4HDUA

Crystal structure of s. pombe atl1 in complex with damaged dna containing 2-aminopurine
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alkyltransferase-like protein (Atl1) distinguishes alkylated guanines for DNA repair using cation-{pi} interactions.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hduA00
1HW5A 2YU3A 1ZG5A 3ZPLA 2YSRA 1XGSA 3BPXA 4HW0A 2LDUA 1FNNA 2RV8A 3HRSA 3HHHA 5DYMA 4BH9A 1RUNA 2MD5A 2XV4S 3GYHX 3MFKA 3WTTC 2NYXA 2BEOA 2E7XA 2R7DA 2IJLA 2RVCA 2X4HA 5JI6A 4L9JA 3BJOA 1JE8A 2QYOA 4G6QA 3FXQA 3M8EA 2Q8KA 1IN7A 3R6SA 4MGRA 2PBIA 1K79A 2XVCA 1FX7A 1OYYA 2L02A 4RGUA 3F3XA 1ZRFA 2GWRA 3DF8A 5E1ZB 4OMZA 1KU2A 4I0AA 2HDCA 4NQWA 3C7JA 3I58A 2M30A 1HKQA 2O6GE 3V8KA 2QWWA 3E6DA 1R1VA 5HLHA 1IXRC 3QU6A 4HV6A 1PP8F 1ZRCA 1J59A 1O57A 1F1ZA 3K9TA 2ZNZA 5HLIA 3FM3A 1W7PB 5LHIA 2EA2A 1I5ZA 2KIUA 2W25A 3C18A 1YS6A 1LVAA 2HS5A 3J80Z 2ZMEA 2ISYA 5D5UB 1RNLA 2NAZA 4G8XA 2ZO4A 4EJVA 3FM5A 3WE3A 3FZVA 5DUKA 4CDGA 5AIQA 3CUOA 4OMYA 5F1RA 4UVBA 1Z05A 2KRFA 3IHUA 1O3TA 6PAXA 1QPMA 5FO5A 5LGTA 3HIFA 2G7UA 2W57A 3BY6A 3I64A 1XMAA 1S7AA 2D1HA 5A2QK 3QAHA 1X3UA 2QVOA 3SZPA 3H92A 4YFXF 1CF7B 4LJZF 3RYRA 2GQQA 2BGCA 2K27A 4UHTA 3QP6A 3E97A 2PEXA 3E5XA 3GZ6A 1P4WA 1GXPA 1XCBA 3V8JA 1R7JA 1J0RA 2D1VA 1G3WA 1MJBA 3I54A 1GHCA 2COMA 4HF1A 1ULYA 5D6EA 3TO7A 1MGTA 4Z2YA 5FLXK 3IWZA 1XB4A 4MEXF 3MQ0A 3MWMA 5LGNA 1JHHA 2FBIA 1B6AA 3QPHA 3K1PA 5DCFA 1LEBA 3IC7A 3ZQ7A 3GXOA 1DPRA 3TO6A 2P6SA 4B09A 4ASNA 5E1WA 2CSOA 1KA8A 1DDNA 4M9ZA 3EDPA 2PI0A 3TDZC 5FD6A 2HYGD 4P9FA 2O61A 2WWYA 2C6YA 3DEUA 4L9TA 2V1UA 1R1UA 4HX7A 2QUFA 2XKOA 1MDMA 1DPUA 4FX0A 3ZMSA 3B73A 3FXUA 4OINF 1D5VA 1Q1HA 4BHCA 2LF7A 2P7VB 1XGOA 1IRFA 3MZYA 4EV0A 1I1GA 4I02A 3K1NA 2GA1A 3TOBA 4U0YA 4BYYA 5E18F 4P96A 5ED4A 1KYWA 3ZN1A 4XLPF 3RJPA 1AWCA 4LK0F 1SFXA 5D4RA 1MJAA 4OOIA 2A07F 4IXAA 1KU9A 2BYVE 5HVQC 3KP7A 3SXYA 2PG4A 2V6CA 2VBXA 1FBUA 4AVPA 1FYLA 1EH8A 1K78B 3GO5A 1YQAA 3BP8A 3SFZA 4L0ZB 3O2PE 4JQFA 3MCZA 2YPRA 1YO5C 3BOQA 2L54A 2P6TA 4WXHA 3U1DA 2JSCA 1HSTA 1XMKA 5DV5A 4M9SA 1WSUA 2RC4A 1I6XA 4U7BA 3M8FA 4GO1A 3W6KB 5CYVA 2OZ6A 1SAXA 2HWVA 5F6FA 4A0ZA 3WU1B 3WTUC 3E5UA 3TDUC 1J7KA 3Q5FA 1FYKA 1OPCA 5KK1A 1EH6A 2JRTA 1P2FA 3JAMK 4ESJA 3V8LA 4ENKA 4AIHA 4YG2F 1H0MA 4L5JA 2LKPA 1V3FA 4UNOA 4Y17A 3MEXA 2HGCA 3GFLA 1DP7P 2VBYA 4L9VA 1IXSB 3F6OA 3ABTA 3KZYA 4N9IA 1YS7A 4QLCU 2FEZA 2DW4A 1S29A 3V7RA 3GZ5A 2XKPA 4GYGA 3HTUA 4S05A 1O7FA 1XSXA 2JTVA 1IRGA 4M71A 5DEQA 2G7HA 4ZYDA 2EV0A 4PCQA 5FD5A 3OV8A 5F64A 3KP6A 4YFKF 2LNBA 2ACJA 3CTAA 2FU4A 3SHFA 3KP2A 4BNCA 5ERIA 1YTYA 4CGZA 5CVIA 5BQTA 1FPQA 4RGSA 1LQ1A 1XGMA 1BI0A 4WX9A 1K7AA 4G94A 1ZARA 2Z33A 1W5TA 4LK1F 3NQOA 1B59A 1ZN2A 2VE8A 1U5TB 2VBZA 5DUIA 1CF7A 4HQMA 5EEHA 2NS0A 2OZUA 3D5LA 4LLGF 3HRUA 3JSOA 1K78A 3Q9SA 3WE2A 4KA4A 4ENJA 2W85A 3I53A 3E6MA 4S04A 5L3EA 1H9GA 2KIMA 5E1XA 3QOPA 4A0YA 2D45A 4A5MA 5DD4A 3VEPA 3R4KA 4RGRA 2ZMEB 1U6GA 2KJBA 5IT3A 5FGMA 2PLYA 4CHUA 1Y0UA 4YIIA 4OIRF 1SMTA 1RZ4A 3J81K 1U3EM 3R0AA 5HDGA 1MD0A 2FNPA 4LB5A 1MDMB 2VONA 2CQKA 2QLZA 2BE5F 1HXDA 3JTHA 3MAJA 3DQVC 2VN2A 2XHKA 3P9CA 3PFIA 1BI3A 5L3GA 2H94A 1BJAA 1YG2A 4HA8A 1Z6TA 3WTYC 4KICA 2YR2A 4HF2A 2K4JA 4CO8A 2KIFA 3L09A 3GFIA 5CVJA 2GIVA 3PQJA 1G3TA 4PDKA 3GFMA 3T1BA 2XIGA 4M74A 3RKYA 2O8XA 1WKMA 2TDXA 2XROA 1MJ9A 1XGNA 3RKWA 1AOYA 2XAGA 3IWFA 3KP5A 4UV9A 3WTZA 1R36A 1QZYA 5L3BA 4WCGA 5CJ9A 5K5OA 3P9IA 3V4GA 2LF8A 4CZZA 3FMQA 3KFWX 1FBSA 4RAZA 1FZPB 4RGXA 5J6XA 3CUQB 2QZ8A 3ECOA 1HW2A 3J7AO 4AD9A 3ROUA 5K5QA 2RKHA 4HX4A 1IN8A 1YW7A 4LD5A 5LHHA 4ZYEA 2OBPA 2F5FA 1FSHA 2IVMA 1O7LA 5K1YA 4E70A 4WXCA 2VXZA 4KYWA 5D4SA 1UFMA 3FX3A 3WGHA 1ZGAA 2OU2A 4R8HA 3H3UA 3KETA 2V9VA 2A6EF 1FLIA 5LEKA 4O3MA 1JXSA 2H6BA 1EV7A 2Z9OA 1BIAA 1BM9A 4CICA 2QBYA 3RIRA 1S7OA 1WWXA 3ZMUA 1W7PA 4K2EA 1QBJA 3IRRA 4R1HA 4DQ2A 1MKMA 2Q2EA 4HDUA 2RGVA 1ZAOA 3GF2A 2DFIA 2IW5A 4IJAA 3F8NA 3E3VA 2XASA 3VOEA 1D3YA 2E1NA 3F22A 3CUQC 1GVJA 1ZLJA 2UWMA 1T38A 1LDDA 5E8GA 3N4MA 1R22A 3GFJA 3ZP5A 4IHTA 4RB1A 2PN6A 1TTYA 4IRHA 3F6VA 4I0BA 3HHGA 4UV8A 2ZJ2A 5A2QZ 4L0YB 2P8TA 3IL2A 3QRFF 2MC3A 4RB2C 5J8CA 1MZBA 2ESHA 2VC0A 2VC1A 3GW2A 3RPUA 1IZ1A 2EJRA 2EV5A 4NB5A 4HQEA 4HAMA 4AIJA 4M6XA 2FXAA 1XDUA 2DLLA 1ZGJA 1PUEE 3FWEA 4LG0B 2WV0A 3HTSB 3QU3A 2DQLA 2DAOA 5ICCA 5DDGA 1XN7A 1LDKB 5K5RA 1B4AA 1GXQA 4I7HA 5E20A 5L3DA 3QPTA 3AAFA 2A5YB 3REOA 4ESBA 2ETHA 2L4AA 4XBFA 2STTA 2EFNA 1FY7A 4BXUA 2MBFA 1YLFA 4I01A 3K69A 5HS7A 5D6FA 1T98A 2W84A 3ULQB 2A61A 3GUDA 5LEJA 5AIPA 1E2XA 4HV5A 3TO9A 1DUXC 1HKTA 1LB2A 4Q48A 5HLGA 1R1TA 2CYYA 2F2EA 4KIGA 3HUGA 3HYIA 1YW9A 4AIKA 1SD4A 3VFZA 1F4KA 4U0VA 4MTEA 3F8FA 3K0LA 3JAMZ 2KKOA 3CJNA 3WG9A 2RNJA 1HKSA 1QZZA 1OMIA 4KIBA 2Z99A 2M5WA 4IRGA 3RYPA 3U9GA 1CGPA 2HQNA 2MLGA 4G7ZF 1T0FA 2QENA 1IN4A 2F5EA 2W24A 4EMSA 2ZFWA 2HTJA 3K1MA 4HX8A 4IRIA 1KQ0A 3RKXA 1G3YA 4KFCA 2FA5A 5E17F 2Z3YA 5J8FA 3LAJA 1O3QA 1U2WA 3R0JA 5EEGA 3FF5A 1BOAA 1RI7A 1XSVA 2CW0F 1ON2A 4HZFA 4BQAA 2FQ3A 1ZG3A 1S8NA 4H0EA 2CGPA 4F7ZA 4LB6B 3RPQA 2RQPA 3LA2A 3LFKA 2HR3A 3KLOA 1WI9A 1PDNC 4HLXA 1TNTA 3U2RA 4WK8F 3TOAA 1P4XA 3BJ6A 2HZTA 2EFPA 4P5OA 2B0LA 2EFQA 3D0SA 1Z91A 1TBXA 1B9NA 4FX4A 1U78A 1NHAA 3IKVA 2DTRA 2EK5A 4HOBA 5AONA 4LMYA 3L9FA 3RDIA 1HW1A 2QM3A 2XAHA 4EJWA 1XD7A 3ERED 4NHJA 2G9WA 3T8TA 2MH2A 3V7SA 2M1BA 4I09A 1YW8A 5BPDA 2QQBA 2RDPA 2Z5UA 4IF4A 1P92A 4KIFA 5FFXA 1SD6A 1UHMA 4P9UA 5ILSA 3F8CA 3MZHA 3I5UA 4PGHA 3DFGA 3I59A 3ABUA 2OQRA 3HSRA 4XRFA 2IP2A 4FT8A 4KMFA 4U0WA 3CUQA 2OQGA 3COAC 1G4DA 5HOOA 5FFZA 2XAFA 3DV8A 3ZMTA 5JHUA 4UUVA 1UHWA 1QGPA 3RTRA 3CLOA 3O6BB 2Y0MA 1KU3A 1FP1D 4DNCA 2UZKA 3T8RA 5TRDA 4G9YA 2MA3A 4B8XA 1J2XA 4OU0A 1VTNC 3ECHA 4WWCA 2D2WA 3EUHA 2HQRA 4EM0B 3ELKA 3DPTA 1U8RA 5D8LB 5FB2A 2RN7A 1R00A 2K4BA 3HSEA 1IXCA 4Q47A 4L5IA 4O5VA 4EJOA 3I4PA 2FBHA 1STZA 5HS9A 2PQ8A 2CG4A 3G3ZA 4HYEA 1BC7C 4ZYGA 3TGNA 3NRVA 4WF2A 2AXLA 3T0YA 1Z1DA 1BI2A 4N0BA 4JBAA 4YFNF 3BDDA 2FRHA 2ZXJA 1R5HA 1LDJA 1BC8C 2M45A 2M87A 1WQ2A 4KUMA 2A3SA 1O3SA 4KMUX 2FMLA 3H3ZA 4GCVA 4LLLA 2ZBKA 5TJJA 1REPC 1P6RA 3J80K 2R7FA 5DCMA 1R58A 3LAPA 2AS5F 2NNYA 2DT5A 1T39A 2J5PA 4Y13A 1EH7A 1L0OC 2VBWA 4G7OF 5LBQA 2YX7A 3SQNA 2A69F 4EJTA 2HYFA 3P7NA 1D8JA 4Y15A 5IT9K 1OR7A 1TNSA 5CLSA 3ISPA 3KCCA 3GX4X 2FBKA 5IT9Z 2IA2A 2E1CA 1G6NA 4LLNA 2FSWA 3G73A 1ZHFA 1SD5A 1LEAA 3BZ6A 3EYYA 3L2CA 3F23A 2EA4A 3F8MA 1LNWA 5LRSA 4AWXB 2PMUA 5DD8A 2DPDA 1U5TA 1RIOH 4I2OA 3BROA 2P5VA 1K6OA 2IT0A 1ONVA 1TQMA 4D0PA 1A04A 5H20A 4N9HA 2V1DA 4MNUA 3F72A 4UVAA 5CVRA 4U88A 3LA3A 1ZH5A 2K7LA 2NRAC 1FC3A 3HOTA 3HSFA 1YIOA 1ZRDA 3CDHA 2R3SA 1XCVA 4MHGA 1C0WA 1BBYA 3DPLC 4QWQA 2WTEA 2P5LC 2A6HF 1QQIA 4KNYA 2HTSA 1BN5A 3VODA 4R79A 5JFRA 2OD5A 2XUBA 3LQRA 3IKTA 5L3CA 1TLHB 4XSZF 4HDVA 1PP7U 2ISZA 4ZYHA 1TW3A 2H09A 4MQVA 3NEUA 4XSXF 1TQPA 4EVIA 3I71A 3FHZA 2QQ9A 3HRMA 4BAYA 1Z7UA 2NNNA 2FNAA 3EQLF 1KGSA 1ON1A 2VT3A 2PMHA 3E6CC 2QQAA 4ENMA 2Q0OA 2V1XA 1OKRA 4IHSA 2JPCA 4UXNA 4G7HF 4BHBA 1XDSA 3EETA 2H27A 1G3SA 1RUOA 1F5TA 4HBLA 4PZJA 2XRNA 3FMSA 3N97A 1FYMA 1HBXG 3BPVA 3FXRA 4P55A 4A2UA 4OIOF 4LFUA 2YX4A 2DI3A 4KDPA 1S6LA 1I1SA 1WRJA 4RB0A 5BOXA 4UVCA 3I59B 1IAWA 1B9MA 2P4WA 3KZZA 3WODF 3JW4A 4JK1X 1BI1A 4CYDA 2JPBA 1H9TA 4YIFA 1USTA 5D5VB 1T2KA 1TQIA 3V7CA 3C3WA 1B1BA 1HSJA 3R60A 1OYWA 2HOEA 2GZWA 2PFBA 4HLYA 1IUYA 2DQRA 5BMZA 4IVNA 3ZMVA 3R61A 2UXXA 1FOKA 5ICGA 1J9IA 4RAYA 2HKOA 2WC2A 2IA1A 5ICFA 5LGUA 1ZREA 3TQNA 5DCMB 3LSTA 4MQ9F 1IW7F 1ZLKA 2ELHA 2VOOA 1FT9A 2LSOA 5JVTA 2QBYB 2BV6A 4OIPF 3ZN0A 1P4AA 1UCRA 1D8KA 3SZTA 3WTVC 2FOKA 2V79A 2ADUA 4L18B 3LWFA 1OYIA 2HKXA 4KN4X 2L01A 2K02A 1FP2A 4GYIA 2FMYA 4G6DA 3LQQA 4MTDA 5CVVA 3F8BA 4Q5SF 3PQKA 4HF0A 2L4MA 3WTXC 3Q9VA 1FWZA 2VE9A 4EJUA 4EQQA 1U5TC 2GXBA 1R23A 3I0TA 1SFUA 3DP7A 2EV6A 3M9AA 1J75A 3L00A 3FMRA 1KQ9A 2MLKA 2XAJA 4M9XA 1J5YA 3M7GA 4GXOA 3E6BA 3QP5A 5LLQA 3WTSC 3WGIA 4M73A 2Y75A 1E17A 2Y48A 3KEOA 5CVUA 1IN5A 1R5GA 2K86A 5E8IA 3KEQA 1KQ8A 2E7WA 5FLXZ 5D5WB 5JR3A 3B02A 3CO7C 2A68F 5D8KB 2DBBA 5BS6A 2EFWA 5L3FA 4ESFA 2H6CA 3BWGA 5KVRA 4L9NA 4Q4ZF 5HS8A 5BPIA 1HQCA 1JGSA 1KYZA 2JZYA 3KE2A 1USSA 2OA4A 3GWZA 4XLNF 4MEYF 4RS8A 3P9KA 2XAQA 1W5SA 3GLXA 1XSDA 2GAUA 1F9NA 5ILVA 1Z9CA 1I27A 4EM2A 4ZZDA 2ZNYA 1UB9A 3OOPA 4O6JA 3J81Z 2O03A 1ZG1A 1SMYF 3KLNA 2O3FA 4RB3C 2P7CB 1O3RA 2STWA 3DKWA 4A6DA 1FBQA 2VT2A 5HDNA 4OIQF 3L7WA 3BJAA 1IN6A 4CXFA 2F5DA 1ODDA 3S2WA 1KU7A 5D5XB 3RI4A 1JHFA 4LG0A 5LRRA 2EFOA 3T5XA 2DK8A 4U7DA 1FSEA 2JT1A 4KN7X 3DXJF 1T6SA 3W6JB 2XGXA 1V4RA 4KT5C 3IRQA 3GEZA 3JTGA 3KP3A 5LHGA 3CO6C 2EWNA 2HEOA 3ML6A 3F21A 1SFEA 2O0YA 2VOPA 4ZZLA 3WU0A 4ETSA 1YFHA 2GA2A 5ILUA 3ZMZA 1BIBA 2ESNA 2CFXA 2ZCWA 4EM1A 4TV7A 1YYVA 4ON0A 2J5OA 2DO7A 2P5KA 3VB2A 2ZKZA 3HOSA 3JSPA 1SD7A 4GGGA 2DU9A 1S3JA 3LA7A 3E5QA 2BBYA 2MH9A 2FE3A 2CO5A 4M6YA 2IA0A 4IPAA 4A12A 1ZYRF 3GVAA 3WGGA 2PJPA 2DPUA 1Z6RA 5ICEA 3K2ZA 2F5CA 2IPQX 4LGWA 1W7PD 4A0XA 2M8EA 2IRFG 4EGYA 4EGZA 3KP4A 4FHTA 2UXNA 3O3KA 3M1EA 4WXDA 1QO0D 2DK5A 1L3LA 2FF4A 2L3DA 5H6QA 4A5NA 1IF1A 4ENNA 1W4MA 1LJ9A 4ZH4F 2KJCA 2CWEA 3EYIA 4I98B 5HDKA 2X0LA 3HRTA 4M72A 4A6EA 4PGGA 2OAZA 2HFHA 4BHPA 3WTWC 1QNTA 1TW2A 5H6RA 2GXGA 3TKYA 3C1DA 3ZMDA 2EB7A 2VODA
chains in the Genus database with same CATH superfamily
2EZHA 2BHZA 4ZTFA 3S8PA 1MBEA 1HW5A 2YU3A 1ZG5A 5J47A 2HVSA 3ZPLA 2AHQA 2DYSH 1XGSA 2YSRA 4XNFA 3RPUD 3BPXA 1S9HA 4HW0A 4M6VA 2JMWA 3K4NA 4DYRA 2LDUA 3TBIA 1FNNA 2RV8A 4RM2A 3HRSA 3DLLF 2X6OA 3GBGA 3HHHA 4LIVA 5DYMA 4BH9A 1RUNA 2MD5A 2DDAA 2XV4S 1VQ8I 4A3LJ 3GYHX 2HU9A 4J19A 3MFKA 4F91B 3MZ8A 3WTTC 2NYXA 2BEOA 2E7XA 2R7DA 2IJLA 2RVCA 4V2FA 2X4HA 5JI6A 3H35A 4L9JA 3JRIA 2ZC2A 3BJOA 1JE8A 2QYOA 4G6QA 1X58A 3FXQA 5FKOA 2VLAA 3M8EA 5M5XJ 2Q8KA 3HDDA 1FIPA 1IN7A 3R6SA 4HRIA 3I56I 4MGRA 2V26A 1RETA 1D0YA 2PBIA 2RNGA 4X6AJ 5B5EC 1K79A 2L7FP 2XVCA 3J7AY 3BZCA 1OCRH 4NDLA 3BTIA 1FX7A 1OYYA 4F92B 4A69C 3HZJA 2M7AA 2L02A 1D0ZA 4RGUA 3F3XA 1FTZA 1TWCJ 1ZRFA 2GWRA 3DF8A 5E1ZB 1ETOA 4OMZA 3Q0VA 1KU2A 4I0AA 5EEAA 4NQWA 4BQOA 2HDCA 3C7JA 4BDYA 3I58A 2M30A 4CZCA 4GFBA 2XSDC 2JVHA 1HKQA 2O6GE 3V8KA 1TL8A 2QWWA 4BEHA 2YS9A 3E6DA 4XRSA 2H1LA 3S1NJ 1R1VA 5HLHA 1IXRC 2ZXWH 4NBQA 3LSJA 3MD2A 3QU6A 1UAAA 3VWBA 4HV6A 1PP8F 1ZRCA 1DU6A 4BJ5C 1SVLA 1O57A 1J59A 4XKCA 1F1ZA 3K9TA 1HDDC 2NVTJ 1WJBA 2F6CA 4HNUA 3BR6A 3LL7A 1PUFA 2HDDA 1V5EA 2ZNZA 5HLIA 3FM3A 1W7PB 5LHIA 2EA2A 2EIJH 1K6YA 1I5ZA 5EF6A 2KIUA 2W25A 3HGGA 3C18A 1YS6A 1O4XA 4U87A 1LVAA 2HS5A 4M3FA 3J80Z 2ZMEA 2ISYA 5D5UB 5E3MA 2V4JC 1RNLA 2NAZA 4G8XA 2ZO4A 2DMNA 1Q1VA 4KT6A 2MG4A 4EJVA 1ZR2A 2ZJPF 3FM5A 2DYRH 3WE3A 3AG3H 3FZVA 1IRZA 5DUKA 1YIJI 4I76A 4CDGA 5AIQA 3CUOA 4OMYA 5F1RA 3CESA 2AQEA 4UVBA 1Z05A 2KRFA 2XF5A 3JRDA 3IHUA 1O3TA 6PAXA 1QPMA 1VI0A 5FO5A 5HNHA 5LGTA 3HIFA 2G7UA 2ECCA 4DZJA 2W57A 3GTQJ 4HEA2 3BY6A 2CQXA 1RPWA 3I64A 1NK3P 3X2QH 1XMAA 2XB5A 2BVLA 1S7AA 3H0DA 1S72I 2D1HA 5A2QK 1Z77A 3QAHA 4IOAF 3MKLA 3BQZA 1X3UA 1MMDA 2X6YA 2QVOA 2B7EA 3SZPA 2VXDA 2HZDA 3H92A 4YFXF 1CF7B 3BG6A 4LJZF 3E1SA 2N8GA 4DIQA 3RYRA 2GQQA 2B9SA 2DJNA 2BGCA 3JR9A 3A2KA 2K27A 4UHTA 3QP6A 4D7NA 4OAZA 3ZOBA 2KT0A 3E97A 4RDUA 2PEXA 3E5XA 1FJLA 4Y33A 3GZ6A 1P4WA 3CMYA 4BY1J 3CCUI 2CQQA 1GXPA 1XCBA 2IS6A 3V8JA 1R7JA 1ACIA 2M34A 1J0RA 2D1VA 1G3WA 1MJBA 2E1MB 2Z2SB 3I54A 1GHCA 2D5VA 1LFUP 2W4SA 1IC8A 2COMA 5FLMJ 3SFIA 4HF1A 4BXXJ 1ULYA 2E19A 2IBDA 4I99C 5D6EA 4BE1A 4XLCA 2JK3A 3CZ6A 4C30A 1MGTA 3TO7A 3OYAA 2VUMJ 1MBKA 3KPHA 4Z2YA 2R5YB 3D5RC 3IWZA 5FLXK 4D7MA 4C3HJ 2QEXI 1XB4A 3IP4B 3MQ0A 3MWMA 5LGNA 3CCLI 4MEXF 3SDGA 1JHHA 1ENHA 2FBIA 1B6AA 3QPHA 