4HE6A

Crystal structure of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
b'SLKTTREFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRKEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase family U32
molecule tags Unknown function
source organism Geobacillus thermoleovorans
publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he6A00
1ZUNB 2BM1A 3WBKA 1KD1D 4YHBA 1FNBA 3FPKA 5H59A 2OTLB 4Y7CA 4ZCLA 3JQRA 1VQ5B 1IB0A 3FJOA 2YWFA 3I1FA 2VYQA 2BSAA 2B7BA 3ES9A 1D8TA 3WBJA 1CNFA 4YAOA 1E62A 2XNCA 4RCYA 4EH1A 3OJXA 3QFRA 1VQKB 1VQ9B 4P3YA 4RD0A 4IW3B 5EMNA 4RD3A 1QX4A 1GO2A 2DETA 3CCMB 1FDRA 3E1YE 3SJZA 3VNUA 2GQFA 4G1BA 1IJFA 3VO1A 3WNCA 3JQPA 4ACBA 5GV7A 2EIXA 1FNMA 3QSYA 4F7DA 1YI2B 2E1RA 1JB9A 4B48A 1VQOB 3VO2A 4LC0A 3W5UA 2BN4A 4PC3A 1A8PA 4PGOA 2VNKA 2PIAA 4TMTA 1VQNB 1N8RD 4ZGNB 1BX1A 1BX0A 1ZM4A 3CMAB 2HCJB 3ZZUA 4AF6A 1KQSB 1HA3A 4DQLA 1YJ9B 2CNDA 4FK8A 3OJWA 1YITB 2QTLA 4Y9RA 5HXBA 2AHOA 1FNCA 1JA1A 3AVUA 3OZUA 2C77A 2PLFA 1J9ZA 1GJRA 3CCUB 4J0QA 2YWHA 1UMKA 4RD6A 5THXA 5KSWB 1R5NA 1GR1A 1ZM9A 1H42A 4TMZA 4K1XA 1R5OA 4LBYA 2BGJA 4AC9A 1EP3B 2NPFA 1WDTA 1E63A 3WNBA 3WYAA 1QUEA 4N3GA 1BJKA 2EFGA 1Q82D 2D74A 4FN5A 1ELOA 1G7SA 3LO8A 4B43A 1EP2B 2BPOA 3CCEB 2DERA 1OGIA 4YAUA 3B82A 4YAWA 2QN6A 3P26A 4Y9UA 1H85A 5TR9A 1K73D 3G4SB 4WQMA 2HMAA 1VQ8B 1BQEA 4RD4A 4M0LA 2RC6A 4ZGQB 1EFCA 3CCRB 1QFJA 2BMWA 3VMFA 2BGIA 4Q7JB 1YJNB 1KK1A 3G71B 4ZV4A 1DARA 3E20A 2VNHA 1XB2A 1QVGB 3MMPA 1KRHA 2QDXA 3PENA 3U6BA 1AIPA 1OB5A 3CMEB 1G7CA 1KK2A 1KK3A 4BPRA 4RJLA 3W2FA 3CPWB 3I56B 1EWYA 4ACAA 1W34A 4TMWA 2R6HA 4TMVA 3B8HA 4PC2A 1QFZA 5AN9A 4G1VA 3LVBA 1KJZA 4DQKA 3W2HA 3U6KA 1KK0A 1W2BB 3AVVA 1XE1A 1U2RA 1QH0A 2DY1A 2OK7A 1DDGA 2QTZA 1YIJB 3AVWA 1JA0A 1SKQA 4B44A 2GPJA 3WXMA 4ZCIA 3V76A 4ZCMA 1ZM2A 4NCNA 1FRQA 