3HNRA 4ZVSA 4Z2YA 1B42A 2QL9A 1XROA 4US1R 1YZ3A 1CUSA 3DMGA 4DRZA 3V4RA 3THWB 3DEKA 5IK2A 3WFZA 3GLGB 3OEHA 2PYZA 3KT0A 5BRNA 4D8WA 3DMHA 3GAMA 1ST2A 4CCAA 5EHQA 4IDHA 1MHTA 1Z0ZA 4BE7B 2P9TA 1QDLB 3CZ9A 3OHMA 1SVIA 1SXIA 1V5WA 3GEEA 2WSYB 5BUQA 5HUHA 3DKVA 1T2UA 3WRYC 4RZUA 4LJRA 3ANXA 4FB5A 3L7OA 3FY4A 1XP8A 2V9ZA 4MS4B 1NN1A 1WRBA 1GNTA 2WT4A 3EC7A 4OLBA 4C07A 1N9ZA 4EHFA 3GXBA 3DMPA 2BFBA 3KT3A 3P26A 5KDDA 2HRBA 2AI2A 3MTBA 4KBFA 3FUUA 3QPWA 2SECE 4C29A 5ITZA 4HKTA 3FMPB 5ALSA 2Q5EA 3LNCA 1T1GA 1YZTA 3VTZA 3WYCA 1Z5NA 3T7EA 1XAIA 1SRRA 1CS4C 4LZNA 4PCLA 5AVOA 1SULA 5MFZA 3U6BA 2I7VA 4MAFA 3QX7A 3SJAA 4NOLA 2OENG 3WNBA 2GLXA 4QD3A 3WGGA 2WTUA 1DC7A 1CS0B 3VOSA 3VYRB 1V1RB 5IG2A 2EP8A 2X9GA 4UTXA 4TVBA 3NHFA 5JDIC 5I8WA 4N5MA 5F21A 2REOA 5FORA 3L7LA 2BGUA 2ZRAA 2JLCA 4RF4A 5CT8A 3VC7A 1TTQB 3KFLA 1YB7A 3A6EA 2JJ2A 5BR1A 2XCQA 3I05A 2GD0A 4ZWNA 4RDIA 2OFXA 4FMDB 3EIWA 3SSNA 5AI9A 4UEQA 1LDNA 5EG5A 3FH0A 2H06A 1PR3A 1WB4A 2HV9A 1G5IA 4JK3A 3FWNA 5F5NA 1OGJA 5E3JA 2BRUA 4WECA 3DMNA 3WZLA 3OMWA 3WIDA 2REXB 4OXQA 5T5QA 3ROMA 2EDAA 3RSCA 1XTIA 5K0GA 2PHZA 2VUUA 2ASVA 4FGSA 1K88A 5KPDA 4LYEA 5AW8A 1GFWA 3HLKA 1GLGA 1DEOA 4IV0A 3ET4A 4MWDA 4RA6B 3SF8B 5BOSA 1P33A 4DM7A 1GILA 5EJ6A 2LIVA 2GD1O 4OATA 4V0MA 2A9OA 4BJ1A 1A98A 3VU8A 1MH9A 4ENWA 1FUUA 5CVCA 1RW4A 1XFDA 3EXAA 2OR3A 4O2BB 4KQHA 3RSGA 2NACA 5CNIA 1VB3A 1A9ZA 4JQYA 4IIDA 4R83A 1MFZA 3R8XA 4B6PA 4BMSA 1DTWB 1L9XA 1Z3IX 3JASA 2D1RA 4QDXA 3L7JA 3AFGA 4ISBA 3NWEA 2GZHA 1JLLB 1MX3A 5ETJA 5IJ0A 5F7ZA 1KZ1A 4NZMA 1NBAA 3EYWA 4JU9A 2EL7A 2DVMA 2H18A 5KNLA 3CVOA 3INNA 3JY6A 1Z0KA 4YJ3A 1R0LA 3V6LA 4A16A 1OC2A 2XNSA 2FPSA 3M9WA 4BMVA 3ZLUA 3B2EA 2JJ1A 4TYYA 1QZTA 2GZ2A 3C6BA 3Q12A 3C3MA 1QS0A 1SIUA 3HVJA 3CSDA 1IN7A 3AVPA 3H7AA 3K94A 1YB5A 2N42A 2JFQA 4C5CA 2WWYA 1YIAA 4KE7A 4CM5A 5FDFA 1YQTA 3I28A 2BT4A 4LUCA 4HNAA 1IUNA 2ZIGA 2DT8A 2OSVA 1NMSA 3F4BA 1Y5IA 2GK4A 3C5EA 3I53A 1TNDA 2GXUA 3KTDA 3LAWA 3SEZA 1O5OA 2G6TA 3OFND 5JAHA 2ERYA 2EVWX 4Q15A 4EEZA 2OK7A 2H4HA 1TT5A 1MTZA 2IXBA 1ZRSA 3O8DA 1PO7A 2HPAA 3BYZA 4N7MA 1MRNA 2I3DA 3AGPA 5EYPA 4XVCA 5AOVA 1CJMA 4K6OA 1E60A 3MTAA 2HNAA 2WTBA 5HYVA 3UAZA 1JMKC 6ABPA 2Z8YM 1SUBA 1R4NA 1XZCA 1G8SA 3M6FA 3ZE1B 1BDIA 3V42A 3TXAA 4ZT7A 1ANKA 5KTNA 4LOLA 7MHTA 1IQUA 5DBFA 1IN1A 4CXMA 1DKOA 3CUKA 1BCSA 1Q2XA 3PTLA 2AFHE 2PZLA 2FZGA 2NZYA 2YHUA 3P19A 2HDNB 4IHJA 4UMVA 3V97A 4AP9A 1HYHA 2WKPA 1PDVA 1QH8A 1XTKA 2QG6A 3ETEA 1XOIA 4PLYA 1YAHA 2HGZA 4QBKA 2PTHA 1NVKA 5EPUA 1V7ZA 5CB4F 2ODEA 4ZVMA 1GRNA 1XLVA 1V16B 5DVZA 1I3NA 1C8KA 1K6EA 3HUDA 1QVAA 4RVHA 5CDHA 5FBHA 5KQPA 5KB3A 2C4NA 1KK3A 2H5EA 1LLFA 3N8NA 1H8EA 1DAGA 3UFBA 1IJFA 1B43A 5EC8A 4NFLA 4IL5A 4QGSA 4TWIA 3ONVA 2W4MA 