1RESA 3BG9A 4BBSJ 3K1PA 5DCFA 2WV1A 1LEBA 3IC7A 1GV2A 3GXOA 3ZQ7A 3L2QA 1DPRA 1VQPI 4MO7A 3TO6A 3FKIJ 3CCJI 2P6SA 4B09A 4E7JA 4ASNA 5E1WA 2CSOA 2X1CA 1N77A 2GM4A 1KA8A 1DDNA 4PSXA 5IP6A 4M9ZA 3EDPA 3DBLB 3TDZC 2PI0A 2KZGA 5FD6A 2HYGD 4P9FA 2O61A 2WWYA 3K4CA 3G71I 2C6YA 2LY9A 3DEUA 4QTRA 4ITVA 4L9TA 2V1UA 4JX5A 1WH7A 1R1UA 2K40A 2PJRB 1QVTA 4HX7A 2MW8A 2QUFA 2XKOA 2E2HJ 1AU7A 3E0JB 4DW6A 1MDMA 1DPUA 3F0CA 2ELJA 4FX0A 1P7JA 3ZMSA 3B73A 9ANTA 3WG7H 3FXUA 4XONA 4OINF 1D5VA 1Q1HA 2XC7A 2KMUA 4A3GJ 4PUSA 3KIOA 4BHCA 2LF7A 2P7VB 1BR1A 1XGOA 3K7AJ 1IRFA 1I3QJ 3MZYA 4EV0A 3O8GA 3A01A 1I1GA 1QHHD 1MSEC 4I02A 1K4TA 3K1NA 3HOVJ 2R0QC 2GA1A 3DBRB 3TOBA 2L0KA 4U0YA 4BYYA 5E18F 1X4PA 4BY7J 4P96A 5ED4A 1KYWA 3ZN1A 2TRTA 1OCZH 3O8HA 3SEZA 4XLPF 3OYLA 3RJPA 5J1YA 1ORKA 1AWCA 4V19K 4LK0F 4IHWA 1SFXA 2Q1ZB 2JA5J 3G4SI 5D4RA 2CH0A 1MJAA 4OOIA 2A07F 3L2RA 4IXAA 1R49A 2EPFA 1KU9A 2BYVE 5HVQC 2JUGA 2CQNA 3MKWB 3KP7A 3SXYA 2PG4A 2V6CA 2VBXA 1FBUA 4AVPA 1D1AA 1W0TA 1FYLA 5FRNA 4CSWA 3RKQA 1EH8A 1K78B 3GO5A 2BY3A 1YQAA 3BP8A 2E5ZA 3SFZA 4L0ZB 4XKWA 3O2PE 4JQFA 4IOCF 3MCZA 4RM3A 1ZK8A 2YPRA 3FXKA 1YO5C 3BOQA 2L54A 2P6TA 2IAIA 4WXHA 4B44A 3U1DA 5JLWA 1YOVB 4BGDA 1B8IA 2JSCA 1HSTA 1XMKA 4JYKA 2V1NA 3A1YA 5EG0B 2VKEA 2EIMH 5DV5A 2VJ5A 4M9SA 3IV5A 1WSUA 1UHSA 2EBIA 3G2BA 1XMXA 4M3BA 5GTIC 1NK2P 2BVMA 4NUBA 2RC4A 1I6XA 4U7BA 1B72A 4HSRA 3M8FA 4Y52J 4GO1A 3BR0A 3W6KB 2R92J 1WJCA 1OCOH 5CYVA 3BC8A 2LYCA 2OZ6A 5F08A 1SAXA 1JGGA 2HWVA 5F6FA 4A0ZA 3WU1B 3WTUC 3E5UA 2HI3A 4A3JJ 3TDUC 3BT9A 1VQNI 1SC7A 1J7KA 3Q5FA 4FTHA 1FYKA 1OPCA 4HSTA 5KK1A 1EH6A 1XG1A 2JRTA 2XPUA 1QPIA 1P2FA 2FQ4A 5JLXA 3JAMK 3BTJA 4ESJA 4Y3OA 4RBOA 3V8LA 3MN2A 4ENKA 4AIHA 1VQKI 3DEWA 3HUGB 4YG2F 1H0MA 1ERDA 4L5JA 2LKPA 1FOXA 1V3FA 4UNOA 2KQRA 3IUOA 4BE0A 4YEJA 4Y17A 3MEXA 2HGCA 3GFLA 1DP7P 2VBYA 4L9VA 1AHDP 2XSJC 1QA6A 1IXSB 3F6OA 4N4NB 3ABTA 3KZYA 4N9IA 2R7WA 3PO3J 1YS7A 4QLCU 2FEZA 5GAGJ 4CYCB 2DW4A 4RAFA 1ITYA 2VKVA 1S29A 1VF9A 2KISA 1TZLA 5GAEJ 2XB0X 2VL8A 2OC6A 4LG3A 3GZ5A 3V7RA 4CCNA 2XKPA 4GYGA 3HTUA 1DU0A 4C2UA 3K2AA 4S05A 1O7FA 1XSXA 2JTVA 2CMPA 3TEDA 3VSLA 1IRGA 4M71A 1UELB 5DEQA 3DWLE 3CMAI 2G7HA 4ZYDA 2EV0A 1RKTA 4PCQA 2BW3B 2LY1A 5FD5A 3OV8A 5F64A 3KP6A 4YFKF 2LNBA 5EGOB 1G59A 2ACJA 3DKXA 3CTAA 2FU4A 2DFHA 3SHFA 3KP2A 4BNCA 2MYSA 3NAUA 3GZNB 2R93J 3AG4H 5ERIA 1YTYA 4CGZA 5CVIA 5BQTA 1H8AC 1FPQA 1ETWA 5TISC 4I6ZA 4RGSA 2LMDA 2EINH 1LQ1A 1X19A 1XGMA 2E1OA 2HDWA 2M9HA 1BI0A 4WX9A 1K7AA 4G94A 1X2NA 1ZARA 1ZTRA 2Z33A 1DGWY 1W5TA 4LK1F 3NQOA 4BE2A 1B59A 2L9SA 1ZN2A 3LSHA 2VE8A 1U5TB 2VBZA 5DUIA 2W1OA 1CF7A 4W1UA 4HQMA 5EEHA 2NS0A 1OCCH 2OZUA 2RQQA 4XMYA 1E3HA 2QF7A 2K3FA 3CDLA 1MBGA 3D5LA 2E34A 4LLGF 5FJ8J 3HRUA 4RLFA 3JSOA 1K78A 5LD2C 3Q9SA 2CUJA 3WE2A 5GPCA 2O8KA 4KA4A 3BQYA 1VQMI 4FISA 4ENJA 2BY0A 1TWAJ 2W85A 4HG2A 3I53A 2L2OA 2FX0A 1BL0A 2HPMA 1U0JA 3E6MA 2DFFA 4S04A 5C4XJ 3ZQLA 3LSGA 5L3EA 1H9GA 2ZJQF 3UKGA 2KIMA 3GLLA 5E1XA 3OYIA 3DPUA 2DA7A 3QOPA 1IRXA 4A0YA 2D45A 5C3EJ 5B66C 4A5MA 2KDOA 2YU9J 3DTEA 5DD4A 2DT6A 5F04A 5J4VA 3VEPA 3R4KA 4RGRA 3EUHC 1H89C 4NNJA 4A3EJ 1GV5A 2ZMEB 2CU7A 1U6GA 2KJBA 5IT3A 5FGMA 1XTAA 3OWTA 3OYNA 2PLYA 1OJLA 1R4NB 3SYTA 2DMQA 1PVEA 1ETVA 4XIDA 2UV1A 4CHUA 4DYQA 1MMSA 2XPWA 4QPQA 1Y0UA 2DJIA 4YIIA 5TGTA 1YJWI 5FKKA 3DLAA 4OIRF 1SMTA 1RZ4A 4KISA 1HLVA 3PL8A 3J81K 2BXYA 1U3EM 3R0AA 5HDGA 3H1CA 2KFDA 4ANJA 2R5ZB 1MD0A 2FNPA 4LB5A 5E3NA 5M5WJ 2K85A 1MDMB 2VONA 2Y9ZA 2CQKA 1R4MB 1T0FC 2QLZA 3OYBA 4BEHB 2BE5F 4PFOA 4CA0A 1HXDA 2QSFX 2ICWG 2WAFA 3JTHA 3MAJA 1IG7A 1OCPA 4FCYA 4EATA 4E4HA 3DQVC 3S14J 3C2GA 3GTLJ 2VN2A 4FETA 2XHKA 2CV1A 3P9CA 3PFIA 1W5CC 4IL6C 1BI3A 1X2MA 5L3GA 2H94A 1BJAA 1FIAA 4IZZA 3ZQGA 2FJ1A 1Y39A 1YG2A 4HA8A 1Z6TA 1FOWA 2X48A 3OIOA 3GTPJ 3A03A 2HQAA 1I50J 3WTYC 4KICA 4IEJA 2YR2A 2EIKH 5E79C 3KYCB 1IJWC 4HF2A 4P1WA 2K4JA 3TW6A 3CCMI 4CO8A 1Y8RB 2KIFA 3L09A 3GFIA 5CVJA 3DU6A 2GIVA 1YX3A 1VNDA 4NC6A 3PQJA 1G3TA 3JRGA 2UUZA 4PDKA 5F0CA 3GFMA 3T1BA 2XIGA 4M74A 2WAEA 3RKYA 2R5YA 1T8IA 3EUAA 2PMZA 2VQLA 2RAEA 1QU3A 3Q3SA 2ZMEC 2O8XA 1MMNA 1WKMA 1GUUA 2TDXA 2XROA 2L7MP 1MJ9A 2G0EA 1XGNA 3RKWA 4JOMA 2XAGA 1AOYA 3IWFA 3KP5A 4UV9A 3WU2C 3S3OA 3WTZA 3WHBA 1OISA 4A3MJ 3PIOF 1R36A 1QZYA 1YX5A 3CC4I 1WJFA 1E3PA 5L3BA 2DA3A 4WCGA 2XRLA 2K9NA 4PFPA 1MBJA 5CJ9A 5K5OA 3ZRGA 3P9IA 2VQGA 3V4GA 2LF8A 4OWRB 4CZZA 2CV0A 3FMQA 2BW3A 3S16J 4UUTA 4IQJA 3KFWX 1FBSA 1TC3C 4RAZA 2LBFB 1FZPB 2M2EA 3I4MJ 2KL4A 3H9QA 2GOXB 1SEUA 4RGXA 5J6XA 3CUQB 4DYCA 3KYLA 2QZ8A 3ECOA 1HW2A 3ABLH 2OTLI 2DFEA 1RC9A 5B1AH 3J7AO 4AD9A 3DBHB 3RSNA 3ROUA 3W6VA 5K5QA 4A3DJ 2RKHA 4HX4A 1Y0NA 1IN8A 1Y1WJ 1YW7A 4LD5A 5LHHA 4ZYEA 2FUG2 2OBPA 4V2GA 2XPVA 2F5FA 1FSHA 2IVMA 4E7ZA 2Y0SA 3DCFA 2O9LA 1O7LA 3CLQA 5K1YA 4E70A 3OYJA 2W7NA 2X6XA 4QIWN 3K4JA 4BL0B 3BR3A 2VXZA 3QYBA 4WXCA 4BS9A 5D4SA 1UFMA 1ETYA 3L2UA 1K4SA 4KYWA 3FX3A 3WGHA 3H9JA 1ZGAA 1AKHA 2OU2A 4R8HA 3H3UA 3KETA 2PX9A 2V9VA 2A6EF 2WY7Q 1FLIA 5LEKA 4O3MA 1JXSA 2H6BA 2NXNB 1EV7A 2Z9OA 1BIAA 1BM9A 4BJTA 1N78A 3LSRA 4UB6C 4CICA 2QBYA 3RIRA 5B3SH 1S7OA 1WWXA 2DMPA 3ZMUA 1W7PA 4K2EA 1QBJA 1SFOJ 4YRVA 3IRRA 1MW7A 3QODA 4R1HA 4DQ2A 3PJRA 1MKMA 2Q2EA 2ECBA 1WJ5A 4HDUA 3CF2A 2Y0SN 3HL2A 2RGVA 1JUSA 1ZAOA 4B43A 3M1CA 3I55I 4AVZA 3GF2A 1UG0A 4A3IJ 2ZXIA 2DFIA 2IW5A 2KHMA 4IJAA 3F8NA 3E3VA 2XASA 2CV2A 2NS7A 3VSKA 2VASA 2DA2A 3VOEA 1D3YA 1X4OA 2E1NA 3FBNB 3F22A 4B3XA 3CUQC 4XRMA 3LSMA 2XF6A 3BR2A 1D1BA 1GVJA 4IHXA 1ZLJA 1OCTC 2VPRA 5EG0A 2UWMA 1T38A 4IO9F 1LDDA 3TL4X 4XN3A 4MIMA 5E8GA 3N4MA 1LPQA 1R22A 3GFJA 3G1LA 3VPRA 3ZP5A 1YJ9I 3OYKA 4IHTA 4RB1A 4PJJA 4FASD 4ZJZA 2PN6A 1TTYA 4IRHA 3TW7A 3F6VA 4I0BA 2BXZA 5IPAA 3HHGA 3PSIA 2ZJ2A 4UV8A 1W36D 5A2QZ 3S1MJ 4L0YB 1BW6A 2P8TA 1BOBA 4D9JA 5DM6F 3IL2A 2NVQJ 5DS9A 3QRFF 2XF7A 4HPQA 2MC3A 4RB2C 5J8CA 1ZELA 1MZBA 1A5JA 4C3IJ 2ME0A 3QPSA 2ESHA 2IEKA 3NWTA 2LFBA 1K61A 2VC0A 5DM7F 2VC1A 1JUPA 3GW2A 3RPUA 2LG4A 4IHVA 1IZ1A 2EJRA 4FE7A 3TMOA 2EV5A 2JN6A 4BACA 4NB5A 4HQEA 4HAMA 4AIJA 4M6XA 3E7LA 2FXAA 1XDUA 2DLLA 1ZGJA 1PUEE 2NOJB 2HOTA 2K9SA 3FWEA 3J7YJ 4LG0B 2WV0A 3HTSB 3QU3A 4PK4A 2IGNA 2DQLA 5GP9A 2QKMB 4C2TA 2DAOA 4DGWB 2R7TA 4II3A 4M3DA 5ICCA 2IS1A 1QZEA 3K70D 5DDGA 1XN7A 1LDKB 5K5RA 1B4AA 1GXQA 3OOUA 2JSPA 4I7HA 5E20A 1JTXA 5L3DA 3QPTA 2AO9A 3SEQA 2R7RA 3AAFA 1ZR4A 2A5YB 3REOA 4ESBA 4UUSA 2R7ZJ 2ETHA 2WBMA 2QKLB 1JT6A 2L4AA 4XBFA 3CJQB 3MKZA 2STTA 4GDFA 2EFNA 2L9NA 3FBIB 1FY7A 4BXUA 1T08B 1YLFA 2MBFA 3N05A 1HF0A 4I01A 1HCRA 3HKZA 3K69A 5HS7A 5D6FA 3U21A 1T98A 2W84A 3ULQB 4CCJA 1WI3A 2ID3A 3SZGA 2A61A 3GUDA 5LEJA 1TT0A 2PJRA 2K3PA 5AIPA 5IYBJ 1F36A 1IV6A 4MLOA 1E2XA 2DXIA 2DT7B 4HV5A 3TO9A 1MNMC 2GLOA 3FKJA 3S1RJ 1DUXC 1HKTA 1LB2A 2JRMA 2JUCA 4Q48A 5HLGA 3LFUA 3H5RA 4FQGA 1TP4A 1MBFA 3UR3C 1R1TA 2CYYA 3ASNH 2DN0A 2X1EA 2QCOA 2F2EA 4KIGA 3HUGA 3HYIA 1YW9A 2VI6A 5IYCJ 1I3AA 1SD4A 1Z0XA 3VFZA 4AIKA 4E7LA 1F4KA 4U0VA 4MTEA 3F8FA 3KX2A 5KNLA 2DDBA 4XL9A 2CFOA 3K0LA 3RCOA 3BR1A 5J1UA 3JAMZ 2KKOA 2DODA 3CJNA 4F52A 3FISA 3WG9A 2RNJA 1HKSA 1QZZA 1OMIA 4KIBA 2Z99A 4EEFG 2M5WA 2V9KA 4IRGA 3RYPA 3U9GA 3QYFA 3B6AA 1CGPA 2HQNA 3VYRB 2FD5A 2DOFA 2MLGA 3HC7A 1T0FA 4G7ZF 2QENA 1IN4A 1TWGJ 2F5EA 2W24A 3IH4A 4XKBA 4EMSA 2ZFWA 4UUSB 2HTJA 3K1MA 4HX8A 4IRIA 4XICA 1LE8A 2XDVA 1KQ0A 3RKXA 1G3YA 4KFCA 2FA5A 5E17F 2DCEA 2Z3YA 5J8FA 1QRYA 3M8JA 3LAJA 2WADA 1O3QA 4BJ6C 4NC8A 1PYVA 1U2WA 2ELKA 3R0JA 3KYDB 1X1DA 5EEGA 3UNGC 2CJJA 3FF5A 3VDXA 1BOAA 4BXFA 2DA1A 1RI7A 3B6CA 2NVUB 1XSVA 4XK4A 2CW0F 1NG6A 1ON2A 4HZFA 4BQAA 1B8IB 2FQ3A 3S3MA 4JP0A 1Z3XA 2HVQA 1MMAA 1S8NA 1ZG3A 3H36A 5FRMA 3W3CA 2WAQA 4H0EA 4F7ZA 2CGPA 2E60A 4LB6B 2EQRA 4DBQA 3FK6A 3RPQA 5M3FJ 2OUMA 2RQPA 4B48A 3LA2A 3LFKA 3ASOH 3AG1H 2HR3A 2O7OA 3KLOA 1HOMA 2QA4I 2DA5A 1WI9A 1PDNC 1LFPA 4HLXA 4ZDOA 3IAS2 1JJ8C 1S7EA 1TNTA 1UJ8A 3U2RA 4WK8F 3TOAA 1XPXA 1P4XA 3BJ6A 2HZTA 4AUXA 2K5CA 5KAFC 3D1NI 2EFPA 1UMQA 4P5OA 2B0LA 4AYBN 2EFQA 1MIJA 2L7KA 3MKYB 2OCCH 2NOGA 2X51A 3I9V2 3CCRI 4D5CA 3AL0B 3D0SA 3A02A 1Z91A 4IHYA 2R7UA 5F1JA 1TBXA 2VQHA 1B9NA 3DKYA 4FX4A 1U78A 3LOCA 1NHAA 3IKVA 2DTRA 1OFCX 2LK2A 3G1OA 2EK5A 4HOBA 1X3ZB 5AONA 4LMYA 1PUFB 3S93A 1ZQ3P 3HPHA 3L9FA 3RDIA 4BUPA 1HW1A 3Q0WA 2QM3A 3H0GJ 5IP7J 2XAHA 4EJWA 1XD7A 3ERED 2OF7A 4BBRJ 4NHJA 2R7XA 2G9WA 4GRIA 3T8TA 5IOZA 2MH2A 3V7SA 3Q0UA 2VPLA 1F43A 2M1BA 2Y31A 4I09A 1YW8A 2E35A 3DTIA 5BPDA 2QQBA 2WB1N 1LFBA 4F55A 2RDPA 2Z5UA 4IF4A 1P92A 4KIFA 1J09A 5FFXA 1MMGA 1YRNA 1SD6A 1UHMA 4P9UA 1AKHB 1VQ5I 3BTCA 5ILSA 4HNTA 3EUKL 2V6EA 3F8CA 3MZHA 4BQNA 5E3OA 4L5EA 2R7VA 2I5UA 4XLHA 3I5UA 4PGHA 3DFGA 3I59A 3ABUA 2OQRA 4ZDPA 3HSRA 1WPKA 1VFCA 4XRFA 1G2HA 2IP2A 4KITB 4DBRA 3K70C 4A93J 4FT8A 2F4MB 4E7IA 4KMFA 1LUJB 1YE9A 4U0WA 1E3OC 2VB6A 3V42A 4QPOA 3CUQA 2OQGA 3COAC 1WGXA 1G4DA 5HOOA 5FFZA 3S32A 4E7HA 1RR8C 2XAFA 3DV8A 2ZFUA 1T95A 2VJJA 3ZMTA 5JHUA 2M4KA 4UUVA 1UHWA 1QGPA 1RR7A 3RTRA 2OV7A 4JX6A 4DZPA 3CLOA 5FKNA 3ZQCA 4ZTJA 2IGOA 5IY5H 1RKWA 3O6BB 3DTKA 1ETXA 2Y0MA 4PSWA 2LR8A 1BA5A 3PUBA 1D1CA 1KU3A 3IAM2 1FP1D 4DNCA 5J4YA 2UZKA 3T8RA 3K6GA 5TRDA 4G9YA 2LKXA 2MA3A 4LIUA 4UB8C 4B8XA 1J2XA 1A35A 5HODA 3AFHA 4OU0A 1VTNC 4MFDA 4RA2A 3ECHA 4WWCA 2D2WA 1Y1VJ 3EUHA 5FLVA 5B1BH 2VKDA 3RZOJ 2HQRA 4CH7A 4EM0B 3ELKA 3DPTA 1U8RA 3P5JA 5D8LB 3IH3A 2OTJI 2VQCA 3OMYA 5FB2A 2RN7A 3HOXJ 1R00A 2K4BA 3HSEA 4BU2A 4X1EA 1IXCA 2E71A 4F3QA 4Q47A 4L5IA 4O5VA 4D1QA 1BW5A 4EJOA 3I4PA 1STZA 2FBHA 2CUEA 3BG5A 3ZR8X 4XLAA 1TWHJ 5HS9A 2Y9YA 2PQ8A 4AU7A 2LRDA 4CYCA 5K7FA 2CG4A 3G3ZA 4HYEA 1BC7C 3OR2C 4ZYGA 3TGNA 4CCOA 3NRVA 5CQEA 4LOCA 4WF2A 3M3YJ 2AXLA 1EJ9A 1APLC 2EILH 1GVDA 3T0YA 1TWFJ 5JVGF 2B63J 3A0HC 1Z1DA 1BI2A 4N0BA 2CW7A 4JBAA 4YFNF 3BDDA 4XLEA 2FRHA 2ZXJA 2WB1A 3VYUB 1R5HA 1LDJA 1BC8C 1R6RA 2M45A 2M87A 1NG7A 1WQ2A 3H9GA 1A6QA 3H5AA 1YJNI 4KUMA 2A3SA 1O3SA 4KMUX 3RZDJ 2FMLA 3TP3A 3H3ZA 4GCVA 4LLLA 2ZBKA 1ETQA 4D5FA 2KDZA 5TJJA 1REPC 2CW8A 1P6RA 3J80K 2M0MA 2R7FA 4RAGA 5DCMA 3H3VK 1QVUA 1R58A 2WA0A 3LAPA 1VQ7I 2AS5F 3QOEA 4S0HB 2NNYA 2DT5A 1T39A 2J5PA 4Y13A 4H4KC 1N25A 1JKQC 3OSGA 1EH7A 1L0OC 2VBWA 4IKFA 4G7OF 1WJAA 4ABZA 5LBQA 1B72B 5F27A 2YX7A 3SQNA 4Y7NJ 2AXTC 1LVKA 2A69F 2MD0A 4EJTA 3GTKJ 2HYFA 3OYFA 3P7NA 1D8JA 3CMEI 4Y15A 5IT9K 3RQ4A 3GTOJ 1OR7A 2HVRA 3JRHA 1M1EB 1TNSA 2W00A 5CLSA 1Z67A 2M8GX 3ISPA 3KCCA 4NQWB 3GX4X 2FBKA 5IT9Z 3AKZA 2IA2A 2E1CA 1G6NA 4XLFA 3ZXSA 5C4JJ 4LLNA 3HPGA 3BTLA 2FSWA 2GIZA 3G73A 1ZHFA 2IGMA 2BY2A 2VIXA 4UY8I 2QSHX 1SD5A 1LEAA 3VYSB 1HA8A 1X3WB 3BZ6A 5J3LA 1V5FA 3PM1A 2E5NA 3EYYA 3L2CA 3F23A 2CS3A 2EA4A 2KP6A 4KJZA 3F8MA 1LNWA 3OL4A 5LRSA 4AWXB 2M4GA 2PMUA 1Y8QB 2KIQA 3DU5A 5DD8A 5IOYA 2DPDA 1U5TA 4A3KJ 3HOWJ 1RIOH 4I2OA 4CUGA 3CCEI 3BROA 3S15J 2P5VA 3S2HJ 3ERMA 1K6OA 2IT0A 2KLOA 1ONVA 3W2VA 5EDNA 3L2VA 4C2MJ 1TQMA 1YITI 4D0PA 4XRSG 3OIQA 1A04A 1ZGWA 5H20A 5F0HA 4N9HA 5JHFA 2OCEA 3CCVI 2V1DA 3QWLA 4MNUA 3F72A 4UVAA 5CVRA 5M5YJ 1P7IA 4U88A 3LA3A 1ZH5A 2KZVA 3DEEA 3GMEA 2K7LA 2NRAC 2LY2A 3HB9A 1FC3A 3HOTA 5FROA 2QQ8A 3HSFA 3K4KA 1YIOA 3CJRB 1ZRDA 1WH5A 3CDHA 2R3SA 5J40A 1XCVA 4QSHA 4MHGA 3ZQHA 1BBYA 3JRFA 1C0WA 3DPLC 4QWQA 2LLKA 1VQ4I 2WTEA 2I8DA 1VQ9I 2P5LC 2R7SA 1FMWA 3PNTA 2A6HF 1QQIA 4BKXA 4BDZA 1UG2A 1JKOC 4KNYA 2HTSA 3NWSA 1BN5A 3VODA 1JJ6C 3FXMA 4R79A 5JFRA 2OD5A 2XUBA 2K9QA 1H88C 1MNEA 4A3BJ 3LQRA 2L5QA 4J01A 2X1DA 3IKTA 5EJCA 1YI2I 1XX5A 1MH3A 5L3CA 1TLHB 4XSZF 1WJEA 3J7ZI 4HDVA 3SJMA 1PP7U 2JJ7A 2ISZA 1HDPA 1IUFA 4ZYHA 2HOAA 1XS9A 1TW3A 2H09A 1TT5B 3FDYA 3LSIA 4MQVA 3NEUA 2LP0A 4XSXF 1TQPA 1V54H 4EVIA 3I71A 4XR6A 3FHZA 1POGA 3A4CA 1ETKA 2QQ9A 3HRMA 4RMNA 