4HDUA

Crystal structure of s. pombe atl1 in complex with damaged dna containing 2-aminopurine
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyltransferase-like protein 1
publication title Alkyltransferase-like protein (Atl1) distinguishes alkylated guanines for DNA repair using cation-{pi} interactions.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hduA00
2FXAA 4ASNA 5CVIA 2QQ9A 3J80K 1ZRFA 4DNCA 4I7HA 5AIQA 2IRFG 3KLNA 2DPUA 3E97A 3LAPA 4Q48A 1X3UA 4CDGA 1RNLA 3F8FA 3O6BB 3J80Z 3WTWC 2QYOA 1HKTA 3HYIA 3KEOA 4M6YA 1HW5A 3RYPA 1HBXG 1GVJA 2EFOA 3BWGA 2NRAC 3ULQB 3IKTA 1JHFA 1F5TA 5DUIA 3I5UA 4XSZF 2VOOA 5L3DA 5E1XA 5FD6A 5LGNA 3P7NA 1V4RA 1CF7B 4HX7A 1OR7A 4G94A 4LB5A 2ZNZA 2Z5UA 1Z91A 2R3SA 1Q1HA 4M9XA 4XLPF 1BM9A 4HAMA 3TDZC 3HRUA 2OZ6A 1EH8A 3I59A 3GLXA 4LD5A 3MQ0A 3RDIA 3E6MA 4OOIA 1AOYA 1P92A 1MZBA 2D1HA 2GZWA 1R00A 2KRFA 3RIRA 3L00A 1CGPA 3SFZA 1W7PB 2A07F 1JGSA 2XVCA 3DEUA 2CGPA 2DQLA 1FWZA 3N4MA 1K7AA 2DO7A 3KP2A 2STTA 4E70A 1R1TA 1U5TA 3ISPA 4BYYA 4EJUA 4CGZA 2J5OA 4UUVA 3CUQA 4MHGA 4MGRA 2F5EA 2XUBA 1T38A 4M9SA 1MD0A 2BV6A 2BBYA 5HLIA 2PFBA 1XGOA 5J8CA 1R5GA 1SD7A 3TOAA 5BQTA 1A04A 2IP2A 2Z99A 3JW4A 2V1UA 5H6RA 2CQKA 5LGTA 3GUDA 1L0OC 3E5UA 5FD5A 3T0YA 3PFIA 3HHHA 4WK8F 3G73A 3F8MA 1ZN2A 1G4DA 1H0MA 4L9VA 1IUYA 1RI7A 3I4PA 3KFWX 2CO5A 4LB6B 2HTSA 4HV5A 5D5XB 3I64A 3HOSA 4ZYGA 3ROUA 5AIPA 1DUXC 1R23A 2PBIA 3D0SA 3H3ZA 4IJAA 2IA2A 2F5DA 5E20A 3N97A 2FU4A 5AONA 4AVPA 2D2WA 3K0LA 1EV7A 2TDXA 4G6DA 3M8FA 1ZG3A 3WTYC 3L7WA 2HR3A 3O3KA 3ZMUA 1BIAA 1O57A 5FGMA 2Z33A 2VBZA 2CWEA 5JI6A 3HRTA 2HEOA 2KKOA 3S2WA 3NRVA 5D8KB 2X4HA 4U0VA 4GYGA 1QBJA 3EQLF 4R8HA 5EEGA 2E1NA 4IPAA 1T39A 4LLNA 4MNUA 3M9AA 4LK1F 1LNWA 2LF8A 2EA2A 2XKOA 4RB2C 2G9WA 2DAOA 3PQKA 4UHTA 5CVUA 4BQAA 2B0LA 1OMIA 2QVOA 3DV8A 5L3EA 1U78A 1O7FA 3FMQA 4PCQA 2KIUA 4K2EA 2PJPA 1J7KA 2ESHA 1MJBA 2K86A 2V9VA 5FFXA 2K02A 4QWQA 1HSJA 4N9HA 2M30A 3C7JA 4WF2A 3FWEA 3R4KA 1T2KA 4Q47A 2R7DA 1FSEA 2EV5A 3C18A 3EETA 1S7OA 4O6JA 1FBSA 2YX7A 3R60A 3TO6A 1WQ2A 2MD5A 1J59A 3LQQA 2W57A 1GXQA 3C1DA 1MDMB 3ZN1A 1O3QA 5H6QA 2XAJA 5LBQA 5HS9A 4B8XA 4XBFA 2WC2A 4LG0B 1BIBA 1BI0A 3F6OA 1QNTA 5D5WB 4S05A 2P5KA 3FXQA 2FEZA 5BS6A 1R5HA 1O3TA 3IWFA 4P96A 2W25A 2ETHA 5LHGA 1DPUA 1XSDA 2EV0A 1ZRCA 3MCZA 1IF1A 3ELKA 1ZG5A 4NQWA 3QU6A 4OINF 4AIHA 1R1UA 1BBYA 4HDVA 2Z3YA 4WXDA 2ZFWA 2A6EF 3V4GA 3REOA 3ZPLA 2RV8A 3WTZA 2O61A 4RS8A 1UHMA 2L4MA 4M72A 2GXBA 3HTSB 3JTGA 3J7AO 2EJRA 3DPLC 1JHHA 4L9TA 3QP5A 3V8LA 2XAFA 2V6CA 4PDKA 2A69F 4M6XA 4I2OA 4XLNF 2HDCA 4HF2A 5J8FA 2BE5F 3ABUA 2CW0F 4GXOA 1ZGJA 4RGSA 5DUKA 1HW2A 4KDPA 1HKSA 5D4SA 4L18B 2P7VB 2LDUA 2FOKA 1YQAA 1XDSA 2FMYA 1K78B 1FC3A 3DF8A 1SD6A 4A2UA 4KIBA 4KYWA 4S04A 4U7DA 3SZPA 2DU9A 1G3TA 4RAYA 3GO5A 2COMA 4ETSA 1IN5A 1QPMA 2H27A 2FSWA 4M9ZA 2OD5A 2QM3A 2Y75A 1F4KA 4KMUX 4P9UA 2EA4A 3R6SA 1YTYA 3CJNA 4U0WA 2QENA 3NEUA 3V8KA 4YFNF 2P6SA 4IRHA 3GX4X 2ZXJA 2HQRA 2HZTA 5HDKA 2HFHA 2GA1A 1P6RA 2IPQX 1ONVA 3KP7A 3V7CA 3ZMSA 2IJLA 4IRIA 4PGGA 2OA4A 2CYYA 3I58A 4HQEA 4AIKA 1FP1D 1S29A 2E7XA 3GF2A 5HOOA 4UXNA 4YG2F 5FLXK 1FLIA 1LB2A 5FO5A 4KN4X 1HQCA 3ZP5A 3HOTA 4M74A 5IT3A 3K1NA 3O2PE 5KK1A 2HQNA 2VN2A 2EV6A 1PP7U 1NHAA 4ZYEA 3I71A 3WGHA 2A3SA 4G8XA 3SHFA 5FLXZ 2EB7A 2IVMA 4EJOA 1D8KA 2GXGA 1PDNC 3TDUC 3IRQA 3OOPA 4L0ZB 3DQVC 4I0AA 2XHKA 4B09A 3LQRA 3K9TA 1YFHA 4EMSA 3BY6A 2ZNYA 5HDNA 3V7SA 5HLHA 1ZRDA 1EH6A 2HYFA 5K5QA 3EDPA 3WTSC 4NHJA 3QU3A 1WSUA 1ZHFA 5DD8A 2JPBA 3G3ZA 3FXRA 3GEZA 2RC4A 5D8LB 4OMYA 2G7UA 3GWZA 3KETA 5LLQA 2HGCA 1TNSA 2ZMEA 4A6DA 2ZO4A 1FPQA 3BZ6A 2VC1A 1FYMA 1ZARA 2H6BA 2RKHA 2Q0OA 2WV0A 3I53A 3R61A 3IWZA 1MJAA 4OIRF 1F9NA 4FX4A 1QGPA 2DLLA 2UXXA 4RGRA 5F64A 4U7BA 3F8CA 4ENJA 4EM0B 2ESNA 4BHCA 2PN6A 2A68F 2EFWA 1BI1A 1XDUA 3V7RA 2NS0A 3DKWA 1YO5C 3LFKA 1B1BA 1J5YA 3ZQ7A 4ZZLA 4EGYA 5JFRA 4EJTA 4HA8A 4PZJA 3FZVA 4KFCA 3RPQA 3VODA 4H0EA 2IW5A 2C6YA 2XROA 2LKPA 4EGZA 3BP8A 5LHHA 1U5TC 3CTAA 2E7WA 2QBYA 3FXUA 2VE8A 1Y0UA 3W6KB 3CUQC 4LGWA 3D5LA 1R36A 2LNBA 3KP4A 3ML6A 3J81K 5HS7A 3EUHA 1D5VA 3F72A 2VBXA 4L5JA 4GCVA 3ZMZA 3E6BA 3F21A 2XASA 2EFPA 1JXSA 2MH9A 5HDGA 2HS5A 3RYRA 2P6TA 1GXPA 2W84A 1G3SA 2UZKA 1LVAA 3J81Z 4HZFA 2PQ8A 1XCVA 1YIOA 3SXYA 4XRFA 2EFNA 4GO1A 2AXLA 3IKVA 4CHUA 4AWXB 2P5VA 4LMYA 2VT3A 2PMHA 2NAZA 3HSFA 3W6JB 2P4WA 1Z05A 3GFMA 5J6XA 3HUGA 4M73A 4A6EA 2PG4A 5LGUA 1Z7UA 4LLGF 5DCMB 3OV8A 4XSXF 5CLSA 2VODA 2K4JA 1ZH5A 1ZAOA 2LF7A 5LHIA 4EM1A 3HSRA 4FT8A 1LEAA 3R0JA 5L3BA 4O3MA 1YW9A 1OYWA 2HWVA 4R79A 3BJAA 1Z9CA 4EJWA 1TW2A 4HBLA 1UCRA 2DK8A 2MA3A 2YU3A 4ZYHA 3I54A 5CJ9A 4I02A 2CFXA 1TBXA 4G9YA 1IN8A 4RB0A 1R22A 5LEKA 5E8GA 1YLFA 2E1CA 3QRFF 2CSOA 1U6GA 5BPDA 2VT2A 4I98B 1EH7A 2OU2A 3M7GA 3JTHA 4F7ZA 3VFZA 1YG2A 1P4WA 4I01A 2XV4S 5BPIA 2IT0A 3GVAA 2MLKA 4MTEA 5F1RA 1XD7A 2UWMA 2A5YB 2O0YA 1KA8A 1KYWA 4EM2A 2M8EA 4IHTA 1XSVA 2FMLA 4MEXF 2BYVE 3TGNA 2DFIA 4A5NA 4CICA 1I1GA 5D6EA 2DI3A 3AAFA 1UHWA 3ECOA 3F8BA 3SZTA 3BJOA 4KT5C 2QWWA 5F6FA 1WKMA 4Q4ZF 2Q2EA 3DXJF 1XMKA 4YFXF 4DQ2A 5K5RA 1TNTA 2MH2A 4YIIA 2FA5A 1SD4A 4U0YA 2AS5F 2WTEA 5LRSA 1FYLA 1MJ9A 1W5SA 2O03A 3V8JA 4WXHA 3JAMK 3HIFA 1VTNC 4YFKF 1K79A 1FY7A 2JT1A 1IRGA 1W7PD 3FX3A 1CF7A 2YX4A 4GYIA 2VBYA 1XSXA 1U2WA 2HYGD 3K2ZA 2CG4A 3WU1B 1ZREA 3I59B 2ZKZA 2VE9A 5E17F 3ECHA 2GAUA 3GFLA 4FX0A 4L0YB 3DPTA 4TV7A 3COAC 4HQMA 2NNYA 4P9FA 1KU2A 5FB2A 1S7AA 2OAZA 4OIOF 6PAXA 5D5UB 4LLLA 2STWA 1W7PA 4BHPA 1J75A 2DPDA 1U5TB 2L3DA 3E6DA 1JE8A 3EYIA 2BGCA 2YR2A 3ZMTA 3CUQB 2IA0A 3K1MA 2R7FA 4HF1A 5ILVA 3KZZA 2BEOA 2DBBA 1T98A 3RKYA 5E1WA 1FSHA 2PLYA 2M5WA 2D1VA 1QO0D 4G6QA 2K7LA 1IXSB 1BOAA 2H6CA 3F22A 5EEHA 3T8TA 1J2XA 3BDDA 1RZ4A 3IC7A 4N9IA 1TQPA 1YS6A 3I0TA 5HLGA 5D5VB 1HW1A 3MEXA 1TTYA 2K27A 4CXFA 2W85A 1BC7C 4Y15A 4UV9A 1STZA 3BPVA 2PI0A 1KU9A 1B59A 1KU3A 3HRSA 2RDPA 5ICGA 2JRTA 4HV6A 2HKXA 5D6FA 2VBWA 4ZZDA 4G7OF 2ZJ2A 4RGUA 1ZLJA 2F2EA 3LA2A 1G3WA 3M8EA 5CYVA 2H94A 4HF0A 4AD9A 3MZYA 1D3YA 1XGSA 3U1DA 2VXZA 1BJAA 2HTJA 1P2FA 1DP7P 1LJ9A 3F8NA 3HTUA 4WCGA 2O3FA 2P7CB 3PQJA 4MEYF 3NQOA 3RTRA 1H9TA 2FF4A 1S8NA 1SFXA 3RI4A 5HS8A 4MQVA 2V1XA 3M1EA 1C0WA 2DTRA 3MFKA 2RN7A 2A61A 2PEXA 1FYKA 3B02A 3F3XA 5JHUA 4ENNA 3Q9VA 3WU0A 2QZ8A 3E3VA 1QQIA 2FNPA 5ILSA 5TJJA 1R58A 5JVTA 2ZCWA 1IZ1A 3E6CC 2OQGA 4RGXA 4HLYA 4D0PA 2NYXA 1KU7A 2VOPA 1E2XA 4KIFA 1BN5A 3ZMDA 4CYDA 1KQ9A 4HX4A 4KA4A 3WGGA 1O7LA 2EWNA 1XMAA 4BH9A 2FRHA 2KIFA 4HLXA 2FBKA 1TLHB 1LDKB 4AIJA 3TKYA 1IN4A 1WI9A 4HW0A 4BXUA 2W24A 1WRJA 5DDGA 1WWXA 5BOXA 4BHBA 5FFZA 3F6VA 1GHCA 4KMFA 4LK0F 1MDMA 2M87A 3DFGA 5E1ZB 1AWCA 1K6OA 1YW8A 5LRRA 3QPTA 4ON0A 1B4AA 3IHUA 1FX7A 3KCCA 4LG0A 1SAXA 1IN6A 3ZMVA 4G7ZF 1PUEE 3JSPA 4Z2YA 2Q8KA 2QQAA 4IF4A 1L3LA 5KVRA 4BAYA 1YS7A 2XGXA 1TQMA 2V79A 2A6HF 1MGTA 2JZYA 5DYMA 2MC3A 4ENKA 1RUOA 1P4XA 1SMYF 4P5OA 3GZ5A 4EVIA 4L9NA 2QLZA 3T1BA 5BMZA 3GXOA 2OBPA 2YPRA 1XGNA 4ESFA 5DCFA 3ZN0A 1Z6RA 4OMZA 1FNNA 1IRFA 4RB1A 5ED4A 1KQ8A 5IT9K 3LA3A 3EYYA 3TO9A 4L9JA 2XAHA 1ULYA 1IXCA 4A5MA 2Z9OA 2LSOA 2VC0A 1ON1A 1T6SA 2VONA 1SFEA 4UNOA 4CO8A 1HSTA 1RIOH 1PP8F 1S3JA 2FE3A 3GFIA 3QP6A 3BJ6A 1SD5A 1YW7A 3WODF 5E8IA 1BC8C 1K78A 2NNNA 2V1DA 3QPHA 2FNAA 5IT9Z 2FBHA 1ON2A 2DQRA 4UVCA 4ZH4F 2J5PA 2EFQA 1IAWA 4KNYA 1BI2A 2MBFA 4U88A 1ZGAA 3CUOA 1P4AA 4BNCA 3FM3A 3LAJA 3WTVC 4WWCA 5TRDA 2ISZA 2RNJA 2P5LC 1Z6TA 2QUFA 5CVVA 4Q5SF 4Y17A 2XAGA 3Q5FA 1Z1DA 4JBAA 2G7HA 2D45A 3WTTC 3FM5A 3L09A 5DD4A 5CVRA 3WE2A 1FBUA 3SQNA 2KJBA 1LEBA 1ODDA 4RB3C 1SFUA 3MWMA 2DK5A 3B73A 2K4BA 1FT9A 3CDHA 4HOBA 3K1PA 1O3SA 3ERED 3U9GA 4Y13A 1LQ1A 2GIVA 2Y0MA 3FMRA 4R1HA 5K5OA 3T5XA 2OZUA 1OYIA 4KN7X 4YIFA 1KGSA 1T0FA 4G7HF 1I1SA 3P9CA 3KP5A 2H09A 2ELHA 4IHSA 5K1YA 3CLOA 2XAQA 1J0RA 1USSA 4KICA 3U2RA 4WXCA 3H92A 2O6GE 5LEJA 2WWYA 1W4MA 1QZYA 1XCBA 3E5XA 3RKXA 3MZHA 3GFJA 3RPUA 3BPXA 3GW2A 1USTA 1V3FA 4EV0A 2FBIA 3QAHA 5ICFA 5D4RA 3KEQA 2GWRA 1OKRA 1U3EM 2UXNA 4ESBA 2ZBKA 3R0AA 2QQBA 2ZMEB 2JPCA 4L5IA 2RVCA 2P8TA 4OIQF 3CO7C 5L3CA 4KIGA 4ESJA 5ILUA 2HKOA 4O5VA 3P9KA 1B9NA 2GA2A 1XGMA 4MQ9F 3IRRA 4EQQA 2F5CA 4GGGA 2IA1A 2KJCA 1U8RA 1IN7A 1KYZA 2ACJA 2RGVA 3BOQA 1J9IA 5ERIA 1FBQA 5DEQA 3FF5A 3LWFA 4KUMA 5CVJA 1IW7F 3WTXC 5HVQC 3LA7A 2M45A 3GYHX 5DV5A 1G3YA 4I09A 2L54A 1HKQA 1YYVA 3JAMZ 1G6NA 1F1ZA 1I6XA 3IL2A 4IRGA 3C3WA 4NB5A 1UB9A 1I27A 3Q9SA 3VEPA 1B9MA 1B6AA 3P9IA 1ZLKA 4JQFA 3WG9A 5L3GA 4HYEA 4UVAA 1E17A 5A2QK 3WGIA 2L4AA 5ICEA 2QBYB 1D8JA 3RKWA 1LDDA 4FHTA 1KQ0A 1R1VA 4ZYDA 4HDUA 2MLGA 2PMUA 1TW3A 1TQIA 3FHZA 4A12A 4WX9A 2L02A 5A2QZ 4I0BA 5E18F 2O8XA 3L9FA 4CZZA 3TQNA 3KLOA 4QLCU 3T8RA 4RAZA 4PGHA 1MKMA 2DW4A 4MTDA 2JTVA 4LJZF 1IXRC 1ZG1A 4A0XA 3WE3A 2EK5A 4OIPF 3GZ6A 3JSOA 1SMTA 1DPRA 1W5TA 1XN7A 2X0LA 2L01A 1ZYRF 1FZPB 1S6LA 3E5QA 1UFMA 1DDNA 1I5ZA 3LSTA 2KIMA 3TO7A 2ISYA 4IVNA 4UV8A 4A0YA 1HXDA 4IXAA 3KZYA 3KE2A 2FQ3A 1R7JA 3KP3A 3KP6A 3MAJA 2XIGA 2HOEA 5H20A 1BI3A 5JR3A 1LDJA 4ENMA 2OQRA 5DCMA 1QZZA 1REPC 4JK1X 3BROA 3FMSA 3TOBA 2RQPA 2GQQA 5L3FA 4HX8A 4P55A 3K69A 2Y48A 3HSEA 3H3UA 4A0ZA 4LFUA 4OU0A 3VOEA 2F5FA 1FOKA 3HRMA 3QOPA 1H9GA 1XB4A 1FP2A 1RUNA 2M1BA 3L2CA 2XKPA 3VB2A 5ICCA 3F23A 2ADUA 3DP7A 4EJVA 4M71A 3ABTA 2DT5A 3CO6C 2XRNA 3RJPA 3HHGA 3WTUC 2JSCA 4UVBA 2YSRA 1OYYA 1OPCA 1O3RA 4N0BA
chains in the Genus database with same CATH superfamily
2LC2A 2FXAA 4ASNA 5CVIA 2BXZA 2QQ9A 5IOZA 1H8AC 3J80K 1GDTA 1ZRFA 2HOSA 1EF4A 4PJ0C 2Y0SA 3P5JA 4DNCA 4I7HA 3CCQI 2XPUA 5AIQA 4BXFA 2NOJB 5FKKA 2IRFG 3KLNA 4PJJA 2DPUA 3E97A 3HGGA 3LAPA 4Q48A 2R0QC 1T33A 4KISA 1OCCH 1B72B 4AYBN 4DYQA 1X3UA 2R7OA 4CDGA 4AM3A 3OS2A 1RNLA 2Q2EB 4PJLA 2B7EA 3F8FA 5KNLA 3O6BB 3J80Z 3WTWC 2QYOA 1HKTA 5GPCA 1K4TA 3KZIC 3HYIA 2RNGA 3KEOA 4X6AJ 4M6YA 2IS2A 4OAZA 4XOTA 1HW5A 5M3MJ 3RYPA 1HBXG 3BLYA 4M6VA 1GVJA 2EFOA 3BWGA 2NRAC 3ULQB 3IKTA 3FXMA 4A3IJ 1OR7C 1UMQA 1JHFA 2R7ZJ 2W7NA 4E4HA 2BY0A 2MW8A 4BY7J 5DUIA 1F5TA 4ZYAA 2M9HA 2DODA 3I5UA 1JKRC 1TWFJ 2H8RA 4C2UA 3GTGJ 2LY2A 4XSZF 5L3DA 1A36A 2VOOA 1ETXA 5E1XA 3A4CA 2N8GA 5FD6A 2F4IA 5LGNA 3OL3A 3P7NA 1V4RA 1CF7B 3GZNB 4HX7A 1OR7A 2CQXA 3OYCA 2CMPA 2X51A 2LYCA 2MGQA 4G94A 4LB5A 5F0FA 3KEYA 2COBA 5F1JA 5E3OA 2ZNZA 2Z5UA 1Z91A 2R3SA 3MMYB 1Q1HA 4GRIA 4M9XA 4XLPF 1WPKA 1BM9A 1HDPA 4HAMA 3TDZC 2VKVA 3HRUA 4Y3OA 2OZ6A 1MMAA 4E7KA 5K7HA 1EH8A 2Y0SN 1JJ8C 2K40A 3I59A 3VPRA 3GLXA 4BS9A 4BUPA 3MKLA 2MC4A 4LD5A 1OISA 3MQ0A 4XOPA 4PK4A 1MBHA 4A3JJ 1LE8A 3RDIA 3E6MA 2AHQA 4OOIA 1XPXA 4LITA 1AOYA 1P92A 1MZBA 1I39A 2D1HA 2GZWA 1R00A 2KRFA 3I9V2 3L00A 3Q0VA 3RIRA 1CGPA 1MSEC 3SFZA 4UB6C 1D1BA 2NXNB 3LSMA 1VQLI 1W7PB 2A07F 3S3OA 1JGSA 1GLNA 2JA8J 2R5ZB 2XVCA 4UUSB 3DEUA 2CGPA 2DQLA 1FWZA 2K9QA 3HL2A 1WHUA 5C4XJ 4CCMA 4DBQA 1B8IB 3N4MA 2XSDC 2DO7A 3M07A 1K7AA 1X19A 3KP2A 2ZJQF 2STTA 1WI3A 3Q0WA 2WY7Q 4E70A 1R1TA 1U5TA 3ISPA 4BYYA 4EJUA 2E1MB 4XNFA 4CGZA 2Y9YA 2QEXI 4IQ4A 2X48A 3DEWA 2J5OA 3OS1A 4UUVA 3CUQA 1R4MB 1Z7LA 4MHGA 4MGRA 2F5EA 2ELJA 2XUBA 3BR6A 3UNGC 1T38A 4M9SA 1V5GA 3J7AY 1MD0A 2BV6A 3OIPA 3AG1H 4V2GA 2BBYA 5HLIA 2PFBA 2EBIA 3L2QA 3SJMA 1XGOA 5J8CA 3FKIJ 1R5GA 1SD7A 4RAFA 4F52A 1MBEA 3J7YJ 3TOAA 2XGCA 2KDOA 5BQTA 1MNDA 3B6AA 1A04A 2IP2A 5IY5H 4PSXA 2Z99A 5M5WJ 3JW4A 2KDZA 1ZR2A 4XLCA 2V1UA 4LG3A 5H6RA 3UR3C 3RZDJ 2CQKA 5LGTA 3GUDA 3K2AA 1L0OC 3E5UA 3S2DJ 5FD5A 3T0YA 3RCOA 3PFIA 2IBDA 3HHHA 4WK8F 3JRBA 1LPQA 3G73A 4HRIA 3F8MA 1ZN2A 1AU7A 2K5CA 4M3DA 1MSFC 1G4DA 3HC7A 1ZTRA 4XM3A 4YIRX 1H0MA 2IAIA 4L9VA 1IUYA 1RI7A 2WAQA 3I4PA 1I3QJ 1WJAA 2K9MA 2CO5A 2ZSIB 3KFWX 4LB6B 5C44J 5IYDJ 2R5YA 5GAHJ 1GUUA 2HTSA 4HV5A 5D5XB 3I64A 4CSWA 3HOSA 1R5ID 4ZYGA 1FMWA 