4C43A 3AVXA 4FWTA 4B47A 2B7CA 3AVYA 3CCVB 2XNJA 4RCZA 4B4DA 1TVCA 4YAFA 1KTVA 3MHPA 5DSZA 3U2QA 4P6VF 3AGQA 1YJWB 3W5VA 1E64A 3CRZA 1K9MD 3CCLB 4C0SA 3W5HA 3WNDA 2XEXA 1QG0A 4QHYA 1VQPB 1W35A 4LBVA 3CW2A 2QMUA 4M2LA 3ZBUA 3CCSB 1VQ7B 1OGJA 2RC5A 4M1KA 1JJ2B 1CQXA 3QFTA 1QFYA 1AMOA 1G7TA 3I55B 4MYTA 1GVHA 3JQQA 4B3XA 3VNVA 1VQ4B 4H9GA 4HE6A 1W87A 3CD6B 1F20A 2J7KA 4YALA 1EFTA 1JNYA 1ZM3A 1I7PA 2YWEA 3QFSA 4UAJA 4M53A 4U9UA 1F60A 1CNEA 3CCJB 1G7RA 3CC7B 1YHQB 1QGAA 3QE2A 5GV8A 2BM0A 4PC7A 3ZZ0A 2C78A 2VZLA 2OTJB 1NJID 5TV2A 4MYUA 3OW2B 1M1KD 3ZZTA 4G5GA 5H5JA 1FRNA 1QVFB 3B78A 3CB4A 1TUIA 1FNDA 3CCQB 1Q81D 4TN1A 2QEXB 1QUFA 2VNJA 4N3NA 5TY0A 5FA6A 3AGPA 4M4SA 1R5BA 3CC2B 1VQMB 4RD2A 4AF7A 1IJEA 1Q7YD 1K8AD 3OZWA 3CXCB 1GAWA 1TLLA 4PC1A 5JBQA 3QFCA 3AVTA 1S0UA 1D1NA 4R71A 2X3UA 1B23P 2PMDA 2CRVA 3ZBTA 2BF4A 4LBWA 1VQ6B 2FX3A 1OB2A 3J81k 1SM4A 3CC4B 1Q86D 4PC6A 3W2EA 3W2IA 1DG1G 3MCAA 1QGYA 2YWGA 1D2EA 4TMXA 3WY9A 4NBSA 3G6EB 2B5OA 2QA4B 2OK8A 1GAQA 2BV3A 3P27A 2VNIA 1M90D 1EXMA 4LBZA 3OZVA 1N0UA 3ZC3A 1DDIA 1VQLB 2BVNA 2DEUA 1KC8D 1EP1B 2HDNB 2ZITA 4QFMA 1TTTA 1B2RA 2DCUA 1EFUA 4HE5A 1QGZA 1NDHA 1S72B 1N0VC 3W2GA 4RD1A
chains in the Genus database with same CATH superfamily
1T6YA 1ZUNB 4FXUA 4X7CA 2V7QA 3ASSA 4WZLA 3VR6A 4XD7A 2BM1A 3WBKA 4DK0A 2WZNA 1KD1D 4YHBA 1FNBA 3FPKA 5H59A 3CTAA 4Y7CA 4ZCLA 3JQRA 2OTLB 2C5HA 1VQ5B 4YEJA 1IB0A 1YLOA 3FJOA 4RLZA 2YWFA 4RPDA 2ZBVA 3OOCA 3I1FA 2VYQA 2C4UA 1PJ6A 2BSAA 2XZLA 3PUNA 2NV4A 1PJ7A 2X53S 2V7VA 2B7BA 1E79A 3ES9A 1D8TA 2JJ2A 3WBJA 1CNFA 4KKTA 4YAOA 3PA1A 4QUZA 1V0FA 1E62A 1IHMA 2XNCA 4RCYA 4EH1A 3OJXA 3QFRA 1VQKB 1VQ9B 4P3YA 4RD0A 4IW3B 5EMNA 4RD3A 4YELA 2OBSA 1QX4A 1GO2A 2DETA 3CCMB 4XR6A 2DIEA 4QVJA 1FDRA 1V0EA 3E1YE 4L8JA 4X7EA 1NRKA 4XLHA 1XFOA 3SJZA 3VNUA 2GQFA 