4BAYA 4AYBA 1Z7UA 3F9KA 4ZC3A 1OR7C 2ME6A 1Z3YA 2TCTA 2IXSA 2MSYA 1SAUA 2NNNA 4CCLA 1ZKGA 3FHNA 2FNAA 3HJEA 3EQLF 1KGSA 4B4CA 2ZSHB 1KZHA 1ON1A 4XN0A 1IGNA 2VT3A 3AL0C 3H5NA 1EA3A 1IDYA 4XORA 2PMHA 3WHCA 3K4BA 5IP9J 4B3AA 2QQAA 3E6CC 2F4OB 1LKXA 4ENMA 2Q0OA 3IH2A 2V1XA 2CUFA 1OKRA 3ZQIA 2DOEA 4IHSA 3PFYA 2R7QA 2EZKA 2JPCA 3CCSI 4UXNA 4G7HF 4BHBA 3LNQA 1XDSA 3EETA 1WZ2A 2H27A 1G3SA 1V5GA 3VYTB 2JVGA 1RUOA 2JQ7A 2VJ4A 3CC7I 1F5TA 1VQ6I 4HBLA 4PZJA 5F0FA 3I3LA 3FXLA 4B1RA 2XRNA 2XGDA 1U9NA 2IS4A 4CCMA 1BR4A 3FMSA 2RREA 3N97A 1FYMA 2KRCA 1HBXG 3BPVA 3GCMA 3FXRA 3HGYA 4P55A 4A2UA 3OS0A 4OIOF 4LFUA 2YX4A 2R4GA 1NH3A 2DI3A 5GADJ 4KDPA 1S6LA 3CD6I 3ESWB 2LKSA 1I1SA 1WRJA 4A3FJ 4RB0A 1FEXA 2KRHA 2A05A 3CDIA 5LFAA 5BOXA 4UVCA 2LVSA 2O5RA 1WHUA 3W2AA 3I59B 3W2WA 1IAWA 1MBHA 3JRAA 2LREA 1B9MA 2P4WA 3GTGJ 3KZZA 3SDBA 3CCQI 3WODF 3JW4A 3C2HA 1VQOI 3ZQFA 4JK1X 3FK7A 1YRNB 1BI1A 4CYDA 2JPBA 1H9TA 4M3EA 1JTYA 4YIFA 1USTA 3LSPA 2Z16A 5D5VB 1T2KA 4PJ0C 5CKTA 3HBLA 1TQIA 3KZIC 3V7CA 1IO2A 3C3WA 1B1BA 2HYJA 1JUMA 2BY1A 1HSJA 5EZHA 3R60A 1D5YA 5GAHJ 1Y56A 3CF5F 1OYWA 2F5VA 2HOEA 2GZWA 2PFBA 4HLYA 1IUYA 2DQRA 2EZLA 5BMZA 2R5ZA 4IVNA 3ZMVA 3R61A 2UXXA 3S3NA 1FOKA 3A01B 3CC2I 2COBA 2BOLA 5ICGA 2K9MA 3S1QJ 1J9IA 1X1PA 4RAYA 2WAQN 5KCMA 2HKOA 2OJED 2M0CA 3OYEA 1XC5A 2WC2A 2IA1A 5ICFA 2IS2A 2Y2ZA 4G12A 3GTJJ 5LGUA 1ZREA 1GDTA 3TQNA 5DCMB 1R9TJ 3LSTA 4MQ9F 1IW7F 3L1PA 1ZLKA 2ELHA 1NTCA 2VOOA 1FT9A 5HNFA 2LSOA 5JVTA 1CQTA 1PJRA 2ZSIB 4AIDA 2QBYB 2BV6A 3LSKA 3ABMH 4OIPF 2H8WA 3ZN0A 3G1MA 1P4AA 1UCRA 1D8KA 1WFXA 2QSGX 3SZTA 3WTVC 2LD5A 1W1WE 2F48A 3MVPA 2FOKA 2V79A 2ADUA 2A5WA 2ID6A 3TP0A 4L18B 2LH9A 2QGUA 3LWFA 1OYIA 1GLNA 2HKXA 4KN4X 4IX7A 1YHQI 2L01A 1V55H 3OIPA 5IYDJ 2ZJRF 2A6TA 2K02A 4JX4A 1FP2A 2JWTA 4GYIA 1SVMA 2FMYA 5KHDA 3ABKH 4G6DA 3LQQA 4MTDA 5CVVA 1FTTA 3F8BA 4Q5SF 3PQKA 3ZGKA 4HF0A 2L4MA 3WTXC 3I4NJ 3Q9VA 1FWZA 2VE9A 1W36C 4EJUA 4EQQA 2HXOA 1AA7A 1U5TC 5M3MJ 2GXBA 2YUSA 2GXAA 1R23A 2DA6A 2NVXJ 3I0TA 3AG2H 1SFUA 3ZCOA 3DP7A 2EV6A 3M9AA 2LBFA 1J75A 2E2JJ 1BR2A 2HXIA 3L00A 4DOZA 1K83J 3PNVA 4XOPA 3FMRA 2I10A 1KQ9A 3BLYA 3M4OJ 2MLKA 1S5LC 3C2BA 2XAJA 5GPAA 3S17J 4M9XA 1IV8A 2LTPA 2VJIA 1MH4A 1J5YA 4ZDLA 2ZB9A 3M7GA 1QHGA 3E6BA 4GXOA 1LE8B 2DMTA 3CJTB 3QP5A 5LLQA 3OYCA 3HXLA 5BNGA 3QYEA 2HNHA 3PUFA 3WTSC 3WGIA 1Y6IA 4M73A 4DJAA 1U8BA 3HKZN 2P0WA 2Y75A 1E17A 2Y48A 1D0XA 2X6WA 3CMMA 3KEOA 4XKVA 1Z21A 5CVUA 2FOWA 1IN5A 3A0BC 1R5GA 5GTHC 2EH3A 1RRJA 2GOMA 3JCUC 3OS2A 4Y4RA 2K86A 3BG7A 5E8IA 4OAYA 3KEQA 1KQ8A 2E7WA 3BR5A 4PJLA 5D5WB 5FLXZ 5JR3A 1WVRA 1EF4A 3M07A 3B02A 3CO7C 2A68F 2DTZA 1T56A 5EYRA 5D8KB 1G8XA 2DBBA 2XGEA 4C9YA 1P9QC 5BS6A 5J1RA 2EFWA 3FIWA 4ESFA 5L3FA 4Z6YA 2HOSA 3BG3A 2H6CA 3BWGA 1KONA 5KVRA 4L9NA 3JRBA 4Q4ZF 5HS8A 4RLQA 2X85A 4AM3A 5BPIA 3EPZA 1HQCA 1JGSA 1KYZA 2JZYA 3OR1C 3KE2A 1USSA 3OYDA 2OA4A 2DOAA 3GWZA 4XLNF 4MEYF 2P81A 4RS8A 3P9KA 1FOYA 2XAQA 5E3LA 1A36A 1VQLI 1W5SA 3GLXA 1DQUA 3D5SC 1XSDA 2GAUA 1F9NA 1SANA 5ILVA 4A3CJ 1OQYA 5K7HA 1Z9CA 1I27A 2LOOA 2W82A 4EM2A 2NVYJ 4ZZDA 2ZNYA 1UB9A 3OOPA 5KAIC 3OYGA 4O6JA 1N75A 3J81Z 5CPRB 2O03A 3U1KA 1ZG1A 2BZTA 1SMYF 2HPIA 3PSFA 3KLNA 2O3FA 3K4LA 4RB3C 2XGCA 2P7CB 1O3RA 1X1CA 3DKWA 2STWA 4A6DA 1UZCA 4HNVA 5C44J 1FBQA 2VT2A 5HDNA 3FXJA 4OIQF 3L7WA 3OYMA 4NC7A 2IGKA 2H8RA 1X1BA 3BJAA 3S2DJ 1X1AA 1IN6A 4N4OB 4CXFA 2JA2A 5FKMA 2E36A 4J00A 2F5DA 2MFZA 2F4IA 5K7ZA 2CUZA 1ODDA 3S2WA 4G6TB 4PJMA 1KU7A 2XAUA 1FMVA 4AC0A 4B47A 5D5XB 4X0GA 3RI4A 1JHFA 4LG0A 1R71A 5LRRA 2EFOA 2DMUA 3QPLA 3MMYB 2DK8A 3T5XA 4U7DA 1A6IA 1FSEA 2JT1A 4ZYAA 4KN7X 3PNYA 3DXJF 1T6SA 3W6JB 3ZQQA 2XGXA 4W97A 2W48A 1V4RA 4KT5C 3IRQA 3GEZA 2ZXHA 3JTGA 3KP3A 5LHGA 3CO6C 2EWNA 4IQ4A 2HEOA 3ML6A 3F21A 2M7BA 1I39A 4YIRX 2OPTA 1U9OA 1SFEA 3K10A 2O0YA 2VOPA 4ZZLA 3HOZJ 3WU0A 3HG9A 4ETSA 1YFHA 5FKLA 2GA2A 5ILUA 1HC8A 3OY9A 3ZMZA 1BIBA 2ESNA 3ONQA 1JKPC 1E0EA 3BCAA 2CFXA 2ZCWA 4EM1A 4TV7A 1IDZA 1VZ0A 4MFEA 1YYVA 4II2A 2K9LA 3JREA 5HLTA 1MSFC 4ON0A 1MNDA 2J5OA 2DO7A 2P5KA 3VB2A 2ZKZA 3HOSA 3JSPA 1T33A 2MC4A 4M3GA 1SD7A 4GGGA 4YELA 4E7SA 4F93B 2DU9A 2LC2A 4XQFA 1S3JA 1SFKA 2DA4A 3LA7A 2Y30A 3E5QA 2Z1DA 2BBYA 3HEFA 2L9VA 3K4MA 2MH9A 2FE3A 1EKEA 2CO5A 4M6YA 2IA0A 4IPAA 2BHYA 3CP8A 3JRCA 3NARA 4BQQA 2V9PA 1WCMJ 2VKHA 3QQAA 4A12A 1ZYRF 3L2WA 3GVAA 3WGGA 2CRGA 2PJPA 5EGOA 1JT0A 2DPUA 1Z6RA 2KPMA 2Q2EB 5ICEA 3CQZJ 2M3AA 1SVOA 3K2ZA 2L7ZA 4E6KG 3PIPF 2F5CA 4XM3A 2IPQX 2E1MC 2EZIA 3HM5A 4LGWA 3G6EI 1OLTA 1W7PD 4A0XA 2CQ7A 1JI8A 2M8EA 2IRFG 2WY8Q 4EGYA 4EGZA 3KP4A 1GT0C 1JKRC 2JA6J 3GTMJ 2PMZN 2NS8A 2UXNA 3O3KA 4FHTA 3LMMA 1W0UA 1DGRM 3HOUJ 3M1EA 4WXDA 3FXOA 1DP3A 1QO0D 2DK5A 1BJZA 1L3LA 2JA7J 2JA8J 2MABA 3CCYA 2FF4A 2L3DA 5H6QA 2R7OA 1A31A 4A5NA 2V7FA 4ENNA 1IF1A 1W4MA 1LJ9A 1WJDA 2KJCA 4ZH4F 2H1KA 2AQFA 3KEYA 4CCKA 2Y69H 1Z7LA 5CQGA 2CWEA 2GBYA 3EYIA 4I98B 3RQIA 3BCBA 4E7KA 3PO2J 3OL3A 2MGQA 5HDKA 2X0LA 3HRTA 4M72A 1R5ID 4A6EA 5H2FC 4PGGA 2OAZA 3OYHA 2L9RA 2E2IJ 2HFHA 4BHPA 2HQ5A 5DTDA 3WTWC 3OS1A 4C3JJ 1QNTA 1TW2A 5EZGA 4XOTA 5H6RA 3HOYJ 2GXGA 3CP2A 1I6HJ 3TKYA 4FE4A 3C1DA 3ZMDA 2X9DA 2EB7A 4LITA 3BZKA 4PJNA 3OSFA 2VODA
chains in the Genus database with same CATH topology
1HW5A 2YU3A 1ZG5A 3ZPLA 2YSRA 1XGSA 3BPXA 4HW0A 2LDUA 1FNNA 2RV8A 3HRSA 3HHHA 5DYMA 4BH9A 1RUNA 2MD5A 2XV4S 3GYHX 3MFKA 3WTTC 2NYXA 2BEOA 2E7XA 2R7DA 2IJLA 2RVCA 2X4HA 5JI6A 4L9JA 3BJOA 1JE8A 2QYOA 4G6QA 3FXQA 3M8EA 2Q8KA 1IN7A 3R6SA 4MGRA 2PBIA 1K79A 2XVCA 1FX7A 1OYYA 2L02A 4RGUA 3F3XA 1ZRFA 2GWRA 3DF8A 5E1ZB 4OMZA 1KU2A 4I0AA 2HDCA 4NQWA 3C7JA 3I58A 2M30A 1HKQA 2O6GE 3V8KA 2QWWA 3E6DA 1R1VA 5HLHA 1IXRC 3QU6A 4HV6A 1PP8F 1ZRCA 1J59A 1O57A 1F1ZA 3K9TA 2ZNZA 5HLIA 3FM3A 1W7PB 5LHIA 2EA2A 1I5ZA 2KIUA 2W25A 3C18A 1YS6A 1LVAA 2HS5A 3J80Z 2ZMEA 2ISYA 5D5UB 1RNLA 2NAZA 4G8XA 2ZO4A 4EJVA 3FM5A 3WE3A 3FZVA 5DUKA 4CDGA 5AIQA 3CUOA 4OMYA 5F1RA 4UVBA 1Z05A 2KRFA 3IHUA 1O3TA 6PAXA 1QPMA 5FO5A 5LGTA 3HIFA 2G7UA 2W57A 3BY6A 3I64A 1XMAA 1S7AA 2D1HA 5A2QK 3QAHA 1X3UA 2QVOA 3SZPA 3H92A 4YFXF 1CF7B 4LJZF 3RYRA 2GQQA 2BGCA 2K27A 4UHTA 3QP6A 3E97A 2PEXA 3E5XA 3GZ6A 1P4WA 1GXPA 1XCBA 3V8JA 1R7JA 1J0RA 2D1VA 1G3WA 1MJBA 3I54A 1GHCA 2COMA 4HF1A 1ULYA 5D6EA 3TO7A 1MGTA 4Z2YA 5FLXK 3IWZA 1XB4A 4MEXF 3MQ0A 3MWMA 5LGNA 1JHHA 2FBIA 1B6AA 3QPHA 3K1PA 5DCFA 1LEBA 3IC7A 3ZQ7A 3GXOA 1DPRA 3TO6A 2P6SA 4B09A 4ASNA 5E1WA 2CSOA 1KA8A 1DDNA 4M9ZA 3EDPA 2PI0A 3TDZC 5FD6A 2HYGD 4P9FA 2O61A 2WWYA 2C6YA 3DEUA 4L9TA 2V1UA 1R1UA 4HX7A 2QUFA 2XKOA 1MDMA 1DPUA 4FX0A 3ZMSA 3B73A 3FXUA 4OINF 1D5VA 1Q1HA 4BHCA 2LF7A 2P7VB 1XGOA 1IRFA 3MZYA 4EV0A 1I1GA 4I02A 3K1NA 2GA1A 3TOBA 4U0YA 4BYYA 5E18F 4P96A 5ED4A 1KYWA 3ZN1A 4XLPF 3RJPA 1AWCA 4LK0F 1SFXA 5D4RA 1MJAA 4OOIA 2A07F 4IXAA 1KU9A 2BYVE 5HVQC 3KP7A 3SXYA 2PG4A 2V6CA 2VBXA 1FBUA 4AVPA 1FYLA 1EH8A 1K78B 3GO5A 1YQAA 3BP8A 3SFZA 4L0ZB 3O2PE 4JQFA 3MCZA 2YPRA 1YO5C 3BOQA 2L54A 2P6TA 4WXHA 3U1DA 2JSCA 1HSTA 1XMKA 5DV5A 4M9SA 1WSUA 2RC4A 1I6XA 4U7BA 3M8FA 4GO1A 3W6KB 5CYVA 2OZ6A 1SAXA 2HWVA 5F6FA 4A0ZA 3WU1B 3WTUC 3E5UA 3TDUC 1J7KA 3Q5FA 1FYKA 1OPCA 5KK1A 1EH6A 2JRTA 1P2FA 3JAMK 4ESJA 3V8LA 4ENKA 4AIHA 4YG2F 1H0MA 4L5JA 2LKPA 1V3FA 4UNOA 4Y17A 3MEXA 2HGCA 3GFLA 1DP7P 2VBYA 4L9VA 1IXSB 3F6OA 3ABTA 3KZYA 4N9IA 1YS7A 4QLCU 2FEZA 2DW4A 1S29A 3V7RA 3GZ5A 2XKPA 4GYGA 3HTUA 4S05A 1O7FA 1XSXA 2JTVA 1IRGA 4M71A 5DEQA 2G7HA 4ZYDA 2EV0A 4PCQA 5FD5A 3OV8A 5F64A 3KP6A 4YFKF 2LNBA 2ACJA 3CTAA 2FU4A 3SHFA 3KP2A 4BNCA 5ERIA 1YTYA 4CGZA 5CVIA 5BQTA 1FPQA 4RGSA 1LQ1A 1XGMA 1BI0A 4WX9A 1K7AA 4G94A 1ZARA 2Z33A 1W5TA 4LK1F 3NQOA 1B59A 1ZN2A 2VE8A 1U5TB 2VBZA 5DUIA 1CF7A 4HQMA 5EEHA 2NS0A 2OZUA 3D5LA 4LLGF 3HRUA 3JSOA 1K78A 3Q9SA 3WE2A 4KA4A 4ENJA 2W85A 3I53A 3E6MA 4S04A 5L3EA 1H9GA 2KIMA 5E1XA 3QOPA 4A0YA 2D45A 4A5MA 5DD4A 3VEPA 3R4KA 4RGRA 2ZMEB 1U6GA 2KJBA 5IT3A 5FGMA 2PLYA 4CHUA 1Y0UA 4YIIA 4OIRF 1SMTA 1RZ4A 3J81K 1U3EM 3R0AA 5HDGA 1MD0A 2FNPA 4LB5A 1MDMB 2VONA 2CQKA 2QLZA 2BE5F 1HXDA 3JTHA 3MAJA 3DQVC 2VN2A 2XHKA 3P9CA 3PFIA 1BI3A 5L3GA 2H94A 1BJAA 1YG2A 4HA8A 1Z6TA 3WTYC 4KICA 2YR2A 4HF2A 2K4JA 4CO8A 2KIFA 3L09A 3GFIA 5CVJA 2GIVA 3PQJA 1G3TA 4PDKA 3GFMA 3T1BA 2XIGA 4M74A 3RKYA 2O8XA 1WKMA 2TDXA 2XROA 1MJ9A 1XGNA 3RKWA 1AOYA 2XAGA 3IWFA 3KP5A 4UV9A 3WTZA 1R36A 1QZYA 5L3BA 4WCGA 5CJ9A 5K5OA 3P9IA 3V4GA 2LF8A 4CZZA 3FMQA 3KFWX 1FBSA 4RAZA 1FZPB 4RGXA 5J6XA 3CUQB 2QZ8A 3ECOA 1HW2A 3J7AO 4AD9A 3ROUA 5K5QA 2RKHA 4HX4A 1IN8A 1YW7A 4LD5A 5LHHA 4ZYEA 2OBPA 2F5FA 1FSHA 2IVMA 1O7LA 5K1YA 4E70A 4WXCA 2VXZA 4KYWA 5D4SA 1UFMA 3FX3A 3WGHA 1ZGAA 2OU2A 4R8HA 3H3UA 3KETA 2V9VA 2A6EF 1FLIA 5LEKA 4O3MA 1JXSA 2H6BA 1EV7A 2Z9OA 1BIAA 1BM9A 4CICA 2QBYA 3RIRA 1S7OA 1WWXA 3ZMUA 1W7PA 4K2EA 1QBJA 3IRRA 4R1HA 4DQ2A 1MKMA 2Q2EA 4HDUA 2RGVA 1ZAOA 3GF2A 2DFIA 2IW5A 4IJAA 3F8NA 3E3VA 2XASA 3VOEA 1D3YA 2E1NA 3F22A 3CUQC 1GVJA 1ZLJA 2UWMA 1T38A 1LDDA 5E8GA 3N4MA 1R22A 3GFJA 3ZP5A 4IHTA 4RB1A 2PN6A 1TTYA 4IRHA 3F6VA 4I0BA 3HHGA 4UV8A 2ZJ2A 5A2QZ 4L0YB 2P8TA 3IL2A 3QRFF 2MC3A 4RB2C 5J8CA 1MZBA 2ESHA 2VC0A 2VC1A 3GW2A 3RPUA 1IZ1A 2EJRA 2EV5A 4NB5A 4HQEA 4HAMA 4AIJA 4M6XA 2FXAA 1XDUA 2DLLA 1ZGJA 1PUEE 3FWEA 4LG0B 2WV0A 3HTSB 3QU3A 2DQLA 2DAOA 5ICCA 5DDGA 1XN7A 1LDKB 5K5RA 1B4AA 1GXQA 4I7HA 5E20A 5L3DA 3QPTA 3AAFA 2A5YB 3REOA 4ESBA 2ETHA 2L4AA 4XBFA 2STTA 2EFNA 1FY7A 4BXUA 2MBFA 1YLFA 4I01A 3K69A 5HS7A 5D6FA 1T98A 2W84A 3ULQB 2A61A 3GUDA 5LEJA 5AIPA 1E2XA 4HV5A 3TO9A 1DUXC 1HKTA 1LB2A 4Q48A 5HLGA 1R1TA 2CYYA 2F2EA 4KIGA 3HUGA 3HYIA 1YW9A 4AIKA 1SD4A 3VFZA 1F4KA 4U0VA 4MTEA 3F8FA 3K0LA 3JAMZ 2KKOA 3CJNA 3WG9A 2RNJA 1HKSA 1QZZA 1OMIA 4KIBA 2Z99A 2M5WA 4IRGA 3RYPA 3U9GA 1CGPA 2HQNA 2MLGA 4G7ZF 1T0FA 2QENA 1IN4A 2F5EA 2W24A 4EMSA 2ZFWA 2HTJA 3K1MA 4HX8A 4IRIA 1KQ0A 3RKXA 1G3YA 4KFCA 2FA5A 5E17F 2Z3YA 5J8FA 3LAJA 1O3QA 1U2WA 3R0JA 5EEGA 3FF5A 1BOAA 1RI7A 1XSVA 2CW0F 1ON2A 4HZFA 4BQAA 2FQ3A 1ZG3A 1S8NA 4H0EA 2CGPA 4F7ZA 4LB6B 3RPQA 2RQPA 3LA2A 3LFKA 2HR3A 3KLOA 1WI9A 1PDNC 4HLXA 1TNTA 3U2RA 4WK8F 3TOAA 1P4XA 3BJ6A 2HZTA 2EFPA 4P5OA 2B0LA 2EFQA 3D0SA 1Z91A 1TBXA 1B9NA 4FX4A 1U78A 1NHAA 3IKVA 2DTRA 2EK5A 4HOBA 5AONA 4LMYA 3L9FA 3RDIA 1HW1A 2QM3A 2XAHA 4EJWA 1XD7A 3ERED 4NHJA 2G9WA 3T8TA 2MH2A 3V7SA 2M1BA 4I09A 1YW8A 5BPDA 2QQBA 2RDPA 2Z5UA 4IF4A 1P92A 4KIFA 5FFXA 1SD6A 1UHMA 4P9UA 5ILSA 3F8CA 3MZHA 3I5UA 4PGHA 3DFGA 3I59A 3ABUA 2OQRA 3HSRA 4XRFA 2IP2A 4FT8A 4KMFA 4U0WA 3CUQA 2OQGA 3COAC 1G4DA 5HOOA 5FFZA 2XAFA 3DV8A 3ZMTA 5JHUA 4UUVA 1UHWA 1QGPA 3RTRA 3CLOA 3O6BB 2Y0MA 1KU3A 1FP1D 4DNCA 2UZKA 3T8RA 5TRDA 4G9YA 2MA3A 4B8XA 1J2XA 4OU0A 1VTNC 3ECHA 4WWCA 2D2WA 3EUHA 2HQRA 4EM0B 3ELKA 3DPTA 1U8RA 5D8LB 5FB2A 2RN7A 1R00A 2K4BA 3HSEA 1IXCA 4Q47A 4L5IA 4O5VA 4EJOA 3I4PA 2FBHA 1STZA 5HS9A 2PQ8A 2CG4A 3G3ZA 4HYEA 1BC7C 4ZYGA 3TGNA 3NRVA 4WF2A 2AXLA 3T0YA 1Z1DA 1BI2A 4N0BA 4JBAA 4YFNF 3BDDA 2FRHA 2ZXJA 1R5HA 1LDJA 1BC8C 2M45A 2M87A 1WQ2A 4KUMA 2A3SA 1O3SA 4KMUX 2FMLA 3H3ZA 4GCVA 4LLLA 2ZBKA 5TJJA 1REPC 1P6RA 3J80K 2R7FA 5DCMA 1R58A 3LAPA 2AS5F 2NNYA 2DT5A 1T39A 2J5PA 4Y13A 1EH7A 1L0OC 2VBWA 4G7OF 5LBQA 2YX7A 3SQNA 2A69F 4EJTA 2HYFA 3P7NA 1D8JA 4Y15A 5IT9K 1OR7A 1TNSA 5CLSA 3ISPA 3KCCA 3GX4X 2FBKA 5IT9Z 2IA2A 2E1CA 1G6NA 4LLNA 2FSWA 3G73A 1ZHFA 1SD5A 1LEAA 3BZ6A 3EYYA 3L2CA 3F23A 2EA4A 3F8MA 1LNWA 5LRSA 4AWXB 2PMUA 5DD8A 2DPDA 1U5TA 1RIOH 4I2OA 3BROA 2P5VA 1K6OA 2IT0A 1ONVA 1TQMA 4D0PA 1A04A 5H20A 4N9HA 2V1DA 4MNUA 3F72A 4UVAA 5CVRA 4U88A 3LA3A 1ZH5A 2K7LA 2NRAC 1FC3A 3HOTA 3HSFA 1YIOA 1ZRDA 3CDHA 2R3SA 1XCVA 4MHGA 1C0WA 1BBYA 3DPLC 4QWQA 2WTEA 2P5LC 2A6HF 1QQIA 4KNYA 2HTSA 1BN5A 3VODA 