1BW5A 3ROUA 5AIPA 1DUXC 3BG3A 1R23A 1WGXA 2PBIA 3D0SA 2DA5A 3H3ZA 4IJAA 2IA2A 1N25A 2F5DA 5E20A 4FQGA 2DA7A 3N97A 2FU4A 5AONA 4AVPA 3BR5A 3CP8A 2VLAA 1T0FC 2D2WA 3K0LA 1EV7A 1XX5A 2TDXA 4G6DA 3M8FA 1ZG3A 3FK6A 3WTYC 3L7WA 2HR3A 3O3KA 3RSNA 3ZMUA 1BIAA 2BHYA 1O57A 4JOMA 5FGMA 4P1WA 2Z33A 2VBZA 2CWEA 1T8IA 5JI6A 3HRTA 2EQRA 2HEOA 2KKOA 3S2WA 3CCVI 3W6VA 3NRVA 4BQQA 4XQFA 5GAGJ 4PFPA 2UV1A 5D8KB 3G1MA 3K70C 4N4NB 1LVKA 2X4HA 5B66C 1SVMA 2HVRA 4U0VA 1R71A 3GLLA 1OLTA 4Y7NJ 2R7QA 4GYGA 1QBJA 1YRNA 1IJWC 3EQLF 2YUSA 4R8HA 5EEGA 2E1NA 4IPAA 1T39A 1MBGA 2Y2ZA 4MNUA 4BKXA 4LLNA 2RAEA 3O8GA 1SEUA 3M9AA 4LK1F 4QTRA 1LNWA 4RA2A 2CW7A 2LF8A 2DYRH 2JUCA 2NVYJ 2EA2A 2XKOA 4DZJA 4A3DJ 4RB2C 2G9WA 5TGTA 2DAOA 3PQKA 4UHTA 5CVUA 4XKWA 4HPQA 1ZK8A 3AKZA 1ETYA 4BQAA 1XS9A 2P81A 3S8PA 2B0LA 1BL0A 4E7HA 1OMIA 1VQMI 1YJNI 2QVOA 3DV8A 5L3EA 3QYFA 1UELB 2WAQN 5J4YA 5LD2C 3SYTA 1U78A 5J3LA 1O7FA 3FMQA 4PCQA 2KIUA 3CCLI 4K2EA 1EJ9A 2LBFB 3CQZJ 3K4MA 5IPAA 2IEKA 3ZRGA 3S1QJ 4U87A 2PJPA 1J7KA 2ESHA 1MJBA 2K86A 3OR2C 2V9VA 5FFXA 2K02A 2HPIA 2W82A 4QWQA 4B3AA 1VZ0A 2L2OA 1HSJA 4N9HA 2M30A 3C7JA 3E0JB 4WF2A 3FWEA 3MKYB 3OYGA 2V1NA 3R4KA 1T2KA 4Q47A 2PX9A 5GTIC 2R7DA 3DPUA 3FISA 4D9JA 5GTHC 1J09A 5DTDA 4Y52J 1FSEA 2HDDA 2EV5A 1E3OC 2F4OB 1K83J 3C18A 2V4JC 3EETA 1BR4A 1S7OA 2FQ4A 4O6JA 1FBSA 2YX7A 3R60A 3TO6A 3L1PA 1WQ2A 4XR6A 1ITYA 1HC8A 2MD5A 1LFPA 2KPMA 1J59A 3LQQA 5F08A 1KZHA 2QKMB 4RLFA 3VYUB 2W57A 1GXQA 3C1DA 1IC8A 1U0JA 1MDMB 2DOFA 2EZKA 3ZN1A 2X6WA 1O3QA 4AUXA 2F5VA 2E5NA 3NARA 4IL6C 5H6QA 2XAJA 5LBQA 5HS9A 4B8XA 4XBFA 2A5WA 2WC2A 1ENHA 4IEJA 1RC9A 3CF2A 2CRGA 4LG0B 1BIBA 2R7RA 1BI0A 3F6OA 1QNTA 2Q1ZB 5D5WB 4S05A 2P5KA 3FXQA 2FEZA 1IO2A 5BS6A 2VB6A 1R5HA 1O3TA 4ANJA 3DLAA 1UZCA 2WAFA 3IWFA 4P96A 4X0GA 2W25A 2ETHA 5LHGA 1DPUA 1XSDA 2EV0A 1ZRCA 3MCZA 1IF1A 3ELKA 1ZG5A 4NQWA 3QU6A 4NC7A 4OINF 4BDYA 4AIHA 1R1UA 1VQ4I 1BBYA 4HDVA 2Z3YA 4WXDA 2E71A 4B43A 2ZFWA 3CCYA 2A6EF 3V4GA 1LKXA 2LH9A 3REOA 4BJ5C 3ZPLA 2RV8A 3K4JA 3LOCA 5HNFA 3WTZA 1W0TA 2O61A 2L9SA 1ETKA 2A05A 4RS8A 3S32A 3VYRB 1UHMA 2E35A 2L4MA 4M72A 2WA0A 3HTSB 2GXBA 3JTGA 3J7AO 4IOAF 2EJRA 2CS3A 2X1EA 3D5RC 1JHHA 3DPLC 3H35A 1D0ZA 4L9TA 3QP5A 3V8LA 2R93J 2XAFA 4BBSJ 2V6CA 4PDKA 2A69F 3CJTB 3CP2A 4M6XA 3W3CA 4I99C 5FKLA 4I2OA 2HXIA 4A3CJ 2DCEA 4XLNF 1VF9A 4NBQA 2HDCA 4HF2A 5J8FA 2BE5F 3ABUA 2CW0F 4GXOA 1ZGJA 4RGSA 5K7ZA 5DUKA 4BEHA 2LRDA 3PNTA 2HYJA 3JR9A 1S72I 4V19K 3I4NJ 5FROA 3ABMH 1RESA 4FTHA 3SEQA 1HW2A 4KDPA 1HKSA 5D4SA 4L18B 3OYJA 2FJ1A 2P7VB 2LDUA 5FRMA 2LK2A 2FOKA 3SEZA 5C4JJ 1YQAA 1XDSA 2FMYA 1K78B 1FC3A 2HVQA 3DF8A 1SD6A 4A2UA 3CCJI 4KIBA 2IS6A 4KYWA 2E2HJ 4S04A 2CUEA 5EZHA 5GAEJ 3MKZA 2KZGA 4U7DA 3SZPA 4DYRA 2DU9A 1QVUA 4CCLA 5FKMA 2V26A 3JRAA 1G3TA 2CJJA 4F93B 4RAYA 3GO5A 2COMA 3G2BA 3PUFA 2VJ4A 4ETSA 1IN5A 3SZGA 4B4CA 2L7FP 4B47A 1QPMA 1FOWA 2H27A 2FSWA 4M9ZA 2OD5A 1AHDP 2QM3A 2Y75A 4CCOA 4KMUX 1F4KA 4P9UA 2EA4A 3DKYA 1V54H 2DMTA 3R6SA 2WV1A 3CJNA 4U0WA 1YTYA 2QENA 3ASOH 3CMEI 3NEUA 3V8KA 4YFNF 2P6SA 2R7UA 4BACA 1VFCA 4IRHA 3GX4X 5EYRA 2ZXJA 3IAS2 2HQRA 3HPGA 1QHGA 2RREA 2HZTA 3KYLA 5B3SH 5HDKA 4E7IA 2HFHA 2GA1A 1P6RA 2IPQX 1ONVA 3KP7A 3V7CA 5CKTA 2DA6A 2EILH 2IJLA 2Z16A 3OOUA 4PGGA 3ZMSA 4IRIA 5HODA 2OA4A 2VIXA 4RDUA 1VQ6I 2CYYA 3I58A 4HQEA 4AIKA 1FP1D 2ICWG 2IGMA 4M3GA 1ZQ3P 1S29A 2E7XA 3BZCA 3K4CA 3GF2A 3I3LA 5HOOA 2M7AA 4UXNA 4YG2F 5FLXK 3S3MA 1JT0A 1FLIA 1LB2A 2R92J 5FO5A 1VQNI 4KN4X 1T56A 1HQCA 1TWHJ 5IP7J 3ZP5A 2NVQJ 3HOTA 3EUAA 4M74A 5IT3A 4XRSA 3PIOF 3K1NA 3O2PE 1M1EB 5KK1A 2HQNA 2VN2A 1HCRA 2EV6A 1PP7U 1NHAA 4ZYEA 2EZHA 3I71A 3WGHA 2FOWA 1MIJA 1XC5A 2A3SA 2VKEA 2W1OA 2DA4A 4G8XA 3SHFA 1HDDC 1WH7A 5FLXZ 2M4GA 2EB7A 1WFXA 2IVMA 4G12A 1D8KA 4EJOA 3A02A 1JT6A 2GXGA 1PDNC 4RLQA 3TDUC 3IRQA 3S17J 1G2HA 3OOPA 4L0ZB 3DQVC 3PJRA 4I0AA 2XHKA 4B09A 3LQRA 2LD5A 1YX5A 1NG7A 3LL7A 3PFYA 3AFHA 5KAFC 3C2BA 5EEAA 3JRHA 1P9QC 3K9TA 2KZVA 4XLAA 1YFHA 1K4SA 4EMSA 4CYCB 3BY6A 1WJEA 2ZNYA 5HDNA 3V7SA 4XKVA 3S2HJ 5HLHA 1ZRDA 1EH6A 2HYFA 3IH2A 3LSRA 5K5QA 3EDPA 3WTSC 2BHZA 4NHJA 3QU3A 1WSUA 1ZHFA 5DD8A 3BG7A 4C2TA 3KIOA 1OQYA 2V9KA 5GPAA 3A03A 3U1KA 1IUFA 2F4MB 2JPBA 5FLVA 3G3ZA 2ZMEC 1SFOJ 3FXRA 1QA6A 5IP9J 1Z0XA 3GEZA 2RC4A 2PJRA 5D8LB 4OMYA 4S0HB 2G7UA 2OPTA 3DTIA 3GWZA 3KETA 4ITVA 2HGCA 5LLQA 1TNSA 2ZMEA 4IHYA 2ELKA 1FOYA 4A6DA 2ZO4A 1FPQA 4DW6A 1Y56A 3BZ6A 4MO7A 3NWTA 2VC1A 2ID6A 1FYMA 1ZARA 1UJ8A 2ECBA 2KMUA 1ZELA 2H6BA 3FXKA 2ECCA 2RKHA 1OCRH 2Q0OA 2WV0A 1DP3A 3VYTB 3I53A 3H5AA 1BJZA 2R7XA 3ONQA 3GTQJ 4CUGA 2Y69H 3R61A 3DTKA 3IWZA 4NC8A 1MJAA 4OIRF 4XK4A 3HG9A 1F9NA 4FX4A 1QGPA 2DLLA 5KCMA 2UXXA 4RGRA 1BW6A 5F64A 4U7BA 3F8CA 4ENJA 4EM0B 2ESNA 4M3BA 2VPLA 4BHCA 2PN6A 4D7MA 4XLHA 2A68F 1WZ2A 2WAEA 2EFWA 1BI1A 1XDUA 5FLMJ 2KFDA 3OYEA 3V7RA 2NS0A 2DFEA 3DKWA 1YO5C 4IHVA 2O5RA 4JX5A 1DU6A 5CPRB 1K61A 3RQ4A 1R49A 3LFKA 1B1BA 1J5YA 1KONA 3ZQ7A 4ZZLA 5B1BH 4D5CA 4EGYA 4UB8C 2NOGA 2KISA 4C3HJ 1SC7A 5JFRA 4EJTA 4HA8A 4PZJA 3HBLA 3FZVA 3FK7A 2X85A 4KFCA 3RPQA 3VODA 3CMMA 4C30A 3CCSI 2O8KA 1XMXA 4XL9A 4H0EA 1OFCX 2IW5A 3H0GJ 2C6YA 2XROA 3LSGA 1BR2A 2LKPA 4PUSA 4E7SA 5C3EJ 4EGZA 3BP8A 5LHHA 2GOXB 3CD6I 1U5TC 3CTAA 2E7WA 2QBYA 2JUGA 3FXUA 2VE8A 4XKBA 2ME0A 1Y0UA 1RETA 3W6KB 3CUQC 4LGWA 3D5LA 1R36A 1X58A 2DA1A 2LNBA 3CESA 4F55A 3KP4A 3ML6A 3J81K 5HS7A 3EUHA 1D5VA 4ZJZA 3OYHA 1N78A 2ZXWH 2V9PA 2EZLA 2O9LA 3F72A 2VBXA 4L5JA 2ZB9A 4GCVA 4B48A 1ORKA 1VI0A 4BDZA 2IGKA 3OS0A 3ZMZA 3H0DA 3E6BA 1ETOA 2XB5A 2VKHA 3F21A 4F92B 2XASA 4J19A 2EFPA 1JXSA 4LOCA 4F91B 2HZDA 2MH9A 5EG0B 5HDGA 2HS5A 3RYRA 2P6TA 1GXPA 2QF7A 2W84A 3G1LA 2HOTA 4FCYA 3CJQB 1T95A 1G3SA 2UZKA 1LVAA 3J81Z 2CV1A 4HZFA 2PQ8A 3PL8A 1XCVA 1YIOA 2E19A 2NVTJ 3SXYA 3TEDA 4FE4A 4XRFA 2EFNA 1JKQC 2Y30A 4GO1A 2AXLA 3IKVA 3KX2A 4NNJA 5IP6A 4CHUA 1QZEA 2IGNA 4AWXB 4BQOA 2P5VA 2E34A 1G59A 4LMYA 4ZC3A 2L7KA 2W48A 3HEFA 1H89C 1JUMA 2XSJC 2VT3A 2DA2A 3BG9A 2CUJA 3AL0C 4HNUA 2BZTA 1VQ9I 2NVXJ 2PMHA 3HJEA 3PM1A 2NAZA 3HSFA 3W6JB 3PNVA 2P4WA 2HPMA 1Z05A 2XDVA 3GFMA 4II3A 3HUGA 1MNEA 1WJDA 5J6XA 4UY8I 4M73A 2VUMJ 4A6EA 2PG4A 5LGUA 1Z7UA 3JRIA 4LLGF 4IKFA 1SAUA 5DCMB 3OV8A 2CW8A 1IDZA 4XSXF 4BQNA 2BY2A 2HU9A 5CLSA 2VODA 2K4JA 2LMDA 4LIVA 1ZH5A 1ZAOA 3FKJA 4XORA 3BR1A 2LF7A 5LHIA 1PYVA 3KYCB 1Y1VJ 4EM1A 1QU3A 3HSRA 4FT8A 1LEAA 3R0JA 5L3BA 4O3MA 5J4VA 2DT6A 3O8HA 1YW9A 1OYWA 4A3BJ 5K7FA 2HWVA 2BW3B 2VKDA 4R79A 2M0CA 1AKHA 2F6CA 3BJAA 5M5XJ 1Z9CA 4EJWA 1TW2A 4HBLA 1UCRA 1NK3P 3S93A 3MD2A 2HQAA 2DK8A 1WJ5A 2M2EA 3RPUD 4E7ZA 1TWAJ 4A3GJ 5F0HA 2MA3A 2YU3A 3J7ZI 4PSWA 4ZYHA 1QRYA 3I54A 5CJ9A 4I02A 2CFXA 3A01A 1PUFB 5F0CA 1TBXA 2LVSA 3VDXA 4G9YA 1IN8A 2K9LA 4RB0A 3IV5A 3ABLH 1R22A 5LEKA 5E8GA 3K6GA 1WJCA 1YLFA 2K3PA 5E3MA 2E1CA 3QRFF 2CSOA 1U6GA 4FE7A 5BPDA 3LSPA 2VT2A 4Z6YA 2DYSH 1IGNA 4I98B 1Y0NA 1GV2A 3S1NJ 1EH7A 2OU2A 3M7GA 3JTHA 4F7ZA 2EIMH 3VFZA 1YG2A 1P4WA 4J01A 4I01A 2XV4S 3H5RA 2GM4A 1SVOA 3H3VK 1IDYA 4QSHA 5BPIA 2IT0A 3GVAA 5J1RA 2K3FA 4BJ6C 2MLKA 4MTEA 5EGOA 2QSGX 5F1RA 4MFEA 1XD7A 4AU7A 2UWMA 2A5YB 2O0YA 1KA8A 1KYWA 1MNMC 4AIDA 2E2JJ 2JJ7A 2AO9A 1GVDA 2JA2A 4EM2A 2M8EA 1NK2P 4IHTA 3F0CA 3C2HA 5FJ8J 1XSVA 2FMLA 3QYEA 1IG7A 1W5CC 3M3YJ 3VSLA 2DFHA 4MEXF 2BYVE 4CH7A 3TGNA 2DFIA 4A5NA 4CICA 4XIDA 1LUJB 1IV6A 1I1GA 2HVSA 3LSKA 5D6EA 3VYSB 3W2WA 3QWLA 2JVGA 2DI3A 3AAFA 1UHWA 3ECOA 2LY9A 3F8BA 3SZTA 3BJOA 4IHWA 2JN6A 4KT5C 2QA4I 2QWWA 3EPZA 5F6FA 1MMNA 3ZQHA 1WKMA 1B72A 2X9DA 3CMAI 3BG6A 4Q4ZF 5IYBJ 4A3EJ 3IUOA 4RMNA 1BA5A 2Q2EA 4HG2A 3DXJF 1XMKA 2ZXHA 4OAYA 5M5YJ 2EINH 4RM3A 4YFXF 3RKQA 4DQ2A 5K5RA 1TNTA 2MH2A 4YIIA 3S14J 2FA5A 1SD4A 4U0YA 2WBMA 2AS5F 2WTEA 5LRSA 1FYLA 1MJ9A 1X1DA 1W5SA 2ZSHB 3BQZA 3TMOA 2O03A 3V8JA 4WXHA 3JAMK 2BVMA 1FJLA 3PO3J 3HIFA 2X1CA 5EDNA 1YI2I 1VTNC 4YFKF 1K79A 1FY7A 2JT1A 3ZQFA 1IRGA 1W7PD 3FX3A 1CF7A 3HOUJ 1YJ9I 2EZIA 2YX4A 3PSIA 4GYIA 2VBYA 1XSXA 2CUFA 1U2WA 2JRMA 2HYGD 2M0MA 3K2ZA 1RPWA 2JVHA 2CG4A 1TT0A 2VJIA 3VSKA 3WU1B 2X1DA 1ZREA 2QQ8A 3I59B 1FTTA 5IYCJ 2ZKZA 1N77A 4FASD 2VE9A 2LOOA 2JSPA 5E17F 3ECHA 4RM2A 2GAUA 3QPLA 1V5EA 1OJLA 4A69C 3GFLA 1LE8B 3NWSA 2DJNA 4FX0A 4L0YB 3DPTA 4TV7A 3ZR8X 3COAC 1NH3A 2KP6A 1VQPI 1G8XA 1APLC 3OL4A 4HQMA 2CFOA 2LTPA 2NNYA 1P7JA 2DN0A 1HA8A 2FUG2 3BTJA 2FX0A 4P9FA 3BR0A 2CV2A 3OYLA 1KU2A 3OYBA 1MH4A 5FB2A 4CZCA 1S7AA 2EH3A 2OAZA 1YJWI 4OIOF 3PUBA 6PAXA 4IQJA 5D5UB 4HSRA 4LLLA 5B5EC 2STWA 1W7PA 4BHPA 3G6EI 2R5ZA 4UUSA 5LFAA 1J75A 2DPDA 1U5TB 3C2GA 4QPQA 3GTJJ 2L3DA 1RR7A 3E6DA 3OMYA 1JE8A 3EYIA 1B8IA 2BGCA 3DTEA 1VQ8I 2YR2A 3ESWB 3ZMTA 4GFBA 3SDGA 2IXSA 3PO2J 1DQUA 2PMZA 3CUQB 2IA0A 3K1MA 3DBHB 3UKGA 1HF0A 3CCMI 3PNYA 3MKWB 2R7FA 4HF1A 1E3PA 5ILVA 3KZZA 3GCMA 2BEOA 2DBBA 1T98A 3RKYA 5E1WA 3ASNH 3IAM2 1FSHA 1H88C 3Q0UA 2PLYA 1DGRM 4D7NA 1YITI 2M5WA 2OTJI 2KLOA 1FTZA 1R6RA 2D1VA 1QO0D 4G6QA 2K7LA 5F04A 2LREA 1IXSB 1BOAA 4JX4A 4XLFA 2H6CA 3F22A 4II2A 3BTLA 5EEHA 3T8TA 2AQFA 3GTLJ 1J2XA 3BDDA 1RZ4A 3IC7A 4N9IA 5JVGF 1TQPA 1YS6A 3I0TA 2ZXIA 5HLGA 5D5VB 2E1OA 3OYKA 2B63J 1HW1A 2LFBA 3MEXA 1TTYA 2GLOA 2K27A 4CXFA 1NG6A 2KIQA 2W85A 2YS9A 1BC7C 3CCUI 3ZCOA 4Y15A 2DFFA 2KT0A 4UV9A 2I10A 2R5YB 2L0KA 1STZA 3BPVA 2PI0A 1KU9A 4HEA2 1OCTC 2CQNA 3CMYA 1B59A 1KU3A 1FEXA 3HRSA 2RDPA 3E7LA 2JRTA 5ICGA 3AL0B 4HV6A 3K7AJ 2HKXA 5D6FA 3EUKL 2YU9J 1D0YA 4B44A 4IZZA 1Z21A 2VBWA 4ZZDA 1S9HA 2OTLI 4G7OF 4LIUA 2ZJ2A 5H2FC 4RGUA 1QVTA 1ZLJA 4PFOA 2F2EA 3LA2A 3I4MJ 4H4KC 4M3EA 2VL8A 4XICA 2MYSA 1G3WA 3M8EA 5CYVA 3S3NA 4BE1A 2H94A 3OWTA 5M3FJ 4HF0A 3BR2A 4AD9A 2KRHA 3DKXA 2MSYA 2Y9ZA 2ZJPF 4AVZA 3H36A 3MZYA 2QGUA 4E6KG 3A0HC 2PMZN 4KITB 1D3YA 1XGSA 2AXTC 1JKPC 3U1DA 2L9RA 2KQRA 2VXZA 3E1SA 1BJAA 1U8BA 2HTJA 1OCOH 3K4LA 2NVUB 1P2FA 4ZTFA 1DP7P 3W2VA 2JA7J 1LJ9A 4A3LJ 3H5NA 1YRNB 3F8NA 4BU2A 1W36D 1CQTA 3HTUA 4WCGA 2O3FA 2P7CB 3S1RJ 3H9JA 3PQJA 2K85A 4AC0A 4DJAA 4MEYF 1R9TJ 3MVPA 2L7MP 4C3IJ 1E0EA 3GMEA 4XRSG 3NQOA 2HQ5A 4NC6A 3RTRA 2X6YA 1JTXA 1H9TA 3HOZJ 2FF4A 1S8NA 2X6OA 1SFXA 4I6ZA 3RI4A 5HS8A 4BE0A 4MQVA 5E3LA 2V1XA 4B3XA 2XF7A 1VQ5I 3M1EA 1C0WA 2DTRA 3MFKA 1F36A 2RN7A 2A61A 3PIPF 2VQCA 3D1NI 2PEXA 3ZQIA 1FYKA 3HOVJ 3B02A 3F3XA 5JHUA 3X2QH 2HI3A 4ENNA 3HXLA 3VWBA 3Q9VA 1XTAA 4GDFA 2BY3A 3HPHA 3QOEA 3WU0A 2KHMA 2W00A 2QZ8A 4EATA 5KHDA 3HM5A 1X2MA 2QSFX 4JP0A 3E3VA 1QQIA 2FNPA 2VJJA 5ILSA 5TJJA 1R58A 5JVTA 2ZCWA 1IZ1A 3E6CC 1SANA 2OQGA 1WJFA 4RGXA 4HLYA 2WADA 2NYXA 2LBFA 3WHCA 4D0PA 3HB9A 3JRFA 1KU7A 1MMGA 1E2XA 2VOPA 4KIFA 1BN5A 1Z67A 3ZMDA 4QIWN 1UG2A 4CYDA 4BL0B 1KQ9A 2HOAA 4RAGA 4HX4A 1QHHD 4KA4A 3WGGA 1YHQI 3WHBA 1O7LA 2EWNA 1JKOC 1XMAA 4BH9A 3TW7A 1RKTA 2FRHA 2LR8A 2KIFA 2WY8Q 4HLXA 4JYKA 5FKOA 3ZGKA 2FBKA 4ABZA 1TLHB 1LDKB 1X2NA 1YE9A 4AIJA 4IHXA 3TKYA 1IN4A 1WI9A 4HW0A 4W1UA 4BXUA 2W24A 1WRJA 4PJNA 5DDGA 3DWLE 1WWXA 1D1CA 1TP4A 5BOXA 5E79C 1JJ6C 4BHBA 3TP0A 4IX7A 5FFZA 1YOVB 4G6TB 4XN0A 3CF5F 3LSHA 3F6VA 3JRCA 3QPSA 4XKCA 5FKNA 2Z2SB 1GHCA 1NTCA 4KMFA 1RKWA 4LK0F 1MDMA 2M87A 3DFGA 5E1ZB 4BJTA 1AWCA 3DU6A 4JX6A 3DU5A 5CQEA 4HSTA 1K6OA 1YW8A 5EZGA 2LLKA 5LRRA 3G1OA 2BXYA 3QPTA 1A31A 4ON0A 1X4OA 4L5EA 1B4AA 5TISC 1HOMA 3IHUA 1FX7A 3KCCA 1PVEA 2L5QA 4LG0A 1Z3YA 1D1AA 3OIQA 1SAXA 1O4XA 1IN6A 1MH3A 3ZMVA 1V5FA 4G7ZF 1PUEE 3JSPA 4Z2YA 2Q8KA 2MG4A 3ZOBA 4NQWB 3A2KA 4DOZA 2LG4A 2QQAA 4IF4A 1L3LA 5KVRA 1JTYA 4BAYA 4EEFG 1YS7A 2XGXA 3WU2C 4IO9F 4C9YA 4CA0A 1TQMA 2V79A 2A6HF 1MGTA 4QPOA 3JRGA 1OCZH 2JZYA 5J1UA 1I6HJ 1T08B 1FMVA 2MC3A 5DYMA 1DU0A 3OR1C 3EUHC 4ENKA 1LFBA 1RUOA 1P4XA 1SMYF 2OCCH 4P5OA 3GZ5A 2VI6A 4EVIA 1P7IA 1MBFA 3W2AA 3H1CA 4MIMA 4CCJA 4L9NA 2LKSA 2QLZA 3T1BA 5BMZA 