4BNXA 2VK8A 3MUFA 1WV1A 2BR3A 5AOBA 3ZE2B 1VSTA 4QXPA 5LKRA 2AMVA 2W6JA 4MRNA 4DYVA 1EE1A 1ZHHA 1GZ6A 1PJ4A 2QZPA 4UVEA 4QYSA 2I3AA 3AY3A 1RHKA 2RHRA 1EVIA 3F2IA 4UUBA 4AKTA 4AB1A 5TS2A 1RPTA 3F7TA 3HP7A 1QCZA 5F4BA 2ET6A 3D3KA 1GYPA 2AF4C 3RFTA 5LQNA 2LBPA 2XZOA 3E03A 4JLDA 1WCXA 2C2XA 2CUKA 3DBRA 3L49A 2O1WA 3O8QB 3RCBA 2WF5A 3WRVA 1RFLA 1W44A 2I2AA 1S9HA 4FXPA 1NATA 4JJ6A 4O4JB 5H80A 3U37A 1R4MA 2RFLA 3DF7A 4MQ5A 1YQQA 2ZR8A 3IJ5A 1CQWA 1RCUA 3LA8A 5A71A 3VUFA 4OU4A 3EFOA 3FTCA 1TX4B 4BJ5A 3AW8A 3AIMA 5HE8A 3ILXA 3A4VA 5C8YA 3TUZC 1H8HD 3F6RA 2P35A 3UIEA 4C87A 4IIJF 4PZAA 4W7SA 1FX1A 4AULA 5FT9A 4KQJA 2E37A 3UHAA 1B8UA 4EDFA 4F9FA 4RK6A 1NRIA 2DQYA 4ZOEA 3ZV5A 1NW6A 3WWDA 4K6MA 2PXXA 2JF0A 1J4AA 3I8OA 5EP3A 4DANA 3WQHA 3HEAA 1XDBA 4CMEA 3J80A 3UMYA 1N6KA 1M2KA 1YB1A 3KSDO 4B3BA 3FDIA 4YMGA 4GMDA 2E6UX 1XYYA 4LYDA 2FMKA 3LDFA 1I5EA 4LRQA 4P0TA 4C0WA 5IAGA 1Y5LA 1WDKA 5B53A 4BPBA 3L8YA 4TUYB 5AKXA 4PGGA 4IH1A 2NQ2C 4NZ9A 1C4XA 1Z2AA 3OP1A 4YJFA 1JDVA 2WFMA 4EDHA 3PX7A 5NULA 5M5BA 4UQPA 1LI7A 3KAKA 2IY9A 2FZ4A 2OG1A 4O5AA 4K9LA 3TEFA 1E1CB 1RYYA 3HWSA 1GGKA 2GX6A 5DCYA 3FF1A 3L18A 3R5TA 1UPCA 1N2BA 2GT1A 2C7RA 4OB7A 5SZJA 4MMXB 1PN3A 2ZKLA 1KGDA 1DTSA 3BAZA 2B37A 4GOND 2A0XA 4NI5A 4LNAA 3A6HA 2HHCA 4NWIA 3MERA 1FDOA 2GN1A 2EKBA 2G88A 1OYWA 3ZV7A 3IP5A 1UP6A 1OZGA 4BB9A 1C0KA 4N7BA 3CMCO 3BWCA 3EIFA 3HH8A 4CTNA 4BFCA 2UV8A 3HSYA 4P3XA 4L57A 1IHOA 2NLOA 3EGCA 4M8NE 2ZAMA 2C2MA 1ZHFA 2AG5A 2EX1A 5JAPA 1BVUA 1ZNXA 3HM2A 5BWNA 2BGNA 1A50B 1SB9A 4OG2A 2CSXA 1X8LA 3ISVA 3O1LA 4M83A 4X24A 2FSSA 5D2CA 4HEA1 4HDSB 1UP7A 2RH5A 1PZEA 3M0EA 5F51A 2AI3A 3DBHA 1JFRA 3KYIB 3F9CA 3OQIA 4ILKA 1R3DA 4G84A 1C2YA 1SC9A 3KE9A 3L7MA 2OHGA 2O3RA 3FOZA 4WTOA 5COQA 4KBGA 3E9NA 3N74A 4QJ4A 4FYXA 2J5RA 3ROQA 4L4XA 2IYXA 2BE7A 1O0SA 2IZ5A 2RIRA 4WEOA 4P9NA 1WUYA 2P9FA 3NANA 4M1MA 2C84A 4UUMA 1IG0A 2D8AA 4RMNA 1GQYA 3ENKA 3HL4A 2TECE 3QXJA 5K7SA 2BH2A 4R7GA 4C4TA 1UWKA 4BO3A 3H5AA 1I32A 4GGOA 1CY6A 4JBIA 5G53C 4HH3C 4ZEOA 2DB3A 2YHSA 1HT2E 1GSOA 1WCV1 3IEVA 1W5AA 1D1TA 1Z2CA 1HE8B 2AN3A 2WYHA 1PQYA 1SCJA 3L4KA 1PJZA 3TLZA 3GXOA 1O89A 5AKYA 3IGFA 3K6RA 4K9QA 3A2NA 1ZONA 4OM8A 5A05A 4F3KA 1FZTA 4X6XA 4PINA 4WKNA 3R6DA 5KDLA 1YFJA 1Z35A 4PCUA 3SJCA 3TTYA 2OCBA 1MZPA 3HZHA 4O59O 1ESEA 721PA 3TTXA 3U6KA 1WF3A 1C8VB 2C5EA 2G8NA 5IXYA 1J9GA 1NVVQ 3DTVB 1R6UA 3T3DA 1KE2A 3ZGOA 1Z82A 4DN6A 3QG1A 4F6LA 1CJUC 1DXHA 4P4GA 1Q0UA 4GOOD 1MO2A 4LRTB 3KDAA 4H3SA 4TL8A 1GTJ1 2X3UA 3QOWA 3AC0A 1EQUA 4RPCA 4UKDA 2R1ZA 4C2BA 1G63A 1ULZA 2IYFA 4O1HA 1OLOA 1UMBA 1UXHA 2J6BA 2JASA 1TGYA 3U13A 3E18A 4HXFB 2IHJA 5DSTA 3L46A 1XD2A 5EMJA 3B52X 4X00A 3OQVA 1FJXA 4UD2A 1AUVA 2YMMA 4HWSA 2W0SA 1TJNA 1W93A 3OWHA 