4R79A 5JFRA 2OD5A 2XUBA 3LQRA 3IKTA 5L3CA 1TLHB 4XSZF 4HDVA 1PP7U 2ISZA 4ZYHA 1TW3A 2H09A 4MQVA 3NEUA 4XSXF 1TQPA 4EVIA 3I71A 3FHZA 2QQ9A 3HRMA 4BAYA 1Z7UA 2NNNA 2FNAA 3EQLF 1KGSA 1ON1A 2VT3A 2PMHA 3E6CC 2QQAA 4ENMA 2Q0OA 2V1XA 1OKRA 4IHSA 2JPCA 4UXNA 4G7HF 4BHBA 1XDSA 3EETA 2H27A 1G3SA 1RUOA 1F5TA 4HBLA 4PZJA 2XRNA 3FMSA 3N97A 1FYMA 1HBXG 3BPVA 3FXRA 4P55A 4A2UA 4OIOF 4LFUA 2YX4A 2DI3A 4KDPA 1S6LA 1I1SA 1WRJA 4RB0A 5BOXA 4UVCA 3I59B 1IAWA 1B9MA 2P4WA 3KZZA 3WODF 3JW4A 4JK1X 1BI1A 4CYDA 2JPBA 1H9TA 4YIFA 1USTA 5D5VB 1T2KA 1TQIA 3V7CA 3C3WA 1B1BA 1HSJA 3R60A 1OYWA 2HOEA 2GZWA 2PFBA 4HLYA 1IUYA 2DQRA 5BMZA 4IVNA 3ZMVA 3R61A 2UXXA 1FOKA 5ICGA 1J9IA 4RAYA 2HKOA 2WC2A 2IA1A 5ICFA 5LGUA 1ZREA 3TQNA 5DCMB 3LSTA 4MQ9F 1IW7F 1ZLKA 2ELHA 2VOOA 1FT9A 2LSOA 5JVTA 2QBYB 2BV6A 4OIPF 3ZN0A 1P4AA 1UCRA 1D8KA 3SZTA 3WTVC 2FOKA 2V79A 2ADUA 4L18B 3LWFA 1OYIA 2HKXA 4KN4X 2L01A 2K02A 1FP2A 4GYIA 2FMYA 4G6DA 3LQQA 4MTDA 5CVVA 3F8BA 4Q5SF 3PQKA 4HF0A 2L4MA 3WTXC 3Q9VA 1FWZA 2VE9A 4EJUA 4EQQA 1U5TC 2GXBA 1R23A 3I0TA 1SFUA 3DP7A 2EV6A 3M9AA 1J75A 3L00A 3FMRA 1KQ9A 2MLKA 2XAJA 4M9XA 1J5YA 3M7GA 4GXOA 3E6BA 3QP5A 5LLQA 3WTSC 3WGIA 4M73A 2Y75A 1E17A 2Y48A 3KEOA 5CVUA 1IN5A 1R5GA 2K86A 5E8IA 3KEQA 1KQ8A 2E7WA 5FLXZ 5D5WB 5JR3A 3B02A 3CO7C 2A68F 5D8KB 2DBBA 5BS6A 2EFWA 5L3FA 4ESFA 2H6CA 3BWGA 5KVRA 4L9NA 4Q4ZF 5HS8A 5BPIA 1HQCA 1JGSA 1KYZA 2JZYA 3KE2A 1USSA 2OA4A 3GWZA 4XLNF 4MEYF 4RS8A 3P9KA 2XAQA 1W5SA 3GLXA 1XSDA 2GAUA 1F9NA 5ILVA 1Z9CA 1I27A 4EM2A 4ZZDA 2ZNYA 1UB9A 3OOPA 4O6JA 3J81Z 2O03A 1ZG1A 1SMYF 3KLNA 2O3FA 4RB3C 2P7CB 1O3RA 2STWA 3DKWA 4A6DA 1FBQA 2VT2A 5HDNA 4OIQF 3L7WA 3BJAA 1IN6A 4CXFA 2F5DA 1ODDA 3S2WA 1KU7A 5D5XB 3RI4A 1JHFA 4LG0A 5LRRA 2EFOA 3T5XA 2DK8A 4U7DA 1FSEA 2JT1A 4KN7X 3DXJF 1T6SA 3W6JB 2XGXA 1V4RA 4KT5C 3IRQA 3GEZA 3JTGA 3KP3A 5LHGA 3CO6C 2EWNA 2HEOA 3ML6A 3F21A 1SFEA 2O0YA 2VOPA 4ZZLA 3WU0A 4ETSA 1YFHA 2GA2A 5ILUA 3ZMZA 1BIBA 2ESNA 2CFXA 2ZCWA 4EM1A 4TV7A 1YYVA 4ON0A 2J5OA 2DO7A 2P5KA 3VB2A 2ZKZA 3HOSA 3JSPA 1SD7A 4GGGA 2DU9A 1S3JA 3LA7A 3E5QA 2BBYA 2MH9A 2FE3A 2CO5A 4M6YA 2IA0A 4IPAA 4A12A 1ZYRF 3GVAA 3WGGA 2PJPA 2DPUA 1Z6RA 5ICEA 3K2ZA 2F5CA 2IPQX 4LGWA 1W7PD 4A0XA 2M8EA 2IRFG 4EGYA 4EGZA 3KP4A 4FHTA 2UXNA 3O3KA 3M1EA 4WXDA 1QO0D 2DK5A 1L3LA 2FF4A 2L3DA 5H6QA 4A5NA 1IF1A 4ENNA 1W4MA 1LJ9A 4ZH4F 2KJCA 2CWEA 3EYIA 4I98B 5HDKA 2X0LA 3HRTA 4M72A 4A6EA 4PGGA 2OAZA 2HFHA 4BHPA 3WTWC 1QNTA 1TW2A 5H6RA 2GXGA 3TKYA 3C1DA 3ZMDA 2EB7A 2VODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW5 A;  2YU3 A;  1ZG5 A;  3ZPL A;  2YSR A;  1XGS A;  3BPX A;  4HW0 A;  2LDU A;  1FNN A;  2RV8 A;  3HRS A;  3HHH A;  5DYM A;  4BH9 A;  1RUN A;  2MD5 A;  2XV4 S;  3GYH X;  3MFK A;  3WTT C;  2NYX A;  2BEO A;  2E7X A;  2R7D A;  2IJL A;  2RVC A;  2X4H A;  5JI6 A;  4L9J A;  3BJO A;  1JE8 A;  2QYO A;  4G6Q A;  3FXQ A;  3M8E A;  2Q8K A;  1IN7 A;  3R6S A;  4MGR A;  2PBI A;  1K79 A;  2XVC A;  1FX7 A;  1OYY A;  2L02 A;  4RGU A;  3F3X A;  1ZRF A;  2GWR A;  3DF8 A;  5E1Z B;  4OMZ A;  1KU2 A;  4I0A A;  2HDC A;  4NQW A;  3C7J A;  3I58 A;  2M30 A;  1HKQ A;  2O6G E;  3V8K A;  2QWW A;  3E6D A;  1R1V A;  5HLH A;  1IXR C;  3QU6 A;  4HV6 A;  1PP8 F;  1ZRC A;  1J59 A;  1O57 A;  1F1Z A;  3K9T A;  2ZNZ A;  5HLI A;  3FM3 A;  1W7P B;  5LHI A;  2EA2 A;  1I5Z A;  2KIU A;  2W25 A;  3C18 A;  1YS6 A;  1LVA A;  2HS5 A;  3J80 Z;  2ZME A;  2ISY A;  5D5U B;  1RNL A;  2NAZ A;  4G8X A;  2ZO4 A;  4EJV A;  3FM5 A;  3WE3 A;  3FZV A;  5DUK A;  4CDG A;  5AIQ A;  3CUO A;  4OMY A;  5F1R A;  4UVB A;  1Z05 A;  2KRF A;  3IHU A;  1O3T A;  6PAX A;  1QPM A;  5FO5 A;  5LGT A;  3HIF A;  2G7U A;  2W57 A;  3BY6 A;  3I64 A;  1XMA A;  1S7A A;  2D1H A;  5A2Q K;  3QAH A;  1X3U A;  2QVO A;  3SZP A;  3H92 A;  4YFX F;  1CF7 B;  4LJZ F;  3RYR A;  2GQQ A;  2BGC A;  2K27 A;  4UHT A;  3QP6 A;  3E97 A;  2PEX A;  3E5X A;  3GZ6 A;  1P4W A;  1GXP A;  1XCB A;  3V8J A;  1R7J A;  1J0R A;  2D1V A;  1G3W A;  1MJB A;  3I54 A;  1GHC A;  2COM A;  4HF1 A;  1ULY A;  5D6E A;  3TO7 A;  1MGT A;  4Z2Y A;  5FLX K;  3IWZ A;  1XB4 A;  4MEX F;  3MQ0 A;  3MWM A;  5LGN A;  1JHH A;  2FBI A;  1B6A A;  3QPH A;  3K1P A;  5DCF A;  1LEB A;  3IC7 A;  3ZQ7 A;  3GXO A;  1DPR A;  3TO6 A;  2P6S A;  4B09 A;  4ASN A;  5E1W A;  2CSO A;  1KA8 A;  1DDN A;  4M9Z A;  3EDP A;  2PI0 A;  3TDZ C;  5FD6 A;  2HYG D;  4P9F A;  2O61 A;  2WWY A;  2C6Y A;  3DEU A;  4L9T A;  2V1U A;  1R1U A;  4HX7 A;  2QUF A;  2XKO A;  1MDM A;  1DPU A;  4FX0 A;  3ZMS A;  3B73 A;  3FXU A;  4OIN F;  1D5V A;  1Q1H A;  4BHC A;  2LF7 A;  2P7V B;  1XGO A;  1IRF A;  3MZY A;  4EV0 A;  1I1G A;  4I02 A;  3K1N A;  2GA1 A;  3TOB A;  4U0Y A;  4BYY A;  5E18 F;  4P96 A;  5ED4 A;  1KYW A;  3ZN1 A;  4XLP F;  3RJP A;  1AWC A;  4LK0 F;  1SFX A;  5D4R A;  1MJA A;  4OOI A;  2A07 F;  4IXA A;  1KU9 A;  2BYV E;  5HVQ C;  3KP7 A;  3SXY A;  2PG4 A;  2V6C A;  2VBX A;  1FBU A;  4AVP A;  1FYL A;  1EH8 A;  1K78 B;  3GO5 A;  1YQA A;  3BP8 A;  3SFZ A;  4L0Z B;  3O2P E;  4JQF A;  3MCZ A;  2YPR A;  1YO5 C;  3BOQ A;  2L54 A;  2P6T A;  4WXH A;  3U1D A;  2JSC A;  1HST A;  1XMK A;  5DV5 A;  4M9S A;  1WSU A;  2RC4 A;  1I6X A;  4U7B A;  3M8F A;  4GO1 A;  3W6K B;  5CYV A;  2OZ6 A;  1SAX A;  2HWV A;  5F6F A;  4A0Z A;  3WU1 B;  3WTU C;  3E5U A;  3TDU C;  1J7K A;  3Q5F A;  1FYK A;  1OPC A;  5KK1 A;  1EH6 A;  2JRT A;  1P2F A;  3JAM K;  4ESJ A;  3V8L A;  4ENK A;  4AIH A;  4YG2 F;  1H0M A;  4L5J A;  2LKP A;  1V3F A;  4UNO A;  4Y17 A;  3MEX A;  2HGC A;  3GFL A;  1DP7 P;  2VBY A;  4L9V A;  1IXS B;  3F6O A;  3ABT A;  3KZY A;  4N9I A;  1YS7 A;  4QLC U;  2FEZ A;  2DW4 A;  1S29 A;  3V7R A;  3GZ5 A;  2XKP A;  4GYG A;  3HTU A;  4S05 A;  1O7F A;  1XSX A;  2JTV A;  1IRG A;  4M71 A;  5DEQ A;  2G7H A;  4ZYD A;  2EV0 A;  4PCQ A;  5FD5 A;  3OV8 A;  5F64 A;  3KP6 A;  4YFK F;  2LNB A;  2ACJ A;  3CTA A;  2FU4 A;  3SHF A;  3KP2 A;  4BNC A;  5ERI A;  1YTY A;  4CGZ A;  5CVI A;  5BQT A;  1FPQ A;  4RGS A;  1LQ1 A;  1XGM A;  1BI0 A;  4WX9 A;  1K7A A;  4G94 A;  1ZAR A;  2Z33 A;  1W5T A;  4LK1 F;  3NQO A;  1B59 A;  1ZN2 A;  2VE8 A;  1U5T B;  2VBZ A;  5DUI A;  1CF7 A;  4HQM A;  5EEH A;  2NS0 A;  2OZU A;  3D5L A;  4LLG F;  3HRU A;  3JSO A;  1K78 A;  3Q9S A;  3WE2 A;  4KA4 A;  4ENJ A;  2W85 A;  3I53 A;  3E6M A;  4S04 A;  5L3E A;  1H9G A;  2KIM A;  5E1X A;  3QOP A;  4A0Y A;  2D45 A;  4A5M A;  5DD4 A;  3VEP A;  3R4K A;  4RGR A;  2ZME B;  1U6G A;  2KJB A;  5IT3 A;  5FGM A;  2PLY A;  4CHU A;  1Y0U A;  4YII A;  4OIR F;  1SMT A;  1RZ4 A;  3J81 K;  1U3E M;  3R0A A;  5HDG A;  1MD0 A;  2FNP A;  4LB5 A;  1MDM B;  2VON A;  2CQK A;  2QLZ A;  2BE5 F;  1HXD A;  3JTH A;  3MAJ A;  3DQV C;  2VN2 A;  2XHK A;  3P9C A;  3PFI A;  1BI3 A;  5L3G A;  2H94 A;  1BJA A;  1YG2 A;  4HA8 A;  1Z6T A;  3WTY C;  4KIC A;  2YR2 A;  4HF2 A;  2K4J A;  4CO8 A;  2KIF A;  3L09 A;  3GFI A;  5CVJ A;  2GIV A;  3PQJ A;  1G3T A;  4PDK A;  3GFM A;  3T1B A;  2XIG A;  4M74 A;  3RKY A;  2O8X A;  1WKM A;  2TDX A;  2XRO A;  1MJ9 A;  1XGN A;  3RKW A;  1AOY A;  2XAG A;  3IWF A;  3KP5 A;  4UV9 A;  3WTZ A;  1R36 A;  1QZY A;  5L3B A;  4WCG A;  5CJ9 A;  5K5O A;  3P9I A;  3V4G A;  2LF8 A;  4CZZ A;  3FMQ A;  3KFW X;  1FBS A;  4RAZ A;  1FZP B;  4RGX A;  5J6X A;  3CUQ B;  2QZ8 A;  3ECO A;  1HW2 A;  3J7A O;  4AD9 A;  3ROU A;  5K5Q A;  2RKH A;  4HX4 A;  1IN8 A;  1YW7 A;  4LD5 A;  5LHH A;  4ZYE A;  2OBP A;  2F5F A;  1FSH A;  2IVM A;  1O7L A;  5K1Y A;  4E70 A;  4WXC A;  2VXZ A;  4KYW A;  5D4S A;  1UFM A;  3FX3 A;  3WGH A;  1ZGA A;  2OU2 A;  4R8H A;  3H3U A;  3KET A;  2V9V A;  2A6E F;  1FLI A;  5LEK A;  4O3M A;  1JXS A;  2H6B A;  1EV7 A;  2Z9O A;  1BIA A;  1BM9 A;  4CIC A;  2QBY A;  3RIR A;  1S7O A;  1WWX A;  3ZMU A;  1W7P A;  4K2E A;  1QBJ A;  3IRR A;  4R1H A;  4DQ2 A;  1MKM A;  2Q2E A;  4HDU A;  2RGV A;  1ZAO A;  3GF2 A;  2DFI A;  2IW5 A;  4IJA A;  3F8N A;  3E3V A;  2XAS A;  3VOE A;  1D3Y A;  2E1N A;  3F22 A;  3CUQ C;  1GVJ A;  1ZLJ A;  2UWM A;  1T38 A;  1LDD A;  5E8G A;  3N4M A;  1R22 A;  3GFJ A;  3ZP5 A;  4IHT A;  4RB1 A;  2PN6 A;  1TTY A;  4IRH A;  3F6V A;  4I0B A;  3HHG A;  4UV8 A;  2ZJ2 A;  5A2Q Z;  4L0Y B;  2P8T A;  3IL2 A;  3QRF F;  2MC3 A;  4RB2 C;  5J8C A;  1MZB A;  2ESH A;  2VC0 A;  2VC1 A;  3GW2 A;  3RPU A;  1IZ1 A;  2EJR A;  2EV5 A;  4NB5 A;  4HQE A;  4HAM A;  4AIJ A;  4M6X A;  2FXA A;  1XDU A;  2DLL A;  1ZGJ A;  1PUE E;  3FWE A;  4LG0 B;  2WV0 A;  3HTS B;  3QU3 A;  2DQL A;  2DAO A;  5ICC A;  5DDG A;  1XN7 A;  1LDK B;  5K5R A;  1B4A A;  1GXQ A;  4I7H A;  5E20 A;  5L3D A;  3QPT A;  3AAF A;  2A5Y B;  3REO A;  4ESB A;  2ETH A;  2L4A A;  4XBF A;  2STT A;  2EFN A;  1FY7 A;  4BXU A;  2MBF A;  1YLF A;  4I01 A;  3K69 A;  5HS7 A;  5D6F A;  1T98 A;  2W84 A;  3ULQ B;  2A61 A;  3GUD A;  5LEJ A;  5AIP A;  1E2X A;  4HV5 A;  3TO9 A;  1DUX C;  1HKT A;  1LB2 A;  4Q48 A;  5HLG A;  1R1T A;  2CYY A;  2F2E A;  4KIG A;  3HUG A;  3HYI A;  1YW9 A;  4AIK A;  1SD4 A;  3VFZ A;  1F4K A;  4U0V A;  4MTE A;  3F8F A;  3K0L A;  3JAM Z;  2KKO A;  3CJN A;  3WG9 A;  2RNJ A;  1HKS A;  1QZZ A;  1OMI A;  4KIB A;  2Z99 A;  2M5W A;  4IRG A;  3RYP A;  3U9G A;  1CGP A;  2HQN A;  2MLG A;  4G7Z F;  1T0F A;  2QEN A;  1IN4 A;  2F5E A;  2W24 A;  4EMS A;  2ZFW A;  2HTJ A;  3K1M A;  4HX8 A;  4IRI A;  1KQ0 A;  3RKX A;  1G3Y A;  4KFC A;  2FA5 A;  5E17 F;  2Z3Y A;  5J8F A;  3LAJ A;  1O3Q A;  1U2W A;  3R0J A;  5EEG A;  3FF5 A;  1BOA A;  1RI7 A;  1XSV A;  2CW0 F;  1ON2 A;  4HZF A;  4BQA A;  2FQ3 A;  1ZG3 A;  1S8N A;  4H0E A;  2CGP A;  4F7Z A;  4LB6 B;  3RPQ A;  2RQP A;  3LA2 A;  3LFK A;  2HR3 A;  3KLO A;  1WI9 A;  1PDN C;  4HLX A;  1TNT A;  3U2R A;  4WK8 F;  3TOA A;  1P4X A;  3BJ6 A;  2HZT A;  2EFP A;  4P5O A;  2B0L A;  2EFQ A;  3D0S A;  1Z91 A;  1TBX A;  1B9N A;  4FX4 A;  1U78 A;  1NHA A;  3IKV A;  2DTR A;  2EK5 A;  4HOB A;  5AON A;  4LMY A;  3L9F A;  3RDI A;  1HW1 A;  2QM3 A;  2XAH A;  4EJW A;  1XD7 A;  3ERE D;  4NHJ A;  2G9W A;  3T8T A;  2MH2 A;  3V7S A;  2M1B A;  4I09 A;  1YW8 A;  5BPD A;  2QQB A;  2RDP A;  2Z5U A;  4IF4 A;  1P92 A;  4KIF A;  5FFX A;  1SD6 A;  1UHM A;  4P9U A;  5ILS A;  3F8C A;  3MZH A;  3I5U A;  4PGH A;  3DFG A;  3I59 A;  3ABU A;  2OQR A;  3HSR A;  4XRF A;  2IP2 A;  4FT8 A;  4KMF A;  4U0W A;  3CUQ A;  2OQG A;  3COA C;  1G4D A;  5HOO A;  5FFZ A;  2XAF A;  3DV8 A;  3ZMT A;  5JHU A;  4UUV A;  1UHW A;  1QGP A;  3RTR A;  3CLO A;  3O6B B;  2Y0M A;  1KU3 A;  1FP1 D;  4DNC A;  2UZK A;  3T8R A;  5TRD A;  4G9Y A;  2MA3 A;  4B8X A;  1J2X A;  4OU0 A;  1VTN C;  3ECH A;  4WWC A;  2D2W A;  3EUH A;  2HQR A;  4EM0 B;  3ELK A;  3DPT A;  1U8R A;  5D8L B;  5FB2 A;  2RN7 A;  1R00 A;  2K4B A;  3HSE A;  1IXC A;  4Q47 A;  4L5I A;  4O5V A;  4EJO A;  3I4P A;  2FBH A;  1STZ A;  5HS9 A;  2PQ8 A;  2CG4 A;  3G3Z A;  4HYE A;  1BC7 C;  4ZYG A;  3TGN A;  3NRV A;  4WF2 A;  2AXL A;  3T0Y A;  1Z1D A;  1BI2 A;  4N0B A;  4JBA A;  4YFN F;  3BDD A;  2FRH A;  2ZXJ A;  1R5H A;  1LDJ A;  1BC8 C;  2M45 A;  2M87 A;  1WQ2 A;  4KUM A;  2A3S A;  1O3S A;  4KMU X;  2FML A;  3H3Z A;  4GCV A;  4LLL A;  2ZBK A;  5TJJ A;  1REP C;  1P6R A;  3J80 K;  2R7F A;  5DCM A;  1R58 A;  3LAP A;  2AS5 F;  2NNY A;  2DT5 A;  1T39 A;  2J5P A;  4Y13 A;  1EH7 A;  1L0O C;  2VBW A;  4G7O F;  5LBQ A;  2YX7 A;  3SQN A;  2A69 F;  4EJT A;  2HYF A;  3P7N A;  1D8J A;  4Y15 A;  5IT9 K;  1OR7 A;  1TNS A;  5CLS A;  3ISP A;  3KCC A;  3GX4 X;  2FBK A;  5IT9 Z;  2IA2 A;  2E1C A;  1G6N A;  4LLN A;  2FSW A;  3G73 A;  1ZHF A;  1SD5 A;  1LEA A;  3BZ6 A;  3EYY A;  