3NE5B 4UZUA 2Q6OA 5F4OA 1VHOA 4G1BA 4II2A 4QV2A 2KVOA 1IJFA 1W9XA 1H8EA 3VO1A 2X8KA 2X6XA 3WNCA 3JQPA 1VJSA 5GV7A 2EIXA 1FNMA 4ACBA 4OOVA 3QSYA 4F7DA 1YI2B 2E1RA 1JB9A 4B48A 1VQOB 3VO2A 4LC0A 2JDIA 3W5UA 3ISXA 2BN4A 5F4MA 4CQJA 1BLIA 4PC3A 1A8PA 3DDYA 2VNKA 4PGOA 4XL9A 5B6IA 2PIAA 2HLDA 3KL9A 4TMTA 1VQNB 1N8RD 4ZGNB 3CPXA 2OBRA 4XNFA 1BX1A 1P4MA 1BX0A 1HZEA 1ZM4A 3CMAB 2HCJB 4OOXA 5J35A 3ZZUA 5IYPA 4WZTA 4AF6A 1KQSB 1HA3A 1UD6A 4DQLA 3GQBA 4XM3A 3OKXA 4TSFA 3OP1A 1YJ9B 2CNDA 4FK8A 2Q6KA 2V7UA 3BQJA 1Q9SA 3FKSA 4XOTA 4XOPA 3OJWA 1WOPA 1YITB 2QTLA 2WPDA 5DN6A 4Y9RA 3WQZA 5HXBA 2AHOA 1FNCA 3G05A 2ZL5A 1JA1A 3AVUA 3A3GA 4RDLA 3OZUA 1N08A 2C77A 2PLFA 2Q6LA 2DYIA 1J9ZA 4UZFA 1GJRA 5FO1A 3CCUB 4J0QA 2WSSA 3Q6QA 2YWHA 1UMKA 4RD6A 4PABA 5THXA 5KSWB 4XN0A 2V4DA 1R5NA 5HZBA 1GR1A 1E3XA 2JJ1A 4OOSA 1ZM9A 5FIUA 1N06A 1H42A 4TMZA 4K1XA 1R5OA 4LBYA 1K28D 2BGJA 4XONA 1NB9A 4DNTB 2X6YA 4AC9A 1WOOA 1EP3B 2NPFA 4WWVA 4YXWA 1WDTA 1WU8A 1COWA 1E63A 3WNBA 1N05A 3WYAA 1UD5A 2F4NA 1QUEA 3SLDA 3OW7A 3ASPA 4X05A 3RY8A 1KZLA 2Q6IA 4N3GA 5FL7A 4RDJA 1BJKA 2EFGA 2F1LA 1Q82D 2D74A 4FN5A 4XLAA 1ELOA 1G7SA 3A8JA 2C2WA 3LO8A 4B43A 3W2GA 4JMQA 4Z4SA 1EP2B 3ASTA 2BPOA 3CCEB 3CP2A 2DERA 3A8KA 1WORA 1XQBA 1OGIA 4YAUA 3ZUGA 4X7DA 3B82A 4YAWA 2QN6A 3A1PA 3P26A 4Y9UA 4HIZA 3BC9A 1H85A 5TR9A 4DK1A 3HAGA 2V7TA 4WQMA 3G4SB 1K73D 2HMAA 1VQ8B 1BQEA 3ONYA 4RD4A 1Y0RA 4M0LA 2RC6A 4X0CA 4Z1MA 3ZIAA 4ZGQB 1EFCA 2LZJA 2ZZFA 3CCRB 1QFJA 2BMWA 2BGIA 4Q7JB 3VMFA 1YJNB 2ZXHA 1KK1A 5A8AA 3G71B 3GSIA 4ZV4A 1DARA 3GVLA 3E20A 2VNHA 1XB2A 3GVJA 1QVGB 2JIZA 3MMPA 2GJKA 1KRHA 1HVXA 2GK6A 1YX2A 2C4TA 2QDXA 3PENA 3U6BA 1AIPA 1OB5A 3A35A 3CMEB 1RQPA 1G7CA 1KK2A 3BH4A 1KK3A 4BPRA 4RJLA 3W2FA 3CPWB 1UD2A 4B3FX 3I56B 1EWYA 2JN9A 4ACAA 2D3NA 1W34A 4TMWA 2R6HA 4TMVA 3B8HA 4PC2A 