1CQJA 2WG2A 1E1YA 3LQFA 1MJFA 1VL0A 3OUUA 2EOAA 2VTVA 2FN8A 3MBOA 1U80A 1FDTA 5CNMA 5DIFA 5FFFA 2B35A 5K8UA 4ZOBA 4WBXC 4LTDA 5FL7A 1W36D 5KO2A 1KRWA 4D5EA 2RI6A 3FTDA 1E7YA 1NJSA 4QGFA 2CEKA 4A0RA 2GF2A 3GH1A 4XFKA 3S44A 4A0HA 1IZZA 2V65A 1T4DA 1U7OA 3GRYA 3UUGA 1TAHA 3BRCA 2Z08A 3T7IA 2J3IA 4DG8A 1JDBB 2XUAA 1SKYE 4ZEMA 4FYWA 2NU8B 4LJLA 5ITVA 5CD1A 3OZXA 1ZU5A 2G06A 2I2BA 5CXXA 4DSAA 1HSOA 3S8YA 4X71A 3QM1A 3ETNA 1NIJA 1G17A 3CB2A 3HRKA 5SY9A 4D2IA 1K6XA 2H8KA 3GD7A 3WOVA 3BDAA 3VGJA 5C5IA 3THWA 3QV1A 1L5QA 3GLGA 1UZMA 2Z56A 3SAJA 1TM2A 1Y1LA 4V0NA 4BMZA 3W04A 1HEUA 4YAUA 1P5HA 1RCTE 3P9YA 1G42A 1N2JA 4Q7QA 4A6PA 4YV1A 3C1UA 1EUDB 1M8GA 1UC9A 4P38A 4Y7CA 4EZBA 3R9WA 1LW6E 2CFOA 2GDJA 1SKMA 5FX2A 2PWZA 3QOYA 2C2GA 1KEPA 2FLWA 2GZ3A 3C6MA 3M6MD 5IBPA 2V6FA 2ACEA 2ZIVB 1GPNA 4XM1A 1EFRD 1A2KC 1T1SA 5A03A 4E2FA 5JAQA 3CMMA 4QL3A 3QUSA 1AN9A 1YCDA 1N6LA 2OC9A 5BN3B 5I9TA 4QPCA 3QVTA 3CLRD 3PE3A 2F48A 4KRYA 1B41A 3OJEA 5H02A 2HC9A 3FUXA 1QR6A 4M0UA 5ILQA 3B36A 5CFPA 5CFLA 2WG0A 1X1AA 3MYRA 1J49A 3DEYX 1DIOB 4EZEA 1CS0A 4Y6PA 3PQFA 1OLSB 1V1RA 1FJGB 1BN7A 2OY0A 3EGIA 2RCYA 2OOSA 3N8KA 5JPCA 4MHTA 2ZBRA 3V7WA 2JRLA 1ZUIA 4F04A 5MN5A 3QMVA 3EZXA 2UYYA 4UPEA 3VR1A 2WB2A 1V4BA 2Z3VA 1BXGB 1ZZEA 2H08A 4MKGA 1VMAA 3U40A 5E1MA 2WFAA 3KJNA 4NICA 4ZYXA 5BQXA 4BZWA 5B4TA 3TGPA 1NZJA 2RHBA 2YYZA 3AB7A 4LXHA 2RH8A 1K7XB 5KPJA 4YCNA 2PL1A 3MTEA 4JI6B 1RXWA 3SR4A 2XBMA 3TBHA 3EMKA 4NQZA 1JA9A 1GKIA 3JVIA 4XWTA 1JIVA 1GTZA 1Z83A 5JC8A 4MUIA 4NCKA 2EDCA 2GNAA 3Q40A 4RA6A 3SF8A 3W5JA 2ZJ0A 3UAWA 4DBLE 5F77A 1FTWA 4J8PA 4ZZ0A 1ORHA 3SHFA 4G25A 4NJOA 4ROSA 1N4AA 3WKDA 3VVBA 5WRFA 4R81A 4O2BA 4TWJA 1TO6A 3LLSA 1GKUB 2Q3FA 1NAIA 1DTWA 2AHOA 2ID7A 4RVCA 4YP5A 4CMIB 2X77A 4C7JA 1RPNA 4JI7B 5BVHB 3IUQA 2QRKA 1JLLA 4HGPA 2WEKA 4A8TA 3KX2A 1XBTA 2YVKA 2PLAA 1N2CB 2FWJA 3H9GA 3HDTA 1GT6A 3GT3A 3A1CA 4G0OA 4DJTA 2V7WA 1XP5A 3IV7A 4UHBA 1CR6A 3C7TA 3FKSD 2EHDA 3HGMA 3LE8A 3RS9A 1YS6A 3OIDA 4DA6A 4E5KA 1UC5B 3CO5A 1G0OA 3I37X 1P18A 3JALB 2IWRA 2C3MA 5TPWA 2J85A 1PWYE 3RREA 3ZU3A 2V6MA 1UBHS 2J3MA 1DCTA 3AGQA 2N75A 5SZHB 2F8TA 1NW8A 1RPAA 2O0LA 2IKSA 2H1LA 3RD5A 2VVTA 4GC5A 4LCBA 1ECLA 2FHPA 2N1BA 3OETA 3EQ8A 5ANRB 1T8WA 3GEMA 2GEJA 3GJSA 3KL2A 1NURA 1ESCA 3LF1A 2IYYA 3MOIA 5JCOC 4IIVA 3MRVA 3I1JA 1IDOA 3GBSA 3DEZA 5DXJA 2X14A 4XWKA 2WQZA 2YCBA 5ICEA 1CPYA 1HDGO 1UFKA 1G20A 4B4DA 1J9ZA 3CX6A 1KF0A 2XB4A 1N2XA 3MJTA 1U5BB 2FEKA 2FFAA 3CWCA 3K70D 2X15A 1EKXA 1G2QA 1QE3A 3GG2A 3M2PA 1YZQA 4KLNA 1IXZA 4K86A 1TC2A 1L0BA 1WLYA 2NYVA 2IY8A 4Q24A 4FINA 4QQFA 4TQ9A 3VI3B 3K9BA 1NJ8A 3T7RA 2VNKA 1D07A 2ZAOA 4JXXA 1ZQ9A 2PL5A 1ESDA 2DUUA 2J3JA 1RPJA 4R2LA 3GLHE 1JQ3A 3IJPA 4Q9IA 5ALVA 5E2AA 2YC2C 