3L2C A;  3F23 A;  2EA4 A;  3F8M A;  1LNW A;  5LRS A;  4AWX B;  2PMU A;  5DD8 A;  2DPD A;  1U5T A;  1RIO H;  4I2O A;  3BRO A;  2P5V A;  1K6O A;  2IT0 A;  1ONV A;  1TQM A;  4D0P A;  1A04 A;  5H20 A;  4N9H A;  2V1D A;  4MNU A;  3F72 A;  4UVA A;  5CVR A;  4U88 A;  3LA3 A;  1ZH5 A;  2K7L A;  2NRA C;  1FC3 A;  3HOT A;  3HSF A;  1YIO A;  1ZRD A;  3CDH A;  2R3S A;  1XCV A;  4MHG A;  1C0W A;  1BBY A;  3DPL C;  4QWQ A;  2WTE A;  2P5L C;  2A6H F;  1QQI A;  4KNY A;  2HTS A;  1BN5 A;  3VOD A;  4R79 A;  5JFR A;  2OD5 A;  2XUB A;  3LQR A;  3IKT A;  5L3C A;  1TLH B;  4XSZ F;  4HDV A;  1PP7 U;  2ISZ A;  4ZYH A;  1TW3 A;  2H09 A;  4MQV A;  3NEU A;  4XSX F;  1TQP A;  4EVI A;  3I71 A;  3FHZ A;  2QQ9 A;  3HRM A;  4BAY A;  1Z7U A;  2NNN A;  2FNA A;  3EQL F;  1KGS A;  1ON1 A;  2VT3 A;  2PMH A;  3E6C C;  2QQA A;  4ENM A;  2Q0O A;  2V1X A;  1OKR A;  4IHS A;  2JPC A;  4UXN A;  4G7H F;  4BHB A;  1XDS A;  3EET A;  2H27 A;  1G3S A;  1RUO A;  1F5T A;  4HBL A;  4PZJ A;  2XRN A;  3FMS A;  3N97 A;  1FYM A;  1HBX G;  3BPV A;  3FXR A;  4P55 A;  4A2U A;  4OIO F;  4LFU A;  2YX4 A;  2DI3 A;  4KDP A;  1S6L A;  1I1S A;  1WRJ A;  4RB0 A;  5BOX A;  4UVC A;  3I59 B;  1IAW A;  1B9M A;  2P4W A;  3KZZ A;  3WOD F;  3JW4 A;  4JK1 X;  1BI1 A;  4CYD A;  2JPB A;  1H9T A;  4YIF A;  1UST A;  5D5V B;  1T2K A;  1TQI A;  3V7C A;  3C3W A;  1B1B A;  1HSJ A;  3R60 A;  1OYW A;  2HOE A;  2GZW A;  2PFB A;  4HLY A;  1IUY A;  2DQR A;  5BMZ A;  4IVN A;  3ZMV A;  3R61 A;  2UXX A;  1FOK A;  5ICG A;  1J9I A;  4RAY A;  2HKO A;  2WC2 A;  2IA1 A;  5ICF A;  5LGU A;  1ZRE A;  3TQN A;  5DCM B;  3LST A;  4MQ9 F;  1IW7 F;  1ZLK A;  2ELH A;  2VOO A;  1FT9 A;  2LSO A;  5JVT A;  2QBY B;  2BV6 A;  4OIP F;  3ZN0 A;  1P4A A;  1UCR A;  1D8K A;  3SZT A;  3WTV C;  2FOK A;  2V79 A;  2ADU A;  4L18 B;  3LWF A;  1OYI A;  2HKX A;  4KN4 X;  2L01 A;  2K02 A;  1FP2 A;  4GYI A;  2FMY A;  4G6D A;  3LQQ A;  4MTD A;  5CVV A;  3F8B A;  4Q5S F;  3PQK A;  4HF0 A;  2L4M A;  3WTX C;  3Q9V A;  1FWZ A;  2VE9 A;  4EJU A;  4EQQ A;  1U5T C;  2GXB A;  1R23 A;  3I0T A;  1SFU A;  3DP7 A;  2EV6 A;  3M9A A;  1J75 A;  3L00 A;  3FMR A;  1KQ9 A;  2MLK A;  2XAJ A;  4M9X A;  1J5Y A;  3M7G A;  4GXO A;  3E6B A;  3QP5 A;  5LLQ A;  3WTS C;  3WGI A;  4M73 A;  2Y75 A;  1E17 A;  2Y48 A;  3KEO A;  5CVU A;  1IN5 A;  1R5G A;  2K86 A;  5E8I A;  3KEQ A;  1KQ8 A;  2E7W A;  5FLX Z;  5D5W B;  5JR3 A;  3B02 A;  3CO7 C;  2A68 F;  5D8K B;  2DBB A;  5BS6 A;  2EFW A;  5L3F A;  4ESF A;  2H6C A;  3BWG A;  5KVR A;  4L9N A;  4Q4Z F;  5HS8 A;  5BPI A;  1HQC A;  1JGS A;  1KYZ A;  2JZY A;  3KE2 A;  1USS A;  2OA4 A;  3GWZ A;  4XLN F;  4MEY F;  4RS8 A;  3P9K A;  2XAQ A;  1W5S A;  3GLX A;  1XSD A;  2GAU A;  1F9N A;  5ILV A;  1Z9C A;  1I27 A;  4EM2 A;  4ZZD A;  2ZNY A;  1UB9 A;  3OOP A;  4O6J A;  3J81 Z;  2O03 A;  1ZG1 A;  1SMY F;  3KLN A;  2O3F A;  4RB3 C;  2P7C B;  1O3R A;  2STW A;  3DKW A;  4A6D A;  1FBQ A;  2VT2 A;  5HDN A;  4OIQ F;  3L7W A;  3BJA A;  1IN6 A;  4CXF A;  2F5D A;  1ODD A;  3S2W A;  1KU7 A;  5D5X B;  3RI4 A;  1JHF A;  4LG0 A;  5LRR A;  2EFO A;  3T5X A;  2DK8 A;  4U7D A;  1FSE A;  2JT1 A;  4KN7 X;  3DXJ F;  1T6S A;  3W6J B;  2XGX A;  1V4R A;  4KT5 C;  3IRQ A;  3GEZ A;  3JTG A;  3KP3 A;  5LHG A;  3CO6 C;  2EWN A;  2HEO A;  3ML6 A;  3F21 A;  1SFE A;  2O0Y A;  2VOP A;  4ZZL A;  3WU0 A;  4ETS A;  1YFH A;  2GA2 A;  5ILU A;  3ZMZ A;  1BIB A;  2ESN A;  2CFX A;  2ZCW A;  4EM1 A;  4TV7 A;  1YYV A;  4ON0 A;  2J5O A;  2DO7 A;  2P5K A;  3VB2 A;  2ZKZ A;  3HOS A;  3JSP A;  1SD7 A;  4GGG A;  2DU9 A;  1S3J A;  3LA7 A;  3E5Q A;  2BBY A;  2MH9 A;  2FE3 A;  2CO5 A;  4M6Y A;  2IA0 A;  4IPA A;  4A12 A;  1ZYR F;  3GVA A;  3WGG A;  2PJP A;  2DPU A;  1Z6R A;  5ICE A;  3K2Z A;  2F5C A;  2IPQ X;  4LGW A;  1W7P D;  4A0X A;  2M8E A;  2IRF G;  4EGY A;  4EGZ A;  3KP4 A;  4FHT A;  2UXN A;  3O3K A;  3M1E A;  4WXD A;  1QO0 D;  2DK5 A;  1L3L A;  2FF4 A;  2L3D A;  5H6Q A;  4A5N A;  1IF1 A;  4ENN A;  1W4M A;  1LJ9 A;  4ZH4 F;  2KJC A;  2CWE A;  3EYI A;  4I98 B;  5HDK A;  2X0L A;  3HRT A;  4M72 A;  4A6E A;  4PGG A;  2OAZ A;  2HFH A;  4BHP A;  3WTW C;  1QNT A;  1TW2 A;  5H6R A;  2GXG A;  3TKY A;  3C1D A;  3ZMD A;  2EB7 A;  2VOD A; 
#chains in the Genus database with same CATH topology
 2EZH A;  2BHZ A;  4ZTF A;  3S8P A;  1MBE A;  1HW5 A;  2YU3 A;  1ZG5 A;  5J47 A;  2HVS A;  3ZPL A;  2AHQ A;  2DYS H;  1XGS A;  2YSR A;  4XNF A;  3RPU D;  3BPX A;  1S9H A;  4HW0 A;  4M6V A;  2JMW A;  3K4N A;  4DYR A;  2LDU A;  3TBI A;  1FNN A;  2RV8 A;  4RM2 A;  3HRS A;  3DLL F;  2X6O A;  3GBG A;  3HHH A;  4LIV A;  5DYM A;  4BH9 A;  1RUN A;  2MD5 A;  2DDA A;  2XV4 S;  1VQ8 I;  4A3L J;  3GYH X;  2HU9 A;  4J19 A;  3MFK A;  4F91 B;  3MZ8 A;  3WTT C;  2NYX A;  2BEO A;  2E7X A;  2R7D A;  2IJL A;  2RVC A;  4V2F A;  2X4H A;  5JI6 A;  3H35 A;  4L9J A;  3JRI A;  2ZC2 A;  3BJO A;  1JE8 A;  2QYO A;  4G6Q A;  1X58 A;  3FXQ A;  5FKO A;  2VLA A;  3M8E A;  5M5X J;  2Q8K A;  3HDD A;  1FIP A;  1IN7 A;  3R6S A;  4HRI A;  3I56 I;  4MGR A;  2V26 A;  1RET A;  1D0Y A;  2PBI A;  2RNG A;  4X6A J;  5B5E C;  1K79 A;  2L7F P;  2XVC A;  3J7A Y;  3BZC A;  1OCR H;  4NDL A;  3BTI A;  1FX7 A;  1OYY A;  4F92 B;  4A69 C;  3HZJ A;  2M7A A;  2L02 A;  1D0Z A;  4RGU A;  3F3X A;  1FTZ A;  1TWC J;  1ZRF A;  2GWR A;  3DF8 A;  5E1Z B;  1ETO A;  4OMZ A;  3Q0V A;  1KU2 A;  4I0A A;  5EEA A;  4NQW A;  4BQO A;  2HDC A;  3C7J A;  4BDY A;  3I58 A;  2M30 A;  4CZC A;  4GFB A;  2XSD C;  2JVH A;  1HKQ A;  2O6G E;  3V8K A;  1TL8 A;  2QWW A;  4BEH A;  2YS9 A;  3E6D A;  4XRS A;  2H1L A;  3S1N J;  1R1V A;  5HLH A;  1IXR C;  2ZXW H;  4NBQ A;  3LSJ A;  3MD2 A;  3QU6 A;  1UAA A;  3VWB A;  4HV6 A;  1PP8 F;  1ZRC A;  1DU6 A;  4BJ5 C;  1SVL A;  1O57 A;  1J59 A;  4XKC A;  1F1Z A;  3K9T A;  1HDD C;  2NVT J;  1WJB A;  2F6C A;  4HNU A;  3BR6 A;  3LL7 A;  1PUF A;  2HDD A;  1V5E A;  2ZNZ A;  5HLI A;  3FM3 A;  1W7P B;  5LHI A;  2EA2 A;  2EIJ H;  1K6Y A;  1I5Z A;  5EF6 A;  2KIU A;  2W25 A;  3HGG A;  3C18 A;  1YS6 A;  1O4X A;  4U87 A;  1LVA A;  2HS5 A;  4M3F A;  3J80 Z;  2ZME A;  2ISY A;  5D5U B;  5E3M A;  2V4J C;  1RNL A;  2NAZ A;  4G8X A;  2ZO4 A;  2DMN A;  1Q1V A;  4KT6 A;  2MG4 A;  4EJV A;  1ZR2 A;  2ZJP F;  3FM5 A;  2DYR H;  3WE3 A;  3AG3 H;  3FZV A;  1IRZ A;  5DUK A;  1YIJ I;  4I76 A;  4CDG A;  5AIQ A;  3CUO A;  4OMY A;  5F1R A;  3CES A;  2AQE A;  4UVB A;  1Z05 A;  2KRF A;  2XF5 A;  3JRD A;  3IHU A;  1O3T A;  6PAX A;  1QPM A;  1VI0 A;  5FO5 A;  5HNH A;  5LGT A;  3HIF A;  2G7U A;  2ECC A;  4DZJ A;  2W57 A;  3GTQ J;  4HEA 2;  3BY6 A;  2CQX A;  1RPW A;  3I64 A;  1NK3 P;  3X2Q H;  1XMA A;  2XB5 A;  2BVL A;  1S7A A;  3H0D A;  1S72 I;  2D1H A;  5A2Q K;  1Z77 A;  3QAH A;  4IOA F;  3MKL A;  3BQZ A;  1X3U A;  1MMD A;  2X6Y A;  2QVO A;  2B7E A;  3SZP A;  2VXD A;  2HZD A;  3H92 A;  4YFX F;  1CF7 B;  3BG6 A;  4LJZ F;  3E1S A;  2N8G A;  4DIQ A;  3RYR A;  2GQQ A;  2B9S A;  2DJN A;  2BGC A;  3JR9 A;  3A2K A;  2K27 A;  4UHT A;  3QP6 A;  4D7N A;  4OAZ A;  3ZOB A;  2KT0 A;  3E97 A;  4RDU A;  2PEX A;  3E5X A;  1FJL A;  4Y33 A;  3GZ6 A;  1P4W A;  3CMY A;  4BY1 J;  3CCU I;  2CQQ A;  1GXP A;  1XCB A;  2IS6 A;  3V8J A;  1R7J A;  1ACI A;  2M34 A;  1J0R A;  2D1V A;  1G3W A;  1MJB A;  2E1M B;  2Z2S B;  3I54 A;  1GHC A;  2D5V A;  1LFU P;  2W4S A;  1IC8 A;  2COM A;  5FLM J;  3SFI A;  4HF1 A;  4BXX J;  1ULY A;  2E19 A;  2IBD A;  4I99 C;  5D6E A;  4BE1 A;  4XLC A;  2JK3 A;  3CZ6 A;  4C30 A;  1MGT A;  3TO7 A;  3OYA A;  2VUM J;  1MBK A;  3KPH A;  4Z2Y A;  2R5Y B;  3D5R C;  3IWZ A;  5FLX K;  4D7M A;  4C3H J;  2QEX I;  1XB4 A;  3IP4 B;  3MQ0 A;  3MWM A;  5LGN A;  3CCL I;  4MEX F;  3SDG A;  1JHH A;  1ENH A;  2FBI A;  1B6A A;  3QPH A;  1RES A;  3BG9 A;  4BBS J;  3K1P A;  5DCF A;  2WV1 A;  1LEB A;  3IC7 A;  1GV2 A;  3GXO A;  3ZQ7 A;  3L2Q A;  1DPR A;  1VQP I;  4MO7 A;  3TO6 A;  3FKI J;  3CCJ I;  2P6S A;  4B09 A;  4E7J A;  4ASN A;  5E1W A;  2CSO A;  2X1C A;  1N77 A;  2GM4 A;  1KA8 A;  1DDN A;  4PSX A;  5IP6 A;  4M9Z A;  3EDP A;  3DBL B;  3TDZ C;  2PI0 A;  2KZG A;  5FD6 A;  2HYG D;  4P9F A;  2O61 A;  2WWY A;  3K4C A;  3G71 I;  2C6Y A;  2LY9 A;  3DEU A;  4QTR A;  4ITV A;  4L9T A;  2V1U A;  4JX5 A;  1WH7 A;  1R1U A;  2K40 A;  2PJR B;  1QVT A;  4HX7 A;  2MW8 A;  2QUF A;  2XKO A;  2E2H J;  1AU7 A;  3E0J B;  4DW6 A;  1MDM A;  1DPU A;  3F0C A;  2ELJ A;  4FX0 A;  1P7J A;  3ZMS A;  3B73 A;  9ANT A;  3WG7 H;  3FXU A;  4XON A;  4OIN F;  1D5V A;  1Q1H A;  2XC7 A;  2KMU A;  4A3G J;  4PUS A;  3KIO A;  4BHC A;  2LF7 A;  2P7V B;  1BR1 A;  1XGO A;  3K7A J;  1IRF A;  1I3Q J;  3MZY A;  4EV0 A;  3O8G A;  3A01 A;  1I1G A;  1QHH D;  1MSE C;  4I02 A;  1K4T A;  3K1N A;  3HOV J;  2R0Q C;  2GA1 A;  3DBR B;  3TOB A;  2L0K A;  4U0Y A;  4BYY A;  5E18 F;  1X4P A;  4BY7 J;  4P96 A;  5ED4 A;  1KYW A;  3ZN1 A;  2TRT A;  1OCZ H;  3O8H A;  3SEZ A;  4XLP F;  3OYL A;  3RJP A;  5J1Y A;  1ORK A;  1AWC A;  4V19 K;  4LK0 F;  4IHW A;  1SFX A;  2Q1Z B;  2JA5 J;  3G4S I;  5D4R A;  2CH0 A;  1MJA A;  4OOI A;  2A07 F;  3L2R A;  4IXA A;  1R49 A;  2EPF A;  1KU9 A;  2BYV E;  5HVQ C;  2JUG A;  2CQN A;  3MKW B;  3KP7 A;  3SXY A;  2PG4 A;  2V6C A;  2VBX A;  1FBU A;  4AVP A;  1D1A A;  1W0T A;  1FYL A;  5FRN A;  4CSW A;  3RKQ A;  1EH8 A;  1K78 B;  3GO5 A;  2BY3 A;  1YQA A;  3BP8 A;  2E5Z A;  3SFZ A;  4L0Z B;  4XKW A;  3O2P E;  4JQF A;  4IOC F;  3MCZ A;  4RM3 A;  1ZK8 A;  2YPR A;  3FXK A;  1YO5 C;  3BOQ A;  2L54 A;  2P6T A;  2IAI A;  4WXH A;  4B44 A;  3U1D A;  5JLW A;  1YOV B;  4BGD A;  1B8I A;  2JSC A;  1HST A;  1XMK A;  4JYK A;  2V1N A;  3A1Y A;  5EG0 B;  2VKE A;  2EIM H;  5DV5 A;  2VJ5 A;  4M9S A;  3IV5 A;  1WSU A;  1UHS A;  2EBI A;  3G2B A;  1XMX A;  4M3B A;  5GTI C;  1NK2 P;  2BVM A;  4NUB A;  2RC4 A;  1I6X A;  4U7B A;  1B72 A;  4HSR A;  3M8F A;  4Y52 J;  4GO1 A;  3BR0 A;  3W6K B;  2R92 J;  1WJC A;  1OCO H;  5CYV A;  3BC8 A;  2LYC A;  2OZ6 A;  5F08 A;  1SAX A;  1JGG A;  2HWV A;  5F6F A;  4A0Z A;  3WU1 B;  3WTU C;  3E5U A;  2HI3 A;  4A3J J;  3TDU C;  3BT9 A;  1VQN I;  1SC7 A;  1J7K A;  3Q5F A;  4FTH A;  1FYK A;  1OPC A;  4HST A;  5KK1 A;  1EH6 A;  1XG1 A;  2JRT A;  2XPU A;  1QPI A;  1P2F A;  2FQ4 A;  5JLX A;  3JAM K;  3BTJ A;  4ESJ A;  4Y3O A;  4RBO A;  3V8L A;  3MN2 A;  4ENK A;  4AIH A;  1VQK I;  3DEW A;  3HUG B;  4YG2 F;  1H0M A;  1ERD A;  4L5J A;  2LKP A;  1FOX A;  1V3F A;  4UNO A;  2KQR A;  3IUO A;  4BE0 A;  4YEJ A;  4Y17 A;  3MEX A;  2HGC A;  3GFL A;  1DP7 P;  2VBY A;  4L9V A;  1AHD P;  2XSJ C;  1QA6 A;  1IXS B;  3F6O A;  4N4N B;  3ABT A;  3KZY A;  4N9I A;  2R7W A;  3PO3 J;  1YS7 A;  4QLC U;  2FEZ A;  5GAG J;  4CYC B;  2DW4 A;  4RAF A;  1ITY A;  2VKV A;  1S29 A;  1VF9 A;  2KIS A;  1TZL A;  5GAE J;  2XB0 X;  2VL8 A;  2OC6 A;  4LG3 A;  3GZ5 A;  3V7R A;  4CCN A;  2XKP A;  4GYG A;  3HTU A;  1DU0 A;  4C2U A;  3K2A A;  4S05 A;  1O7F A;  1XSX A;  2JTV A;  2CMP A;  3TED A;  3VSL A;  1IRG A;  4M71 A;  1UEL B;  5DEQ A;  3DWL E;  3CMA I;  2G7H A;  4ZYD A;  2EV0 A;  1RKT A;  4PCQ A;  2BW3 B;  2LY1 A;  5FD5 A;  3OV8 A;  5F64 A;  3KP6 A;  4YFK F;  2LNB A;  5EGO B;  1G59 A;  2ACJ A;  3DKX A;  3CTA A;  2FU4 A;  2DFH A;  3SHF A;  3KP2 A;  4BNC A;  2MYS A;  3NAU A;  3GZN B;  2R93 J;  3AG4 H;  5ERI A;  1YTY A;  4CGZ A;  5CVI A;  5BQT A;  1H8A C;  1FPQ A;  1ETW A;  5TIS C;  4I6Z A;  4RGS A;  2LMD A;  2EIN H;  1LQ1 A;  1X19 A;  1XGM A;  2E1O A;  2HDW A;  2M9H A;  1BI0 A;  4WX9 A;  1K7A A;  4G94 A;  1X2N A;  1ZAR