2GXAA 3GXOA 3I56I 4A3MJ 2OBPA 2YPRA 3FXOA 4D1QA 1Y39A 4DBRA 1W0UA 1XGNA 4A3KJ 4C2MJ 2MABA 4ESFA 1JUSA 5DCFA 3DBRB 3ZN0A 3L2UA 1Z6RA 4B1RA 3CLQA 3A1YA 1FNNA 4OMZA 3D5SC 1IRFA 2L7ZA 2HXOA 3TW6A 4BEHB 4RB1A 5GP9A 5ED4A 1KQ8A 5IT9K 2AQEA 3LA3A 2Z1DA 1F43A 3EYYA 1PJRA 2CQQA 3N05A 3HOWJ 3TL4X 3OSFA 3TO9A 4ZTJA 1JGGA 4L9JA 2XAHA 1ULYA 1IXCA 3FBNB 1MMDA 3K4KA 2LSOA 1MW7A 4A5MA 2Z9OA 3OY9A 2VC0A 2NS8A 1ON1A 2VPRA 1T6SA 3GTKJ 2VONA 1SFEA 3G71I 4CO8A 4UNOA 1HSTA 1RIOH 3SFIA 3DCFA 1PP8F 4E7JA 1X3ZB 1S3JA 2FE3A 2ZFUA 3QP6A 3GFIA 3BJ6A 1SD5A 1YW7A 3WODF 4BE2A 5E8IA 3CC2I 2M4KA 1Y1WJ 3ZQLA 1ZKGA 2XPWA 1BC8C 1K78A 1VQ7I 2NNNA 2V1DA 2GIZA 3QPHA 3S16J 2FNAA 5IT9Z 1TC3C 3TP3A 5IOYA 3TBIA 1TL8A 4DIQA 2FBHA 1ON2A 2DQRA 4M3FA 4UVCA 4ZH4F 5F27A 1RRJA 2J5PA 2EFQA 1IAWA 4J00A 4MFDA 2O7OA 1Y8QB 2JWTA 3L2WA 4ZDPA 4KNYA 1BI2A 3CC7I 2DMUA 1XG1A 3GTOJ 2MBFA 4U88A 1ZGAA 2VJ5A 4I76A 3CUOA 2W4SA 1P4AA 2DDAA 2H1KA 4BNCA 3FM3A 3LAJA 3WTVC 4WWCA 2A6TA 5TRDA 4C3JJ 2ISZA 2RNJA 2P5LC 3LSIA 3OYIA 1Z6TA 4D5FA 2QUFA 5CVVA 4Q5SF 4Y17A 4UUTA 2DMQA 2D5VA 2XAGA 2OC6A 3Q5FA 1Z1DA 4JBAA 2G7HA 3Q3SA 2D45A 3WTTC 1WCMJ 2LY1A 3BTIA 3FM5A 3FBIB 3L09A 2RQQA 1POGA 5DD4A 5CVRA 3WE2A 1FBUA 1ERDA 1X1BA 2M8GX 4YEJA 2KJBA 3SQNA 1ODDA 1LEBA 4RB3C 1SFUA 3MWMA 2DJIA 2DK5A 3B73A 2K4BA 2CU7A 2QCOA 2IS1A 4DYCA 3BCBA 1FT9A 4A93J 3MZ8A 3CDHA 3DEEA 3BR3A 2DMNA 4HOBA 3K70D 1RR8C 3K1PA 1O3SA 1W1WE 2FD5A 3G4SI 2DTZA 3AG3H 3BCAA 3BC8A 3ERED 1MMSA 2IS4A 2CUZA 2DDBA 1AA7A 3U9GA 4Y13A 1LQ1A 2GIVA 3V42A 2Y0MA 3FMRA 4A3FJ 4R1HA 5K5OA 3T5XA 2OZUA 1YX3A 3OYDA 1D5YA 1OYIA 4KN7X 4YIFA 1KGSA 3CDLA 1T0FA 4G7HF 2KL4A 5JLWA 1I1SA 3P9CA 2TCTA 2TRTA 3KP5A 2H09A 2ELHA 2NS7A 1IRXA 4IHSA 5K1YA 3DLLF 1ZGWA 3CLOA 2HDWA 1QPIA 2XAQA 1A6IA 4XRMA 1J0RA 1USSA 4KICA 3U2RA 1I3AA 4NDLA 1ACIA 4WXCA 3H92A 3QODA 3F9KA 2JA5J 2O6GE 3S15J 5LEJA 1GV5A 4V2FA 2WWYA 2F48A 2ZJRF 1W4MA 3AG2H 2KRCA 1QZYA 1XCBA 1N75A 5DM7F 3E5XA 5DS9A 2BY1A 2L9VA 3M4OJ 3RKXA 2IGOA 3FDYA 3MZHA 2LKXA 3MN2A 3GFJA 3CJRB 3GTPJ 2G0EA 3RPUA 1VQOI 4OWRB 4XONA 3BPXA 4CYCA 3CCRI 3K4NA 2XPVA 1R4NB 2BOLA 4ZDOA 4DZPA 3K4BA 2DOEA 3GW2A 1USTA 3LNQA 1V3FA 4EV0A 2FBIA 2R7VA 9ANTA 5FRNA 3QAHA 5ICFA 2XB0X 1FIAA 5D4RA 3KEQA 2E2IJ 4HNTA 2GWRA 2PJRB 2V6EA 2QKLB 1OKRA 1U3EM 2R7WA 2UXNA 4DGWB 4ESBA 2R7TA 2ZBKA 2K9NA 3R0AA 2QQBA 2ZMEB 2JPCA 4L5IA 1V55H 1Q1VA 1DGWY 3M1CA 2RVCA 2P8TA 2CH0A 2DXIA 4OIQF 1EKEA 3CO7C 2XF6A 5L3CA 2M7BA 4KIGA 2XAUA 3LFUA 4BXXJ 1IV8A 4ESJA 4PJMA 2BVLA 1Y6IA 4BBRJ 5ILUA 4IOCF 2HKOA 4O5VA 2EIKH 3P9KA 1B9NA 2ZC2A 2GA2A 3HOYJ 4ZDLA 1XGMA 4MQ9F 2MD0A 3OYMA 3IRRA 4EQQA 3OYNA 3L2RA 2F5CA 4GGGA 2XC7A 2DMPA 2IA1A 4BY1J 1UAAA 2KJCA 1U8RA 1IN7A 1KYZA 4XLEA 2ACJA 2RGVA 1SVLA 3BOQA 3HKZA 2X6XA 2OJED 5JLXA 1J9IA 5ERIA 1FBQA 5DEQA 2EPFA 3FF5A 3LWFA 5J47A 4KUMA 1ZR4A 5CVJA 1IW7F 1X1PA 1TWCJ 3WTXC 5HVQC 4KJZA 3LA7A 4BGDA 2M45A 3FHNA 3GYHX 5DV5A 1G3YA 5CQGA 1WH5A 4I09A 2L54A 1HKQA 1YYVA 3JAMZ 1X1AA 1G6NA 3M8JA 4FISA 1F1ZA 2VQLA 3GBGA 1I6XA 4IRGA 3IL2A 3C3WA 1FOXA 4NB5A 1A6QA 5BNGA 1UB9A 3OSGA 1I27A 2LP0A 3Q9SA 3VEPA 2GOMA 1B9MA 1B6AA 1LFUP 3P9IA 2P0WA 1ZLKA 4JQFA 2WB1A 3WG9A 5L3GA 4HYEA 4RBOA 3CCEI 4UVAA 1E17A 5A2QK 1SFKA 3WGIA 3ZQCA 1Z77A 3IH3A 2L4AA 2OUMA 1OCPA 2H1LA 5ICEA 2QBYB 1U9OA 1D8JA 2R4GA 3RKWA 1LDDA 4FHTA 5KAIC 5E3NA 1KQ0A 3RZOJ 3ZXSA 1R1VA 4CCKA 4ZYDA 3I55I 2E1MC 4HDUA 2OCEA 2UUZA 2MLGA 3BT9A 3BZKA 2PMUA 1TW3A 1TQIA 2EIJH 2M34A 5J40A 3FHZA 4A12A 4WX9A 3OYFA 4E7LA 2B9SA 2L02A 5A2QZ 4I0BA 5E18F 2O8XA 3L9FA 2K9SA 4CZZA 4XMYA 3TQNA 4CCNA 3KLOA 4QLCU 1TWGJ 3T8RA 3KPHA 3B6CA 4RAZA 5GADJ 1S7EA 4PGHA 4F3QA 3PSFA 1MKMA 3CDIA 1TZLA 3RQIA 2DW4A 3IP4B 4Y4RA 4MTDA 3DBLB 1ETVA 2DT7B 2E5ZA 2JTVA 2E60A 1FIPA 4LJZF 1IXRC 5EG0A 3HKZN 2DOAA 1ZG1A 4A0XA 3WE3A 2EK5A 4KT6A 4OIPF 3GZ6A 3JSOA 1SMTA 1DPRA 1W5TA 1XN7A 2JK3A 3HOXJ 2X0LA 2L01A 5HNHA 3GTMJ 2DA3A 1ZYRF 3KYDB 5HLTA 3ZQGA 1FZPB 1S6LA 3ABKH 3E5QA 3QYBA 3HZJA 3ZQQA 1UFMA 1DDNA 3IH4A 1I5ZA 1Y8RB 3LSTA 4X1EA 2KIMA 2CQ7A 4HNVA 1YIJI 2ISYA 4IVNA 3HGYA 4UV8A 3TO7A 1HXDA 4A0YA 1K6YA 4IXAA 3KZYA 3KE2A 2OF7A 2V7FA 1UG0A 2WB1N 3OIOA 2MFZA 3HUGB 2FQ3A 3SDBA 1ETQA 1R7JA 3H9QA 3KP3A 4XN3A 1EA3A 1Z3XA 2JMWA 2VQGA 1X1CA 3KP6A 4MLOA 3CC4I 2XGDA 3MAJA 2XIGA 2HOEA 3FXJA 5H20A 1VQKI 3BTCA 4W97A 1BI3A 1A35A 3WG7H 5JHFA 5JR3A 2Y31A 4YELA 1LDJA 4ENMA 1TT5B 1HLVA 2OQRA 3JREA 1WVRA 3OYAA 5DCMA 1QZZA 3LMMA 2I8DA 1REPC 4JK1X 1X4PA 2GBYA 3BROA 2JA6J 5B1AH 3FMSA 3TOBA 2XRLA 1S5LC 1WJBA 2XGEA 2RQPA 2GQQA 1MBKA 2ME6A 5L3FA 4HX8A 5J1YA 2E36A 1E3HA 3CZ6A 2M3AA 1IRZA 2H8WA 4P55A 1AKHB 1BR1A 3BG5A 3K69A 4AYBA 2Y48A 3NAUA 3HSEA 1JUPA 3H3UA 3H9GA 2CV0A 2I5UA 2BW3A 3K10A 4LFUA 3JCUC 3QQAA 3U21A 4A0ZA 4OU0A 1MBJA 5EF6A 3VOEA 3A01B 2F5FA 1FOKA 4YRVA 3HRMA 1BOBA 3QOPA 3FIWA 1PUFA 3S1MJ 2R7SA 5DM6F 2VASA 5EJCA 3AG4H 1H9GA 1XB4A 4NUBA 1FP2A 1RUNA 2M1BA 3L2CA 1I50J 3FXLA 2XKPA 1A5JA 1U9NA 3VB2A 5ICCA 3F23A 4FETA 2ADUA 3JRDA 2QSHX 1ETWA 3DP7A 4EJVA 4M71A 2L9NA 3ABTA 2JQ7A 2VQHA 1JI8A 2OV7A 2DT5A 3CO6C 1UHSA 1GT0C 1X3WB 3BQYA 2XRNA 3A0BC 2VXDA 3RJPA 3HHGA 3WTUC 3HDDA 2JSCA 3ERMA 3LSJA 4N4OB 4UVBA 4Y33A 2YSRA 1W36C 1VNDA 3L2VA 1OYYA 5EGOB 1D0XA 1OPCA 2HNHA 1O3RA 4N0BA 2ID3A 2XF5A
chains in the Genus database with same CATH topology
2FXAA 4ASNA 5CVIA 2QQ9A 3J80K 1ZRFA 4DNCA 4I7HA 5AIQA 2IRFG 3KLNA 2DPUA 3E97A 3LAPA 4Q48A 1X3UA 4CDGA 1RNLA 3F8FA 3O6BB 3J80Z 3WTWC 2QYOA 1HKTA 3HYIA 3KEOA 4M6YA 1HW5A 3RYPA 1HBXG 1GVJA 2EFOA 3BWGA 2NRAC 3ULQB 3IKTA 1JHFA 1F5TA 5DUIA 3I5UA 4XSZF 2VOOA 5L3DA 5E1XA 5FD6A 5LGNA 3P7NA 1V4RA 1CF7B 4HX7A 1OR7A 4G94A 4LB5A 2ZNZA 2Z5UA 1Z91A 2R3SA 1Q1HA 4M9XA 4XLPF 1BM9A 4HAMA 3TDZC 3HRUA 2OZ6A 1EH8A 3I59A 3GLXA 4LD5A 3MQ0A 3RDIA 3E6MA 4OOIA 1AOYA 1P92A 1MZBA 2D1HA 2GZWA 1R00A 2KRFA 3RIRA 3L00A 1CGPA 3SFZA 1W7PB 2A07F 1JGSA 2XVCA 3DEUA 2CGPA 2DQLA 1FWZA 3N4MA 1K7AA 2DO7A 3KP2A 2STTA 4E70A 1R1TA 1U5TA 3ISPA 4BYYA 4EJUA 4CGZA 2J5OA 4UUVA 3CUQA 4MHGA 4MGRA 2F5EA 2XUBA 1T38A 4M9SA 1MD0A 2BV6A 2BBYA 5HLIA 2PFBA 1XGOA 5J8CA 1R5GA 1SD7A 3TOAA 5BQTA 1A04A 2IP2A 2Z99A 3JW4A 2V1UA 5H6RA 2CQKA 5LGTA 3GUDA 1L0OC 3E5UA 5FD5A 3T0YA 3PFIA 3HHHA 4WK8F 3G73A 3F8MA 1ZN2A 1G4DA 1H0MA 4L9VA 1IUYA 1RI7A 3I4PA 3KFWX 2CO5A 4LB6B 2HTSA 4HV5A 5D5XB 3I64A 3HOSA 4ZYGA 3ROUA 5AIPA 1DUXC 1R23A 2PBIA 3D0SA 3H3ZA 4IJAA 2IA2A 2F5DA 5E20A 3N97A 2FU4A 5AONA 4AVPA 2D2WA 3K0LA 1EV7A 2TDXA 4G6DA 3M8FA 1ZG3A 3WTYC 3L7WA 2HR3A 3O3KA 3ZMUA 1BIAA 1O57A 5FGMA 2Z33A 2VBZA 2CWEA 5JI6A 3HRTA 2HEOA 2KKOA 3S2WA 3NRVA 5D8KB 2X4HA 4U0VA 4GYGA 1QBJA 3EQLF 4R8HA 5EEGA 2E1NA 4IPAA 1T39A 4LLNA 4MNUA 3M9AA 4LK1F 1LNWA 2LF8A 2EA2A 2XKOA 4RB2C 2G9WA 2DAOA 3PQKA 4UHTA 5CVUA 4BQAA 2B0LA 1OMIA 2QVOA 3DV8A 5L3EA 1U78A 1O7FA 3FMQA 4PCQA 2KIUA 4K2EA 2PJPA 1J7KA 2ESHA 1MJBA 2K86A 2V9VA 5FFXA 2K02A 4QWQA 1HSJA 4N9HA 2M30A 3C7JA 4WF2A 3FWEA 3R4KA 1T2KA 4Q47A 2R7DA 1FSEA 2EV5A 3C18A 3EETA 1S7OA 4O6JA 1FBSA 2YX7A 3R60A 3TO6A 1WQ2A 2MD5A 1J59A 3LQQA 2W57A 1GXQA 3C1DA 1MDMB 3ZN1A 1O3QA 5H6QA 2XAJA 5LBQA 5HS9A 4B8XA 4XBFA 2WC2A 4LG0B 1BIBA 1BI0A 3F6OA 1QNTA 5D5WB 4S05A 2P5KA 3FXQA 2FEZA 5BS6A 1R5HA 1O3TA 3IWFA 4P96A 2W25A 2ETHA 5LHGA 1DPUA 1XSDA 2EV0A 1ZRCA 3MCZA 1IF1A 3ELKA 1ZG5A 4NQWA 3QU6A 4OINF 4AIHA 1R1UA 1BBYA 4HDVA 2Z3YA 4WXDA 2ZFWA 2A6EF 3V4GA 3REOA 3ZPLA 2RV8A 3WTZA 2O61A 4RS8A 1UHMA 2L4MA 4M72A 2GXBA 3HTSB 3JTGA 3J7AO 2EJRA 3DPLC 1JHHA 4L9TA 3QP5A 3V8LA 2XAFA 2V6CA 4PDKA 2A69F 4M6XA 4I2OA 4XLNF 2HDCA 4HF2A 5J8FA 2BE5F 3ABUA 2CW0F 4GXOA 1ZGJA 4RGSA 5DUKA 1HW2A 4KDPA 1HKSA 5D4SA 4L18B 2P7VB 2LDUA 2FOKA 1YQAA 1XDSA 2FMYA 1K78B 1FC3A 3DF8A 1SD6A 4A2UA 4KIBA 4KYWA 4S04A 4U7DA 3SZPA 2DU9A 1G3TA 4RAYA 3GO5A 2COMA 4ETSA 1IN5A 1QPMA 2H27A 2FSWA 4M9ZA 2OD5A 2QM3A 2Y75A 1F4KA 4KMUX 4P9UA 2EA4A 3R6SA 1YTYA 3CJNA 4U0WA 2QENA 3NEUA 3V8KA 4YFNF 2P6SA 4IRHA 3GX4X 2ZXJA 2HQRA 2HZTA 5HDKA 2HFHA 2GA1A 1P6RA 2IPQX 1ONVA 3KP7A 3V7CA 3ZMSA 2IJLA 4IRIA 4PGGA 2OA4A 2CYYA 3I58A 4HQEA 4AIKA 1FP1D 1S29A 2E7XA 3GF2A 5HOOA 4UXNA 4YG2F 5FLXK 1FLIA 1LB2A 5FO5A 4KN4X 1HQCA 3ZP5A 3HOTA 4M74A 5IT3A 3K1NA 3O2PE 5KK1A 2HQNA 2VN2A 2EV6A 1PP7U 1NHAA 4ZYEA 3I71A 3WGHA 2A3SA 4G8XA 3SHFA 5FLXZ 2EB7A 2IVMA 4EJOA 1D8KA 2GXGA 1PDNC 3TDUC 3IRQA 3OOPA 4L0ZB 3DQVC 4I0AA 2XHKA 4B09A 3LQRA 3K9TA 1YFHA 4EMSA 3BY6A 2ZNYA 5HDNA 3V7SA 5HLHA 1ZRDA 1EH6A 2HYFA 5K5QA 3EDPA 3WTSC 4NHJA 3QU3A 1WSUA 1ZHFA 5DD8A 2JPBA 3G3ZA 3FXRA 3GEZA 2RC4A 5D8LB 4OMYA 2G7UA 3GWZA 3KETA 5LLQA 2HGCA 1TNSA 2ZMEA 4A6DA 2ZO4A 1FPQA 3BZ6A 2VC1A 1FYMA 1ZARA 2H6BA 2RKHA 2Q0OA 2WV0A 3I53A 3R61A 3IWZA 1MJAA 4OIRF 1F9NA 4FX4A 1QGPA 2DLLA 2UXXA 4RGRA 5F64A 4U7BA 3F8CA 4ENJA 4EM0B 2ESNA 4BHCA 2PN6A 2A68F 2EFWA 1BI1A 1XDUA 3V7RA 2NS0A 3DKWA 1YO5C 3LFKA 1B1BA 1J5YA 3ZQ7A 4ZZLA 4EGYA 5JFRA 4EJTA 4HA8A 4PZJA 3FZVA 4KFCA 3RPQA 3VODA 4H0EA 2IW5A 2C6YA 2XROA 2LKPA 4EGZA 3BP8A 5LHHA 1U5TC 3CTAA 2E7WA 2QBYA 3FXUA 2VE8A 1Y0UA 3W6KB 3CUQC 4LGWA 3D5LA 1R36A 2LNBA 3KP4A 3ML6A 3J81K 5HS7A 3EUHA 1D5VA 3F72A 2VBXA 4L5JA 4GCVA 3ZMZA 3E6BA 3F21A 2XASA 2EFPA 1JXSA 2MH9A 5HDGA 2HS5A 3RYRA 2P6TA 1GXPA 2W84A 1G3SA 2UZKA 1LVAA 3J81Z 4HZFA 2PQ8A 1XCVA 1YIOA 3SXYA 4XRFA 2EFNA 4GO1A 2AXLA 3IKVA 4CHUA 4AWXB 2P5VA 4LMYA 2VT3A 2PMHA 2NAZA 3HSFA 3W6JB 2P4WA 1Z05A 3GFMA 5J6XA 3HUGA 4M73A 4A6EA 2PG4A 5LGUA 1Z7UA 4LLGF 5DCMB 3OV8A 4XSXF 5CLSA 2VODA 2K4JA 1ZH5A 1ZAOA 2LF7A 5LHIA 4EM1A 3HSRA 4FT8A 1LEAA 3R0JA 5L3BA 4O3MA 1YW9A 1OYWA 2HWVA 4R79A 3BJAA 1Z9CA 4EJWA 1TW2A 4HBLA 1UCRA 2DK8A 2MA3A 2YU3A 4ZYHA 3I54A 5CJ9A 4I02A 2CFXA 1TBXA 4G9YA 1IN8A 4RB0A 1R22A 5LEKA 5E8GA 1YLFA 2E1CA 3QRFF 2CSOA 1U6GA 5BPDA 2VT2A 4I98B 1EH7A 2OU2A 3M7GA 3JTHA 4F7ZA 3VFZA 1YG2A 1P4WA 4I01A 2XV4S 5BPIA 2IT0A 3GVAA 2MLKA 4MTEA 5F1RA 1XD7A 2UWMA 2A5YB 2O0YA 1KA8A 1KYWA 4EM2A 2M8EA 4IHTA 1XSVA 2FMLA 4MEXF 2BYVE 3TGNA 2DFIA 4A5NA 4CICA 1I1GA 5D6EA 2DI3A 3AAFA 1UHWA 3ECOA 3F8BA 3SZTA 3BJOA 4KT5C 2QWWA 5F6FA 1WKMA 4Q4ZF 2Q2EA 3DXJF 1XMKA 4YFXF 4DQ2A 5K5RA 1TNTA 2MH2A 4YIIA 2FA5A 1SD4A 4U0YA 2AS5F 2WTEA 5LRSA 1FYLA 1MJ9A 1W5SA 2O03A 3V8JA 4WXHA 3JAMK 3HIFA 1VTNC 4YFKF 1K79A 1FY7A 2JT1A 1IRGA 1W7PD 3FX3A 1CF7A 2YX4A 4GYIA 2VBYA 1XSXA 1U2WA 2HYGD 3K2ZA 2CG4A 3WU1B 1ZREA 3I59B 2ZKZA 2VE9A 5E17F 3ECHA 2GAUA 3GFLA 4FX0A 4L0YB 3DPTA 4TV7A 3COAC 4HQMA 2NNYA 4P9FA 1KU2A 5FB2A 1S7AA 2OAZA 4OIOF 6PAXA 5D5UB 4LLLA 2STWA 1W7PA 4BHPA 1J75A 2DPDA 1U5TB 2L3DA 3E6DA 1JE8A 3EYIA 2BGCA 2YR2A 3ZMTA 3CUQB 2IA0A 3K1MA 2R7FA 4HF1A 5ILVA 3KZZA 2BEOA 2DBBA 1T98A 3RKYA 5E1WA 1FSHA 2PLYA 2M5WA 2D1VA 1QO0D 4G6QA 2K7LA 1IXSB 1BOAA 2H6CA 3F22A 5EEHA 3T8TA 1J2XA 3BDDA 1RZ4A 3IC7A 4N9IA 1TQPA 1YS6A 3I0TA 5HLGA 5D5VB 1HW1A 3MEXA 1TTYA 2K27A 4CXFA 2W85A 1BC7C 4Y15A 4UV9A 1STZA 3BPVA 2PI0A 1KU9A 1B59A 1KU3A 3HRSA 2RDPA 5ICGA 2JRTA 4HV6A 2HKXA 5D6FA 2VBWA 4ZZDA 4G7OF 2ZJ2A 4RGUA 1ZLJA 2F2EA 3LA2A 1G3WA 3M8EA 5CYVA 2H94A 4HF0A 4AD9A 3MZYA 1D3YA 1XGSA 3U1DA 2VXZA 1BJAA 2HTJA 1P2FA 1DP7P 1LJ9A 3F8NA 3HTUA 4WCGA 2O3FA 2P7CB 3PQJA 4MEYF 3NQOA 3RTRA 1H9TA 2FF4A 1S8NA 1SFXA 3RI4A 5HS8A 4MQVA 2V1XA 3M1EA 1C0WA 2DTRA 3MFKA 2RN7A 2A61A 2PEXA 1FYKA 3B02A 3F3XA 5JHUA 4ENNA 3Q9VA 3WU0A 2QZ8A 3E3VA 1QQIA 2FNPA 5ILSA 5TJJA 1R58A 5JVTA 2ZCWA 1IZ1A 3E6CC 2OQGA 4RGXA 4HLYA 4D0PA 2NYXA 1KU7A 2VOPA 1E2XA 4KIFA 1BN5A 3ZMDA 4CYDA 1KQ9A 4HX4A 4KA4A 3WGGA 1O7LA 2EWNA 1XMAA 4BH9A 2FRHA 2KIFA 4HLXA 2FBKA 1TLHB 1LDKB 4AIJA 3TKYA 1IN4A 1WI9A 4HW0A 4BXUA 2W24A 1WRJA 5DDGA 1WWXA 5BOXA 4BHBA 5FFZA 3F6VA 1GHCA 4KMFA 4LK0F 1MDMA 2M87A 3DFGA 5E1ZB 1AWCA 1K6OA 1YW8A 5LRRA 3QPTA 4ON0A 1B4AA 3IHUA 1FX7A 3KCCA 4LG0A 1SAXA 1IN6A 3ZMVA 4G7ZF 1PUEE 3JSPA 4Z2YA 2Q8KA 2QQAA 