1QFZA 5AN9A 2ZTNA 4G1VA 4Z4WA 3R6JA 4Z4ZA 1KJZA 3LVBA 1T6XA 1VHEA 2VBTA 5IYWA 4DQKA 4ASUA 3OEEA 5TRDA 2XGJA 4P9SA 2WYRA 3W2HA 1WPCA 3U6KA 1KK0A 4P2NA 1W2BB 1E1RA 3AVVA 1XE1A 5BSYA 2XOKA 1U2RA 4XKWA 4E0FA 3BNWA 1QH0A 5IYNA 5A88A 2DY1A 2CK3A 1BPLA 2CC2A 2OK7A 2VBSA 1DDGA 1PKVA 1T5EA 2QTZA 4OP7A 3T56B 1UD3A 1YIJB 1VLYA 3AVWA 1JA0A 4Z4RA 1SKQA 4RPBA 3T53B 4B44A 2GPJA 2D3LA 3WXMA 4ZCIA 2GJPA 1W0JA 3V76A 4ZCMA 1W0KA 2VJJA 3V7AA 1ZM2A 4NCNA 1FRQA 4C43A 3AVXA 4FWTA 4B47A 4G7WA 2B7CA 3A8IA 4XLCA 4GQNA 3AVYA 3OEHA 3CCVB 5IYQA 2XNJA 3BY2A 4RCZA 1V5VA 2CBXA 4B4DA 2VBVA 1TVCA 4YAFA 1KTVA 2X85A 3MHPA 3Q38A 4ROXA 5DSZA 2ZL7A 3U2QA 4P6VF 3AGQA 4KKSA 1WP6A 4X06A 4X07A 1YJWB 2ZZEA 3W5VA 4XLFA 3OPOA 1KMHA 1OB0A 1E64A 3CRZA 1K9MD 4X8IA 3CCLB 2ZZGA 4NNJA 3SJPA 4C0SA 3W5HA 4X7FA 3WNDA 1OHHA 2XEXA 1QG0A 4QHYA 5A89A 1VQPB 4XKVA 1W35A 4TKOB 1UD4A 2X0KA 4LBVA 3CW2A 2D9RA 4P3IA 2M5SA 3LQ6A 2QMUA 4M2LA 3ZBUA 2GK7A 3CCSB 1OGJA 2RC5A 4M1KA 3LQEA 1VQ7B 2WJVA 1JJ2B 2GJRA 2V7XA 3Q6RA 1NBMA 1CQXA 3QFTA 3H9NA 2VJIA 1QFYA 5KNLA 2XZPA 1AMOA 1G7TA 1Y0YA 4XLEA 3ONUA 4UZEA 1MABA 3I55B 2V31A 4MYTA 1GVHA 3JQQA 5FNZA 4B3XA 3PUMA 3VNVA 1VQ4B 4H9GA 4HE6A 4XMYA 2CF4A 5IK2A 3D26A 1W87A 4II3A 4PAAA 3CD6B 1F20A 4RDKA 5DS0A 2J7KA 4YALA 4P12A 1EFTA 2C5BA 2ZBUA 1JNYA 1ZM3A 3CP8A 1I7PA 2YWEA 3OAAA 3QFSA 4UAJA 2WZPP 4M53A 4U9UA 1EFRA 4OPOA 1F60A 4P22A 1CNEA 3CCJB 1G7RA 3CC7B 1YHQB 4RM0A 2OBTA 3LNNA 4TT3A 3FPPA 5CDFA 3OFNA 1QGAA 3QE2A 5GV8A 2BM0A 4Z4YA 1T6ZA 4PC7A 4Z4VA 3ZZ0A 3CESA 2W6IA 2C78A 2VZLA 5LMZA 3Q3AA 2OTJB 3ZPNA 1NJID 3A3BA 5TV2A 4MYUA 3OW2B 1M1KD 2ZL6A 3ZZTA 1E1QA 2WJYA 5BSXA 4G5GA 5H5JA 1FRNA 2E1BA 3B78A 3CB4A 3PA2A 1TUIA 5HKKA 1QVFB 1FNDA 3CCQB 4P25A 1Q81D 4TN1A 4XQFA 2ZZQA 2QEXB 1QUFA 1WSRA 2VNJA 3PVDA 4N3NA 3BY1A 5TY0A 4Z4UA 5FA6A 2P3MA 2R9VA 2W6JA 