A;  1ZTR A;  2Z33 A;  1DGW Y;  1W5T A;  4LK1 F;  3NQO A;  4BE2 A;  1B59 A;  2L9S A;  1ZN2 A;  3LSH A;  2VE8 A;  1U5T B;  2VBZ A;  5DUI A;  2W1O A;  1CF7 A;  4W1U A;  4HQM A;  5EEH A;  2NS0 A;  1OCC H;  2OZU A;  2RQQ A;  4XMY A;  1E3H A;  2QF7 A;  2K3F A;  3CDL A;  1MBG A;  3D5L A;  2E34 A;  4LLG F;  5FJ8 J;  3HRU A;  4RLF A;  3JSO A;  1K78 A;  5LD2 C;  3Q9S A;  2CUJ A;  3WE2 A;  5GPC A;  2O8K A;  4KA4 A;  3BQY A;  1VQM I;  4FIS A;  4ENJ A;  2BY0 A;  1TWA J;  2W85 A;  4HG2 A;  3I53 A;  2L2O A;  2FX0 A;  1BL0 A;  2HPM A;  1U0J A;  3E6M A;  2DFF A;  4S04 A;  5C4X J;  3ZQL A;  3LSG A;  5L3E A;  1H9G A;  2ZJQ F;  3UKG A;  2KIM A;  3GLL A;  5E1X A;  3OYI A;  3DPU A;  2DA7 A;  3QOP A;  1IRX A;  4A0Y A;  2D45 A;  5C3E J;  5B66 C;  4A5M A;  2KDO A;  2YU9 J;  3DTE A;  5DD4 A;  2DT6 A;  5F04 A;  5J4V A;  3VEP A;  3R4K A;  4RGR A;  3EUH C;  1H89 C;  4NNJ A;  4A3E J;  1GV5 A;  2ZME B;  2CU7 A;  1U6G A;  2KJB A;  5IT3 A;  5FGM A;  1XTA A;  3OWT A;  3OYN A;  2PLY A;  1OJL A;  1R4N B;  3SYT A;  2DMQ A;  1PVE A;  1ETV A;  4XID A;  2UV1 A;  4CHU A;  4DYQ A;  1MMS A;  2XPW A;  4QPQ A;  1Y0U A;  2DJI A;  4YII A;  5TGT A;  1YJW I;  5FKK A;  3DLA A;  4OIR F;  1SMT A;  1RZ4 A;  4KIS A;  1HLV A;  3PL8 A;  3J81 K;  2BXY A;  1U3E M;  3R0A A;  5HDG A;  3H1C A;  2KFD A;  4ANJ A;  2R5Z B;  1MD0 A;  2FNP A;  4LB5 A;  5E3N A;  5M5W J;  2K85 A;  1MDM B;  2VON A;  2Y9Z A;  2CQK A;  1R4M B;  1T0F C;  2QLZ A;  3OYB A;  4BEH B;  2BE5 F;  4PFO A;  4CA0 A;  1HXD A;  2QSF X;  2ICW G;  2WAF A;  3JTH A;  3MAJ A;  1IG7 A;  1OCP A;  4FCY A;  4EAT A;  4E4H A;  3DQV C;  3S14 J;  3C2G A;  3GTL J;  2VN2 A;  4FET A;  2XHK A;  2CV1 A;  3P9C A;  3PFI A;  1W5C C;  4IL6 C;  1BI3 A;  1X2M A;  5L3G A;  2H94 A;  1BJA A;  1FIA A;  4IZZ A;  3ZQG A;  2FJ1 A;  1Y39 A;  1YG2 A;  4HA8 A;  1Z6T A;  1FOW A;  2X48 A;  3OIO A;  3GTP J;  3A03 A;  2HQA A;  1I50 J;  3WTY C;  4KIC A;  4IEJ A;  2YR2 A;  2EIK H;  5E79 C;  3KYC B;  1IJW C;  4HF2 A;  4P1W A;  2K4J A;  3TW6 A;  3CCM I;  4CO8 A;  1Y8R B;  2KIF A;  3L09 A;  3GFI A;  5CVJ A;  3DU6 A;  2GIV A;  1YX3 A;  1VND A;  4NC6 A;  3PQJ A;  1G3T A;  3JRG A;  2UUZ A;  4PDK A;  5F0C A;  3GFM A;  3T1B A;  2XIG A;  4M74 A;  2WAE A;  3RKY A;  2R5Y A;  1T8I A;  3EUA A;  2PMZ A;  2VQL A;  2RAE A;  1QU3 A;  3Q3S A;  2ZME C;  2O8X A;  1MMN A;  1WKM A;  1GUU A;  2TDX A;  2XRO A;  2L7M P;  1MJ9 A;  2G0E A;  1XGN A;  3RKW A;  4JOM A;  2XAG A;  1AOY A;  3IWF A;  3KP5 A;  4UV9 A;  3WU2 C;  3S3O A;  3WTZ A;  3WHB A;  1OIS A;  4A3M J;  3PIO F;  1R36 A;  1QZY A;  1YX5 A;  3CC4 I;  1WJF A;  1E3P A;  5L3B A;  2DA3 A;  4WCG A;  2XRL A;  2K9N A;  4PFP A;  1MBJ A;  5CJ9 A;  5K5O A;  3ZRG A;  3P9I A;  2VQG A;  3V4G A;  2LF8 A;  4OWR B;  4CZZ A;  2CV0 A;  3FMQ A;  2BW3 A;  3S16 J;  4UUT A;  4IQJ A;  3KFW X;  1FBS A;  1TC3 C;  4RAZ A;  2LBF B;  1FZP B;  2M2E A;  3I4M J;  2KL4 A;  3H9Q A;  2GOX B;  1SEU A;  4RGX A;  5J6X A;  3CUQ B;  4DYC A;  3KYL A;  2QZ8 A;  3ECO A;  1HW2 A;  3ABL H;  2OTL I;  2DFE A;  1RC9 A;  5B1A H;  3J7A O;  4AD9 A;  3DBH B;  3RSN A;  3ROU A;  3W6V A;  5K5Q A;  4A3D J;  2RKH A;  4HX4 A;  1Y0N A;  1IN8 A;  1Y1W J;  1YW7 A;  4LD5 A;  5LHH A;  4ZYE A;  2FUG 2;  2OBP A;  4V2G A;  2XPV A;  2F5F A;  1FSH A;  2IVM A;  4E7Z A;  2Y0S A;  3DCF A;  2O9L A;  1O7L A;  3CLQ A;  5K1Y A;  4E70 A;  3OYJ A;  2W7N A;  2X6X A;  4QIW N;  3K4J A;  4BL0 B;  3BR3 A;  2VXZ A;  3QYB A;  4WXC A;  4BS9 A;  5D4S A;  1UFM A;  1ETY A;  3L2U A;  1K4S A;  4KYW A;  3FX3 A;  3WGH A;  3H9J A;  1ZGA A;  1AKH A;  2OU2 A;  4R8H A;  3H3U A;  3KET A;  2PX9 A;  2V9V A;  2A6E F;  2WY7 Q;  1FLI A;  5LEK A;  4O3M A;  1JXS A;  2H6B A;  2NXN B;  1EV7 A;  2Z9O A;  1BIA A;  1BM9 A;  4BJT A;  1N78 A;  3LSR A;  4UB6 C;  4CIC A;  2QBY A;  3RIR A;  5B3S H;  1S7O A;  1WWX A;  2DMP A;  3ZMU A;  1W7P A;  4K2E A;  1QBJ A;  1SFO J;  4YRV A;  3IRR A;  1MW7 A;  3QOD A;  4R1H A;  4DQ2 A;  3PJR A;  1MKM A;  2Q2E A;  2ECB A;  1WJ5 A;  4HDU A;  3CF2 A;  2Y0S N;  3HL2 A;  2RGV A;  1JUS A;  1ZAO A;  4B43 A;  3M1C A;  3I55 I;  4AVZ A;  3GF2 A;  1UG0 A;  4A3I J;  2ZXI A;  2DFI A;  2IW5 A;  2KHM A;  4IJA A;  3F8N A;  3E3V A;  2XAS A;  2CV2 A;  2NS7 A;  3VSK A;  2VAS A;  2DA2 A;  3VOE A;  1D3Y A;  1X4O A;  2E1N A;  3FBN B;  3F22 A;  4B3X A;  3CUQ C;  4XRM A;  3LSM A;  2XF6 A;  3BR2 A;  1D1B A;  1GVJ A;  4IHX A;  1ZLJ A;  1OCT C;  2VPR A;  5EG0 A;  2UWM A;  1T38 A;  4IO9 F;  1LDD A;  3TL4 X;  4XN3 A;  4MIM A;  5E8G A;  3N4M A;  1LPQ A;  1R22 A;  3GFJ A;  3G1L A;  3VPR A;  3ZP5 A;  1YJ9 I;  3OYK A;  4IHT A;  4RB1 A;  4PJJ A;  4FAS D;  4ZJZ A;  2PN6 A;  1TTY A;  4IRH A;  3TW7 A;  3F6V A;  4I0B A;  2BXZ A;  5IPA A;  3HHG A;  3PSI A;  2ZJ2 A;  4UV8 A;  1W36 D;  5A2Q Z;  3S1M J;  4L0Y B;  1BW6 A;  2P8T A;  1BOB A;  4D9J A;  5DM6 F;  3IL2 A;  2NVQ J;  5DS9 A;  3QRF F;  2XF7 A;  4HPQ A;  2MC3 A;  4RB2 C;  5J8C A;  1ZEL A;  1MZB A;  1A5J A;  4C3I J;  2ME0 A;  3QPS A;  2ESH A;  2IEK A;  3NWT A;  2LFB A;  1K61 A;  2VC0 A;  5DM7 F;  2VC1 A;  1JUP A;  3GW2 A;  3RPU A;  2LG4 A;  4IHV A;  1IZ1 A;  2EJR A;  4FE7 A;  3TMO A;  2EV5 A;  2JN6 A;  4BAC A;  4NB5 A;  4HQE A;  4HAM A;  4AIJ A;  4M6X A;  3E7L A;  2FXA A;  1XDU A;  2DLL A;  1ZGJ A;  1PUE E;  2NOJ B;  2HOT A;  2K9S A;  3FWE A;  3J7Y J;  4LG0 B;  2WV0 A;  3HTS B;  3QU3 A;  4PK4 A;  2IGN A;  2DQL A;  5GP9 A;  2QKM B;  4C2T A;  2DAO A;  4DGW B;  2R7T A;  4II3 A;  4M3D A;  5ICC A;  2IS1 A;  1QZE A;  3K70 D;  5DDG A;  1XN7 A;  1LDK B;  5K5R A;  1B4A A;  1GXQ A;  3OOU A;  2JSP A;  4I7H A;  5E20 A;  1JTX A;  5L3D A;  3QPT A;  2AO9 A;  3SEQ A;  2R7R A;  3AAF A;  1ZR4 A;  2A5Y B;  3REO A;  4ESB A;  4UUS A;  2R7Z J;  2ETH A;  2WBM A;  2QKL B;  1JT6 A;  2L4A A;  4XBF A;  3CJQ B;  3MKZ A;  2STT A;  4GDF A;  2EFN A;  2L9N A;  3FBI B;  1FY7 A;  4BXU A;  1T08 B;  1YLF A;  2MBF A;  3N05 A;  1HF0 A;  4I01 A;  1HCR A;  3HKZ A;  3K69 A;  5HS7 A;  5D6F A;  3U21 A;  1T98 A;  2W84 A;  3ULQ B;  4CCJ A;  1WI3 A;  2ID3 A;  3SZG A;  2A61 A;  3GUD A;  5LEJ A;  1TT0 A;  2PJR A;  2K3P A;  5AIP A;  5IYB J;  1F36 A;  1IV6 A;  4MLO A;  1E2X A;  2DXI A;  2DT7 B;  4HV5 A;  3TO9 A;  1MNM C;  2GLO A;  3FKJ A;  3S1R J;  1DUX C;  1HKT A;  1LB2 A;  2JRM A;  2JUC A;  4Q48 A;  5HLG A;  3LFU A;  3H5R A;  4FQG A;  1TP4 A;  1MBF A;  3UR3 C;  1R1T A;  2CYY A;  3ASN H;  2DN0 A;  2X1E A;  2QCO A;  2F2E A;  4KIG A;  3HUG A;  3HYI A;  1YW9 A;  2VI6 A;  5IYC J;  1I3A A;  1SD4 A;  1Z0X A;  3VFZ A;  4AIK A;  4E7L A;  1F4K A;  4U0V A;  4MTE A;  3F8F A;  3KX2 A;  5KNL A;  2DDB A;  4XL9 A;  2CFO A;  3K0L A;  3RCO A;  3BR1 A;  5J1U A;  3JAM Z;  2KKO A;  2DOD A;  3CJN A;  4F52 A;  3FIS A;  3WG9 A;  2RNJ A;  1HKS A;  1QZZ A;  1OMI A;  4KIB A;  2Z99 A;  4EEF G;  2M5W A;  2V9K A;  4IRG A;  3RYP A;  3U9G A;  3QYF A;  3B6A A;  1CGP A;  2HQN A;  3VYR B;  2FD5 A;  2DOF A;  2MLG A;  3HC7 A;  1T0F A;  4G7Z F;  2QEN A;  1IN4 A;  1TWG J;  2F5E A;  2W24 A;  3IH4 A;  4XKB A;  4EMS A;  2ZFW A;  4UUS B;  2HTJ A;  3K1M A;  4HX8 A;  4IRI A;  4XIC A;  1LE8 A;  2XDV A;  1KQ0 A;  3RKX A;  1G3Y A;  4KFC A;  2FA5 A;  5E17 F;  2DCE A;  2Z3Y A;  5J8F A;  1QRY A;  3M8J A;  3LAJ A;  2WAD A;  1O3Q A;  4BJ6 C;  4NC8 A;  1PYV A;  1U2W A;  2ELK A;  3R0J A;  3KYD B;  1X1D A;  5EEG A;  3UNG C;  2CJJ A;  3FF5 A;  3VDX A;  1BOA A;  4BXF A;  2DA1 A;  1RI7 A;  3B6C A;  2NVU B;  1XSV A;  4XK4 A;  2CW0 F;  1NG6 A;  1ON2 A;  4HZF A;  4BQA A;  1B8I B;  2FQ3 A;  3S3M A;  4JP0 A;  1Z3X A;  2HVQ A;  1MMA A;  1S8N A;  1ZG3 A;  3H36 A;  5FRM A;  3W3C A;  2WAQ A;  4H0E A;  4F7Z A;  2CGP A;  2E60 A;  4LB6 B;  2EQR A;  4DBQ A;  3FK6 A;  3RPQ A;  5M3F J;  2OUM A;  2RQP A;  4B48 A;  3LA2 A;  3LFK A;  3ASO H;  3AG1 H;  2HR3 A;  2O7O A;  3KLO A;  1HOM A;  2QA4 I;  2DA5 A;  1WI9 A;  1PDN C;  1LFP A;  4HLX A;  4ZDO A;  3IAS 2;  1JJ8 C;  1S7E A;  1TNT A;  1UJ8 A;  3U2R A;  4WK8 F;  3TOA A;  1XPX A;  1P4X A;  3BJ6 A;  2HZT A;  4AUX A;  2K5C A;  5KAF C;  3D1N I;  2EFP A;  1UMQ A;  4P5O A;  2B0L A;  4AYB N;  2EFQ A;  1MIJ A;  2L7K A;  3MKY B;  2OCC H;  2NOG A;  2X51 A;  3I9V 2;  3CCR I;  4D5C A;  3AL0 B;  3D0S A;  3A02 A;  1Z91 A;  4IHY A;  2R7U A;  5F1J A;  1TBX A;  2VQH A;  1B9N A;  3DKY A;  4FX4 A;  1U78 A;  3LOC A;  1NHA A;  3IKV A;  2DTR A;  1OFC X;  2LK2 A;  3G1O A;  2EK5 A;  4HOB A;  1X3Z B;  5AON A;  4LMY A;  1PUF B;  3S93 A;  1ZQ3 P;  3HPH A;  3L9F A;  3RDI A;  4BUP A;  1HW1 A;  3Q0W A;  2QM3 A;  3H0G J;  5IP7 J;  2XAH A;  4EJW A;  1XD7 A;  3ERE D;  2OF7 A;  4BBR J;  4NHJ A;  2R7X A;  2G9W A;  4GRI A;  3T8T A;  5IOZ A;  2MH2 A;  3V7S A;  3Q0U A;  2VPL A;  1F43 A;  2M1B A;  2Y31 A;  4I09 A;  1YW8 A;  2E35 A;  3DTI A;  5BPD A;  2QQB A;  2WB1 N;  1LFB A;  4F55 A;  2RDP A;  2Z5U A;  4IF4 A;  1P92 A;  4KIF A;  1J09 A;  5FFX A;  1MMG A;  1YRN A;  1SD6 A;  1UHM A;  4P9U A;  1AKH B;  1VQ5 I;  3BTC A;  5ILS A;  4HNT A;  3EUK L;  2V6E A;  3F8C A;  3MZH A;  4BQN A;  5E3O A;  4L5E A;  2R7V A;  2I5U A;  4XLH A;  3I5U A;  4PGH A;  3DFG A;  3I59 A;  3ABU A;  2OQR A;  4ZDP A;  3HSR A;  1WPK A;  1VFC A;  4XRF A;  1G2H A;  2IP2 A;  4KIT B;  4DBR A;  3K70 C;  4A93 J;  4FT8 A;  2F4M B;  4E7I A;  4KMF A;  1LUJ B;  1YE9 A;  4U0W A;  1E3O C;  2VB6 A;  3V42 A;  4QPO A;  3CUQ A;  2OQG A;  3COA C;  1WGX A;  1G4D A;  5HOO A;  5FFZ A;  3S32 A;  4E7H A;  1RR8 C;  2XAF A;  3DV8 A;  2ZFU A;  1T95 A;  2VJJ A;  3ZMT A;  5JHU A;  2M4K A;  4UUV A;  1UHW A;  1QGP A;  1RR7 A;  3RTR A;  2OV7 A;  4JX6 A;  4DZP A;  3CLO A;  5FKN A;  3ZQC A;  4ZTJ A;  2IGO A;  5IY5 H;  1RKW A;  3O6B B;  3DTK A;  1ETX A;  2Y0M A;  4PSW A;  2LR8 A;  1BA5 A;  3PUB A;  1D1C A;  1KU3 A;  3IAM 2;  1FP1 D;  4DNC A;  5J4Y A;  2UZK A;  3T8R A;  3K6G A;  5TRD A;  4G9Y A;  2LKX A;  2MA3 A;  4LIU A;  4UB8 C;  4B8X A;  1J2X A;  1A35 A;  5HOD A;  3AFH A;  4OU0 A;  1VTN C;  4MFD A;  4RA2 A;  3ECH A;  4WWC A;  2D2W A;  1Y1V J;  3EUH A;  5FLV A;  5B1B H;  2VKD A;  3RZO J;  2HQR A;  4CH7 A;  4EM0 B;  3ELK A;  3DPT A;  1U8R A;  3P5J A;  5D8L B;  3IH3 A;  2OTJ I;  2VQC A;  3OMY A;  5FB2 A;  2RN7 A;  3HOX J;  1R00 A;  2K4B A;  3HSE A;  4BU2 A;  4X1E A;  1IXC A;  2E71 A;  4F3Q A;  4Q47 A;  4L5I A;  4O5V A;  4D1Q A;  1BW5 A;  4EJO A;  3I4P A;  1STZ A;  2FBH A;  2CUE A;  3BG5 A;  3ZR8 X;  4XLA A;  1TWH J;  5HS9 A;  2Y9Y A;  2PQ8 A;  4AU7 A;  2LRD A;  4CYC A;  5K7F A;  2CG4 A;  3G3Z A;  4HYE A;  1BC7 C;  3OR2 C;  4ZYG A;  3TGN A;  4CCO A;  3NRV A;  5CQE A;  4LOC A;  4WF2 A;  3M3Y J;  2AXL A;  1EJ9 A;  1APL C;  2EIL H;  1GVD A;  3T0Y A;  1TWF J;  5JVG F;  2B63 J;  3A0H C;  1Z1D A;  1BI2 A;  4N0B A;  2CW7 A;  4JBA A;  4YFN F;  3BDD A;  4XLE A;  2FRH A;  2ZXJ A;  2WB1 A;  3VYU B;  1R5H A;  1LDJ A;  1BC8 C;  1R6R A;  2M45 A;  2M87 A;  1NG7 A;  1WQ2 A;  3H9G A;  1A6Q A;  3H5A A;  1YJN I;  4KUM A;  2A3S A;  1O3S A;  4KMU X;  3RZD J;  2FML A;  3TP3 A;  3H3Z A;  4GCV A;  4LLL A;  2ZBK A;  1ETQ A;  4D5F A;  2KDZ A;  5TJJ A;  1REP C;  2CW8 A;  1P6R A;  3J80 K;  2M0M A;  2R7F A;  4RAG A;  5DCM A;  3H3V K;  1QVU A;  1R58 A;  2WA0 A;  3LAP A;  1VQ7 I;  2AS5 F;  3QOE A;  4S0H B;  2NNY A;  2DT5 A;  1T39 A;  2J5P A;  4Y13 A;  4H4K C;  1N25 A;  1JKQ C;  3OSG A;  1EH7 A;  1L0O C;  2VBW A;  4IKF A;  4G7O F;  1WJA A;  4ABZ A;  5LBQ A;  1B72 B;  5F27 A;  2YX7 A;  3SQN A;  4Y7N J;  2AXT C;  1LVK A;  2A69 F;  2MD0 A;  4EJT A;  3GTK J;  2HYF A;  3OYF A;  3P7N A;  1D8J A;  3CME I;  4Y15 A;  5IT9 K;  3RQ4 A;  3GTO J;  