4NU0A 4DLNA 2EG9A 3OAAA 1COWD 3OU6A 1A9QA 4WZBE 1KQNA 1OCEA 4B6GA 2HHAA 3IP3A 3RU3A 3UKDA 4KR6A 4I1SA 1AKNA 1ABFA 2C4HA 2X3FA 3DLIA 1ZW6A 3JZFA 3F1KA 2AXQA 2GNPA 2P27A 2IXEA 2CLEB 2I2FA 2ZBDA 4H7IA 2P2ZA 3U4DA 1BTOA 2ZB8A 4G9GA 1SVKA 4GXTA 1DL5A 4Y6SA 4B34A 2O4UX 4M7PA 3VKFA 5KNBA 1V16A 3FHCB 2V7QA 2XUKA 5GGXA 5CEFA 2MHCA 5IBQA 1AGYA 3B89A 3NORA 5MGBA 4BU1A 1OA1A 1ZRNA 1YC5A 5AK3A 1AQIA 1XRSB 1D4FA 2IQ5A 3OWXA 3RIHA 1A1VA 4E94A 3M6LA 5L7WA 1KOGA 4AF8A 4Y2YA 5LLTA 3PDCA 1GVHA 3D6UA 3W90A 4BCBA 2BE9A 1D9ZA 2GAJA 2R8YA 2MU1A 1R6VA 3HK2A 1GAEO 1T2FA 1SCKA 2B83A 3IBTA 3IO3A 3INRA 1XK6A 4UNIA 5ALUA 3LUAA 1QIGA 3LUHA 2KBFA 2J9RA 3IRUA 3JZDA 4Q1DA 4TWRA 1VXRA 2KS6A 4EI2A 3I30X 4MA4A 2E18A 4MUEA 4QAQA 3DLHA 4NECA 4IW3B 1IQRA 1PT7A 4TKZA 4CTJA 2RGWA 5FTWA 3URMA 3Q6NA 1ZOSA 1ONBA 3O8QA 4IICA 3LT0A 4WK6A 4LWPA 4KVFA 3GGCA 4KUEA 1UXKA 1FDWA 2ZIWB 4G65A 4NH4A 2QORA 5K0ZA 1LPMA 1UPAA 1YSCA 5J43A 2HHHB 1E7WA 2AJCA 3LT1A 1Z47A 3EVDA 1PAUA 2VAVA 1D4ZA 4PM4A 2GXSA 4P4SB 2WUWE 3L06A 4M1ZA 5HILA 1IK4A 4ZCMA 4DV6B 1FFYA 1CEXA 4L4YA 3EPPA 3A6FA 3T1NA 3H8SA 2V8OA 1ZM2A 3ECAA 3FE2A 1W46A 1IY1A 4PZEA 2XPCA 4QREA 1OV4A 2JGNA 3HUTA 4EB6B 1GUBA 3MJEA 3WTCA 2HA2A 2ZRHA 3H84A 2PA0A 3NTOA 4GR9A 2JCVA 1SCDA 2C9OA 2FZEA 1W4ZA 1YR6A 3GOQA 4M88A 3I2FA 4QXOA 4KQ2A 4GRIA 4XIYA 3UZUA 5C8YF 3K73O 1PD0A 1HL7A 2ZE8A 3Q9UA 4H6VA 4HMOA 1X3LA 1U3UA 2A3RA 4RWZA 2XDAA 4DHWA 1NJFA 4WCDA 2R1TB 1V5EA 1KGSA 3LCJA 1U8TA 4BBPA 1X77A 4D4IA 5DHRA 3S55A 4F96A 2Z2YA 5GOTA 1OH7A 1F0NA 2EHJA 3ZY2A 1P1HA 1XZGA 1W8IA 2RBEA 2D1YA 4IZ6A 1E3QA 5ERYA 5IVIA 1E1CA 3IUPA 3KQMA 4FI3C 3U7JA 1FX0B 1OLXB 1Q0QA 1OTHA 1UKZA 2SKEA 3Q3GE 4JP5A 4G4JA 3GARA 4YT2A 3RV3A 2ZK7A 3ZXIA 3V9AA 1JHXA 4LF6B 1K6JA 4Y30A 3GFOA 2ZM6B 4C7XA 5HVNA 3UAGA 1DAKA 2I03A 2OCKA 2WW8A 3IMFA 5ENVA 1BKSB 2IYPA 2JHPA 1Z8NA 2IDMA 2PZGA 1D2GA 2R8BA 2JJ2D 2YHBA 4NZNA 1VMEA 2ZJ7A 3RGGA 1E5VA 3VO1A 4B80A 1MVLA 4JSRA 5KCMA 3M4NA 2AW5A 4MIYA 4ABTA 5KWVA 4AKIA 2XUFA 2KBEA 4ZMSA 3CRMA 3PXAA 1P3Y1 3O92A 3LCRA 2F64A 4YRSA 3IUEA 5GJWC 3BHMA 4K0KB 4NATA 4PS1A 2Z04A 1ABEA 1TL7C 4HDSA 2V58A 2XTAA 3AHGA 4FS8A 3WBKA 5JLJA 3ZDAA 1KJIA 3DOIA 3KOMA 3IVCA 2OGUA 3MIIA 4H4EA 1T5IA 3PEYA 1T8SA 1PW5A 2XHEA 4R05A 4IGEA 1QFSA 2WF6A 1AHPA 2QTRA 2V97A 2FMXA 3M70A 4GSYA 3WHKA 3CW2A 1NE2A 1JG6A 3NWJA 1CP3A 4HQNA 2PRZA 1XPUA 4RIGA 4XX0B 1DARA 4JL6A 3KJXA 5JROA 1E7QA 2N46A 2GI4A 2V6IA 3KVYA 1QNFA 4JHXA 4OP3A 4LCJA 4R16A 3SBEA 4PZCA 2FG5A 3PJGA 2W8BB 1QYRA 4ZQCB 1ZCFA 2E5WA 2EGGA 2WWWA 2I6FA 2ZBFA 4FFDA 4CKXA 2B21A 1Q22A 3GQBA 2P2NA 3G2MA 2Q3DA 3O4RA 3OO0A 4PCVA 1RXEA 3NIDB 1V39A 1DFHA 5GV7A 3V7FA 1I14A 3H2ZA 4DVJA 4E5NA 5JBIA 2GN6A 1ZKMA 1WU8A 5GVRA 2Q46A 2CXNA 4YP9A 2WMYA 5L9AA 3FOCA 