3AGPA 4M4SA 2QE7A 1RQRA 1MRZA 3GIRA 1R5BA 4G6IA 3CC2B 1VQMB 4RD2A 4AF7A 1IJEA 1Q7YD 1K8AD 3SLNA 3OZWA 3ASQA 3CXCB 2Z6BD 1H8HA 1BMFA 3KEWA 4OPVA 1GAWA 1TLLA 4PC1A 5JBQA 1UD8A 3QFCA 3AVTA 3ASRA 3OE7A 1E3ZA 1S0UA 5FO0A 1D1NA 4R71A 1NB0A 4G7XA 2X3UA 1B23P 2PMDA 2CRVA 2X6WA 1N07A 4WZEA 3ZBTA 1WSVA 2BF4A 1I18A 4P6YA 3BCDA 4LBWA 4KKUA 1VQ6B 2FX3A 1OB2A 3JU4A 3J81k 2F1MA 1SM4A 3CC4B 1Q86D 4PC6A 3W2EA 1DG1G 3W2IA 1E43A 3MCAA 1WTHD 1QGYA 1S4MA 4XN3A 3GVKA 4Z4TA 2XZOA 2VBUA 4WZKA 2YWGA 1FX0A 1D2EA 4TMXA 5J3OA 3WY9A 4NBSA 5HZAA 3G6EB 4AVZA 2B5OA 2QA4B 2V7WA 1VF7A 2OK8A 1GAQA 2BV3A 2CW5A 2FVGA 3CMMA 2QGGA 3P27A 5KW9A 3T51B 2ZTGA 5L46A 4P1VA 2VNIA 1I8DA 1EXMA 2DOGA 4LBZA 1M90D 3OZVA 1N0UA 5F4JA 1DDIA 3SKBA 3ZC3A 1VQLB 2BVNA 2OYNA 2DEUA 1KC8D 1EP1B 2HDNB 2ZITA 1VLOA 4QFMA 5E6TA 1WOSA 2PE3A 1TTTA 3BCFA 3H94A 2WR8A 4DNRB 3R6KA 4P26A 2F43A 5IYRA 1B2RA 2DCUA 1EFUA 2GREA 4HE5A 1PJ5A 4OPSA 4B3GA 1QGZA 2XNDA 3SEJA 2I1LA 4XORA 3Q39A 4QVAA 1NDHA 1S72B 1N0VC 1SKYB 2ZXIA 4RD1A
chains in the Genus database with same CATH topology
1ZUNB 2BM1A 3WBKA 1KD1D 4YHBA 1FNBA 3FPKA 5H59A 2OTLB 4Y7CA 4ZCLA 3JQRA 1VQ5B 1IB0A 3FJOA 2YWFA 3I1FA 2VYQA 2BSAA 2B7BA 3ES9A 1D8TA 3WBJA 1CNFA 4YAOA 1E62A 2XNCA 4RCYA 4EH1A 3OJXA 3QFRA 1VQKB 1VQ9B 4P3YA 4RD0A 4IW3B 5EMNA 4RD3A 1QX4A 1GO2A 2DETA 3CCMB 1FDRA 3E1YE 3SJZA 3VNUA 2GQFA 4G1BA 1IJFA 3VO1A 3WNCA 3JQPA 4ACBA 5GV7A 2EIXA 1FNMA 3QSYA 4F7DA 1YI2B 2E1RA 1JB9A 4B48A 1VQOB 3VO2A 4LC0A 3W5UA 2BN4A 4PC3A 1A8PA 4PGOA 2VNKA 2PIAA 4TMTA 1VQNB 1N8RD 4ZGNB 1BX1A 1BX0A 1ZM4A 3CMAB 2HCJB 3ZZUA 4AF6A 1KQSB 1HA3A 4DQLA 1YJ9B 2CNDA 4FK8A 3OJWA 1YITB 2QTLA 4Y9RA 5HXBA 2AHOA 1FNCA 1JA1A 3AVUA 3OZUA 2C77A 2PLFA 1J9ZA 1GJRA 3CCUB 4J0QA 2YWHA 1UMKA 4RD6A 5THXA 5KSWB 1R5NA 1GR1A 1ZM9A 1H42A 4TMZA 4K1XA 1R5OA 4LBYA 2BGJA 4AC9A 