1OR7 A;  2HVR A;  3JRH A;  1M1E B;  1TNS A;  2W00 A;  5CLS A;  1Z67 A;  2M8G X;  3ISP A;  3KCC A;  4NQW B;  3GX4 X;  2FBK A;  5IT9 Z;  3AKZ A;  2IA2 A;  2E1C A;  1G6N A;  4XLF A;  3ZXS A;  5C4J J;  4LLN A;  3HPG A;  3BTL A;  2FSW A;  2GIZ A;  3G73 A;  1ZHF A;  2IGM A;  2BY2 A;  2VIX A;  4UY8 I;  2QSH X;  1SD5 A;  1LEA A;  3VYS B;  1HA8 A;  1X3W B;  3BZ6 A;  5J3L A;  1V5F A;  3PM1 A;  2E5N A;  3EYY A;  3L2C A;  3F23 A;  2CS3 A;  2EA4 A;  2KP6 A;  4KJZ A;  3F8M A;  1LNW A;  3OL4 A;  5LRS A;  4AWX B;  2M4G A;  2PMU A;  1Y8Q B;  2KIQ A;  3DU5 A;  5DD8 A;  5IOY A;  2DPD A;  1U5T A;  4A3K J;  3HOW J;  1RIO H;  4I2O A;  4CUG A;  3CCE I;  3BRO A;  3S15 J;  2P5V A;  3S2H J;  3ERM A;  1K6O A;  2IT0 A;  2KLO A;  1ONV A;  3W2V A;  5EDN A;  3L2V A;  4C2M J;  1TQM A;  1YIT I;  4D0P A;  4XRS G;  3OIQ A;  1A04 A;  1ZGW A;  5H20 A;  5F0H A;  4N9H A;  5JHF A;  2OCE A;  3CCV I;  2V1D A;  3QWL A;  4MNU A;  3F72 A;  4UVA A;  5CVR A;  5M5Y J;  1P7I A;  4U88 A;  3LA3 A;  1ZH5 A;  2KZV A;  3DEE A;  3GME A;  2K7L A;  2NRA C;  2LY2 A;  3HB9 A;  1FC3 A;  3HOT A;  5FRO A;  2QQ8 A;  3HSF A;  3K4K A;  1YIO A;  3CJR B;  1ZRD A;  1WH5 A;  3CDH A;  2R3S A;  5J40 A;  1XCV A;  4QSH A;  4MHG A;  3ZQH A;  1BBY A;  3JRF A;  1C0W A;  3DPL C;  4QWQ A;  2LLK A;  1VQ4 I;  2WTE A;  2I8D A;  1VQ9 I;  2P5L C;  2R7S A;  1FMW A;  3PNT A;  2A6H F;  1QQI A;  4BKX A;  4BDZ A;  1UG2 A;  1JKO C;  4KNY A;  2HTS A;  3NWS A;  1BN5 A;  3VOD A;  1JJ6 C;  3FXM A;  4R79 A;  5JFR A;  2OD5 A;  2XUB A;  2K9Q A;  1H88 C;  1MNE A;  4A3B J;  3LQR A;  2L5Q A;  4J01 A;  2X1D A;  3IKT A;  5EJC A;  1YI2 I;  1XX5 A;  1MH3 A;  5L3C A;  1TLH B;  4XSZ F;  1WJE A;  3J7Z I;  4HDV A;  3SJM A;  1PP7 U;  2JJ7 A;  2ISZ A;  1HDP A;  1IUF A;  4ZYH A;  2HOA A;  1XS9 A;  1TW3 A;  2H09 A;  1TT5 B;  3FDY A;  3LSI A;  4MQV A;  3NEU A;  2LP0 A;  4XSX F;  1TQP A;  1V54 H;  4EVI A;  3I71 A;  4XR6 A;  3FHZ A;  1POG A;  3A4C A;  1ETK A;  2QQ9 A;  3HRM A;  4RMN A;  4BAY A;  4AYB A;  1Z7U A;  3F9K A;  4ZC3 A;  1OR7 C;  2ME6 A;  1Z3Y A;  2TCT A;  2IXS A;  2MSY A;  1SAU A;  2NNN A;  4CCL A;  1ZKG A;  3FHN A;  2FNA A;  3HJE A;  3EQL F;  1KGS A;  4B4C A;  2ZSH B;  1KZH A;  1ON1 A;  4XN0 A;  1IGN A;  2VT3 A;  3AL0 C;  3H5N A;  1EA3 A;  1IDY A;  4XOR A;  2PMH A;  3WHC A;  3K4B A;  5IP9 J;  4B3A A;  2QQA A;  3E6C C;  2F4O B;  1LKX A;  4ENM A;  2Q0O A;  3IH2 A;  2V1X A;  2CUF A;  1OKR A;  3ZQI A;  2DOE A;  4IHS A;  3PFY A;  2R7Q A;  2EZK A;  2JPC A;  3CCS I;  4UXN A;  4G7H F;  4BHB A;  3LNQ A;  1XDS A;  3EET A;  1WZ2 A;  2H27 A;  1G3S A;  1V5G A;  3VYT B;  2JVG A;  1RUO A;  2JQ7 A;  2VJ4 A;  3CC7 I;  1F5T A;  1VQ6 I;  4HBL A;  4PZJ A;  5F0F A;  3I3L A;  3FXL A;  4B1R A;  2XRN A;  2XGD A;  1U9N A;  2IS4 A;  4CCM A;  1BR4 A;  3FMS A;  2RRE A;  3N97 A;  1FYM A;  2KRC A;  1HBX G;  3BPV A;  3GCM A;  3FXR A;  3HGY A;  4P55 A;  4A2U A;  3OS0 A;  4OIO F;  4LFU A;  2YX4 A;  2R4G A;  1NH3 A;  2DI3 A;  5GAD J;  4KDP A;  1S6L A;  3CD6 I;  3ESW B;  2LKS A;  1I1S A;  1WRJ A;  4A3F J;  4RB0 A;  1FEX A;  2KRH A;  2A05 A;  3CDI A;  5LFA A;  5BOX A;  4UVC A;  2LVS A;  2O5R A;  1WHU A;  3W2A A;  3I59 B;  3W2W A;  1IAW A;  1MBH A;  3JRA A;  2LRE A;  1B9M A;  2P4W A;  3GTG J;  3KZZ A;  3SDB A;  3CCQ I;  3WOD F;  3JW4 A;  3C2H A;  1VQO I;  3ZQF A;  4JK1 X;  3FK7 A;  1YRN B;  1BI1 A;  4CYD A;  2JPB A;  1H9T A;  4M3E A;  1JTY A;  4YIF A;  1UST A;  3LSP A;  2Z16 A;  5D5V B;  1T2K A;  4PJ0 C;  5CKT A;  3HBL A;  1TQI A;  3KZI C;  3V7C A;  1IO2 A;  3C3W A;  1B1B A;  2HYJ A;  1JUM A;  2BY1 A;  1HSJ A;  5EZH A;  3R60 A;  1D5Y A;  5GAH J;  1Y56 A;  3CF5 F;  1OYW A;  2F5V A;  2HOE A;  2GZW A;  2PFB A;  4HLY A;  1IUY A;  2DQR A;  2EZL A;  5BMZ A;  2R5Z A;  4IVN A;  3ZMV A;  3R61 A;  2UXX A;  3S3N A;  1FOK A;  3A01 B;  3CC2 I;  2COB A;  2BOL A;  5ICG A;  2K9M A;  3S1Q J;  1J9I A;  1X1P A;  4RAY A;  2WAQ N;  5KCM A;  2HKO A;  2OJE D;  2M0C A;  3OYE A;  1XC5 A;  2WC2 A;  2IA1 A;  5ICF A;  2IS2 A;  2Y2Z A;  4G12 A;  3GTJ J;  5LGU A;  1ZRE A;  1GDT A;  3TQN A;  5DCM B;  1R9T J;  3LST A;  4MQ9 F;  1IW7 F;  3L1P A;  1ZLK A;  2ELH A;  1NTC A;  2VOO A;  1FT9 A;  5HNF A;  2LSO A;  5JVT A;  1CQT A;  1PJR A;  2ZSI B;  4AID A;  2QBY B;  2BV6 A;  3LSK A;  3ABM H;  4OIP F;  2H8W A;  3ZN0 A;  3G1M A;  1P4A A;  1UCR A;  1D8K A;  1WFX A;  2QSG X;  3SZT A;  3WTV C;  2LD5 A;  1W1W E;  2F48 A;  3MVP A;  2FOK A;  2V79 A;  2ADU A;  2A5W A;  2ID6 A;  3TP0 A;  4L18 B;  2LH9 A;  2QGU A;  3LWF A;  1OYI A;  1GLN A;  2HKX A;  4KN4 X;  4IX7 A;  1YHQ I;  2L01 A;  1V55 H;  3OIP A;  5IYD J;  2ZJR F;  2A6T A;  2K02 A;  4JX4 A;  1FP2 A;  2JWT A;  4GYI A;  1SVM A;  2FMY A;  5KHD A;  3ABK H;  4G6D A;  3LQQ A;  4MTD A;  5CVV A;  1FTT A;  3F8B A;  4Q5S F;  3PQK A;  3ZGK A;  4HF0 A;  2L4M A;  3WTX C;  3I4N J;  3Q9V A;  1FWZ A;  2VE9 A;  1W36 C;  4EJU A;  4EQQ A;  2HXO A;  1AA7 A;  1U5T C;  5M3M J;  2GXB A;  2YUS A;  2GXA A;  1R23 A;  2DA6 A;  2NVX J;  3I0T A;  3AG2 H;  1SFU A;  3ZCO A;  3DP7 A;  2EV6 A;  3M9A A;  2LBF A;  1J75 A;  2E2J J;  1BR2 A;  2HXI A;  3L00 A;  4DOZ A;  1K83 J;  3PNV A;  4XOP A;  3FMR A;  2I10 A;  1KQ9 A;  3BLY A;  3M4O J;  2MLK A;  1S5L C;  3C2B A;  2XAJ A;  5GPA A;  3S17 J;  4M9X A;  1IV8 A;  2LTP A;  2VJI A;  1MH4 A;  1J5Y A;  4ZDL A;  2ZB9 A;  3M7G A;  1QHG A;  3E6B A;  4GXO A;  1LE8 B;  2DMT A;  3CJT B;  3QP5 A;  5LLQ A;  3OYC A;  3HXL A;  5BNG A;  3QYE A;  2HNH A;  3PUF A;  3WTS C;  3WGI A;  1Y6I A;  4M73 A;  4DJA A;  1U8B A;  3HKZ N;  2P0W A;  2Y75 A;  1E17 A;  2Y48 A;  1D0X A;  2X6W A;  3CMM A;  3KEO A;  4XKV A;  1Z21 A;  5CVU A;  2FOW A;  1IN5 A;  3A0B C;  1R5G A;  5GTH C;  2EH3 A;  1RRJ A;  2GOM A;  3JCU C;  3OS2 A;  4Y4R A;  2K86 A;  3BG7 A;  5E8I A;  4OAY A;  3KEQ A;  1KQ8 A;  2E7W A;  3BR5 A;  4PJL A;  5D5W B;  5FLX Z;  5JR3 A;  1WVR A;  1EF4 A;  3M07 A;  3B02 A;  3CO7 C;  2A68 F;  2DTZ A;  1T56 A;  5EYR A;  5D8K B;  1G8X A;  2DBB A;  2XGE A;  4C9Y A;  1P9Q C;  5BS6 A;  5J1R A;  2EFW A;  3FIW A;  4ESF A;  5L3F A;  4Z6Y A;  2HOS A;  3BG3 A;  2H6C A;  3BWG A;  1KON A;  5KVR A;  4L9N A;  3JRB A;  4Q4Z F;  5HS8 A;  4RLQ A;  2X85 A;  4AM3 A;  5BPI A;  3EPZ A;  1HQC A;  1JGS A;  1KYZ A;  2JZY A;  3OR1 C;  3KE2 A;  1USS A;  3OYD A;  2OA4 A;  2DOA A;  3GWZ A;  4XLN F;  4MEY F;  2P81 A;  4RS8 A;  3P9K A;  1FOY A;  2XAQ A;  5E3L A;  1A36 A;  1VQL I;  1W5S A;  3GLX A;  1DQU A;  3D5S C;  1XSD A;  2GAU A;  1F9N A;  1SAN A;  5ILV A;  4A3C J;  1OQY A;  5K7H A;  1Z9C A;  1I27 A;  2LOO A;  2W82 A;  4EM2 A;  2NVY J;  4ZZD A;  2ZNY A;  1UB9 A;  3OOP A;  5KAI C;  3OYG A;  4O6J A;  1N75 A;  3J81 Z;  5CPR B;  2O03 A;  3U1K A;  1ZG1 A;  2BZT A;  1SMY F;  2HPI A;  3PSF A;  3KLN A;  2O3F A;  3K4L A;  4RB3 C;  2XGC A;  2P7C B;  1O3R A;  1X1C A;  3DKW A;  2STW A;  4A6D A;  1UZC A;  4HNV A;  5C44 J;  1FBQ A;  2VT2 A;  5HDN A;  3FXJ A;  4OIQ F;  3L7W A;  3OYM A;  4NC7 A;  2IGK A;  2H8R A;  1X1B A;  3BJA A;  3S2D J;  1X1A A;  1IN6 A;  4N4O B;  4CXF A;  2JA2 A;  5FKM A;  2E36 A;  4J00 A;  2F5D A;  2MFZ A;  2F4I A;  5K7Z A;  2CUZ A;  1ODD A;  3S2W A;  4G6T B;  4PJM A;  1KU7 A;  2XAU A;  1FMV A;  4AC0 A;  4B47 A;  5D5X B;  4X0G A;  3RI4 A;  1JHF A;  4LG0 A;  1R71 A;  5LRR A;  2EFO A;  2DMU A;  3QPL A;  3MMY B;  2DK8 A;  3T5X A;  4U7D A;  1A6I A;  1FSE A;  2JT1 A;  4ZYA A;  4KN7 X;  3PNY A;  3DXJ F;  1T6S A;  3W6J B;  3ZQQ A;  2XGX A;  4W97 A;  2W48 A;  1V4R A;  4KT5 C;  3IRQ A;  3GEZ A;  2ZXH A;  3JTG A;  3KP3 A;  5LHG A;  3CO6 C;  2EWN A;  4IQ4 A;  2HEO A;  3ML6 A;  3F21 A;  2M7B A;  1I39 A;  4YIR X;  2OPT A;  1U9O A;  1SFE A;  3K10 A;  2O0Y A;  2VOP A;  4ZZL A;  3HOZ J;  3WU0 A;  3HG9 A;  4ETS A;  1YFH A;  5FKL A;  2GA2 A;  5ILU A;  1HC8 A;  3OY9 A;  3ZMZ A;  1BIB A;  2ESN A;  3ONQ A;  1JKP C;  1E0E A;  3BCA A;  2CFX A;  2ZCW A;  4EM1 A;  4TV7 A;  1IDZ A;  1VZ0 A;  4MFE A;  1YYV A;  4II2 A;  2K9L A;  3JRE A;  5HLT A;  1MSF C;  4ON0 A;  1MND A;  2J5O A;  2DO7 A;  2P5K A;  3VB2 A;  2ZKZ A;  3HOS A;  3JSP A;  1T33 A;  2MC4 A;  4M3G A;  1SD7 A;  4GGG A;  4YEL A;  4E7S A;  4F93 B;  2DU9 A;  2LC2 A;  4XQF A;  1S3J A;  1SFK A;  2DA4 A;  3LA7 A;  2Y30 A;  3E5Q A;  2Z1D A;  2BBY A;  3HEF A;  2L9V A;  3K4M A;  2MH9 A;  2FE3 A;  1EKE A;  2CO5 A;  4M6Y A;  2IA0 A;  4IPA A;  2BHY A;  3CP8 A;  3JRC A;  3NAR A;  4BQQ A;  2V9P A;  1WCM J;  2VKH A;  3QQA A;  4A12 A;  1ZYR F;  3L2W A;  3GVA A;  3WGG A;  2CRG A;  2PJP A;  5EGO A;  1JT0 A;  2DPU A;  1Z6R A;  2KPM A;  2Q2E B;  5ICE A;  3CQZ J;  2M3A A;  1SVO A;  3K2Z A;  2L7Z A;  4E6K G;  3PIP F;  2F5C A;  4XM3 A;  2IPQ X;  2E1M C;  2EZI A;  3HM5 A;  4LGW A;  3G6E I;  1OLT A;  1W7P D;  4A0X A;  2CQ7 A;  1JI8 A;  2M8E A;  2IRF G;  2WY8 Q;  4EGY A;  4EGZ A;  3KP4 A;  1GT0 C;  1JKR C;  2JA6 J;  3GTM J;  2PMZ N;  2NS8 A;  2UXN A;  3O3K A;  4FHT A;  3LMM A;  1W0U A;  1DGR M;  3HOU J;  3M1E A;  4WXD A;  3FXO A;  1DP3 A;  1QO0 D;  2DK5 A;  1BJZ A;  1L3L A;  2JA7 J;  2JA8 J;  2MAB A;  3CCY A;  2FF4 A;  2L3D A;  5H6Q A;  2R7O A;  1A31 A;  4A5N A;  2V7F A;  4ENN A;  1IF1 A;  1W4M A;  1LJ9 A;  1WJD A;  2KJC A;  4ZH4 F;  2H1K A;  2AQF A;  3KEY A;  4CCK A;  2Y69 H;  1Z7L A;  5CQG A;  2CWE A;  2GBY A;  3EYI A;  4I98 B;  3RQI A;  3BCB A;  4E7K A;  3PO2 J;  3OL3 A;  2MGQ A;  5HDK A;  2X0L A;  3HRT A;  4M72 A;  1R5I D;  4A6E A;  5H2F C;  4PGG A;  2OAZ A;  3OYH A;  2L9R A;  2E2I J;  2HFH A;  4BHP A;  2HQ5 A;  5DTD A;  3WTW C;  3OS1 A;  4C3J J;  1QNT A;  1TW2 A;  5EZG A;  4XOT A;  5H6R A;  3HOY J;  2GXG A;  3CP2 A;  1I6H J;  3TKY A;  4FE4 A;  3C1D A;  3ZMD A;  2X9D A;  2EB7 A;  4LIT A;  3BZK A;  4PJN A;  3OSF A;  2VOD A; 
#chains in the Genus database with same CATH homology
 1HW5 A;  2YU3 A;  1ZG5 A;  3ZPL A;  2YSR A;  1XGS A;  3BPX A;  4HW0 A;  2LDU A;  1FNN A;  2RV8 A;  3HRS A;  3HHH A;  5DYM A;  4BH9 A;  1RUN A;  2MD5 A;  2XV4 S;  3GYH X;  3MFK A;  3WTT C;  2NYX A;  2BEO A;  2E7X A;  2R7D A;  2IJL A;  2RVC A;  2X4H A;  5JI6 A;  4L9J A;  3BJO A;  1JE8 A;  2QYO A;  4G6Q A;  3FXQ A;  3M8E A;  2Q8K A;  1IN7 A;  3R6S A;  4MGR A;  2PBI A;  1K79 A;  2XVC A;  1FX7 A;  1OYY A;  2L02 A;  4RGU A;  3F3X A;  1ZRF A;  2GWR A;  3DF8 A;  5E1Z B;  4OMZ A;  1KU2 A;  4I0A A;  2HDC A;  4NQW A;  3C7J A;  3I58 A;  2M30 A;  1HKQ A;  2O6G E;  3V8K A;  2QWW A;  3E6D A;  1R1V A;  5HLH A;  1IXR C;  3QU6 A;  4HV6 A;  1PP8 F;  1ZRC A;  1J59 A;  1O57 A;  1F1Z A;  3K9T A;  2ZNZ A;  5HLI A;  3FM3 A;  1W7P B;  5LHI A;  2EA2 A;  1I5Z A;  2KIU A;  2W25 A;  3C18 A;  1YS6 A;  1LVA A;  2HS5 A;  3J80 Z;  2ZME A;  2ISY A;  5D5U B;  1RNL A;  2NAZ A;  4G8X A;  2ZO4 A;  4EJV A;  3FM5 A;  3WE3 A;  3FZV A;  5DUK A;  4CDG A;  5AIQ A;  3CUO A;  4OMY A;  5F1R A;  4UVB A;  1Z05 A;  2KRF A;  3IHU A;  1O3T A;  6PAX A;  1QPM A;  5FO5 A;  5LGT A;  3HIF A;  2G7U A;  2W57 A;  3BY6 A;  3I64 A;  1XMA A;  1S7A A;  2D1H A;  5A2Q K;  3QAH A;  1X3U A;  2QVO A;  3SZP A;  3H92 A;  4YFX F;  1CF7 B;  4LJZ F;  3RYR A;  2GQQ A;  2BGC A;  2K27 A;  4UHT A;  3QP6 A;  3E97 A;  2PEX A;  3E5X A;  3GZ6 A;  1P4W A;  1GXP A;  1XCB A;  3V8J A;  1R7J A;  1J0R A;  2D1V A;  1G3W A;  1MJB A;  3I54 A;  1GHC A;  2COM A;  4HF1 A;  1ULY A;  5D6E A;  3TO7 A;  1MGT A;  4Z2Y A;  5FLX K;  3IWZ A;  1XB4 A;  4MEX F;  3MQ0 A;  3MWM A;  5LGN A;  1JHH A;  2FBI A;  1B6A A;  3QPH A;  3K1P A;  5DCF A;  1LEB A;  3IC7 A;  3ZQ7 A;  3GXO A;  1DPR A;  3TO6 A;  2P6S A;  4B09 A;  4ASN A;  5E1W A;  2CSO A;  1KA8 A;  