4IF4A 1L3LA 5KVRA 4BAYA 1YS7A 2XGXA 1TQMA 2V79A 2A6HF 1MGTA 2JZYA 5DYMA 2MC3A 4ENKA 1RUOA 1P4XA 1SMYF 4P5OA 3GZ5A 4EVIA 4L9NA 2QLZA 3T1BA 5BMZA 3GXOA 2OBPA 2YPRA 1XGNA 4ESFA 5DCFA 3ZN0A 1Z6RA 4OMZA 1FNNA 1IRFA 4RB1A 5ED4A 1KQ8A 5IT9K 3LA3A 3EYYA 3TO9A 4L9JA 2XAHA 1ULYA 1IXCA 4A5MA 2Z9OA 2LSOA 2VC0A 1ON1A 1T6SA 2VONA 1SFEA 4UNOA 4CO8A 1HSTA 1RIOH 1PP8F 1S3JA 2FE3A 3GFIA 3QP6A 3BJ6A 1SD5A 1YW7A 3WODF 5E8IA 1BC8C 1K78A 2NNNA 2V1DA 3QPHA 2FNAA 5IT9Z 2FBHA 1ON2A 2DQRA 4UVCA 4ZH4F 2J5PA 2EFQA 1IAWA 4KNYA 1BI2A 2MBFA 4U88A 1ZGAA 3CUOA 1P4AA 4BNCA 3FM3A 3LAJA 3WTVC 4WWCA 5TRDA 2ISZA 2RNJA 2P5LC 1Z6TA 2QUFA 5CVVA 4Q5SF 4Y17A 2XAGA 3Q5FA 1Z1DA 4JBAA 2G7HA 2D45A 3WTTC 3FM5A 3L09A 5DD4A 5CVRA 3WE2A 1FBUA 3SQNA 2KJBA 1LEBA 1ODDA 4RB3C 1SFUA 3MWMA 2DK5A 3B73A 2K4BA 1FT9A 3CDHA 4HOBA 3K1PA 1O3SA 3ERED 3U9GA 4Y13A 1LQ1A 2GIVA 2Y0MA 3FMRA 4R1HA 5K5OA 3T5XA 2OZUA 1OYIA 4KN7X 4YIFA 1KGSA 1T0FA 4G7HF 1I1SA 3P9CA 3KP5A 2H09A 2ELHA 4IHSA 5K1YA 3CLOA 2XAQA 1J0RA 1USSA 4KICA 3U2RA 4WXCA 3H92A 2O6GE 5LEJA 2WWYA 1W4MA 1QZYA 1XCBA 3E5XA 3RKXA 3MZHA 3GFJA 3RPUA 3BPXA 3GW2A 1USTA 1V3FA 4EV0A 2FBIA 3QAHA 5ICFA 5D4RA 3KEQA 2GWRA 1OKRA 1U3EM 2UXNA 4ESBA 2ZBKA 3R0AA 2QQBA 2ZMEB 2JPCA 4L5IA 2RVCA 2P8TA 4OIQF 3CO7C 5L3CA 4KIGA 4ESJA 5ILUA 2HKOA 4O5VA 3P9KA 1B9NA 2GA2A 1XGMA 4MQ9F 3IRRA 4EQQA 2F5CA 4GGGA 2IA1A 2KJCA 1U8RA 1IN7A 1KYZA 2ACJA 2RGVA 3BOQA 1J9IA 5ERIA 1FBQA 5DEQA 3FF5A 3LWFA 4KUMA 5CVJA 1IW7F 3WTXC 5HVQC 3LA7A 2M45A 3GYHX 5DV5A 1G3YA 4I09A 2L54A 1HKQA 1YYVA 3JAMZ 1G6NA 1F1ZA 1I6XA 3IL2A 4IRGA 3C3WA 4NB5A 1UB9A 1I27A 3Q9SA 3VEPA 1B9MA 1B6AA 3P9IA 1ZLKA 4JQFA 3WG9A 5L3GA 4HYEA 4UVAA 1E17A 5A2QK 3WGIA 2L4AA 5ICEA 2QBYB 1D8JA 3RKWA 1LDDA 4FHTA 1KQ0A 1R1VA 4ZYDA 4HDUA 2MLGA 2PMUA 1TW3A 1TQIA 3FHZA 4A12A 4WX9A 2L02A 5A2QZ 4I0BA 5E18F 2O8XA 3L9FA 4CZZA 3TQNA 3KLOA 4QLCU 3T8RA 4RAZA 4PGHA 1MKMA 2DW4A 4MTDA 2JTVA 4LJZF 1IXRC 1ZG1A 4A0XA 3WE3A 2EK5A 4OIPF 3GZ6A 3JSOA 1SMTA 1DPRA 1W5TA 1XN7A 2X0LA 2L01A 1ZYRF 1FZPB 1S6LA 3E5QA 1UFMA 1DDNA 1I5ZA 3LSTA 2KIMA 3TO7A 2ISYA 4IVNA 4UV8A 4A0YA 1HXDA 4IXAA 3KZYA 3KE2A 2FQ3A 1R7JA 3KP3A 3KP6A 3MAJA 2XIGA 2HOEA 5H20A 1BI3A 5JR3A 1LDJA 4ENMA 2OQRA 5DCMA 1QZZA 1REPC 4JK1X 3BROA 3FMSA 3TOBA 2RQPA 2GQQA 5L3FA 4HX8A 4P55A 3K69A 2Y48A 3HSEA 3H3UA 4A0ZA 4LFUA 4OU0A 3VOEA 2F5FA 1FOKA 3HRMA 3QOPA 1H9GA 1XB4A 1FP2A 1RUNA 2M1BA 3L2CA 2XKPA 3VB2A 5ICCA 3F23A 2ADUA 3DP7A 4EJVA 4M71A 3ABTA 2DT5A 3CO6C 2XRNA 3RJPA 3HHGA 3WTUC 2JSCA 4UVBA 2YSRA 1OYYA 1OPCA 1O3RA 4N0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXA A;  4ASN A;  5CVI A;  2QQ9 A;  3J80 K;  1ZRF A;  4DNC A;  4I7H A;  5AIQ A;  2IRF G;  3KLN A;  2DPU A;  3E97 A;  3LAP A;  4Q48 A;  1X3U A;  4CDG A;  1RNL A;  3F8F A;  3O6B B;  3J80 Z;  3WTW C;  2QYO A;  1HKT A;  3HYI A;  3KEO A;  4M6Y A;  1HW5 A;  3RYP A;  1HBX G;  1GVJ A;  2EFO A;  3BWG A;  2NRA C;  3ULQ B;  3IKT A;  1JHF A;  1F5T A;  5DUI A;  3I5U A;  4XSZ F;  2VOO A;  5L3D A;  5E1X A;  5FD6 A;  5LGN A;  3P7N A;  1V4R A;  1CF7 B;  4HX7 A;  1OR7 A;  4G94 A;  4LB5 A;  2ZNZ A;  2Z5U A;  1Z91 A;  2R3S A;  1Q1H A;  4M9X A;  4XLP F;  1BM9 A;  4HAM A;  3TDZ C;  3HRU A;  2OZ6 A;  1EH8 A;  3I59 A;  3GLX A;  4LD5 A;  3MQ0 A;  3RDI A;  3E6M A;  4OOI A;  1AOY A;  1P92 A;  1MZB A;  2D1H A;  2GZW A;  1R00 A;  2KRF A;  3RIR A;  3L00 A;  1CGP A;  3SFZ A;  1W7P B;  2A07 F;  1JGS A;  2XVC A;  3DEU A;  2CGP A;  2DQL A;  1FWZ A;  3N4M A;  1K7A A;  2DO7 A;  3KP2 A;  2STT A;  4E70 A;  1R1T A;  1U5T A;  3ISP A;  4BYY A;  4EJU A;  4CGZ A;  2J5O A;  4UUV A;  3CUQ A;  4MHG A;  4MGR A;  2F5E A;  2XUB A;  1T38 A;  4M9S A;  1MD0 A;  2BV6 A;  2BBY A;  5HLI A;  2PFB A;  1XGO A;  5J8C A;  1R5G A;  1SD7 A;  3TOA A;  5BQT A;  1A04 A;  2IP2 A;  2Z99 A;  3JW4 A;  2V1U A;  5H6R A;  2CQK A;  5LGT A;  3GUD A;  1L0O C;  3E5U A;  5FD5 A;  3T0Y A;  3PFI A;  3HHH A;  4WK8 F;  3G73 A;  3F8M A;  1ZN2 A;  1G4D A;  1H0M A;  4L9V A;  1IUY A;  1RI7 A;  3I4P A;  3KFW X;  2CO5 A;  4LB6 B;  2HTS A;  4HV5 A;  5D5X B;  3I64 A;  3HOS A;  4ZYG A;  3ROU A;  5AIP A;  1DUX C;  1R23 A;  2PBI A;  3D0S A;  3H3Z A;  4IJA A;  2IA2 A;  2F5D A;  5E20 A;  3N97 A;  2FU4 A;  5AON A;  4AVP A;  2D2W A;  3K0L A;  1EV7 A;  2TDX A;  4G6D A;  3M8F A;  1ZG3 A;  3WTY C;  3L7W A;  2HR3 A;  3O3K A;  3ZMU A;  1BIA A;  1O57 A;  5FGM A;  2Z33 A;  2VBZ A;  2CWE A;  5JI6 A;  3HRT A;  2HEO A;  2KKO A;  3S2W A;  3NRV A;  5D8K B;  2X4H A;  4U0V A;  4GYG A;  1QBJ A;  3EQL F;  4R8H A;  5EEG A;  2E1N A;  4IPA A;  1T39 A;  4LLN A;  4MNU A;  3M9A A;  4LK1 F;  1LNW A;  2LF8 A;  2EA2 A;  2XKO A;  4RB2 C;  2G9W A;  2DAO A;  3PQK A;  4UHT A;  5CVU A;  4BQA A;  2B0L A;  1OMI A;  2QVO A;  3DV8 A;  5L3E A;  1U78 A;  1O7F A;  3FMQ A;  4PCQ A;  2KIU A;  4K2E A;  2PJP A;  1J7K A;  2ESH A;  1MJB A;  2K86 A;  2V9V A;  5FFX A;  2K02 A;  4QWQ A;  1HSJ A;  4N9H A;  2M30 A;  3C7J A;  4WF2 A;  3FWE A;  3R4K A;  1T2K A;  4Q47 A;  2R7D A;  1FSE A;  2EV5 A;  3C18 A;  3EET A;  1S7O A;  4O6J A;  1FBS A;  2YX7 A;  3R60 A;  3TO6 A;  1WQ2 A;  2MD5 A;  1J59 A;  3LQQ A;  2W57 A;  1GXQ A;  3C1D A;  1MDM B;  3ZN1 A;  1O3Q A;  5H6Q A;  2XAJ A;  5LBQ A;  5HS9 A;  4B8X A;  4XBF A;  2WC2 A;  4LG0 B;  1BIB A;  1BI0 A;  3F6O A;  1QNT A;  5D5W B;  4S05 A;  2P5K A;  3FXQ A;  2FEZ A;  5BS6 A;  1R5H A;  1O3T A;  3IWF A;  4P96 A;  2W25 A;  2ETH A;  5LHG A;  1DPU A;  1XSD A;  2EV0 A;  1ZRC A;  3MCZ A;  1IF1 A;  3ELK A;  1ZG5 A;  4NQW A;  3QU6 A;  4OIN F;  4AIH A;  1R1U A;  1BBY A;  4HDV A;  2Z3Y A;  4WXD A;  2ZFW A;  2A6E F;  3V4G A;  3REO A;  3ZPL A;  2RV8 A;  3WTZ A;  2O61 A;  4RS8 A;  1UHM A;  2L4M A;  4M72 A;  2GXB A;  3HTS B;  3JTG A;  3J7A O;  2EJR A;  3DPL C;  1JHH A;  4L9T A;  3QP5 A;  3V8L A;  2XAF A;  2V6C A;  4PDK A;  2A69 F;  4M6X A;  4I2O A;  4XLN F;  2HDC A;  4HF2 A;  5J8F A;  2BE5 F;  3ABU A;  2CW0 F;  4GXO A;  1ZGJ A;  4RGS A;  5DUK A;  1HW2 A;  4KDP A;  1HKS A;  5D4S A;  4L18 B;  2P7V B;  2LDU A;  2FOK A;  1YQA A;  1XDS A;  2FMY A;  1K78 B;  1FC3 A;  3DF8 A;  1SD6 A;  4A2U A;  4KIB A;  4KYW A;  4S04 A;  4U7D A;  3SZP A;  2DU9 A;  1G3T A;  4RAY A;  3GO5 A;  2COM A;  4ETS A;  1IN5 A;  1QPM A;  2H27 A;  2FSW A;  4M9Z A;  2OD5 A;  2QM3 A;  2Y75 A;  1F4K A;  4KMU X;  4P9U A;  2EA4 A;  3R6S A;  1YTY A;  3CJN A;  4U0W A;  2QEN A;  3NEU A;  3V8K A;  4YFN F;  2P6S A;  4IRH A;  3GX4 X;  2ZXJ A;  2HQR A;  2HZT A;  5HDK A;  2HFH A;  2GA1 A;  1P6R A;  2IPQ X;  1ONV A;  3KP7 A;  3V7C A;  3ZMS A;  2IJL A;  4IRI A;  4PGG A;  2OA4 A;  2CYY A;  3I58 A;  4HQE A;  4AIK A;  1FP1 D;  1S29 A;  2E7X A;  3GF2 A;  5HOO A;  4UXN A;  4YG2 F;  5FLX K;  1FLI A;  1LB2 A;  5FO5 A;  4KN4 X;  1HQC A;  3ZP5 A;  3HOT A;  4M74 A;  5IT3 A;  3K1N A;  3O2P E;  5KK1 A;  2HQN A;  2VN2 A;  2EV6 A;  1PP7 U;  1NHA A;  4ZYE A;  3I71 A;  3WGH A;  2A3S A;  4G8X A;  3SHF A;  5FLX Z;  2EB7 A;  2IVM A;  4EJO A;  1D8K A;  2GXG A;  1PDN C;  3TDU C;  3IRQ A;  3OOP A;  4L0Z B;  3DQV C;  4I0A A;  2XHK A;  4B09 A;  3LQR A;  3K9T A;  1YFH A;  4EMS A;  3BY6 A;  2ZNY A;  5HDN A;  3V7S A;  5HLH A;  1ZRD A;  1EH6 A;  2HYF A;  5K5Q A;  3EDP A;  3WTS C;  4NHJ A;  3QU3 A;  1WSU A;  1ZHF A;  5DD8 A;  2JPB A;  3G3Z A;  3FXR A;  3GEZ A;  2RC4 A;  5D8L B;  4OMY A;  2G7U A;  3GWZ A;  3KET A;  5LLQ A;  2HGC A;  1TNS A;  2ZME A;  4A6D A;  2ZO4 A;  1FPQ A;  3BZ6 A;  2VC1 A;  1FYM A;  1ZAR A;  2H6B A;  2RKH A;  2Q0O A;  2WV0 A;  3I53 A;  3R61 A;  3IWZ A;  1MJA A;  4OIR F;  1F9N A;  4FX4 A;  1QGP A;  2DLL A;  2UXX A;  4RGR A;  5F64 A;  4U7B A;  3F8C A;  4ENJ A;  4EM0 B;  2ESN A;  4BHC A;  2PN6 A;  2A68 F;  2EFW A;  1BI1 A;  1XDU A;  3V7R A;  2NS0 A;  3DKW A;  1YO5 C;  3LFK A;  1B1B A;  1J5Y A;  3ZQ7 A;  4ZZL A;  4EGY A;  5JFR A;  4EJT A;  4HA8 A;  4PZJ A;  3FZV A;  4KFC A;  3RPQ A;  3VOD A;  4H0E A;  2IW5 A;  2C6Y A;  2XRO A;  2LKP A;  4EGZ A;  3BP8 A;  5LHH A;  1U5T C;  3CTA A;  2E7W A;  2QBY A;  3FXU A;  2VE8 A;  1Y0U A;  3W6K B;  3CUQ C;  4LGW A;  3D5L A;  1R36 A;  2LNB A;  3KP4 A;  3ML6 A;  3J81 K;  5HS7 A;  3EUH A;  1D5V A;  3F72 A;  2VBX A;  4L5J A;  4GCV A;  3ZMZ A;  3E6B A;  3F21 A;  2XAS A;  2EFP A;  1JXS A;  2MH9 A;  5HDG A;  2HS5 A;  3RYR A;  2P6T A;  1GXP A;  2W84 A;  1G3S A;  2UZK A;  1LVA A;  3J81 Z;  4HZF A;  2PQ8 A;  1XCV A;  1YIO A;  3SXY A;  4XRF A;  2EFN A;  4GO1 A;  2AXL A;  3IKV A;  4CHU A;  4AWX B;  2P5V A;  4LMY A;  2VT3 A;  2PMH A;  2NAZ A;  3HSF A;  3W6J B;  2P4W A;  1Z05 A;  3GFM A;  5J6X A;  3HUG A;  4M73 A;  4A6E A;  2PG4 A;  5LGU A;  1Z7U A;  4LLG F;  5DCM B;  3OV8 A;  4XSX F;  5CLS A;  2VOD A;  2K4J A;  1ZH5 A;  1ZAO A;  2LF7 A;  5LHI A;  4EM1 A;  3HSR A;  4FT8 A;  1LEA A;  3R0J A;  5L3B A;  4O3M A;  1YW9 A;  1OYW A;  2HWV A;  4R79 A;  3BJA A;  1Z9C A;  4EJW A;  1TW2 A;  4HBL A;  1UCR A;  2DK8 A;  2MA3 A;  2YU3 A;  4ZYH A;  3I54 A;  5CJ9 A;  4I02 A;  2CFX A;  1TBX A;  4G9Y A;  1IN8 A;  4RB0 A;  1R22 A;  5LEK A;  5E8G A;  1YLF A;  2E1C A;  3QRF F;  2CSO A;  1U6G A;  5BPD A;  2VT2 A;  4I98 B;  1EH7 A;  2OU2 A;  3M7G A;  3JTH A;  4F7Z A;  3VFZ A;  1YG2 A;  1P4W A;  4I01 A;  2XV4 S;  5BPI A;  2IT0 A;  3GVA A;  2MLK A;  4MTE A;  5F1R A;  1XD7 A;  2UWM A;  2A5Y B;  2O0Y A;  1KA8 A;  1KYW A;  4EM2 A;  2M8E A;  4IHT A;  1XSV A;  2FML A;  4MEX F;  2BYV E;  3TGN A;  2DFI A;  4A5N A;  4CIC A;  1I1G A;  5D6E A;  2DI3 A;  3AAF A;  1UHW A;  3ECO A;  3F8B A;  3SZT A;  3BJO A;  4KT5 C;  2QWW A;  5F6F A;  1WKM A;  4Q4Z F;  2Q2E A;  3DXJ F;  1XMK A;  4YFX F;  4DQ2 A;  5K5R A;  1TNT A;  2MH2 A;  4YII A;  2FA5 A;  1SD4 A;  4U0Y A;  2AS5 F;  2WTE A;  5LRS A;  1FYL A;  1MJ9 A;  1W5S A;  2O03 A;  3V8J A;  4WXH A;  3JAM K;  3HIF A;  1VTN C;  4YFK F;  1K79 A;  1FY7 A;  2JT1 A;  1IRG A;  1W7P D;  3FX3 A;  1CF7 A;  2YX4 A;  4GYI A;  2VBY A;  1XSX A;  1U2W A;  2HYG D;  3K2Z A;  2CG4 A;  3WU1 B;  1ZRE A;  3I59 B;  2ZKZ A;  2VE9 A;  5E17 F;  3ECH A;  2GAU A;  3GFL A;  4FX0 A;  4L0Y B;  3DPT A;  4TV7 A;  3COA C;  4HQM A;  2NNY A;  4P9F A;  1KU2 A;  5FB2 A;  1S7A A;  2OAZ A;  4OIO F;  6PAX A;  5D5U B;  4LLL A;  2STW A;  1W7P A;  4BHP A;  1J75 A;  2DPD A;  1U5T B;  2L3D A;  3E6D A;  1JE8 A;  3EYI A;  2BGC A;  2YR2 A;  3ZMT A;  3CUQ B;  2IA0 A;  3K1M A;  2R7F A;  4HF1 A;  5ILV A;  3KZZ A;  2BEO A;  2DBB A;  1T98 A;  3RKY A;  5E1W A;  1FSH A;  2PLY A;  2M5W A;  2D1V A;  1QO0 D;  4G6Q A;  2K7L A;  1IXS B;  1BOA A;  2H6C A;  3F22 A;  5EEH A;  3T8T A;  1J2X A;  3BDD A;  1RZ4 A;  3IC7 A;  4N9I A;  1TQP A;  1YS6 A;  3I0T A;  5HLG A;  5D5V B;  1HW1 A;  3MEX A;  1TTY A;  2K27 A;  4CXF A;  2W85 A;  1BC7 C;  4Y15 A;  4UV9 A;  1STZ A;  3BPV A;  2PI0 A;  1KU9 A;  1B59 A;  1KU3 A;  3HRS A;  2RDP A;  5ICG A;  2JRT A;  4HV6 A;  2HKX A;  5D6F A;  2VBW A;  4ZZD A;  4G7O F;  2ZJ2 A;  4RGU A;  1ZLJ A;  2F2E A;  3LA2 A;  1G3W A;  3M8E A;  5CYV A;  2H94 A;  4HF0 A;  4AD9 A;  3MZY A;  1D3Y A;  1XGS A;  3U1D A;  2VXZ A;  1BJA A;  2HTJ A;  1P2F A;  1DP7 P;  1LJ9 A;  3F8N A;  3HTU A;  4WCG A;  2O3F A;  2P7C B;  3PQJ A;  4MEY F;  3NQO A;  3RTR A;  1H9T A;  2FF4 A;  1S8N A;  1SFX A;  3RI4 A;  5HS8 A;  4MQV A;  2V1X A;  3M1E A;  1C0W A;  2DTR A;  3MFK A;  2RN7 A;  2A61 A;  2PEX A;  1FYK A;  3B02 A;  3F3X A;  5JHU A;  4ENN A;  3Q9V A;  3WU0 A;  2QZ8 A;  3E3V A;  1QQI A;  2FNP A;  5ILS A;  5TJJ A;  1R58 A;  5JVT A;  2ZCW A;  1IZ1 A;  3E6C C;  2OQG A;  4RGX A;  4HLY A;  4D0P A;  2NYX A;  1KU7 A;  2VOP A;  1E2X A;  4KIF A;  1BN5 A;  3ZMD A;  4CYD A;  1KQ9 A;  4HX4 A;  4KA4 A;  3WGG