1EP3B 2NPFA 1WDTA 1E63A 3WNBA 3WYAA 1QUEA 4N3GA 1BJKA 2EFGA 1Q82D 2D74A 4FN5A 1ELOA 1G7SA 3LO8A 4B43A 1EP2B 2BPOA 3CCEB 2DERA 1OGIA 4YAUA 3B82A 4YAWA 2QN6A 3P26A 4Y9UA 1H85A 5TR9A 1K73D 3G4SB 4WQMA 2HMAA 1VQ8B 1BQEA 4RD4A 4M0LA 2RC6A 4ZGQB 1EFCA 3CCRB 1QFJA 2BMWA 3VMFA 2BGIA 4Q7JB 1YJNB 1KK1A 3G71B 4ZV4A 1DARA 3E20A 2VNHA 1XB2A 1QVGB 3MMPA 1KRHA 2QDXA 3PENA 3U6BA 1AIPA 1OB5A 3CMEB 1G7CA 1KK2A 1KK3A 4BPRA 4RJLA 3W2FA 3CPWB 3I56B 1EWYA 4ACAA 1W34A 4TMWA 2R6HA 4TMVA 3B8HA 4PC2A 1QFZA 5AN9A 4G1VA 3LVBA 1KJZA 4DQKA 3W2HA 3U6KA 1KK0A 1W2BB 3AVVA 1XE1A 1U2RA 1QH0A 2DY1A 2OK7A 1DDGA 2QTZA 1YIJB 3AVWA 1JA0A 1SKQA 4B44A 2GPJA 3WXMA 4ZCIA 3V76A 4ZCMA 1ZM2A 4NCNA 1FRQA 4C43A 3AVXA 4FWTA 4B47A 2B7CA 3AVYA 3CCVB 2XNJA 4RCZA 4B4DA 1TVCA 4YAFA 1KTVA 3MHPA 5DSZA 3U2QA 4P6VF 3AGQA 1YJWB 3W5VA 1E64A 3CRZA 1K9MD 3CCLB 4C0SA 3W5HA 3WNDA 2XEXA 1QG0A 4QHYA 1VQPB 1W35A 4LBVA 3CW2A 2QMUA 4M2LA 3ZBUA 3CCSB 1VQ7B 1OGJA 2RC5A 4M1KA 1JJ2B 1CQXA 3QFTA 1QFYA 1AMOA 1G7TA 3I55B 4MYTA 1GVHA 3JQQA 4B3XA 3VNVA 1VQ4B 4H9GA 4HE6A 1W87A 3CD6B 1F20A 2J7KA 4YALA 1EFTA 1JNYA 1ZM3A 1I7PA 2YWEA 3QFSA 4UAJA 4M53A 4U9UA 1F60A 1CNEA 3CCJB 1G7RA 3CC7B 1YHQB 1QGAA 3QE2A 5GV8A 2BM0A 4PC7A 3ZZ0A 2C78A 2VZLA 2OTJB 1NJID 5TV2A 4MYUA 3OW2B 1M1KD 3ZZTA 4G5GA 5H5JA 1FRNA 1QVFB 3B78A 3CB4A 1TUIA 1FNDA 3CCQB 1Q81D 4TN1A 2QEXB 1QUFA 2VNJA 4N3NA 5TY0A 5FA6A 3AGPA 4M4SA 1R5BA 3CC2B 1VQMB 4RD2A 4AF7A 1IJEA 1Q7YD 1K8AD 3OZWA 3CXCB 1GAWA 1TLLA 4PC1A 5JBQA 3QFCA 3AVTA 1S0UA 1D1NA 4R71A 2X3UA 1B23P 2PMDA 2CRVA 3ZBTA 2BF4A 4LBWA 1VQ6B 2FX3A 1OB2A 3J81k 1SM4A 3CC4B 1Q86D 4PC6A 3W2EA 3W2IA 1DG1G 3MCAA 1QGYA 2YWGA 1D2EA 4TMXA 3WY9A 4NBSA 3G6EB 2B5OA 2QA4B 2OK8A 1GAQA 2BV3A 3P27A 2VNIA 1M90D 1EXMA 4LBZA 3OZVA 1N0UA 3ZC3A 1DDIA 1VQLB 2BVNA 2DEUA 1KC8D 1EP1B 2HDNB 2ZITA 4QFMA 1TTTA 