1QK3A 2CB9A 3LL4A 4U5QA 5CG1A 3R8FA 3LC1O 3Q8KA 2BTQB 1ZM3A 2JJ1D 3ER8A 3AOEA 1NG1A 1UBRS 4C7MA 4J6FA 4H1HA 1ACLA 4EB0A 1EK5A 2R2AA 2R86A 3LWNA 4ZCLA 3PJRA 5I9BA 3DTVA 2IU0A 4DSNA 1LGYA 5K3CA 1TMOA 3A8TA 2HJGA 3M4ZA 4HAYA 4NBVA 3F7OA 1FF9A 2A86A 2ZI5A 3RU9A 4M0MA 4MW4A 2OORC 1E7RA 4LXTA 3DZ8A 4R1UA 2B5OA 1EEHA 1TD9A 4WNIA 5AMXA 1MB0A 1QGYA 3BQMB 3NATA 1UDCA 3HFRA 4UQOA 5HRAA 3IX7A 5DTIA 2FUG6 1O97C 4YJ2B 4GWLA 4IDPA 4IQGA 5H3LA 3R7LA 1EG2A 2ZATA 3DCJA 5KQMA 2VNAA 4Z54A 2VCYA 4HUJA 4XR4A 3B13B 3BH7A 4LVUA 3X1JA 1J5PA 3LVBA 5IFLA 3BEDA 2BM1A 3GLSA 4Y0VA 2G1PA 3QKRB 3DLTA 4R98A 3NP9A 5K2OA 4OK3A 1E2UA 1HKHA 4NYMQ 1GSIA 5CVDA 5AW0A 3ODGA 3VNRA 1JKXA 1XD9A 2XWBF 4TWZA 1ADYA 1BYIA 1H2YA 2DF8A 2LNDA 1UKAA 4P58A 2OK8A 1LNSA 5C1DA 5DHSA 1E79A 3SBXA 3FR7A 2H2AA 3GVPA 4TV9F 2JLZA 2F3UA 1JLSA 5JS1A 4MI3A 2DQSA 4N3GA 3WK8A 2Q7DA 2NU8A 1DXYA 1G59A 1ZR4A 2HBYA 4OXKA 3K1TA 3KEFA 5LZ4A 2WYUA 2IH4A 4BQIA 1XL1A 3ZU5A 3KB2A 4OYYA 4PQRA 3KZXA 3FVRA 1PIWA 3BXEA 3OLCX 4FSDA 1EFCA 3IV9A 5LBUA 3SSOA 1H8ED 3ZWYA 4ZYZA 5CH3A 4BBZA 4BQNA 3W2HA 5ALMA 2YHIB 1J20A 1E9BA 1ENOA 1P3DA 2BCGY 2EJCA 1ZL0A 2YC4C 4MCHA 4JV5B 1EUDA 2W6JD 3D0OA 1TYBE 2BZ1A 2HSEA 2QQ5A 1MRZA 4MUHA 2Y1LA 4H7KA 3OLXA 3RC9A 5CPFA 4EW1A 5IVHA 3HO1A 2YDYA 4QVKA 1AKYA 2PL9A 2FJPA 2XNHA 1KC3A 4DA0A 2HUPA 1Q0HA 1QOPB 4GM0A 5ESWA 1LDMA 5SY6A 5DX8A 2FRVA 1DG3A 3WBFA 2PZAA 5BN3A 3Q1KA 3ESQA 3GP5A 4BTEA 3VHLB 1I1HA 2QJWA 3KXLA 3WP0A 3FUVA 4M8KA 5BYJA 2HCRA 3GYGA 4QYXA 4BNMA 4D26A 1G8PA 5JU6A 1TE2A 3D2BA 3ZKWB 5JCXA 2FJUA 3QLJA 4B71A 1JHDA 3U39A 1IHYA 4U7HA 1EH5A 1WW2A 2ZTUA 1Y1SA 1TVMA 3FCYA 1G7RA 3MHPA 1XCBA 1OLSA 3H9CA 4RW0A 1DRUA 2QYOA 4H6XA 3VYWA 5BSWA 2XUOA 2J9ZB 3GK3A 3PDWA 2VDVE 4YT5A 1H9BA 4Q9NA 3CNLA 2IYNA 3S2FA 4ZGGA 4MDEA 2RONA 1IPFA 2GAOA 2KMLA 1P7PA 3K9WA 4GIBA 3LK7A 4HN2A 4ECEA 1T8RA 4EFLA 5B2EA 1HUQA 2R1VB 3DFIA 3EISA 3HU5A 4C6SA 4EJ0A 2PSDA 5KMGB 4NE7A 4IVNA 3UEOA 1XSEA 4MRAA 1T8YA 3HV2A 2IYAA 2IH5A 2RMKA 3IA7A 1GN8A 2JAHA 4ZU6X 5BSFA 1W2HA 5EZYF 1R66A 1BMFA 5DM4A 1WMFA 3YASA 2Y9MB 2OLEA 3H19A 5BVGB 4MQFB 3W6NA 3PQ7A 1KU6A 3JAMA 2H63A 2XUHA 3FNGA 4MR9B 4RY0A 4TKLA 2PVCA 2DE0X 2H85A 4Y9SA 4OK6A 3L01A 4DZTA 2ZSFA 4MLDA 2PY6A 2Q2NA 4G0QA 1Q3HA 1KRHA 1ZJZA 2Q49A 2Y1WA 3D3WA 5C81A 5JXWA 3S1AB 2CWWA 1S89A 4E5UA 4B3GA 2GH1A 1CE8B 4RABA 2CXXA 3MT8A 4U02A 5FFMA 2CXTA 5FUQA 4A73A 1NR7A 3PGMA 1Z3CA 3AL2A 3L93A 1U9IA 2YJ5A 2VAWA 3P2IA 3VPDA 4XIFA 3GLVA 4XSVA 5AO9A 1P6QA 4Z4EA 3KT6A 1Y9EA 4RX1A 5DNEA 2UUAB 1T36B 3OA2A 2FX2A 4RDXA 5FL3A 2J9FB 1EIWA 4MVJG 3ZGYA 1OSNA 1ODTC 2N0SA 4GLBA 5BVHA 2AN1A 1P77A 2GTPA 2XAAA 3KALA 2Q5FA 5E1BA 3UK1A 3ZXYA 1KC1A 4EKGA 3U4AA 4X8HA 1N2CA 2IOQA 2ESRA 3NV7A 3P0FA 5DK6A 3LC0A 1KWGA 1A88A 2ZLBA 