A;  1O7L A;  2EWN A;  1XMA A;  4BH9 A;  2FRH A;  2KIF A;  4HLX A;  2FBK A;  1TLH B;  1LDK B;  4AIJ A;  3TKY A;  1IN4 A;  1WI9 A;  4HW0 A;  4BXU A;  2W24 A;  1WRJ A;  5DDG A;  1WWX A;  5BOX A;  4BHB A;  5FFZ A;  3F6V A;  1GHC A;  4KMF A;  4LK0 F;  1MDM A;  2M87 A;  3DFG A;  5E1Z B;  1AWC A;  1K6O A;  1YW8 A;  5LRR A;  3QPT A;  4ON0 A;  1B4A A;  3IHU A;  1FX7 A;  3KCC A;  4LG0 A;  1SAX A;  1IN6 A;  3ZMV A;  4G7Z F;  1PUE E;  3JSP A;  4Z2Y A;  2Q8K A;  2QQA A;  4IF4 A;  1L3L A;  5KVR A;  4BAY A;  1YS7 A;  2XGX A;  1TQM A;  2V79 A;  2A6H F;  1MGT A;  2JZY A;  5DYM A;  2MC3 A;  4ENK A;  1RUO A;  1P4X A;  1SMY F;  4P5O A;  3GZ5 A;  4EVI A;  4L9N A;  2QLZ A;  3T1B A;  5BMZ A;  3GXO A;  2OBP A;  2YPR A;  1XGN A;  4ESF A;  5DCF A;  3ZN0 A;  1Z6R A;  4OMZ A;  1FNN A;  1IRF A;  4RB1 A;  5ED4 A;  1KQ8 A;  5IT9 K;  3LA3 A;  3EYY A;  3TO9 A;  4L9J A;  2XAH A;  1ULY A;  1IXC A;  4A5M A;  2Z9O A;  2LSO A;  2VC0 A;  1ON1 A;  1T6S A;  2VON A;  1SFE A;  4UNO A;  4CO8 A;  1HST A;  1RIO H;  1PP8 F;  1S3J A;  2FE3 A;  3GFI A;  3QP6 A;  3BJ6 A;  1SD5 A;  1YW7 A;  3WOD F;  5E8I A;  1BC8 C;  1K78 A;  2NNN A;  2V1D A;  3QPH A;  2FNA A;  5IT9 Z;  2FBH A;  1ON2 A;  2DQR A;  4UVC A;  4ZH4 F;  2J5P A;  2EFQ A;  1IAW A;  4KNY A;  1BI2 A;  2MBF A;  4U88 A;  1ZGA A;  3CUO A;  1P4A A;  4BNC A;  3FM3 A;  3LAJ A;  3WTV C;  4WWC A;  5TRD A;  2ISZ A;  2RNJ A;  2P5L C;  1Z6T A;  2QUF A;  5CVV A;  4Q5S F;  4Y17 A;  2XAG A;  3Q5F A;  1Z1D A;  4JBA A;  2G7H A;  2D45 A;  3WTT C;  3FM5 A;  3L09 A;  5DD4 A;  5CVR A;  3WE2 A;  1FBU A;  3SQN A;  2KJB A;  1LEB A;  1ODD A;  4RB3 C;  1SFU A;  3MWM A;  2DK5 A;  3B73 A;  2K4B A;  1FT9 A;  3CDH A;  4HOB A;  3K1P A;  1O3S A;  3ERE D;  3U9G A;  4Y13 A;  1LQ1 A;  2GIV A;  2Y0M A;  3FMR A;  4R1H A;  5K5O A;  3T5X A;  2OZU A;  1OYI A;  4KN7 X;  4YIF A;  1KGS A;  1T0F A;  4G7H F;  1I1S A;  3P9C A;  3KP5 A;  2H09 A;  2ELH A;  4IHS A;  5K1Y A;  3CLO A;  2XAQ A;  1J0R A;  1USS A;  4KIC A;  3U2R A;  4WXC A;  3H92 A;  2O6G E;  5LEJ A;  2WWY A;  1W4M A;  1QZY A;  1XCB A;  3E5X A;  3RKX A;  3MZH A;  3GFJ A;  3RPU A;  3BPX A;  3GW2 A;  1UST A;  1V3F A;  4EV0 A;  2FBI A;  3QAH A;  5ICF A;  5D4R A;  3KEQ A;  2GWR A;  1OKR A;  1U3E M;  2UXN A;  4ESB A;  2ZBK A;  3R0A A;  2QQB A;  2ZME B;  2JPC A;  4L5I A;  2RVC A;  2P8T A;  4OIQ F;  3CO7 C;  5L3C A;  4KIG A;  4ESJ A;  5ILU A;  2HKO A;  4O5V A;  3P9K A;  1B9N A;  2GA2 A;  1XGM A;  4MQ9 F;  3IRR A;  4EQQ A;  2F5C A;  4GGG A;  2IA1 A;  2KJC A;  1U8R A;  1IN7 A;  1KYZ A;  2ACJ A;  2RGV A;  3BOQ A;  1J9I A;  5ERI A;  1FBQ A;  5DEQ A;  3FF5 A;  3LWF A;  4KUM A;  5CVJ A;  1IW7 F;  3WTX C;  5HVQ C;  3LA7 A;  2M45 A;  3GYH X;  5DV5 A;  1G3Y A;  4I09 A;  2L54 A;  1HKQ A;  1YYV A;  3JAM Z;  1G6N A;  1F1Z A;  1I6X A;  3IL2 A;  4IRG A;  3C3W A;  4NB5 A;  1UB9 A;  1I27 A;  3Q9S A;  3VEP A;  1B9M A;  1B6A A;  3P9I A;  1ZLK A;  4JQF A;  3WG9 A;  5L3G A;  4HYE A;  4UVA A;  1E17 A;  5A2Q K;  3WGI A;  2L4A A;  5ICE A;  2QBY B;  1D8J A;  3RKW A;  1LDD A;  4FHT A;  1KQ0 A;  1R1V A;  4ZYD A;  4HDU A;  2MLG A;  2PMU A;  1TW3 A;  1TQI A;  3FHZ A;  4A12 A;  4WX9 A;  2L02 A;  5A2Q Z;  4I0B A;  5E18 F;  2O8X A;  3L9F A;  4CZZ A;  3TQN A;  3KLO A;  4QLC U;  3T8R A;  4RAZ A;  4PGH A;  1MKM A;  2DW4 A;  4MTD A;  2JTV A;  4LJZ F;  1IXR C;  1ZG1 A;  4A0X A;  3WE3 A;  2EK5 A;  4OIP F;  3GZ6 A;  3JSO A;  1SMT A;  1DPR A;  1W5T A;  1XN7 A;  2X0L A;  2L01 A;  1ZYR F;  1FZP B;  1S6L A;  3E5Q A;  1UFM A;  1DDN A;  1I5Z A;  3LST A;  2KIM A;  3TO7 A;  2ISY A;  4IVN A;  4UV8 A;  4A0Y A;  1HXD A;  4IXA A;  3KZY A;  3KE2 A;  2FQ3 A;  1R7J A;  3KP3 A;  3KP6 A;  3MAJ A;  2XIG A;  2HOE A;  5H20 A;  1BI3 A;  5JR3 A;  1LDJ A;  4ENM A;  2OQR A;  5DCM A;  1QZZ A;  1REP C;  4JK1 X;  3BRO A;  3FMS A;  3TOB A;  2RQP A;  2GQQ A;  5L3F A;  4HX8 A;  4P55 A;  3K69 A;  2Y48 A;  3HSE A;  3H3U A;  4A0Z A;  4LFU A;  4OU0 A;  3VOE A;  2F5F A;  1FOK A;  3HRM A;  3QOP A;  1H9G A;  1XB4 A;  1FP2 A;  1RUN A;  2M1B A;  3L2C A;  2XKP A;  3VB2 A;  5ICC A;  3F23 A;  2ADU A;  3DP7 A;  4EJV A;  4M71 A;  3ABT A;  2DT5 A;  3CO6 C;  2XRN A;  3RJP A;  3HHG A;  3WTU C;  2JSC A;  4UVB A;  2YSR A;  1OYY A;  1OPC A;  1O3R A;  4N0B A; 
#chains in the Genus database with same CATH topology
 2LC2 A;  2FXA A;  4ASN A;  5CVI A;  2BXZ A;  2QQ9 A;  5IOZ A;  1H8A C;  3J80 K;  1GDT A;  1ZRF A;  2HOS A;  1EF4 A;  4PJ0 C;  2Y0S A;  3P5J A;  4DNC A;  4I7H A;  3CCQ I;  2XPU A;  5AIQ A;  4BXF A;  2NOJ B;  5FKK A;  2IRF G;  3KLN A;  4PJJ A;  2DPU A;  3E97 A;  3HGG A;  3LAP A;  4Q48 A;  2R0Q C;  1T33 A;  4KIS A;  1OCC H;  1B72 B;  4AYB N;  4DYQ A;  1X3U A;  2R7O A;  4CDG A;  4AM3 A;  3OS2 A;  1RNL A;  2Q2E B;  4PJL A;  2B7E A;  3F8F A;  5KNL A;  3O6B B;  3J80 Z;  3WTW C;  2QYO A;  1HKT A;  5GPC A;  1K4T A;  3KZI C;  3HYI A;  2RNG A;  3KEO A;  4X6A J;  4M6Y A;  2IS2 A;  4OAZ A;  4XOT A;  1HW5 A;  5M3M J;  3RYP A;  1HBX G;  3BLY A;  4M6V A;  1GVJ A;  2EFO A;  3BWG A;  2NRA C;  3ULQ B;  3IKT A;  3FXM A;  4A3I J;  1OR7 C;  1UMQ A;  1JHF A;  2R7Z J;  2W7N A;  4E4H A;  2BY0 A;  2MW8 A;  4BY7 J;  5DUI A;  1F5T A;  4ZYA A;  2M9H A;  2DOD A;  3I5U A;  1JKR C;  1TWF J;  2H8R A;  4C2U A;  3GTG J;  2LY2 A;  4XSZ F;  5L3D A;  1A36 A;  2VOO A;  1ETX A;  5E1X A;  3A4C A;  2N8G A;  5FD6 A;  2F4I A;  5LGN A;  3OL3 A;  3P7N A;  1V4R A;  1CF7 B;  3GZN B;  4HX7 A;  1OR7 A;  2CQX A;  3OYC A;  2CMP A;  2X51 A;  2LYC A;  2MGQ A;  4G94 A;  4LB5 A;  5F0F A;  3KEY A;  2COB A;  5F1J A;  5E3O A;  2ZNZ A;  2Z5U A;  1Z91 A;  2R3S A;  3MMY B;  1Q1H A;  4GRI A;  4M9X A;  4XLP F;  1WPK A;  1BM9 A;  1HDP A;  4HAM A;  3TDZ C;  2VKV A;  3HRU A;  4Y3O A;  2OZ6 A;  1MMA A;  4E7K A;  5K7H A;  1EH8 A;  2Y0S N;  1JJ8 C;  2K40 A;  3I59 A;  3VPR A;  3GLX A;  4BS9 A;  4BUP A;  3MKL A;  2MC4 A;  4LD5 A;  1OIS A;  3MQ0 A;  4XOP A;  4PK4 A;  1MBH A;  4A3J J;  1LE8 A;  3RDI A;  3E6M A;  2AHQ A;  4OOI A;  1XPX A;  4LIT A;  1AOY A;  1P92 A;  1MZB A;  1I39 A;  2D1H A;  2GZW A;  1R00 A;  2KRF A;  3I9V 2;  3L00 A;  3Q0V A;  3RIR A;  1CGP A;  1MSE C;  3SFZ A;  4UB6 C;  1D1B A;  2NXN B;  3LSM A;  1VQL I;  1W7P B;  2A07 F;  3S3O A;  1JGS A;  1GLN A;  2JA8 J;  2R5Z B;  2XVC A;  4UUS B;  3DEU A;  2CGP A;  2DQL A;  1FWZ A;  2K9Q A;  3HL2 A;  1WHU A;  5C4X J;  4CCM A;  4DBQ A;  1B8I B;  3N4M A;  2XSD C;  2DO7 A;  3M07 A;  1K7A A;  1X19 A;  3KP2 A;  2ZJQ F;  2STT A;  1WI3 A;  3Q0W A;  2WY7 Q;  4E70 A;  1R1T A;  1U5T A;  3ISP A;  4BYY A;  4EJU A;  2E1M B;  4XNF A;  4CGZ A;  2Y9Y A;  2QEX I;  4IQ4 A;  2X48 A;  3DEW A;  2J5O A;  3OS1 A;  4UUV A;  3CUQ A;  1R4M B;  1Z7L A;  4MHG A;  4MGR A;  2F5E A;  2ELJ A;  2XUB A;  3BR6 A;  3UNG C;  1T38 A;  4M9S A;  1V5G A;  3J7A Y;  1MD0 A;  2BV6 A;  3OIP A;  3AG1 H;  4V2G A;  2BBY A;  5HLI A;  2PFB A;  2EBI A;  3L2Q A;  3SJM A;  1XGO A;  5J8C A;  3FKI J;  1R5G A;  1SD7 A;  4RAF A;  4F52 A;  1MBE A;  3J7Y J;  3TOA A;  2XGC A;  2KDO A;  5BQT A;  1MND A;  3B6A A;  1A04 A;  2IP2 A;  5IY5 H;  4PSX A;  2Z99 A;  5M5W J;  3JW4 A;  2KDZ A;  1ZR2 A;  4XLC A;  2V1U A;  4LG3 A;  5H6R A;  3UR3 C;  3RZD J;  2CQK A;  5LGT A;  3GUD A;  3K2A A;  1L0O C;  3E5U A;  3S2D J;  5FD5 A;  3T0Y A;  3RCO A;  3PFI A;  2IBD A;  3HHH A;  4WK8 F;  3JRB A;  1LPQ A;  3G73 A;  4HRI A;  3F8M A;  1ZN2 A;  1AU7 A;  2K5C A;  4M3D A;  1MSF C;  1G4D A;  3HC7 A;  1ZTR A;  4XM3 A;  4YIR X;  1H0M A;  2IAI A;  4L9V A;  1IUY A;  1RI7 A;  2WAQ A;  3I4P A;  1I3Q J;  1WJA A;  2K9M A;  2CO5 A;  2ZSI B;  3KFW X;  4LB6 B;  5C44 J;  5IYD J;  2R5Y A;  5GAH J;  1GUU A;  2HTS A;  4HV5 A;  5D5X B;  3I64 A;  4CSW A;  3HOS A;  1R5I D;  4ZYG A;  1FMW A;  1BW5 A;  3ROU A;  5AIP A;  1DUX C;  3BG3 A;  1R23 A;  1WGX A;  2PBI A;  3D0S A;  2DA5 A;  3H3Z A;  4IJA A;  2IA2 A;  1N25 A;  2F5D A;  5E20 A;  4FQG A;  2DA7 A;  3N97 A;  2FU4 A;  5AON A;  4AVP A;  3BR5 A;  3CP8 A;  2VLA A;  1T0F C;  2D2W A;  3K0L A;  1EV7 A;  1XX5 A;  2TDX A;  4G6D A;  3M8F A;  1ZG3 A;  3FK6 A;  3WTY C;  3L7W A;  2HR3 A;  3O3K A;  3RSN A;  3ZMU A;  1BIA A;  2BHY A;  1O57 A;  4JOM A;  5FGM A;  4P1W A;  2Z33 A;  2VBZ A;  2CWE A;  1T8I A;  5JI6 A;  3HRT A;  2EQR A;  2HEO A;  2KKO A;  3S2W A;  3CCV I;  3W6V A;  3NRV A;  4BQQ A;  4XQF A;  5GAG J;  4PFP A;  2UV1 A;  5D8K B;  3G1M A;  3K70 C;  4N4N B;  1LVK A;  2X4H A;  5B66 C;  1SVM A;  2HVR A;  4U0V A;  1R71 A;  3GLL A;  1OLT A;  4Y7N J;  2R7Q A;  4GYG A;  1QBJ A;  1YRN A;  1IJW C;  3EQL F;  2YUS A;  4R8H A;  5EEG A;  2E1N A;  4IPA A;  1T39 A;  1MBG A;  2Y2Z A;  4MNU A;  4BKX A;  4LLN A;  2RAE A;  3O8G A;  1SEU A;  3M9A A;  4LK1 F;  4QTR A;  1LNW A;  4RA2 A;  2CW7 A;  2LF8 A;  2DYR H;  2JUC A;  2NVY J;  2EA2 A;  2XKO A;  4DZJ A;  4A3D J;  4RB2 C;  2G9W A;  5TGT A;  2DAO A;  3PQK A;  4UHT A;  5CVU A;  4XKW A;  4HPQ A;  1ZK8 A;  3AKZ A;  1ETY A;  4BQA A;  1XS9 A;  2P81 A;  3S8P A;  2B0L A;  1BL0 A;  4E7H A;  1OMI A;  1VQM I;  1YJN I;  2QVO A;  3DV8 A;  5L3E A;  3QYF A;  1UEL B;  2WAQ N;  5J4Y A;  5LD2 C;  3SYT A;  1U78 A;  5J3L A;  1O7F A;  3FMQ A;  4PCQ A;  2KIU A;  3CCL I;  4K2E A;  1EJ9 A;  2LBF B;  3CQZ J;  3K4M A;  5IPA A;  2IEK A;  3ZRG A;  3S1Q J;  4U87 A;  2PJP A;  1J7K A;  2ESH A;  1MJB A;  2K86 A;  3OR2 C;  2V9V A;  5FFX A;  2K02 A;  2HPI A;  2W82 A;  4QWQ A;  4B3A A;  1VZ0 A;  2L2O A;  1HSJ A;  4N9H A;  2M30 A;  3C7J A;  3E0J B;  4WF2 A;  3FWE A;  3MKY B;  3OYG A;  2V1N A;  3R4K A;  1T2K A;  4Q47 A;  2PX9 A;  5GTI C;  2R7D A;  3DPU A;  3FIS A;  4D9J A;  5GTH C;  1J09 A;  5DTD A;  4Y52 J;  1FSE A;  2HDD A;  2EV5 A;  1E3O C;  2F4O B;  1K83 J;  3C18 A;  2V4J C;  3EET A;  1BR4 A;  1S7O A;  2FQ4 A;  4O6J A;  1FBS A;  2YX7 A;  3R60 A;  3TO6 A;  3L1P A;  1WQ2 A;  4XR6 A;  1ITY A;  1HC8 A;  2MD5 A;  1LFP A;  2KPM A;  1J59 A;  3LQQ A;  5F08 A;  1KZH A;  2QKM B;  4RLF A;  3VYU B;  2W57 A;  1GXQ A;  3C1D A;  1IC8 A;  1U0J A;  1MDM B;  2DOF A;  2EZK A;  3ZN1 A;  2X6W A;  1O3Q A;  4AUX A;  2F5V A;  2E5N A;  3NAR A;  4IL6 C;  5H6Q A;  2XAJ A;  5LBQ A;  5HS9 A;  4B8X A;  4XBF A;  2A5W A;  2WC2 A;  1ENH A;  4IEJ A;  1RC9 A;  3CF2 A;  2CRG A;  4LG0 B;  1BIB A;  2R7R A;  1BI0 A;  3F6O A;  1QNT A;  2Q1Z B;  5D5W B;  4S05 A;  2P5K A;  3FXQ A;  2FEZ A;  1IO2 A;  5BS6 A;  2VB6 A;  1R5H A;  1O3T A;  4ANJ A;  3DLA A;  1UZC A;  2WAF A;  3IWF A;  4P96 A;  4X0G A;  2W25 A;  2ETH A;  5LHG A;  1DPU A;  1XSD A;  2EV0 A;  1ZRC A;  3MCZ A;  1IF1 A;  3ELK A;  1ZG5 A;  4NQW A;  3QU6 A;  4NC7 A;  4OIN F;  4BDY A;  4AIH A;  1R1U A;  1VQ4 I;  1BBY A;  4HDV A;  2Z3Y A;  4WXD A;  2E71 A;  4B43 A;  2ZFW A;  3CCY A;  2A6E F;  3V4G A;  1LKX A;  2LH9 A;  3REO A;  4BJ5 C;  3ZPL A;  2RV8 A;  3K4J A;  3LOC A;  5HNF A;  3WTZ A;  1W0T A;  2O61 A;  2L9S A;  1ETK A;  2A05 A;  4RS8 A;  3S32 A;  3VYR B;  1UHM A;  2E35 A;  2L4M A;  4M72 A;  2WA0 A;  3HTS B;  2GXB A;  3JTG A;  3J7A O;  4IOA F;  2EJR A;  2CS3 A;  2X1E A;  3D5R C;  1JHH A;  3DPL C;  3H35 A;  1D0Z A;  4L9T A;  3QP5 A;  3V8L A;  2R93 J;  2XAF A;  4BBS J;  2V6C A;  4PDK A;  2A69 F;  3CJT B;  3CP2 A;  4M6X A;  3W3C A;  4I99 C;  5FKL A;  4I2O A;  2HXI A;  4A3C J;  2DCE A;  4XLN F;  1VF9 A;  4NBQ A;  2HDC A;  4HF2 A;  5J8F A;  2BE5 F;  3ABU A;  2CW0 F;  4GXO A;  1ZGJ A;  4RGS A;  5K7Z A;  5DUK A;  4BEH A;  2LRD A;  3PNT A;  2HYJ A;  3JR9 A;  1S72 I;  4V19 K;  3I4N J;  5FRO A;  3ABM H;  1RES A;  4FTH A;  3SEQ A;  1HW2 A;  4KDP A;  1HKS A;  5D4S A;  4L18 B;  3OYJ A;  2FJ1 A;  2P7V