1DDN A;  4M9Z A;  3EDP A;  2PI0 A;  3TDZ C;  5FD6 A;  2HYG D;  4P9F A;  2O61 A;  2WWY A;  2C6Y A;  3DEU A;  4L9T A;  2V1U A;  1R1U A;  4HX7 A;  2QUF A;  2XKO A;  1MDM A;  1DPU A;  4FX0 A;  3ZMS A;  3B73 A;  3FXU A;  4OIN F;  1D5V A;  1Q1H A;  4BHC A;  2LF7 A;  2P7V B;  1XGO A;  1IRF A;  3MZY A;  4EV0 A;  1I1G A;  4I02 A;  3K1N A;  2GA1 A;  3TOB A;  4U0Y A;  4BYY A;  5E18 F;  4P96 A;  5ED4 A;  1KYW A;  3ZN1 A;  4XLP F;  3RJP A;  1AWC A;  4LK0 F;  1SFX A;  5D4R A;  1MJA A;  4OOI A;  2A07 F;  4IXA A;  1KU9 A;  2BYV E;  5HVQ C;  3KP7 A;  3SXY A;  2PG4 A;  2V6C A;  2VBX A;  1FBU A;  4AVP A;  1FYL A;  1EH8 A;  1K78 B;  3GO5 A;  1YQA A;  3BP8 A;  3SFZ A;  4L0Z B;  3O2P E;  4JQF A;  3MCZ A;  2YPR A;  1YO5 C;  3BOQ A;  2L54 A;  2P6T A;  4WXH A;  3U1D A;  2JSC A;  1HST A;  1XMK A;  5DV5 A;  4M9S A;  1WSU A;  2RC4 A;  1I6X A;  4U7B A;  3M8F A;  4GO1 A;  3W6K B;  5CYV A;  2OZ6 A;  1SAX A;  2HWV A;  5F6F A;  4A0Z A;  3WU1 B;  3WTU C;  3E5U A;  3TDU C;  1J7K A;  3Q5F A;  1FYK A;  1OPC A;  5KK1 A;  1EH6 A;  2JRT A;  1P2F A;  3JAM K;  4ESJ A;  3V8L A;  4ENK A;  4AIH A;  4YG2 F;  1H0M A;  4L5J A;  2LKP A;  1V3F A;  4UNO A;  4Y17 A;  3MEX A;  2HGC A;  3GFL A;  1DP7 P;  2VBY A;  4L9V A;  1IXS B;  3F6O A;  3ABT A;  3KZY A;  4N9I A;  1YS7 A;  4QLC U;  2FEZ A;  2DW4 A;  1S29 A;  3V7R A;  3GZ5 A;  2XKP A;  4GYG A;  3HTU A;  4S05 A;  1O7F A;  1XSX A;  2JTV A;  1IRG A;  4M71 A;  5DEQ A;  2G7H A;  4ZYD A;  2EV0 A;  4PCQ A;  5FD5 A;  3OV8 A;  5F64 A;  3KP6 A;  4YFK F;  2LNB A;  2ACJ A;  3CTA A;  2FU4 A;  3SHF A;  3KP2 A;  4BNC A;  5ERI A;  1YTY A;  4CGZ A;  5CVI A;  5BQT A;  1FPQ A;  4RGS A;  1LQ1 A;  1XGM A;  1BI0 A;  4WX9 A;  1K7A A;  4G94 A;  1ZAR A;  2Z33 A;  1W5T A;  4LK1 F;  3NQO A;  1B59 A;  1ZN2 A;  2VE8 A;  1U5T B;  2VBZ A;  5DUI A;  1CF7 A;  4HQM A;  5EEH A;  2NS0 A;  2OZU A;  3D5L A;  4LLG F;  3HRU A;  3JSO A;  1K78 A;  3Q9S A;  3WE2 A;  4KA4 A;  4ENJ A;  2W85 A;  3I53 A;  3E6M A;  4S04 A;  5L3E A;  1H9G A;  2KIM A;  5E1X A;  3QOP A;  4A0Y A;  2D45 A;  4A5M A;  5DD4 A;  3VEP A;  3R4K A;  4RGR A;  2ZME B;  1U6G A;  2KJB A;  5IT3 A;  5FGM A;  2PLY A;  4CHU A;  1Y0U A;  4YII A;  4OIR F;  1SMT A;  1RZ4 A;  3J81 K;  1U3E M;  3R0A A;  5HDG A;  1MD0 A;  2FNP A;  4LB5 A;  1MDM B;  2VON A;  2CQK A;  2QLZ A;  2BE5 F;  1HXD A;  3JTH A;  3MAJ A;  3DQV C;  2VN2 A;  2XHK A;  3P9C A;  3PFI A;  1BI3 A;  5L3G A;  2H94 A;  1BJA A;  1YG2 A;  4HA8 A;  1Z6T A;  3WTY C;  4KIC A;  2YR2 A;  4HF2 A;  2K4J A;  4CO8 A;  2KIF A;  3L09 A;  3GFI A;  5CVJ A;  2GIV A;  3PQJ A;  1G3T A;  4PDK A;  3GFM A;  3T1B A;  2XIG A;  4M74 A;  3RKY A;  2O8X A;  1WKM A;  2TDX A;  2XRO A;  1MJ9 A;  1XGN A;  3RKW A;  1AOY A;  2XAG A;  3IWF A;  3KP5 A;  4UV9 A;  3WTZ A;  1R36 A;  1QZY A;  5L3B A;  4WCG A;  5CJ9 A;  5K5O A;  3P9I A;  3V4G A;  2LF8 A;  4CZZ A;  3FMQ A;  3KFW X;  1FBS A;  4RAZ A;  1FZP B;  4RGX A;  5J6X A;  3CUQ B;  2QZ8 A;  3ECO A;  1HW2 A;  3J7A O;  4AD9 A;  3ROU A;  5K5Q A;  2RKH A;  4HX4 A;  1IN8 A;  1YW7 A;  4LD5 A;  5LHH A;  4ZYE A;  2OBP A;  2F5F A;  1FSH A;  2IVM A;  1O7L A;  5K1Y A;  4E70 A;  4WXC A;  2VXZ A;  4KYW A;  5D4S A;  1UFM A;  3FX3 A;  3WGH A;  1ZGA A;  2OU2 A;  4R8H A;  3H3U A;  3KET A;  2V9V A;  2A6E F;  1FLI A;  5LEK A;  4O3M A;  1JXS A;  2H6B A;  1EV7 A;  2Z9O A;  1BIA A;  1BM9 A;  4CIC A;  2QBY A;  3RIR A;  1S7O A;  1WWX A;  3ZMU A;  1W7P A;  4K2E A;  1QBJ A;  3IRR A;  4R1H A;  4DQ2 A;  1MKM A;  2Q2E A;  4HDU A;  2RGV A;  1ZAO A;  3GF2 A;  2DFI A;  2IW5 A;  4IJA A;  3F8N A;  3E3V A;  2XAS A;  3VOE A;  1D3Y A;  2E1N A;  3F22 A;  3CUQ C;  1GVJ A;  1ZLJ A;  2UWM A;  1T38 A;  1LDD A;  5E8G A;  3N4M A;  1R22 A;  3GFJ A;  3ZP5 A;  4IHT A;  4RB1 A;  2PN6 A;  1TTY A;  4IRH A;  3F6V A;  4I0B A;  3HHG A;  4UV8 A;  2ZJ2 A;  5A2Q Z;  4L0Y B;  2P8T A;  3IL2 A;  3QRF F;  2MC3 A;  4RB2 C;  5J8C A;  1MZB A;  2ESH A;  2VC0 A;  2VC1 A;  3GW2 A;  3RPU A;  1IZ1 A;  2EJR A;  2EV5 A;  4NB5 A;  4HQE A;  4HAM A;  4AIJ A;  4M6X A;  2FXA A;  1XDU A;  2DLL A;  1ZGJ A;  1PUE E;  3FWE A;  4LG0 B;  2WV0 A;  3HTS B;  3QU3 A;  2DQL A;  2DAO A;  5ICC A;  5DDG A;  1XN7 A;  1LDK B;  5K5R A;  1B4A A;  1GXQ A;  4I7H A;  5E20 A;  5L3D A;  3QPT A;  3AAF A;  2A5Y B;  3REO A;  4ESB A;  2ETH A;  2L4A A;  4XBF A;  2STT A;  2EFN A;  1FY7 A;  4BXU A;  2MBF A;  1YLF A;  4I01 A;  3K69 A;  5HS7 A;  5D6F A;  1T98 A;  2W84 A;  3ULQ B;  2A61 A;  3GUD A;  5LEJ A;  5AIP A;  1E2X A;  4HV5 A;  3TO9 A;  1DUX C;  1HKT A;  1LB2 A;  4Q48 A;  5HLG A;  1R1T A;  2CYY A;  2F2E A;  4KIG A;  3HUG A;  3HYI A;  1YW9 A;  4AIK A;  1SD4 A;  3VFZ A;  1F4K A;  4U0V A;  4MTE A;  3F8F A;  3K0L A;  3JAM Z;  2KKO A;  3CJN A;  3WG9 A;  2RNJ A;  1HKS A;  1QZZ A;  1OMI A;  4KIB A;  2Z99 A;  2M5W A;  4IRG A;  3RYP A;  3U9G A;  1CGP A;  2HQN A;  2MLG A;  4G7Z F;  1T0F A;  2QEN A;  1IN4 A;  2F5E A;  2W24 A;  4EMS A;  2ZFW A;  2HTJ A;  3K1M A;  4HX8 A;  4IRI A;  1KQ0 A;  3RKX A;  1G3Y A;  4KFC A;  2FA5 A;  5E17 F;  2Z3Y A;  5J8F A;  3LAJ A;  1O3Q A;  1U2W A;  3R0J A;  5EEG A;  3FF5 A;  1BOA A;  1RI7 A;  1XSV A;  2CW0 F;  1ON2 A;  4HZF A;  4BQA A;  2FQ3 A;  1ZG3 A;  1S8N A;  4H0E A;  2CGP A;  4F7Z A;  4LB6 B;  3RPQ A;  2RQP A;  3LA2 A;  3LFK A;  2HR3 A;  3KLO A;  1WI9 A;  1PDN C;  4HLX A;  1TNT A;  3U2R A;  4WK8 F;  3TOA A;  1P4X A;  3BJ6 A;  2HZT A;  2EFP A;  4P5O A;  2B0L A;  2EFQ A;  3D0S A;  1Z91 A;  1TBX A;  1B9N A;  4FX4 A;  1U78 A;  1NHA A;  3IKV A;  2DTR A;  2EK5 A;  4HOB A;  5AON A;  4LMY A;  3L9F A;  3RDI A;  1HW1 A;  2QM3 A;  2XAH A;  4EJW A;  1XD7 A;  3ERE D;  4NHJ A;  2G9W A;  3T8T A;  2MH2 A;  3V7S A;  2M1B A;  4I09 A;  1YW8 A;  5BPD A;  2QQB A;  2RDP A;  2Z5U A;  4IF4 A;  1P92 A;  4KIF A;  5FFX A;  1SD6 A;  1UHM A;  4P9U A;  5ILS A;  3F8C A;  3MZH A;  3I5U A;  4PGH A;  3DFG A;  3I59 A;  3ABU A;  2OQR A;  3HSR A;  4XRF A;  2IP2 A;  4FT8 A;  4KMF A;  4U0W A;  3CUQ A;  2OQG A;  3COA C;  1G4D A;  5HOO A;  5FFZ A;  2XAF A;  3DV8 A;  3ZMT A;  5JHU A;  4UUV A;  1UHW A;  1QGP A;  3RTR A;  3CLO A;  3O6B B;  2Y0M A;  1KU3 A;  1FP1 D;  4DNC A;  2UZK A;  3T8R A;  5TRD A;  4G9Y A;  2MA3 A;  4B8X A;  1J2X A;  4OU0 A;  1VTN C;  3ECH A;  4WWC A;  2D2W A;  3EUH A;  2HQR A;  4EM0 B;  3ELK A;  3DPT A;  1U8R A;  5D8L B;  5FB2 A;  2RN7 A;  1R00 A;  2K4B A;  3HSE A;  1IXC A;  4Q47 A;  4L5I A;  4O5V A;  4EJO A;  3I4P A;  2FBH A;  1STZ A;  5HS9 A;  2PQ8 A;  2CG4 A;  3G3Z A;  4HYE A;  1BC7 C;  4ZYG A;  3TGN A;  3NRV A;  4WF2 A;  2AXL A;  3T0Y A;  1Z1D A;  1BI2 A;  4N0B A;  4JBA A;  4YFN F;  3BDD A;  2FRH A;  2ZXJ A;  1R5H A;  1LDJ A;  1BC8 C;  2M45 A;  2M87 A;  1WQ2 A;  4KUM A;  2A3S A;  1O3S A;  4KMU X;  2FML A;  3H3Z A;  4GCV A;  4LLL A;  2ZBK A;  5TJJ A;  1REP C;  1P6R A;  3J80 K;  2R7F A;  5DCM A;  1R58 A;  3LAP A;  2AS5 F;  2NNY A;  2DT5 A;  1T39 A;  2J5P A;  4Y13 A;  1EH7 A;  1L0O C;  2VBW A;  4G7O F;  5LBQ A;  2YX7 A;  3SQN A;  2A69 F;  4EJT A;  2HYF A;  3P7N A;  1D8J A;  4Y15 A;  5IT9 K;  1OR7 A;  1TNS A;  5CLS A;  3ISP A;  3KCC A;  3GX4 X;  2FBK A;  5IT9 Z;  2IA2 A;  2E1C A;  1G6N A;  4LLN A;  2FSW A;  3G73 A;  1ZHF A;  1SD5 A;  1LEA A;  3BZ6 A;  3EYY A;  3L2C A;  3F23 A;  2EA4 A;  3F8M A;  1LNW A;  5LRS A;  4AWX B;  2PMU A;  5DD8 A;  2DPD A;  1U5T A;  1RIO H;  4I2O A;  3BRO A;  2P5V A;  1K6O A;  2IT0 A;  1ONV A;  1TQM A;  4D0P A;  1A04 A;  5H20 A;  4N9H A;  2V1D A;  4MNU A;  3F72 A;  4UVA A;  5CVR A;  4U88 A;  3LA3 A;  1ZH5 A;  2K7L A;  2NRA C;  1FC3 A;  3HOT A;  3HSF A;  1YIO A;  1ZRD A;  3CDH A;  2R3S A;  1XCV A;  4MHG A;  1C0W A;  1BBY A;  3DPL C;  4QWQ A;  2WTE A;  2P5L C;  2A6H F;  1QQI A;  4KNY A;  2HTS A;  1BN5 A;  3VOD A;  4R79 A;  5JFR A;  2OD5 A;  2XUB A;  3LQR A;  3IKT A;  5L3C A;  1TLH B;  4XSZ F;  4HDV A;  1PP7 U;  2ISZ A;  4ZYH A;  1TW3 A;  2H09 A;  4MQV A;  3NEU A;  4XSX F;  1TQP A;  4EVI A;  3I71 A;  3FHZ A;  2QQ9 A;  3HRM A;  4BAY A;  1Z7U A;  2NNN A;  2FNA A;  3EQL F;  1KGS A;  1ON1 A;  2VT3 A;  2PMH A;  3E6C C;  2QQA A;  4ENM A;  2Q0O A;  2V1X A;  1OKR A;  4IHS A;  2JPC A;  4UXN A;  4G7H F;  4BHB A;  1XDS A;  3EET A;  2H27 A;  1G3S A;  1RUO A;  1F5T A;  4HBL A;  4PZJ A;  2XRN A;  3FMS A;  3N97 A;  1FYM A;  1HBX G;  3BPV A;  3FXR A;  4P55 A;  4A2U A;  4OIO F;  4LFU A;  2YX4 A;  2DI3 A;  4KDP A;  1S6L A;  1I1S A;  1WRJ A;  4RB0 A;  5BOX A;  4UVC A;  3I59 B;  1IAW A;  1B9M A;  2P4W A;  3KZZ A;  3WOD F;  3JW4 A;  4JK1 X;  1BI1 A;  4CYD A;  2JPB A;  1H9T A;  4YIF A;  1UST A;  5D5V B;  1T2K A;  1TQI A;  3V7C A;  3C3W A;  1B1B A;  1HSJ A;  3R60 A;  1OYW A;  2HOE A;  2GZW A;  2PFB A;  4HLY A;  1IUY A;  2DQR A;  5BMZ A;  4IVN A;  3ZMV A;  3R61 A;  2UXX A;  1FOK A;  5ICG A;  1J9I A;  4RAY A;  2HKO A;  2WC2 A;  2IA1 A;  5ICF A;  5LGU A;  1ZRE A;  3TQN A;  5DCM B;  3LST A;  4MQ9 F;  1IW7 F;  1ZLK A;  2ELH A;  2VOO A;  1FT9 A;  2LSO A;  5JVT A;  2QBY B;  2BV6 A;  4OIP F;  3ZN0 A;  1P4A A;  1UCR A;  1D8K A;  3SZT A;  3WTV C;  2FOK A;  2V79 A;  2ADU A;  4L18 B;  3LWF A;  1OYI A;  2HKX A;  4KN4 X;  2L01 A;  2K02 A;  1FP2 A;  4GYI A;  2FMY A;  4G6D A;  3LQQ A;  4MTD A;  5CVV A;  3F8B A;  4Q5S F;  3PQK A;  4HF0 A;  2L4M A;  3WTX C;  3Q9V A;  1FWZ A;  2VE9 A;  4EJU A;  4EQQ A;  1U5T C;  2GXB A;  1R23 A;  3I0T A;  1SFU A;  3DP7 A;  2EV6 A;  3M9A A;  1J75 A;  3L00 A;  3FMR A;  1KQ9 A;  2MLK A;  2XAJ A;  4M9X A;  1J5Y A;  3M7G A;  4GXO A;  3E6B A;  3QP5 A;  5LLQ A;  3WTS C;  3WGI A;  4M73 A;  2Y75 A;  1E17 A;  2Y48 A;  3KEO A;  5CVU A;  1IN5 A;  1R5G A;  2K86 A;  5E8I A;  3KEQ A;  1KQ8 A;  2E7W A;  5FLX Z;  5D5W B;  5JR3 A;  3B02 A;  3CO7 C;  2A68 F;  5D8K B;  2DBB A;  5BS6 A;  2EFW A;  5L3F A;  4ESF A;  2H6C A;  3BWG A;  5KVR A;  4L9N A;  4Q4Z F;  5HS8 A;  5BPI A;  1HQC A;  1JGS A;  1KYZ A;  2JZY A;  3KE2 A;  1USS A;  2OA4 A;  3GWZ A;  4XLN F;  4MEY F;  4RS8 A;  3P9K A;  2XAQ A;  1W5S A;  3GLX A;  1XSD A;  2GAU A;  1F9N A;  5ILV A;  1Z9C A;  1I27 A;  4EM2 A;  4ZZD A;  2ZNY A;  1UB9 A;  3OOP A;  4O6J A;  3J81 Z;  2O03 A;  1ZG1 A;  1SMY F;  3KLN A;  2O3F A;  4RB3 C;  2P7C B;  1O3R A;  2STW A;  3DKW A;  4A6D A;  1FBQ A;  2VT2 A;  5HDN A;  4OIQ F;  3L7W A;  3BJA A;  1IN6 A;  4CXF A;  2F5D A;  1ODD A;  3S2W A;  1KU7 A;  5D5X B;  3RI4 A;  1JHF A;  4LG0 A;  5LRR A;  2EFO A;  3T5X A;  2DK8 A;  4U7D A;  1FSE A;  2JT1 A;  4KN7 X;  3DXJ F;  1T6S A;  3W6J B;  2XGX A;  1V4R A;  4KT5 C;  3IRQ A;  3GEZ A;  3JTG A;  3KP3 A;  5LHG A;  3CO6 C;  2EWN A;  2HEO A;  3ML6 A;  3F21 A;  1SFE A;  2O0Y A;  2VOP A;  4ZZL A;  3WU0 A;  4ETS A;  1YFH A;  2GA2 A;  5ILU A;  3ZMZ A;  1BIB A;  2ESN A;  2CFX A;  2ZCW A;  4EM1 A;  4TV7 A;  1YYV A;  4ON0 A;  2J5O A;  2DO7 A;  2P5K A;  3VB2 A;  2ZKZ A;  3HOS A;  3JSP A;  1SD7 A;  4GGG A;  2DU9 A;  1S3J A;  3LA7 A;  3E5Q A;  2BBY A;  2MH9 A;  2FE3 A;  2CO5 A;  4M6Y A;  2IA0 A;  4IPA A;  4A12 A;  1ZYR F;  3GVA A;  3WGG A;  2PJP A;  2DPU A;  1Z6R A;  5ICE A;  3K2Z A;  2F5C A;  2IPQ X;  4LGW A;  1W7P D;  4A0X A;  2M8E A;  2IRF G;  4EGY A;  4EGZ A;  3KP4 A;  4FHT A;  2UXN A;  3O3K A;  3M1E A;  4WXD A;  1QO0 D;  2DK5 A;  1L3L A;  2FF4 A;  2L3D A;  5H6Q A;  4A5N A;  1IF1 A;  4ENN A;  1W4M A;  1LJ9 A;  4ZH4 F;  2KJC A;  2CWE A;  3EYI A;  4I98 B;  5HDK A;  2X0L A;  3HRT A;  4M72 A;  4A6E A;  4PGG A;  2OAZ A;  2HFH A;  4BHP A;  3WTW C;  1QNT A;  1TW2 A;  5H6R A;  2GXG A;  3TKY A;  3C1D A;  3ZMD A;  2EB7 A;  2VOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...