1TYEB 3DOEA 2E1PA 1E3SA 1ISRA 1T6XA 3QU5A 9ABPA 4QARA 3WTBA 4BASA 3HU3A 4XCXA 2YJ3A 2IHKA 3EY9A 3GRVA 2A30A 3BULA 2E4YA 3JALA 3V1YA 4EKNB 4IWXA 4CG3A 3OFJA 5FQNA 1UBUS 1QGED 2H07A 4RNCA 1F6DA 1Q0ZA 4G09A 3B9BA 4I50A 1Z28A 4F56A 4E09A 1AK1A 1EX7A 1CTQA 2QT0A 2VFAA 2NM0A 4KQXA 3LUFA 4YIKA 4WCFC 3AYZB 2Y1KA 3RIYA 1MAAA 4EA9A 3IT2A 4LIPD 5DEOA 2DMRA 1YTUA 4FFBB 4FLFA 1PR6A 4YROA 1UBSB 4M0KA 4YT8A 2GKOA 4R1QA 3D8HA 3KD3A 1GZ7A 1XV5A 2XJ4A 2PWYA 1CRQA 1KMMA 1PQUA 1MXHA 2BP7A 3MBKA 1TT7A 4PR0A 5JW6A 3P2YA 1U5BA 5F1OA 3RVBA 3O84A 1NMEA 4KPUB 2Z2KA 1JA1A 4O4HB 5FNVB 4ZVLA 3ZC3A 4ND7A 3E53A 4GAEA 3M4XA 5JRDS 5DBOA 2FA9A 2IYUA 3G9ZA 1WB9A 2HHJA 1MOQA 2VCHA 4L95C 1ZIDA 2AD1A 4Q7JB 1M5UA 3L7IA 4R0VA 4UU8A 5IZCC 3W5AA 2AZXA 4CT0A 5AVUA 5HJEA 4YRPA 3IKLA 1NW5A 3ILVA 5AI4A 1FA9A 4K0RA 4UHEA 2FK8A 3SVZA 4WBNB 3ITDA 1SC1A 3MCTA 4F4FA 3ASZA 4PAWA 3OOJA 4F4DA 2AWNA 3VHRA 2XVMA 4P7FA 3RHSA 3GJZA 3IBCA 5KOJA 5L6MB 5DNYB 5F98A 2VI5A 4QA9A 5D1NA 3QPDA 1SKBA 3OZEA 4BCDA 5SYMA 5TMBA 4G2NA 4RC9A 3N7TA 2QY9A 2VBFA 3TFQA 4OHKA 2HFJA 3DQQA 3GGSA 2MINB 1MNAA 1NBEA 2NV6A 2DUNA 3PVCA 3ONEA 1W30A 4GVXA 2X19A 1LBIA 1MABA 3C48A 4B84A 5LXTB 3MZ0A 3REQB 5IUJC 4JNKA 1Z22A 3V8RA 4QJIA 4PN7A 2GCNA 3R6TA 4P86A 2FY8A 4FGZA 3MQ2A 4U2CA 1VBMA 3F8SA 3RC2A 1NUPA 1C3LA 3NEYA 3NONA 5JSQA 4PLVA 1JXMA 1JLHA 4I55F 3IR7A 3REOA 1TOAA 2YX1A 3AQIA 2EEZA 4HADA 5A4MS 1CY1A 2OZLB 1EFKA 3OU2A 1GPBA 2W6IA 2BFAA 3IP7A 2F55A 3H87A 2IF0A 4B8YA 3IP1A 1CNMA 2BH9A 2ZSEA 9GPBA 3F6YA 4KQ9A 1IEVA 1F06A 1EI9A 1P6XA 2QVCA 2BLLA 3FPLA 2C5LA 1PQWA 2X23A 1CDEA 4YTEA 1P7YA 3VSAA 2XF8A 2H57A 4QUAA 5K0TA 4OEHA 2A57A 2DLDA 3BGOS 3KUKA 2C7OA 3F3KA 2FAXA 4C0LA 4EELA 4UOQA 4P4SA 1JSCA 2K5UA 1T9KA 3RVOA 5IDWA 4BEWA 4D3SA 3O3OB 1D1SA 1JBQA 4DNOA 4NAHA 4EB6A 1U28C 3AF6A 1KS2A 2MYPA 4TSFD 1K98A 3GRPA 1IMJA 2Q8NA 1QFYA 5A6SB 3OQMA 4WPGA 4BV8A 2HLDA 3GLIB 1GFIA 2VDUE 1J2YA 3VNVA 4PGHA 2Z98A 2PYDA 1XJ5A 2X4DA 3GX1A 3A9SA 4J7UA 4BFUA 2F00A 2I6QA 2OV1A 1NYTA 3INGA 4DMMA 2C7QA 1WTAA 1T9GR 5FPPA 1XX6A 4YWJA 3V3TA 1HDXA 2R1TA 4H7EA 3A2KA 4CL0A 1NVAA 3GIDA 1SA0B 1AVTA 1VKRA 2DPGA 3NKVA 4LRYA 2RB5A 4RD3A 5TEVA 1ZD1A 4AJNA 5D51S 5LZ2A 2GA8A 2X22A 3I5YA 1X0VA 4E51A 1BVRA 3AUAA 2YASA 1FX0A 1OLXA 4AD8A 2EP7A 3KJFA 4CVNA 2O2DA 4EIWA 5IKXA 4S2EA 4WOKA 5ECDA 1JW9B 2MSNA 4LSZA 2E82A 4EM6A 5KYYB 1E6UA 1SD1A 3P27A 1NUQA 3IODA 3VSDA 1D0SA 3L82B 1H66A 3PWKA 4IQ4A 2OO5C 3ROEA 3K35A 4XEHA 3W2IA 1K4MA 1CX9B 4F4IA 3M5CA 3KU1A 3G5MA 4GHWA 2V0NA 4M9RA 4RKFA 2B1QA 3AEYA 1I51A 2HU7A 3DDCA 2HH9A 3H2HA 5E8RA 2AMLA 4NFHA 4J2OA 2ZYHA 1MUUA 1LK5A 1Z7BA 3S70A 3ANNA 4M60A 4I6EA 3EIEA 4ZHSA 5CHEA 2X86A 4UU7A 3INTA 1PWEA 1BW9B 3GLRA 1VTKA 4YRTA 2O14A 2EF0A 4Q18A 1NF3A 3AEXA 