B;  2LDU A;  5FRM A;  2LK2 A;  2FOK A;  3SEZ A;  5C4J J;  1YQA A;  1XDS A;  2FMY A;  1K78 B;  1FC3 A;  2HVQ A;  3DF8 A;  1SD6 A;  4A2U A;  3CCJ I;  4KIB A;  2IS6 A;  4KYW A;  2E2H J;  4S04 A;  2CUE A;  5EZH A;  5GAE J;  3MKZ A;  2KZG A;  4U7D A;  3SZP A;  4DYR A;  2DU9 A;  1QVU A;  4CCL A;  5FKM A;  2V26 A;  3JRA A;  1G3T A;  2CJJ A;  4F93 B;  4RAY A;  3GO5 A;  2COM A;  3G2B A;  3PUF A;  2VJ4 A;  4ETS A;  1IN5 A;  3SZG A;  4B4C A;  2L7F P;  4B47 A;  1QPM A;  1FOW A;  2H27 A;  2FSW A;  4M9Z A;  2OD5 A;  1AHD P;  2QM3 A;  2Y75 A;  4CCO A;  4KMU X;  1F4K A;  4P9U A;  2EA4 A;  3DKY A;  1V54 H;  2DMT A;  3R6S A;  2WV1 A;  3CJN A;  4U0W A;  1YTY A;  2QEN A;  3ASO H;  3CME I;  3NEU A;  3V8K A;  4YFN F;  2P6S A;  2R7U A;  4BAC A;  1VFC A;  4IRH A;  3GX4 X;  5EYR A;  2ZXJ A;  3IAS 2;  2HQR A;  3HPG A;  1QHG A;  2RRE A;  2HZT A;  3KYL A;  5B3S H;  5HDK A;  4E7I A;  2HFH A;  2GA1 A;  1P6R A;  2IPQ X;  1ONV A;  3KP7 A;  3V7C A;  5CKT A;  2DA6 A;  2EIL H;  2IJL A;  2Z16 A;  3OOU A;  4PGG A;  3ZMS A;  4IRI A;  5HOD A;  2OA4 A;  2VIX A;  4RDU A;  1VQ6 I;  2CYY A;  3I58 A;  4HQE A;  4AIK A;  1FP1 D;  2ICW G;  2IGM A;  4M3G A;  1ZQ3 P;  1S29 A;  2E7X A;  3BZC A;  3K4C A;  3GF2 A;  3I3L A;  5HOO A;  2M7A A;  4UXN A;  4YG2 F;  5FLX K;  3S3M A;  1JT0 A;  1FLI A;  1LB2 A;  2R92 J;  5FO5 A;  1VQN I;  4KN4 X;  1T56 A;  1HQC A;  1TWH J;  5IP7 J;  3ZP5 A;  2NVQ J;  3HOT A;  3EUA A;  4M74 A;  5IT3 A;  4XRS A;  3PIO F;  3K1N A;  3O2P E;  1M1E B;  5KK1 A;  2HQN A;  2VN2 A;  1HCR A;  2EV6 A;  1PP7 U;  1NHA A;  4ZYE A;  2EZH A;  3I71 A;  3WGH A;  2FOW A;  1MIJ A;  1XC5 A;  2A3S A;  2VKE A;  2W1O A;  2DA4 A;  4G8X A;  3SHF A;  1HDD C;  1WH7 A;  5FLX Z;  2M4G A;  2EB7 A;  1WFX A;  2IVM A;  4G12 A;  1D8K A;  4EJO A;  3A02 A;  1JT6 A;  2GXG A;  1PDN C;  4RLQ A;  3TDU C;  3IRQ A;  3S17 J;  1G2H A;  3OOP A;  4L0Z B;  3DQV C;  3PJR A;  4I0A A;  2XHK A;  4B09 A;  3LQR A;  2LD5 A;  1YX5 A;  1NG7 A;  3LL7 A;  3PFY A;  3AFH A;  5KAF C;  3C2B A;  5EEA A;  3JRH A;  1P9Q C;  3K9T A;  2KZV A;  4XLA A;  1YFH A;  1K4S A;  4EMS A;  4CYC B;  3BY6 A;  1WJE A;  2ZNY A;  5HDN A;  3V7S A;  4XKV A;  3S2H J;  5HLH A;  1ZRD A;  1EH6 A;  2HYF A;  3IH2 A;  3LSR A;  5K5Q A;  3EDP A;  3WTS C;  2BHZ A;  4NHJ A;  3QU3 A;  1WSU A;  1ZHF A;  5DD8 A;  3BG7 A;  4C2T A;  3KIO A;  1OQY A;  2V9K A;  5GPA A;  3A03 A;  3U1K A;  1IUF A;  2F4M B;  2JPB A;  5FLV A;  3G3Z A;  2ZME C;  1SFO J;  3FXR A;  1QA6 A;  5IP9 J;  1Z0X A;  3GEZ A;  2RC4 A;  2PJR A;  5D8L B;  4OMY A;  4S0H B;  2G7U A;  2OPT A;  3DTI A;  3GWZ A;  3KET A;  4ITV A;  2HGC A;  5LLQ A;  1TNS A;  2ZME A;  4IHY A;  2ELK A;  1FOY A;  4A6D A;  2ZO4 A;  1FPQ A;  4DW6 A;  1Y56 A;  3BZ6 A;  4MO7 A;  3NWT A;  2VC1 A;  2ID6 A;  1FYM A;  1ZAR A;  1UJ8 A;  2ECB A;  2KMU A;  1ZEL A;  2H6B A;  3FXK A;  2ECC A;  2RKH A;  1OCR H;  2Q0O A;  2WV0 A;  1DP3 A;  3VYT B;  3I53 A;  3H5A A;  1BJZ A;  2R7X A;  3ONQ A;  3GTQ J;  4CUG A;  2Y69 H;  3R61 A;  3DTK A;  3IWZ A;  4NC8 A;  1MJA A;  4OIR F;  4XK4 A;  3HG9 A;  1F9N A;  4FX4 A;  1QGP A;  2DLL A;  5KCM A;  2UXX A;  4RGR A;  1BW6 A;  5F64 A;  4U7B A;  3F8C A;  4ENJ A;  4EM0 B;  2ESN A;  4M3B A;  2VPL A;  4BHC A;  2PN6 A;  4D7M A;  4XLH A;  2A68 F;  1WZ2 A;  2WAE A;  2EFW A;  1BI1 A;  1XDU A;  5FLM J;  2KFD A;  3OYE A;  3V7R A;  2NS0 A;  2DFE A;  3DKW A;  1YO5 C;  4IHV A;  2O5R A;  4JX5 A;  1DU6 A;  5CPR B;  1K61 A;  3RQ4 A;  1R49 A;  3LFK A;  1B1B A;  1J5Y A;  1KON A;  3ZQ7 A;  4ZZL A;  5B1B H;  4D5C A;  4EGY A;  4UB8 C;  2NOG A;  2KIS A;  4C3H J;  1SC7 A;  5JFR A;  4EJT A;  4HA8 A;  4PZJ A;  3HBL A;  3FZV A;  3FK7 A;  2X85 A;  4KFC A;  3RPQ A;  3VOD A;  3CMM A;  4C30 A;  3CCS I;  2O8K A;  1XMX A;  4XL9 A;  4H0E A;  1OFC X;  2IW5 A;  3H0G J;  2C6Y A;  2XRO A;  3LSG A;  1BR2 A;  2LKP A;  4PUS A;  4E7S A;  5C3E J;  4EGZ A;  3BP8 A;  5LHH A;  2GOX B;  3CD6 I;  1U5T C;  3CTA A;  2E7W A;  2QBY A;  2JUG A;  3FXU A;  2VE8 A;  4XKB A;  2ME0 A;  1Y0U A;  1RET A;  3W6K B;  3CUQ C;  4LGW A;  3D5L A;  1R36 A;  1X58 A;  2DA1 A;  2LNB A;  3CES A;  4F55 A;  3KP4 A;  3ML6 A;  3J81 K;  5HS7 A;  3EUH A;  1D5V A;  4ZJZ A;  3OYH A;  1N78 A;  2ZXW H;  2V9P A;  2EZL A;  2O9L A;  3F72 A;  2VBX A;  4L5J A;  2ZB9 A;  4GCV A;  4B48 A;  1ORK A;  1VI0 A;  4BDZ A;  2IGK A;  3OS0 A;  3ZMZ A;  3H0D A;  3E6B A;  1ETO A;  2XB5 A;  2VKH A;  3F21 A;  4F92 B;  2XAS A;  4J19 A;  2EFP A;  1JXS A;  4LOC A;  4F91 B;  2HZD A;  2MH9 A;  5EG0 B;  5HDG A;  2HS5 A;  3RYR A;  2P6T A;  1GXP A;  2QF7 A;  2W84 A;  3G1L A;  2HOT A;  4FCY A;  3CJQ B;  1T95 A;  1G3S A;  2UZK A;  1LVA A;  3J81 Z;  2CV1 A;  4HZF A;  2PQ8 A;  3PL8 A;  1XCV A;  1YIO A;  2E19 A;  2NVT J;  3SXY A;  3TED A;  4FE4 A;  4XRF A;  2EFN A;  1JKQ C;  2Y30 A;  4GO1 A;  2AXL A;  3IKV A;  3KX2 A;  4NNJ A;  5IP6 A;  4CHU A;  1QZE A;  2IGN A;  4AWX B;  4BQO A;  2P5V A;  2E34 A;  1G59 A;  4LMY A;  4ZC3 A;  2L7K A;  2W48 A;  3HEF A;  1H89 C;  1JUM A;  2XSJ C;  2VT3 A;  2DA2 A;  3BG9 A;  2CUJ A;  3AL0 C;  4HNU A;  2BZT A;  1VQ9 I;  2NVX J;  2PMH A;  3HJE A;  3PM1 A;  2NAZ A;  3HSF A;  3W6J B;  3PNV A;  2P4W A;  2HPM A;  1Z05 A;  2XDV A;  3GFM A;  4II3 A;  3HUG A;  1MNE A;  1WJD A;  5J6X A;  4UY8 I;  4M73 A;  2VUM J;  4A6E A;  2PG4 A;  5LGU A;  1Z7U A;  3JRI A;  4LLG F;  4IKF A;  1SAU A;  5DCM B;  3OV8 A;  2CW8 A;  1IDZ A;  4XSX F;  4BQN A;  2BY2 A;  2HU9 A;  5CLS A;  2VOD A;  2K4J A;  2LMD A;  4LIV A;  1ZH5 A;  1ZAO A;  3FKJ A;  4XOR A;  3BR1 A;  2LF7 A;  5LHI A;  1PYV A;  3KYC B;  1Y1V J;  4EM1 A;  1QU3 A;  3HSR A;  4FT8 A;  1LEA A;  3R0J A;  5L3B A;  4O3M A;  5J4V A;  2DT6 A;  3O8H A;  1YW9 A;  1OYW A;  4A3B J;  5K7F A;  2HWV A;  2BW3 B;  2VKD A;  4R79 A;  2M0C A;  1AKH A;  2F6C A;  3BJA A;  5M5X J;  1Z9C A;  4EJW A;  1TW2 A;  4HBL A;  1UCR A;  1NK3 P;  3S93 A;  3MD2 A;  2HQA A;  2DK8 A;  1WJ5 A;  2M2E A;  3RPU D;  4E7Z A;  1TWA J;  4A3G J;  5F0H A;  2MA3 A;  2YU3 A;  3J7Z I;  4PSW A;  4ZYH A;  1QRY A;  3I54 A;  5CJ9 A;  4I02 A;  2CFX A;  3A01 A;  1PUF B;  5F0C A;  1TBX A;  2LVS A;  3VDX A;  4G9Y A;  1IN8 A;  2K9L A;  4RB0 A;  3IV5 A;  3ABL H;  1R22 A;  5LEK A;  5E8G A;  3K6G A;  1WJC A;  1YLF A;  2K3P A;  5E3M A;  2E1C A;  3QRF F;  2CSO A;  1U6G A;  4FE7 A;  5BPD A;  3LSP A;  2VT2 A;  4Z6Y A;  2DYS H;  1IGN A;  4I98 B;  1Y0N A;  1GV2 A;  3S1N J;  1EH7 A;  2OU2 A;  3M7G A;  3JTH A;  4F7Z A;  2EIM H;  3VFZ A;  1YG2 A;  1P4W A;  4J01 A;  4I01 A;  2XV4 S;  3H5R A;  2GM4 A;  1SVO A;  3H3V K;  1IDY A;  4QSH A;  5BPI A;  2IT0 A;  3GVA A;  5J1R A;  2K3F A;  4BJ6 C;  2MLK A;  4MTE A;  5EGO A;  2QSG X;  5F1R A;  4MFE A;  1XD7 A;  4AU7 A;  2UWM A;  2A5Y B;  2O0Y A;  1KA8 A;  1KYW A;  1MNM C;  4AID A;  2E2J J;  2JJ7 A;  2AO9 A;  1GVD A;  2JA2 A;  4EM2 A;  2M8E A;  1NK2 P;  4IHT A;  3F0C A;  3C2H A;  5FJ8 J;  1XSV A;  2FML A;  3QYE A;  1IG7 A;  1W5C C;  3M3Y J;  3VSL A;  2DFH A;  4MEX F;  2BYV E;  4CH7 A;  3TGN A;  2DFI A;  4A5N A;  4CIC A;  4XID A;  1LUJ B;  1IV6 A;  1I1G A;  2HVS A;  3LSK A;  5D6E A;  3VYS B;  3W2W A;  3QWL A;  2JVG A;  2DI3 A;  3AAF A;  1UHW A;  3ECO A;  2LY9 A;  3F8B A;  3SZT A;  3BJO A;  4IHW A;  2JN6 A;  4KT5 C;  2QA4 I;  2QWW A;  3EPZ A;  5F6F A;  1MMN A;  3ZQH A;  1WKM A;  1B72 A;  2X9D A;  3CMA I;  3BG6 A;  4Q4Z F;  5IYB J;  4A3E J;  3IUO A;  4RMN A;  1BA5 A;  2Q2E A;  4HG2 A;  3DXJ F;  1XMK A;  2ZXH A;  4OAY A;  5M5Y J;  2EIN H;  4RM3 A;  4YFX F;  3RKQ A;  4DQ2 A;  5K5R A;  1TNT A;  2MH2 A;  4YII A;  3S14 J;  2FA5 A;  1SD4 A;  4U0Y A;  2WBM A;  2AS5 F;  2WTE A;  5LRS A;  1FYL A;  1MJ9 A;  1X1D A;  1W5S A;  2ZSH B;  3BQZ A;  3TMO A;  2O03 A;  3V8J A;  4WXH A;  3JAM K;  2BVM A;  1FJL A;  3PO3 J;  3HIF A;  2X1C A;  5EDN A;  1YI2 I;  1VTN C;  4YFK F;  1K79 A;  1FY7 A;  2JT1 A;  3ZQF A;  1IRG A;  1W7P D;  3FX3 A;  1CF7 A;  3HOU J;  1YJ9 I;  2EZI A;  2YX4 A;  3PSI A;  4GYI A;  2VBY A;  1XSX A;  2CUF A;  1U2W A;  2JRM A;  2HYG D;  2M0M A;  3K2Z A;  1RPW A;  2JVH A;  2CG4 A;  1TT0 A;  2VJI A;  3VSK A;  3WU1 B;  2X1D A;  1ZRE A;  2QQ8 A;  3I59 B;  1FTT A;  5IYC J;  2ZKZ A;  1N77 A;  4FAS D;  2VE9 A;  2LOO A;  2JSP A;  5E17 F;  3ECH A;  4RM2 A;  2GAU A;  3QPL A;  1V5E A;  1OJL A;  4A69 C;  3GFL A;  1LE8 B;  3NWS A;  2DJN A;  4FX0 A;  4L0Y B;  3DPT A;  4TV7 A;  3ZR8 X;  3COA C;  1NH3 A;  2KP6 A;  1VQP I;  1G8X A;  1APL C;  3OL4 A;  4HQM A;  2CFO A;  2LTP A;  2NNY A;  1P7J A;  2DN0 A;  1HA8 A;  2FUG 2;  3BTJ A;  2FX0 A;  4P9F A;  3BR0 A;  2CV2 A;  3OYL A;  1KU2 A;  3OYB A;  1MH4 A;  5FB2 A;  4CZC A;  1S7A A;  2EH3 A;  2OAZ A;  1YJW I;  4OIO F;  3PUB A;  6PAX A;  4IQJ A;  5D5U B;  4HSR A;  4LLL A;  5B5E C;  2STW A;  1W7P A;  4BHP A;  3G6E I;  2R5Z A;  4UUS A;  5LFA A;  1J75 A;  2DPD A;  1U5T B;  3C2G A;  4QPQ A;  3GTJ J;  2L3D A;  1RR7 A;  3E6D A;  3OMY A;  1JE8 A;  3EYI A;  1B8I A;  2BGC A;  3DTE A;  1VQ8 I;  2YR2 A;  3ESW B;  3ZMT A;  4GFB A;  3SDG A;  2IXS A;  3PO2 J;  1DQU A;  2PMZ A;  3CUQ B;  2IA0 A;  3K1M A;  3DBH B;  3UKG A;  1HF0 A;  3CCM I;  3PNY A;  3MKW B;  2R7F A;  4HF1 A;  1E3P A;  5ILV A;  3KZZ A;  3GCM A;  2BEO A;  2DBB A;  1T98 A;  3RKY A;  5E1W A;  3ASN H;  3IAM 2;  1FSH A;  1H88 C;  3Q0U A;  2PLY A;  1DGR M;  4D7N A;  1YIT I;  2M5W A;  2OTJ I;  2KLO A;  1FTZ A;  1R6R A;  2D1V A;  1QO0 D;  4G6Q A;  2K7L A;  5F04 A;  2LRE A;  1IXS B;  1BOA A;  4JX4 A;  4XLF A;  2H6C A;  3F22 A;  4II2 A;  3BTL A;  5EEH A;  3T8T A;  2AQF A;  3GTL J;  1J2X A;  3BDD A;  1RZ4 A;  3IC7 A;  4N9I A;  5JVG F;  1TQP A;  1YS6 A;  3I0T A;  2ZXI A;  5HLG A;  5D5V B;  2E1O A;  3OYK A;  2B63 J;  1HW1 A;  2LFB A;  3MEX A;  1TTY A;  2GLO A;  2K27 A;  4CXF A;  1NG6 A;  2KIQ A;  2W85 A;  2YS9 A;  1BC7 C;  3CCU I;  3ZCO A;  4Y15 A;  2DFF A;  2KT0 A;  4UV9 A;  2I10 A;  2R5Y B;  2L0K A;  1STZ A;  3BPV A;  2PI0 A;  1KU9 A;  4HEA 2;  1OCT C;  2CQN A;  3CMY A;  1B59 A;  1KU3 A;  1FEX A;  3HRS A;  2RDP A;  3E7L A;  2JRT A;  5ICG A;  3AL0 B;  4HV6 A;  3K7A J;  2HKX A;  5D6F A;  3EUK L;  2YU9 J;  1D0Y A;  4B44 A;  4IZZ A;  1Z21 A;  2VBW A;  4ZZD A;  1S9H A;  2OTL I;  4G7O F;  4LIU A;  2ZJ2 A;  5H2F C;  4RGU A;  1QVT A;  1ZLJ A;  4PFO A;  2F2E A;  3LA2 A;  3I4M J;  4H4K C;  4M3E A;  2VL8 A;  4XIC A;  2MYS A;  1G3W A;  3M8E A;  5CYV A;  3S3N A;  4BE1 A;  2H94 A;  3OWT A;  5M3F J;  4HF0 A;  3BR2 A;  4AD9 A;  2KRH A;  3DKX A;  2MSY A;  2Y9Z A;  2ZJP F;  4AVZ A;  3H36 A;  3MZY A;  2QGU A;  4E6K G;  3A0H C;  2PMZ N;  4KIT B;  1D3Y A;  1XGS A;  2AXT C;  1JKP C;  3U1D A;  2L9R A;  2KQR A;  2VXZ A;  3E1S A;  1BJA A;  1U8B A;  2HTJ A;  1OCO H;  3K4L A;  2NVU B;  1P2F A;  4ZTF A;  1DP7 P;  3W2V A;  2JA7 J;  1LJ9 A;  4A3L J;  3H5N A;  1YRN B;  3F8N A;  4BU2 A;  1W36 D;  1CQT A;  3HTU A;  4WCG A;  2O3F A;  2P7C B;  3S1R J;  3H9J A;  3PQJ A;  2K85 A;  4AC0 A;  4DJA A;  4MEY F;  1R9T J;  3MVP A;  2L7M P;  4C3I J;  1E0E A;  3GME A;  4XRS G;  3NQO A;  2HQ5 A;  4NC6 A;  3RTR A;  2X6Y A;  1JTX A;  1H9T A;  3HOZ J;  2FF4 A;  1S8N A;  2X6O A;  1SFX A;  4I6Z A;  3RI4 A;  5HS8 A;  4BE0 A;  4MQV A;  5E3L A;  2V1X A;  4B3X A;  2XF7 A;  1VQ5 I;  3M1E A;  1C0W A;  2DTR A;  3MFK A;  1F36 A;  2RN7 A;  2A61 A;  3PIP F;  2VQC A;  3D1N I;  2PEX A;  3ZQI A;  1FYK A;  3HOV J;  3B02 A;  3F3X A;  5JHU A;  3X2Q H;  2HI3 A;  4ENN A;  3HXL A;  3VWB A;  3Q9V A;  1XTA A;  4GDF A;  2BY3 A;  3HPH A;  3QOE A;  3WU0 A;  2KHM A;  2W00 A;  2QZ8 A;  4EAT A;  5KHD A;  3HM5 A;  1X2M A;  2QSF X;  4JP0 A;  3E3V A;  1QQI A;  2FNP A;  2VJJ A;  5ILS A;  5TJJ A;  1R58 A;  5JVT A;  2ZCW A;  1IZ1 A;  3E6C C;  1SAN A;  2OQG A;  1WJF A;  4RGX A;  4HLY A;  2WAD A;  2NYX A;  2LBF A;  3WHC A;  4D0P A;  3HB9 A;  3JRF A;  1KU7 A;  1MMG A;  1E2X A;  2VOP A;  4KIF A;  1BN5 A;  1Z67 A;  3ZMD A;  4QIW N;  1UG2 A;  4CYD A;  4BL0 B;  1KQ9 A;  2HOA A;  4RAG A;  4HX4 A;  1QHH D;  4KA4 A;  3WGG A;  1YHQ I;  3WHB A;  1O7L A;  2EWN A;  1JKO C;  1XMA A;  4BH9 A;  3TW7 A;  1RKT A;  2FRH A;  2LR8 A;  2KIF A;  2WY8 Q;  4HLX A;  4JYK A;  5FKO A;  3ZGK A;  2FBK A;  4ABZ A;  1TLH B;  1LDK B;  1X2N A;  1YE9 A;  4AIJ A;  4IHX A;  3TKY A;  1IN4 A;  1WI9 A;  4HW0 A;  4W1U A;  4BXU A;  2W24 A;  1WRJ A;  4PJN A;  5DDG A;  3DWL E;  1WWX A;  1D1C A;  1TP4 A;  5BOX A;  5E79 C;  1JJ6 C;  4BHB A;  3TP0 A;  4IX7 A;  5FFZ A;  1YOV B;  4G6T B;  4XN0 A;  3CF5 F;  3LSH A;  3F6V A;  3JRC A;  3QPS A;  4XKC A;  5FKN A;  2Z2S B;  1GHC A;  1NTC A;  4KMF A;  1RKW A;  4LK0 F;  1MDM A;  2M87 A;  3DFG A;  5E1Z B;  4BJT A;  1AWC A;  3DU6 A;  4JX6 A;  3DU5 A;  5CQE A;  4HST A;  1K6O A;  1YW8 A;  5EZG A;  2LLK A;  5LRR A;  3G1O A;  2BXY A;  3QPT A;  1A31 A;  4ON0 A;  1X4O A;  4L5E A;  1B4A A;  5TIS C;  1HOM A;  3IHU A;  1FX7 A;  3KCC A;  1PVE A;  2L5Q A;  4LG0 A;  1Z3Y A;  1D1A A;  3OIQ A;  1SAX A;  1O4X A;  1IN6 A;  1MH3 A;  3ZMV A;  1V5F A;  4G7Z F;  1PUE E;  3JSP A;  4Z2Y A;  2Q8K A;  2MG4 A;  3ZOB A;  4NQW B;  3A2K A;  4DOZ A;  2LG4 A;  2QQA A;  4IF4 A;  1L3L A;  5KVR A;  1JTY A;  4BAY A;  4EEF G;  1YS7 A;  2XGX A;  3WU2 C;  4IO9 F;  4C9Y A;  4CA0 A;  1TQM A;  2V79 A;  2A6H F;  1MGT A;  4QPO A;  3JRG A;  1OCZ H;  2JZY A;  5J1U A;  1I6H J;  1T08 B;  1FMV A;  2MC3 A;  5DYM A;  1DU0 A;  3OR1 C;  3EUH C;  4ENK A;  1LFB A;  1RUO A;  1P4X A;  1SMY F;  2OCC H;  4P5O A;  3GZ5 A;  2VI6 A;  4EVI A;  1P7I A;  1MBF A;  3W2A A;  3H1C A;  4MIM A;  4CCJ A;  4L9N A;  2LKS A;  2QLZ A;  3T1B A;  5BMZ A;  2GXA A;  3GXO A;  3I56 I;  4A3M J;  2OBP A;  2YPR A;  3FXO A;  4D1Q A;  1Y39 A;  4DBR A;  1W0U A;  1XGN A;  4A3K J;  4C2M J;  2MAB A;  4ESF A;  1JUS A;  5DCF A;  3DBR B;  3ZN0 A;  3L2U A;  1Z6R A;  4B1R A;  3CLQ A;  3A1Y A;  1FNN A;  4OMZ A;  3D5S C;  1IRF A;  2L7Z A;  2HXO A;  3TW6 A;  4BEH B;  4RB1 A;  5GP9 A;  5ED4 A;  1KQ8 A;  5IT9 K;  2AQE A;  3LA3 A;  2Z1D A;  1F43 A;  3EYY A;  1PJR A;  2CQQ A;  3N05 A;  3HOW J;  3TL4 X;  3OSF A;  3TO9 A;  4ZTJ A;  1JGG A;  4L9J A;  2XAH A;  1ULY A;  1IXC A;  3FBN B;  1MMD A;  3K4K A;  2LSO A;  1MW7 A;  4A5M A;  2Z9O A;  3OY9 A;  2VC0 A;  2NS8 A;  1ON1 A;  2VPR A;  1T6S A;  3GTK J;  2VON A;  1SFE A;  3G71 I;  4CO8 A;  4UNO A;  1HST A;  1RIO H;  3SFI A;  3DCF A;  1PP8 F;  4E7J A;  1X3Z B;  1S3J A;  2FE3 A;  2ZFU A;  3QP6 A;  3GFI A;  3BJ6 A;  1SD5 A;  1YW7 A;  3WOD F;  4BE2 A;  5E8I A;  3CC2 I;  2M4K A;  1Y1W J;  3ZQL A;  1ZKG A;  2XPW A;  1BC8 C;  1K78 A;  1VQ7 I;  2NNN A;  2V1D A;  2GIZ A;  3QPH A;  3S16 J;  2FNA A;  5IT9 Z;  1TC3 C;  3TP3 A;  5IOY A;  3TBI A;  1TL8 A;  4DIQ A;  2FBH A;  1ON2 A;  2DQR A;  4M3F A;  4UVC A;  4ZH4 F;  5F27 A;  1RRJ A;  2J5P A;  2EFQ A;  1IAW A;  4J00 A;  4MFD A;  2O7O A;  1Y8Q B;  2JWT A;  3L2W A;  4ZDP A;  4KNY A;  1BI2 A;  3CC7 I;  2DMU A;  1XG1 A;  3GTO J;  2MBF A;  4U88 A;  1ZGA A;  2VJ5 A;  4I76 A;  3CUO A;  2W4S A;  1P4A A;  2DDA A;  2H1K A;  4BNC A;  3FM3 A;  3LAJ A;  3WTV C;  4WWC A;  2A6T A;  5TRD A;  4C3J J;  2ISZ A;  2RNJ A;  2P5L C;  3LSI A;  3OYI A;  1Z6T A;  4D5F A;  2QUF A;  5CVV A;  4Q5S F;  4Y17 A;  4UUT A;  2DMQ A;  2D5V A;  2XAG A;  2OC6 A;  3Q5F A;  1Z1D A;  4JBA A;  2G7H A;  3Q3S A;  2D45 A;  3WTT C;  1WCM J;  2LY1 A;  3BTI A;  3FM5 A;  3FBI B;  3L09 A;  2RQQ A;  1POG A;  5DD4 A;  5CVR A;  3WE2 A;  1FBU A;  1ERD A;  1X1B A;  2M8G X;  4YEJ A;  2KJB A;  3SQN A;  1ODD A;  1LEB A;  4RB3 C;  1SFU A;  3MWM A;  2DJI A;  2DK5 A;  3B73 A;  2K4B A;  2CU7 A;  2QCO A;  2IS1 A;  4DYC A;  3BCB A;  1FT9 A;  4A93 J;  3MZ8 A;  3CDH A;  3DEE A;  3BR3 A;  2DMN A;  4HOB A;  3K70 D;  1RR8 C;  3K1P A;  1O3S A;  1W1W E;  2FD5 A;  3G4S I;  2DTZ A;  3AG3 H;  3BCA A;  3BC8 A;  3ERE D;  1MMS A;  2IS4 A;  2CUZ A;  2DDB A;  1AA7 A;  3U9G A;  4Y13 A;  1LQ1 A;  2GIV A;  3V42 A;  2Y0M A;  3FMR A;  4A3F J;  4R1H A;  5K5O A;  3T5X A;  2OZU A;  1YX3 A;  3OYD A;  1D5Y A;  1OYI A;  4KN7 X;  4YIF A;  1KGS A;  3CDL A;  1T0F A;  4G7H F;  2KL4 A;  5JLW A;  1I1S A;  3P9C A;  2TCT A;  2TRT A;  3KP5 A;  2H09 A;  2ELH A;  2NS7 A;  1IRX A;  4IHS A;  5K1Y A;  3DLL F;  1ZGW A;  3CLO A;  2HDW A;  1QPI A;  2XAQ A;  1A6I A;  4XRM A;  1J0R A;  1USS A;  4KIC A;  3U2R A;  1I3A A;  4NDL A;  1ACI A;  4WXC A;  3H92 A;  3QOD A;  3F9K A;  2JA5 J;  2O6G E;  3S15 J;  5LEJ A;  1GV5 A;  4V2F A;  2WWY A;  2F48 A;  2ZJR F;  1W4M A;  3AG2 H;  2KRC A;  1QZY A;  1XCB A;  1N75 A;  5DM7 F;  3E5X A;  5DS9 A;  2BY1 A;  2L9V A;  3M4O J;  3RKX A;  2IGO A;  3FDY A;  3MZH A;  2LKX A;  3MN2 A;  3GFJ A;  3CJR B;  3GTP J;  2G0E A;  3RPU A;  1VQO I;  4OWR B;  4XON A;  3BPX A;  4CYC A;  3CCR I;  3K4N A;  2XPV A;  1R4N B;  2BOL A;  4ZDO A;  4DZP A;  3K4B A;  2DOE A;  3GW2 A;  1UST A;  3LNQ A;  1V3F A;  4EV0 A;  2FBI A;  2R7V A;  9ANT A;  5FRN A;  3QAH A;  5ICF A;  2XB0 X;  1FIA A;  5D4R A;  3KEQ A;  2E2I J;  4HNT A;  2GWR A;  2PJR B;  2V6E A;  2QKL B;  1OKR A;  1U3E M;  2R7W A;  2UXN A;  4DGW B;  4ESB A;  2R7T A;  2ZBK A;  2K9N A;  3R0A A;  2QQB A;  2ZME B;  2JPC A;  4L5I A;  1V55 H;  1Q1V A;  1DGW Y;  3M1C A;  2RVC A;  2P8T A;  2CH0 A;  2DXI A;  4OIQ F;  1EKE A;  3CO7 C;  2XF6 A;  5L3C A;  2M7B A;  4KIG A;  2XAU A;  3LFU A;  4BXX J;  1IV8 A;  4ESJ A;  4PJM A;  2BVL A;  1Y6I A;  4BBR J;  5ILU A;  4IOC F;  2HKO A;  4O5V A;  2EIK H;  3P9K A;  1B9N A;  2ZC2 A;  2GA2 A;  3HOY J;  4ZDL A;  1XGM A;  4MQ9 F;  2MD0 A;  3OYM A;  3IRR A;  4EQQ A;  3OYN A;  3L2R A;  2F5C A;  4GGG A;  2XC7 A;  2DMP A;  2IA1 A;  4BY1 J;  1UAA A;  2KJC A;  1U8R A;  1IN7 A;  1KYZ A;  4XLE A;  2ACJ A;  2RGV A;  1SVL A;  3BOQ A;  3HKZ A;  2X6X A;  2OJE D;  5JLX A;  1J9I A;  5ERI A;  1FBQ A;  5DEQ A;  2EPF A;  3FF5 A;  3LWF A;  5J47 A;  4KUM A;  1ZR4 A;  5CVJ A;  1IW7 F;  1X1P A;  1TWC J;  3WTX C;  5HVQ C;  4KJZ A;  3LA7 A;  4BGD A;  2M45 A;  3FHN A;  3GYH X;  5DV5 A;  1G3Y A;  5CQG A;  1WH5 A;  4I09 A;  2L54 A;  1HKQ A;  1YYV A;  3JAM Z;  1X1A A;  1G6N A;  3M8J A;  4FIS A;  1F1Z A;  2VQL A;  3GBG A;  1I6X A;  4IRG A;  3IL2 A;  3C3W A;  1FOX A;  4NB5 A;  1A6Q A;  5BNG A;  1UB9 A;  3OSG A;  1I27 A;  2LP0 A;  3Q9S A;  3VEP A;  2GOM A;  1B9M A;  1B6A A;  1LFU P;  3P9I A;  2P0W A;  1ZLK A;  4JQF A;  2WB1 A;  3WG9 A;  5L3G A;  4HYE A;  4RBO A;  3CCE I;  4UVA A;  1E17 A;  5A2Q K;  1SFK A;  3WGI A;  3ZQC A;  1Z77 A;  3IH3 A;  2L4A A;  2OUM A;  1OCP A;  2H1L A;  5ICE A;  2QBY B;  1U9O A;  1D8J A;  2R4G A;  3RKW A;  1LDD A;  4FHT A;  5KAI C;  5E3N A;  1KQ0 A;  3RZO J;  3ZXS A;  1R1V A;  4CCK A;  4ZYD A;  3I55 I;  2E1M C;  4HDU A;  2OCE A;  2UUZ A;  2MLG A;  3BT9 A;  3BZK A;  2PMU A;  1TW3 A;  1TQI A;  2EIJ H;  2M34 A;  5J40 A;  3FHZ A;  4A12 A;  4WX9 A;  3OYF A;  4E7L A;  2B9S A;  2L02 A;  5A2Q Z;  4I0B A;  5E18 F;  2O8X A;  3L9F A;  2K9S A;  4CZZ A;  4XMY A;  3TQN A;  4CCN A;  3KLO A;  4QLC U;  1TWG J;  3T8R A;  3KPH A;  3B6C A;  4RAZ A;  5GAD J;  1S7E A;  4PGH A;  4F3Q A;  3PSF A;  1MKM A;  3CDI A;  1TZL A;  3RQI A;  2DW4 A;  3IP4 B;  4Y4R A;  4MTD A;  3DBL B;  1ETV A;  2DT7 B;  2E5Z A;  2JTV A;  2E60 A;  1FIP A;  4LJZ F;  1IXR C;  5EG0 A;  3HKZ N;  2DOA A;  1ZG1 A;  4A0X A;  3WE3 A;  2EK5 A;  4KT6 A;  4OIP F;  3GZ6 A;  3JSO A;  1SMT A;  1DPR A;  1W5T A;  1XN7 A;  2JK3 A;  3HOX J;  2X0L A;  2L01 A;  5HNH A;  3GTM J;  2DA3 A;  1ZYR F;  3KYD B;  5HLT A;  3ZQG A;  1FZP B;  1S6L A;  3ABK H;  3E5Q A;  3QYB A;  3HZJ A;  3ZQQ A;  1UFM A;  1DDN A;  3IH4 A;  1I5Z A;  1Y8R B;  3LST A;  4X1E A;  2KIM A;  2CQ7 A;  4HNV A;  1YIJ I;  2ISY A;  4IVN A;  3HGY A;  4UV8 A;  3TO7 A;  1HXD A;  4A0Y A;  1K6Y A;  4IXA A;  3KZY A;  3KE2 A;  2OF7 A;  2V7F A;  1UG0 A;  2WB1 N;  3OIO A;  2MFZ A;  3HUG B;  2FQ3 A;  3SDB A;  1ETQ A;  1R7J A;  3H9Q A;  3KP3 A;  4XN3 A;  1EA3 A;  1Z3X A;  2JMW A;  2VQG A;  1X1C A;  3KP6 A;  4MLO A;  3CC4 I;  2XGD A;  3MAJ A;  2XIG A;  2HOE A;  3FXJ A;  5H20 A;  1VQK I;  3BTC A;  4W97 A;  1BI3 A;  1A35 A;  3WG7 H;  5JHF A;  5JR3 A;  2Y31 A;  4YEL A;  1LDJ A;  4ENM A;  1TT5 B;  1HLV A;  2OQR A;  3JRE A;  1WVR A;  3OYA A;  5DCM A;  1QZZ A;  3LMM A;  2I8D A;  1REP C;  4JK1 X;  1X4P A;  2GBY A;  3BRO A;  2JA6 J;  5B1A H;  3FMS A;  3TOB A;  2XRL A;  1S5L C;  1WJB A;  2XGE A;  2RQP A;  2GQQ A;  1MBK A;  2ME6 A;  5L3F A;  4HX8 A;  5J1Y A;  2E36 A;  1E3H A;  3CZ6 A;  2M3A A;  1IRZ A;  2H8W A;  4P55 A;  1AKH B;  1BR1 A;  3BG5 A;  3K69 A;  4AYB A;  2Y48 A;  3NAU A;  3HSE A;  1JUP A;  3H3U A;  3H9G A;  2CV0 A;  2I5U A;  2BW3 A;  3K10 A;  4LFU A;  3JCU C;  3QQA A;  3U21 A;  4A0Z A;  4OU0 A;  1MBJ A;  5EF6 A;  3VOE A;  3A01 B;  2F5F A;  1FOK A;  4YRV A;  3HRM A;  1BOB A;  3QOP A;  3FIW A;  1PUF A;  3S1M J;  2R7S A;  5DM6 F;  2VAS A;  5EJC A;  3AG4 H;  1H9G A;  1XB4 A;  4NUB A;  1FP2 A;  1RUN A;  2M1B A;  3L2C A;  1I50 J;  3FXL A;  2XKP A;  1A5J A;  1U9N A;  3VB2 A;  5ICC A;  3F23 A;  4FET A;  2ADU A;  3JRD A;  2QSH X;  1ETW A;  3DP7 A;  4EJV A;  4M71 A;  2L9N A;  3ABT A;  2JQ7 A;  2VQH A;  1JI8 A;  2OV7 A;  2DT5 A;  3CO6 C;  1UHS A;  1GT0 C;  1X3W B;  3BQY A;  2XRN A;  3A0B C;  2VXD A;  3RJP A;  3HHG A;  3WTU C;  3HDD A;  2JSC A;  3ERM A;  3LSJ A;  4N4O B;  4UVB A;  4Y33 A;  2YSR A;  1W36 C;  1VND A;  3L2V A;  1OYY A;  5EGO B;  1D0X A;  1OPC A;  2HNH A;  1O3R A;  4N0B A;  2ID3 A;  2XF5 A; 
#chains in the Genus database with same CATH homology
 2FXA A;  4ASN A;  5CVI A;  2QQ9 A;  3J80 K;  1ZRF A;  4DNC A;  4I7H A;  5AIQ A;  2IRF G;  3KLN A;  2DPU A;  3E97 A;  3LAP A;  4Q48 A;  1X3U A;  4CDG A;  1RNL A;  3F8F A;  3O6B B;  3J80 Z;  3WTW C;  2QYO A;  1HKT A;  3HYI A;  3KEO A;  4M6Y A;  1HW5 A;  3RYP A;  1HBX G;  1GVJ A;  2EFO A;  3BWG A;  2NRA C;  3ULQ B;  3IKT A;  1JHF A;  1F5T A;  5DUI A;  3I5U A;  4XSZ F;  2VOO A;  5L3D A;  5E1X A;  5FD6 A;  5LGN A;  3P7N A;  1V4R A;  1CF7 B;  4HX7 A;  1OR7 A;  4G94 A;  4LB5 A;  2ZNZ A;  2Z5U A;  1Z91 A;  2R3S A;  1Q1H A;  4M9X A;  4XLP F;  1BM9 A;  4HAM A;  3TDZ C;  3HRU A;  2OZ6 A;  1EH8 A;  3I59 A;  3GLX A;  4LD5 A;  3MQ0 A;  3RDI A;  3E6M A;  4OOI A;  1AOY A;  1P92 A;  1MZB A;  2D1H A;  2GZW A;  1R00 A;  2KRF A;  3RIR A;  3L00 A;  1CGP A;  3SFZ A;  1W7P B;  2A07 F;  1JGS A;  2XVC A;  3DEU A;  2CGP A;  2DQL A;  1FWZ A;  3N4M A;  1K7A A;  2DO7 A;  3KP2 A;  2STT A;  4E70 A;  1R1T A;  1U5T A;  3ISP A;  4BYY A;  4EJU A;  4CGZ A;  2J5O A;  4UUV A;  3CUQ A;  4MHG A;  4MGR A;  2F5E A;  2XUB A;  1T38 A;  4M9S A;  1MD0 A;  2BV6 A;  2BBY A;  5HLI A;  2PFB A;  1XGO A;  5J8C A;  1R5G A;  1SD7 A;  3TOA A;  5BQT A;  1A04 A;  2IP2 A;  2Z99 A;  3JW4 A;  2V1U A;  5H6R A;  2CQK A;  5LGT A;  3GUD A;  1L0O C;  3E5U A;  5FD5 A;  3T0Y A;  3PFI A;  3HHH A;  4WK8 F;  3G73 A;  3F8M A;  1ZN2 A;  1G4D A;  1H0M A;  4L9V A;  1IUY A;  1RI7 A;  3I4P A;  3KFW X;  2CO5 A;  4LB6 B;  2HTS A;  4HV5 A;  5D5X B;  3I64 A;  3HOS A;  4ZYG A;  3ROU A;  5AIP A;  1DUX C;  1R23 A;  2PBI A;  3D0S A;  3H3Z A;  4IJA A;  2IA2 A;  2F5D A;  5E20 A;  3N97 A;  2FU4 A;  5AON A;  4AVP A;  2D2W A;  3K0L A;  1EV7 A;  2TDX A;  4G6D A;  3M8F A;  1ZG3 A;  3WTY C;  3L7W A;  2HR3 A;  3O3K A;  3ZMU A;  