4LDPA 3GJXC 1SHLA 2QM7A 3JRWA 5FV4A 4MGYR 1PEDA 1NDQA 1KQFA 2RJOA 4WASA 2QLMA 2RD2A 1P0MA 1RHRA 4XQ0A 5AW3A 4M2LA 3WK9A 1DBIA 2F1OA 4KE6A 1GM5A 1QGUB 2O8BB 1V6CA 1VIDA 5E4FA 1JFTA 2AT1A 5CJPA 1MAHA 1ZJ6A 2VP6A 1N3BA 2FMFA 2JCYA 4XX0A 4I1RA 2UAGA 3TQHA 2QMQA 2NO9A 4IUCS 1QH9A 1OYOA 1P4SA 3ZW7A 3OWOA 3OTGA 4KSCA 4IY1A 2EU8A 4KW7A 5E7MA 1EFLA 3CVVA 3WP1B 1DE0A 3QVWA 2W8BA 3IKJA 2DPYA 2YQ5A 4Q05A 5K8TA 1B8PA 1GGVA 3HKCB 2V9CA 1Z2DA 5H81A 4GPBA 1EP1B 1GPYA 4P2GA 3W5BA 5CM2Z 1YMUA 2W37A 1SG6A 2XGSA 5T3YA 1WW3A 2X6RA 4YT4A 4P5EA 1WOYA 2B8JA 2JAPA 1NC3A 1VECA 2BBTA 3CRW1 3VHXA 4WKOA 2VQ3A 2BTQA 3AR5A 4FN4A 2VRNA 1SBHA 2P2CA 3WJ1A 1KOFA 5KHLB 2V0CA 4J94A 4MRPA 3ZWAA 2ZJ1A 3ZU4A 2J0SA 1ZUWA 2QN9A 4OJYA 5DGCA 4B0PA 5K8VA 3H11B 2WG1A 1E5XA 3GJ7A 1W0KA 1JMYA 2QJOA 5KSYA 3QVVA 2WOJA 4H0FA 1P1JA 4P93A 4UVGA 4IR7A 2AA3A 2JAUA 3DNFA 4N76A 5KSPA 1VZ3A 3W4JA 4TRNA 4YJ2A 2P9BA 4W8HA 4JVLA 3GP3A 4B3DA 5K03A 2EYUA 2CL7X 1SOWA 3M3HA 4QATA 1AKEA 4PSCA 3TDMA 3CLTC 3V1TC 5HJ7A 3GFFA 1AF4A 8MHTA 1FU8A 4L8YA 5CNJA 5I48A 4HX9A 3ND9A 2RE8A 1HDIA 1VHTA 3QKRA 1IXRC 2Z2ZA 3I64A 4M0CA 1WX1A 1VKZA 2I1VB 1ATZA 3DEIA 1TQDA 3HA7A 5A7GA 2B7CA 4KK4A 2DFTA 2X5OA 2MSKA 3FOBA 2EC5A 2ZS8A 1KZHA 1C3XA 3NASA 1TEVA 3R76A 1M0SA 4N7JA 4P83A 4B3SB 1D2CA 1FXUA 3WL3A 1GZ4A 3CF4G 2VQEB 4C06A 1M2FA 3VJMA 1OVGA 3FTQA 4G5GA 4G4IA 5EIOA 1JIKA 3L1KA 2C9MA 3I0MA 4YO8A 2O7QA 1IIRA 4ZAZA 5KNBD 2QHXA 5ALKA 5TV2A 4BYGA 4KNWA 1VCHA 4KAXA 5BSTA 1X0XA 4EWLA 5M2QA 3H5TA 1YOVB 1XK7A 4RZSA 4EUKA 1LX7A 1NXSA 4RJKA 2YHIA 4E7OA 2QG9A 1ZGBA 1O08A 4D9IA 3W5SA 1ZM9A 2VPXA 3BZUA 3K0CA 2Q50A 2XA1A 4D45A 2CEAA 4Y8VA 4YECA 3R1IA 3G0HA 3HXOA 1YQEA 5IAJA 3VZPA 2F4NA 1YT5A 3UY4A 4LJAA 3KBBA 2ZUFA 1L7OA 1RAHA 4KMOA 1XZPA 4UMEA 1I1QB 2Q45A 5KHAA 5JCZA 2BDEA 3N76A 3I76A 4HZIA 1DT5A 4O4LB 2OXCA 4EGCB 5KVQA 1J9EA 1ZJYA 4FR0A 2RKWA 2DFLA 2ID8A 4IDQA 2IW1A 2AKYA 1YS2X 2R6R1 4B74A 4K88A 3ZKWA 3QY9A 1XTRA 4G89A 1JL3A 1HETA 4DAOA 1W36C 4FZJA 4CI9A 1U6KA 4DV7B 4KODA 2WHXA 4S35A 2DXIA 4FJ2A 1V71A 2UYCA 3DLAA 3IT0A 4OL9A 2PFKA 1GNSA 2O2ZA 4M1WA 1EG7A 4DM4A 2R1VA 1XCOA 2HPVA 3BXHA 1I6LA 2YRWA 4JI2B 4MOWA 4MK4A 1H9AA 2X7HA 3JQ9C 1XQYA 3WB1A 4OGGA 3E5RA 2EBWA 2BCJQ 3ZGVA 5BVGA 3V80A 4FMBB 2ZROA 2I7XA 3FNBA 2D1SA 4MQFA 3QKIA 1NY6A 4COKA 1TC1A 4EJ6A 1PUXA 2DUMA 2RGBA 2ZT8A 2BZGA 2WVJA 4IBOA 1VFNA 3ZWMA 2Z58A 4KSYA 4HB0A 5EGNA 1BMQA 1NKVA 3UAOA 5BWBA 1B0UA 3HYCA 2IHUA 3PPVA 4S24A 4ON9A 2C0QA 4ZALA 3S4YA 3IH5A 1SOMA 3STHA 4GR5A 1CE8A 2HXSA 3CIOA 2WJ6A 4DSZA 3IPLA 4WACA 4ETWA 1OW3B 5AIAA 4L07A 3CKMA 2Z4TA 3VAZA 3WDSA 1B74A 1RS0A 2C8LA 1OT5A 1Z4PX 1XZHA 2YIMA 3EWSA 2FR8A 3O1IC 3O8BA 4WH0A 1T36A 4CFZA 1C7QA 2J9FA 4EKEA 3NYQA 1WZUA 1JMVA 1WVIA 1X2BA 2BSAA 