1BIA A;  1O57 A;  5FGM A;  2Z33 A;  2VBZ A;  2CWE A;  5JI6 A;  3HRT A;  2HEO A;  2KKO A;  3S2W A;  3NRV A;  5D8K B;  2X4H A;  4U0V A;  4GYG A;  1QBJ A;  3EQL F;  4R8H A;  5EEG A;  2E1N A;  4IPA A;  1T39 A;  4LLN A;  4MNU A;  3M9A A;  4LK1 F;  1LNW A;  2LF8 A;  2EA2 A;  2XKO A;  4RB2 C;  2G9W A;  2DAO A;  3PQK A;  4UHT A;  5CVU A;  4BQA A;  2B0L A;  1OMI A;  2QVO A;  3DV8 A;  5L3E A;  1U78 A;  1O7F A;  3FMQ A;  4PCQ A;  2KIU A;  4K2E A;  2PJP A;  1J7K A;  2ESH A;  1MJB A;  2K86 A;  2V9V A;  5FFX A;  2K02 A;  4QWQ A;  1HSJ A;  4N9H A;  2M30 A;  3C7J A;  4WF2 A;  3FWE A;  3R4K A;  1T2K A;  4Q47 A;  2R7D A;  1FSE A;  2EV5 A;  3C18 A;  3EET A;  1S7O A;  4O6J A;  1FBS A;  2YX7 A;  3R60 A;  3TO6 A;  1WQ2 A;  2MD5 A;  1J59 A;  3LQQ A;  2W57 A;  1GXQ A;  3C1D A;  1MDM B;  3ZN1 A;  1O3Q A;  5H6Q A;  2XAJ A;  5LBQ A;  5HS9 A;  4B8X A;  4XBF A;  2WC2 A;  4LG0 B;  1BIB A;  1BI0 A;  3F6O A;  1QNT A;  5D5W B;  4S05 A;  2P5K A;  3FXQ A;  2FEZ A;  5BS6 A;  1R5H A;  1O3T A;  3IWF A;  4P96 A;  2W25 A;  2ETH A;  5LHG A;  1DPU A;  1XSD A;  2EV0 A;  1ZRC A;  3MCZ A;  1IF1 A;  3ELK A;  1ZG5 A;  4NQW A;  3QU6 A;  4OIN F;  4AIH A;  1R1U A;  1BBY A;  4HDV A;  2Z3Y A;  4WXD A;  2ZFW A;  2A6E F;  3V4G A;  3REO A;  3ZPL A;  2RV8 A;  3WTZ A;  2O61 A;  4RS8 A;  1UHM A;  2L4M A;  4M72 A;  2GXB A;  3HTS B;  3JTG A;  3J7A O;  2EJR A;  3DPL C;  1JHH A;  4L9T A;  3QP5 A;  3V8L A;  2XAF A;  2V6C A;  4PDK A;  2A69 F;  4M6X A;  4I2O A;  4XLN F;  2HDC A;  4HF2 A;  5J8F A;  2BE5 F;  3ABU A;  2CW0 F;  4GXO A;  1ZGJ A;  4RGS A;  5DUK A;  1HW2 A;  4KDP A;  1HKS A;  5D4S A;  4L18 B;  2P7V B;  2LDU A;  2FOK A;  1YQA A;  1XDS A;  2FMY A;  1K78 B;  1FC3 A;  3DF8 A;  1SD6 A;  4A2U A;  4KIB A;  4KYW A;  4S04 A;  4U7D A;  3SZP A;  2DU9 A;  1G3T A;  4RAY A;  3GO5 A;  2COM A;  4ETS A;  1IN5 A;  1QPM A;  2H27 A;  2FSW A;  4M9Z A;  2OD5 A;  2QM3 A;  2Y75 A;  1F4K A;  4KMU X;  4P9U A;  2EA4 A;  3R6S A;  1YTY A;  3CJN A;  4U0W A;  2QEN A;  3NEU A;  3V8K A;  4YFN F;  2P6S A;  4IRH A;  3GX4 X;  2ZXJ A;  2HQR A;  2HZT A;  5HDK A;  2HFH A;  2GA1 A;  1P6R A;  2IPQ X;  1ONV A;  3KP7 A;  3V7C A;  3ZMS A;  2IJL A;  4IRI A;  4PGG A;  2OA4 A;  2CYY A;  3I58 A;  4HQE A;  4AIK A;  1FP1 D;  1S29 A;  2E7X A;  3GF2 A;  5HOO A;  4UXN A;  4YG2 F;  5FLX K;  1FLI A;  1LB2 A;  5FO5 A;  4KN4 X;  1HQC A;  3ZP5 A;  3HOT A;  4M74 A;  5IT3 A;  3K1N A;  3O2P E;  5KK1 A;  2HQN A;  2VN2 A;  2EV6 A;  1PP7 U;  1NHA A;  4ZYE A;  3I71 A;  3WGH A;  2A3S A;  4G8X A;  3SHF A;  5FLX Z;  2EB7 A;  2IVM A;  4EJO A;  1D8K A;  2GXG A;  1PDN C;  3TDU C;  3IRQ A;  3OOP A;  4L0Z B;  3DQV C;  4I0A A;  2XHK A;  4B09 A;  3LQR A;  3K9T A;  1YFH A;  4EMS A;  3BY6 A;  2ZNY A;  5HDN A;  3V7S A;  5HLH A;  1ZRD A;  1EH6 A;  2HYF A;  5K5Q A;  3EDP A;  3WTS C;  4NHJ A;  3QU3 A;  1WSU A;  1ZHF A;  5DD8 A;  2JPB A;  3G3Z A;  3FXR A;  3GEZ A;  2RC4 A;  5D8L B;  4OMY A;  2G7U A;  3GWZ A;  3KET A;  5LLQ A;  2HGC A;  1TNS A;  2ZME A;  4A6D A;  2ZO4 A;  1FPQ A;  3BZ6 A;  2VC1 A;  1FYM A;  1ZAR A;  2H6B A;  2RKH A;  2Q0O A;  2WV0 A;  3I53 A;  3R61 A;  3IWZ A;  1MJA A;  4OIR F;  1F9N A;  4FX4 A;  1QGP A;  2DLL A;  2UXX A;  4RGR A;  5F64 A;  4U7B A;  3F8C A;  4ENJ A;  4EM0 B;  2ESN A;  4BHC A;  2PN6 A;  2A68 F;  2EFW A;  1BI1 A;  1XDU A;  3V7R A;  2NS0 A;  3DKW A;  1YO5 C;  3LFK A;  1B1B A;  1J5Y A;  3ZQ7 A;  4ZZL A;  4EGY A;  5JFR A;  4EJT A;  4HA8 A;  4PZJ A;  3FZV A;  4KFC A;  3RPQ A;  3VOD A;  4H0E A;  2IW5 A;  2C6Y A;  2XRO A;  2LKP A;  4EGZ A;  3BP8 A;  5LHH A;  1U5T C;  3CTA A;  2E7W A;  2QBY A;  3FXU A;  2VE8 A;  1Y0U A;  3W6K B;  3CUQ C;  4LGW A;  3D5L A;  1R36 A;  2LNB A;  3KP4 A;  3ML6 A;  3J81 K;  5HS7 A;  3EUH A;  1D5V A;  3F72 A;  2VBX A;  4L5J A;  4GCV A;  3ZMZ A;  3E6B A;  3F21 A;  2XAS A;  2EFP A;  1JXS A;  2MH9 A;  5HDG A;  2HS5 A;  3RYR A;  2P6T A;  1GXP A;  2W84 A;  1G3S A;  2UZK A;  1LVA A;  3J81 Z;  4HZF A;  2PQ8 A;  1XCV A;  1YIO A;  3SXY A;  4XRF A;  2EFN A;  4GO1 A;  2AXL A;  3IKV A;  4CHU A;  4AWX B;  2P5V A;  4LMY A;  2VT3 A;  2PMH A;  2NAZ A;  3HSF A;  3W6J B;  2P4W A;  1Z05 A;  3GFM A;  5J6X A;  3HUG A;  4M73 A;  4A6E A;  2PG4 A;  5LGU A;  1Z7U A;  4LLG F;  5DCM B;  3OV8 A;  4XSX F;  5CLS A;  2VOD A;  2K4J A;  1ZH5 A;  1ZAO A;  2LF7 A;  5LHI A;  4EM1 A;  3HSR A;  4FT8 A;  1LEA A;  3R0J A;  5L3B A;  4O3M A;  1YW9 A;  1OYW A;  2HWV A;  4R79 A;  3BJA A;  1Z9C A;  4EJW A;  1TW2 A;  4HBL A;  1UCR A;  2DK8 A;  2MA3 A;  2YU3 A;  4ZYH A;  3I54 A;  5CJ9 A;  4I02 A;  2CFX A;  1TBX A;  4G9Y A;  1IN8 A;  4RB0 A;  1R22 A;  5LEK A;  5E8G A;  1YLF A;  2E1C A;  3QRF F;  2CSO A;  1U6G A;  5BPD A;  2VT2 A;  4I98 B;  1EH7 A;  2OU2 A;  3M7G A;  3JTH A;  4F7Z A;  3VFZ A;  1YG2 A;  1P4W A;  4I01 A;  2XV4 S;  5BPI A;  2IT0 A;  3GVA A;  2MLK A;  4MTE A;  5F1R A;  1XD7 A;  2UWM A;  2A5Y B;  2O0Y A;  1KA8 A;  1KYW A;  4EM2 A;  2M8E A;  4IHT A;  1XSV A;  2FML A;  4MEX F;  2BYV E;  3TGN A;  2DFI A;  4A5N A;  4CIC A;  1I1G A;  5D6E A;  2DI3 A;  3AAF A;  1UHW A;  3ECO A;  3F8B A;  3SZT A;  3BJO A;  4KT5 C;  2QWW A;  5F6F A;  1WKM A;  4Q4Z F;  2Q2E A;  3DXJ F;  1XMK A;  4YFX F;  4DQ2 A;  5K5R A;  1TNT A;  2MH2 A;  4YII A;  2FA5 A;  1SD4 A;  4U0Y A;  2AS5 F;  2WTE A;  5LRS A;  1FYL A;  1MJ9 A;  1W5S A;  2O03 A;  3V8J A;  4WXH A;  3JAM K;  3HIF A;  1VTN C;  4YFK F;  1K79 A;  1FY7 A;  2JT1 A;  1IRG A;  1W7P D;  3FX3 A;  1CF7 A;  2YX4 A;  4GYI A;  2VBY A;  1XSX A;  1U2W A;  2HYG D;  3K2Z A;  2CG4 A;  3WU1 B;  1ZRE A;  3I59 B;  2ZKZ A;  2VE9 A;  5E17 F;  3ECH A;  2GAU A;  3GFL A;  4FX0 A;  4L0Y B;  3DPT A;  4TV7 A;  3COA C;  4HQM A;  2NNY A;  4P9F A;  1KU2 A;  5FB2 A;  1S7A A;  2OAZ A;  4OIO F;  6PAX A;  5D5U B;  4LLL A;  2STW A;  1W7P A;  4BHP A;  1J75 A;  2DPD A;  1U5T B;  2L3D A;  3E6D A;  1JE8 A;  3EYI A;  2BGC A;  2YR2 A;  3ZMT A;  3CUQ B;  2IA0 A;  3K1M A;  2R7F A;  4HF1 A;  5ILV A;  3KZZ A;  2BEO A;  2DBB A;  1T98 A;  3RKY A;  5E1W A;  1FSH A;  2PLY A;  2M5W A;  2D1V A;  1QO0 D;  4G6Q A;  2K7L A;  1IXS B;  1BOA A;  2H6C A;  3F22 A;  5EEH A;  3T8T A;  1J2X A;  3BDD A;  1RZ4 A;  3IC7 A;  4N9I A;  1TQP A;  1YS6 A;  3I0T A;  5HLG A;  5D5V B;  1HW1 A;  3MEX A;  1TTY A;  2K27 A;  4CXF A;  2W85 A;  1BC7 C;  4Y15 A;  4UV9 A;  1STZ A;  3BPV A;  2PI0 A;  1KU9 A;  1B59 A;  1KU3 A;  3HRS A;  2RDP A;  5ICG A;  2JRT A;  4HV6 A;  2HKX A;  5D6F A;  2VBW A;  4ZZD A;  4G7O F;  2ZJ2 A;  4RGU A;  1ZLJ A;  2F2E A;  3LA2 A;  1G3W A;  3M8E A;  5CYV A;  2H94 A;  4HF0 A;  4AD9 A;  3MZY A;  1D3Y A;  1XGS A;  3U1D A;  2VXZ A;  1BJA A;  2HTJ A;  1P2F A;  1DP7 P;  1LJ9 A;  3F8N A;  3HTU A;  4WCG A;  2O3F A;  2P7C B;  3PQJ A;  4MEY F;  3NQO A;  3RTR A;  1H9T A;  2FF4 A;  1S8N A;  1SFX A;  3RI4 A;  5HS8 A;  4MQV A;  2V1X A;  3M1E A;  1C0W A;  2DTR A;  3MFK A;  2RN7 A;  2A61 A;  2PEX A;  1FYK A;  3B02 A;  3F3X A;  5JHU A;  4ENN A;  3Q9V A;  3WU0 A;  2QZ8 A;  3E3V A;  1QQI A;  2FNP A;  5ILS A;  5TJJ A;  1R58 A;  5JVT A;  2ZCW A;  1IZ1 A;  3E6C C;  2OQG A;  4RGX A;  4HLY A;  4D0P A;  2NYX A;  1KU7 A;  2VOP A;  1E2X A;  4KIF A;  1BN5 A;  3ZMD A;  4CYD A;  1KQ9 A;  4HX4 A;  4KA4 A;  3WGG A;  1O7L A;  2EWN A;  1XMA A;  4BH9 A;  2FRH A;  2KIF A;  4HLX A;  2FBK A;  1TLH B;  1LDK B;  4AIJ A;  3TKY A;  1IN4 A;  1WI9 A;  4HW0 A;  4BXU A;  2W24 A;  1WRJ A;  5DDG A;  1WWX A;  5BOX A;  4BHB A;  5FFZ A;  3F6V A;  1GHC A;  4KMF A;  4LK0 F;  1MDM A;  2M87 A;  3DFG A;  5E1Z B;  1AWC A;  1K6O A;  1YW8 A;  5LRR A;  3QPT A;  4ON0 A;  1B4A A;  3IHU A;  1FX7 A;  3KCC A;  4LG0 A;  1SAX A;  1IN6 A;  3ZMV A;  4G7Z F;  1PUE E;  3JSP A;  4Z2Y A;  2Q8K A;  2QQA A;  4IF4 A;  1L3L A;  5KVR A;  4BAY A;  1YS7 A;  2XGX A;  1TQM A;  2V79 A;  2A6H F;  1MGT A;  2JZY A;  5DYM A;  2MC3 A;  4ENK A;  1RUO A;  1P4X A;  1SMY F;  4P5O A;  3GZ5 A;  4EVI A;  4L9N A;  2QLZ A;  3T1B A;  5BMZ A;  3GXO A;  2OBP A;  2YPR A;  1XGN A;  4ESF A;  5DCF A;  3ZN0 A;  1Z6R A;  4OMZ A;  1FNN A;  1IRF A;  4RB1 A;  5ED4 A;  1KQ8 A;  5IT9 K;  3LA3 A;  3EYY A;  3TO9 A;  4L9J A;  2XAH A;  1ULY A;  1IXC A;  4A5M A;  2Z9O A;  2LSO A;  2VC0 A;  1ON1 A;  1T6S A;  2VON A;  1SFE A;  4UNO A;  4CO8 A;  1HST A;  1RIO H;  1PP8 F;  1S3J A;  2FE3 A;  3GFI A;  3QP6 A;  3BJ6 A;  1SD5 A;  1YW7 A;  3WOD F;  5E8I A;  1BC8 C;  1K78 A;  2NNN A;  2V1D A;  3QPH A;  2FNA A;  5IT9 Z;  2FBH A;  1ON2 A;  2DQR A;  4UVC A;  4ZH4 F;  2J5P A;  2EFQ A;  1IAW A;  4KNY A;  1BI2 A;  2MBF A;  4U88 A;  1ZGA A;  3CUO A;  1P4A A;  4BNC A;  3FM3 A;  3LAJ A;  3WTV C;  4WWC A;  5TRD A;  2ISZ A;  2RNJ A;  2P5L C;  1Z6T A;  2QUF A;  5CVV A;  4Q5S F;  4Y17 A;  2XAG A;  3Q5F A;  1Z1D A;  4JBA A;  2G7H A;  2D45 A;  3WTT C;  3FM5 A;  3L09 A;  5DD4 A;  5CVR A;  3WE2 A;  1FBU A;  3SQN A;  2KJB A;  1LEB A;  1ODD A;  4RB3 C;  1SFU A;  3MWM A;  2DK5 A;  3B73 A;  2K4B A;  1FT9 A;  3CDH A;  4HOB A;  3K1P A;  1O3S A;  3ERE D;  3U9G A;  4Y13 A;  1LQ1 A;  2GIV A;  2Y0M A;  3FMR A;  4R1H A;  5K5O A;  3T5X A;  2OZU A;  1OYI A;  4KN7 X;  4YIF A;  1KGS A;  1T0F A;  4G7H F;  1I1S A;  3P9C A;  3KP5 A;  2H09 A;  2ELH A;  4IHS A;  5K1Y A;  3CLO A;  2XAQ A;  1J0R A;  1USS A;  4KIC A;  3U2R A;  4WXC A;  3H92 A;  2O6G E;  5LEJ A;  2WWY A;  1W4M A;  1QZY A;  1XCB A;  3E5X A;  3RKX A;  3MZH A;  3GFJ A;  3RPU A;  3BPX A;  3GW2 A;  1UST A;  1V3F A;  4EV0 A;  2FBI A;  3QAH A;  5ICF A;  5D4R A;  3KEQ A;  2GWR A;  1OKR A;  1U3E M;  2UXN A;  4ESB A;  2ZBK A;  3R0A A;  2QQB A;  2ZME B;  2JPC A;  4L5I A;  2RVC A;  2P8T A;  4OIQ F;  3CO7 C;  5L3C A;  4KIG A;  4ESJ A;  5ILU A;  2HKO A;  4O5V A;  3P9K A;  1B9N A;  2GA2 A;  1XGM A;  4MQ9 F;  3IRR A;  4EQQ A;  2F5C A;  4GGG A;  2IA1 A;  2KJC A;  1U8R A;  1IN7 A;  1KYZ A;  2ACJ A;  2RGV A;  3BOQ A;  1J9I A;  5ERI A;  1FBQ A;  5DEQ A;  3FF5 A;  3LWF A;  4KUM A;  5CVJ A;  1IW7 F;  3WTX C;  5HVQ C;  3LA7 A;  2M45 A;  3GYH X;  5DV5 A;  1G3Y A;  4I09 A;  2L54 A;  1HKQ A;  1YYV A;  3JAM Z;  1G6N A;  1F1Z A;  1I6X A;  3IL2 A;  4IRG A;  3C3W A;  4NB5 A;  1UB9 A;  1I27 A;  3Q9S A;  3VEP A;  1B9M A;  1B6A A;  3P9I A;  1ZLK A;  4JQF A;  3WG9 A;  5L3G A;  4HYE A;  4UVA A;  1E17 A;  5A2Q K;  3WGI A;  2L4A A;  5ICE A;  2QBY B;  1D8J A;  3RKW A;  1LDD A;  4FHT A;  1KQ0 A;  1R1V A;  4ZYD A;  4HDU A;  2MLG A;  2PMU A;  1TW3 A;  1TQI A;  3FHZ A;  4A12 A;  4WX9 A;  2L02 A;  5A2Q Z;  4I0B A;  5E18 F;  2O8X A;  3L9F A;  4CZZ A;  3TQN A;  3KLO A;  4QLC U;  3T8R A;  4RAZ A;  4PGH A;  1MKM A;  2DW4 A;  4MTD A;  2JTV A;  4LJZ F;  1IXR C;  1ZG1 A;  4A0X A;  3WE3 A;  2EK5 A;  4OIP F;  3GZ6 A;  3JSO A;  1SMT A;  1DPR A;  1W5T A;  1XN7 A;  2X0L A;  2L01 A;  1ZYR F;  1FZP B;  1S6L A;  3E5Q A;  1UFM A;  1DDN A;  1I5Z A;  3LST A;  2KIM A;  3TO7 A;  2ISY A;  4IVN A;  4UV8 A;  4A0Y A;  1HXD A;  4IXA A;  3KZY A;  3KE2 A;  2FQ3 A;  1R7J A;  3KP3 A;  3KP6 A;  3MAJ A;  2XIG A;  2HOE A;  5H20 A;  1BI3 A;  5JR3 A;  1LDJ A;  4ENM A;  2OQR A;  5DCM A;  1QZZ A;  1REP C;  4JK1 X;  3BRO A;  3FMS A;  3TOB A;  2RQP A;  2GQQ A;  5L3F A;  4HX8 A;  4P55 A;  3K69 A;  2Y48 A;  3HSE A;  3H3U A;  4A0Z A;  4LFU A;  4OU0 A;  3VOE A;  2F5F A;  1FOK A;  3HRM A;  3QOP A;  1H9G A;  1XB4 A;  1FP2 A;  1RUN A;  2M1B A;  3L2C A;  2XKP A;  3VB2 A;  5ICC A;  3F23 A;  2ADU A;  3DP7 A;  4EJV A;  4M71 A;  3ABT A;  2DT5 A;  3CO6 C;  2XRN A;  3RJP A;  3HHG A;  3WTU C;  2JSC A;  4UVB A;  2YSR A;  1OYY A;  1OPC A;  1O3R A;  4N0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...