1FLDA 3H2JA 4LYGA 3RNLA 1TKAA 1QIEA 1QPZA 3AXSA 3UXEA 3CLRC 3GP8A 2NSDA 1NL3A 4FZRA 2CL6X 6REQB 1KU0A 1VE6A 4HVCA 2COKA 1MAVA 4YCJA 2FOIA 1F20A 2AE2A 4PQFA 3UA3A 2EFGA 3M2TA 4F11A 4L75A 1UCFA 1POXA 4BN0A 2J1LA 1SUIA 2G9RA 1EFTA 4ZCQA 5C7LO 3ME5A 1S01A 3PWTA 4F9EA 2XT0A 1A8QA 5HS4A 2P65A 2YS7A 1K3TA 1ZN2A 3KOWA 1VRVA 3NPAA 4RMIA 4QU5A 2XGJA 2Z4SA 3RAPR 1H3EA 3L79A 2ZRKA 1N5RA 3LV8A 1RXYA 4BVLA 2DR3A 1RYEA 1LEHA 2BHRA 3NGLA 1CXZA 4UHKA 5IEBA 4AYWA 1JTFA 2DHRA 1RE0A 3HB0A 1PS0A 4KYVA 3E7FA 3ZY6A 2D2FA 3HXLA 4FFBA 1R3UA 2OGWA 2QNIA 5IUKC 3Q5EA 4IIEA 2NADA 3JQ7B 1PL6A 2Q4BA 5DLYA 2QNBA 4DJEC 3BXPA 4KPUA 4O4HA 4RTKA 5FNVA 3GDWA 1PNRA 1E7MA 3RFCA 4X93A 3HYLA 3R5FA 1VRCA 1Y1RA 1G9TA 2JEZA 3Q5GA 1J0EA 4RTPA 4LKOA 3TI9A 1T43A 2NZXA 2PZJA 2O9JA 3ABOB 4WBNA 3BA6A 1E0JA 2P91A 3V7UA 4ENPA 5E0OA 4L8FA 3R6LA 4EF6A 4RVUA 1CQPA 2A9QA 1CCWA 5LYJF 3NVDA 5D86A 3CW9A 3PX3A 2E2WA 2YS6A 2H9YA 4P2BA 3WGYA 2VEDA 1GADO 1RQGA 3G23A 5JJCA 3DTVD 3EDYA 1ZWKA 3UANA 1SK9A 4JIGA 2OLKA 4E3ZA 5FLEX 1V7PC 2J30A 2MINA 1SRQA 4K9OA 1DQSA 5IULC 5IARA 1WDLA 4CG1A 2H17A 5LXTA 5L3QB 5TE9A 1V6AA 1WXFA 3EVFA 3REQA 3EYAA 4E1VA 3O2QB 5K6TA 1L4KA 3IMEA 1RWMA 1L5WA 3L6UA 1FSGA 4R01A 2BKEA 3HYTA 3KAQA 3QJ5A 5A62A 3IMCA 4X90A 4HGYA 4U2BA 1L1QA 3BGIA 3MGCA 2DKOA 3HL0A 1VHJA 2P4QA 4ZV4A 3TJZA 4Q00A 1E3EA 1LBTA 1QAOA 2OZLA 5IDQA 1TAGA 3NGMA 3KQTA 3UAVA 4AQYB 1FFEA 3DEFA 1PJAA 3PYMA 4CM8B 3K70C 4JVMA 4HWPA 4ANFA 3GYBA 1E79D 1NV9A 3BCHA 3JVEA 4PYRA 3THYB 4JUFA 1P29A 2A58A 3PEWA 1K2WA 2ZWMA 4OOFA 4YBRA 2G5TA 5LQDA 5K01A 5KKAA 2BHNA 5IWCA 2A1UB 3BB1A 1C29B 4JA2A 1QTQA 4C22A 1U8ZA 3FPHA 1SHTX 3FAZA 4EA7A 5IANA 1AHNA 1KZ7B 5FTKA 1L5FA 5LA6B 5EWMA 3MJHA 3JR3A 1WWKA 5F4ZA 1EM6A 3VHQA 5B1EA 5JQGB 1GOTA 1JG1A 2XMDA 3LY5A 3LQ2A 4ITVA 3U1BA 2C4TA 4AICA 3K0FB 2VA8A 5DN6D 5A6SA 2AG6A 4W9NC 2EBUA 4Z0NA 3U9TA 3QFSA 5L3SA 3ZJUA 3I9V6 2JLVA 3NDBB 4MV4A 3ODPA 4B3HA 2O3SA 1JTEA 4DLLA 3W79A 4N4AA 2WNIA 3CZPA 4HAOA 5G02A 4UTVA 5T4BA 4CCWA 4UDYX 3G8YA 5K05A 1U65A 1SA0A 3L6BA 3MUEA 4PQEA 4UCXA 2XCRB 5CIQA 1I2BA 2H4FA 3ORYA 1D6JA 1FRFS 3WMGA 2BFFB 4FEYA 1KAEA 3NC4A 2VUIB 3F6BX 2CWDA 3BB4A 4P1ZA 4Q6WA 4UAGA 1H94A 4URHA 1UPUA 4R8VA 4BNWA 2Q1TA 3W9SA 2Q62A 4INPA 3VR5H 5B2FA 4ZO9A 5KYYA 2JFOA 3IJEB 5CDFA 3SQXA 2CJXA 3AHCA 1UFQA 1CUXA 1U9ZA 3QE2A 2PUHA 4N3NA 4KWEA 3BJMA 5BWOA 2A1TR 1EVJA 2DHCA 2D0OB 3EVZA 1PJTA 2XADA 3PPWA 4YK7A 4P31A 1LBHA 2WJPA 1YDEA 1ZBQA 2YJGA 1FNBA 1GP2A 1BMFD 1QWSA 2WJHA 4K87A 2FMHA 4I36A 1BW9A 4Q7KA 4HH1A 1WAMA 2PD4A 3CF4A 3T54A 1BU5A 1YNSA 3C0KA 3UFXB 1CUHA 1PNQA 2J0VA 2SHKA 3E4CA 5LJIA 4RE5A 1ULAA 3TL3A 2KE5A 4NU6A 1PUIA 4BQSA 5EESA 3TAUA 4HTFB 1GCAA 4IFBA 3R77A 2DPHA 2O8BA 1QGUA 2H7YA 1VIMA 3K2EA 4K9MA 4MV8A