1B2RA 2DCUA 1EFUA 4HE5A 1QGZA 1NDHA 1S72B 1N0VC 3W2GA 4RD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUN B;  2BM1 A;  3WBK A;  1KD1 D;  4YHB A;  1FNB A;  3FPK A;  5H59 A;  2OTL B;  4Y7C A;  4ZCL A;  3JQR A;  1VQ5 B;  1IB0 A;  3FJO A;  2YWF A;  3I1F A;  2VYQ A;  2BSA A;  2B7B A;  3ES9 A;  1D8T A;  3WBJ A;  1CNF A;  4YAO A;  1E62 A;  2XNC A;  4RCY A;  4EH1 A;  3OJX A;  3QFR A;  1VQK B;  1VQ9 B;  4P3Y A;  4RD0 A;  4IW3 B;  5EMN A;  4RD3 A;  1QX4 A;  1GO2 A;  2DET A;  3CCM B;  1FDR A;  3E1Y E;  3SJZ A;  3VNU A;  2GQF A;  4G1B A;  1IJF A;  3VO1 A;  3WNC A;  3JQP A;  4ACB A;  5GV7 A;  2EIX A;  1FNM A;  3QSY A;  4F7D A;  1YI2 B;  2E1R A;  1JB9 A;  4B48 A;  1VQO B;  3VO2 A;  4LC0 A;  3W5U A;  2BN4 A;  4PC3 A;  1A8P A;  4PGO A;  2VNK A;  2PIA A;  4TMT A;  1VQN B;  1N8R D;  4ZGN B;  1BX1 A;  1BX0 A;  1ZM4 A;  3CMA B;  2HCJ B;  3ZZU A;  4AF6 A;  1KQS B;  1HA3 A;  4DQL A;  1YJ9 B;  2CND A;  4FK8 A;  3OJW A;  1YIT B;  2QTL A;  4Y9R A;  5HXB A;  2AHO A;  1FNC A;  1JA1 A;  3AVU A;  3OZU A;  2C77 A;  2PLF A;  1J9Z A;  1GJR A;  3CCU B;  4J0Q A;  2YWH A;  1UMK A;  4RD6 A;  5THX A;  5KSW B;  1R5N A;  1GR1 A;  1ZM9 A;  1H42 A;  4TMZ A;  4K1X A;  1R5O A;  4LBY A;  2BGJ A;  4AC9 A;  1EP3 B;  2NPF A;  1WDT A;  1E63 A;  3WNB A;  3WYA A;  1QUE A;  4N3G A;  1BJK A;  2EFG A;  1Q82 D;  2D74 A;  4FN5 A;  1ELO A;  1G7S A;  3LO8 A;  4B43 A;  1EP2 B;  2BPO A;  3CCE B;  2DER A;  1OGI A;  4YAU A;  3B82 A;  4YAW A;  2QN6 A;  3P26 A;  4Y9U A;  1H85 A;  5TR9 A;  1K73 D;  3G4S B;  4WQM A;  2HMA A;  1VQ8 B;  1BQE A;  4RD4 A;  4M0L A;  2RC6 A;  4ZGQ B;  1EFC A;  3CCR B;  1QFJ A;  2BMW A;  3VMF A;  2BGI A;  4Q7J B;  1YJN B;  1KK1 A;  3G71 B;  4ZV4 A;  1DAR A;  3E20 A;  2VNH A;  1XB2 A;  1QVG B;  3MMP A;  1KRH A;  2QDX A;  3PEN A;  3U6B A;  1AIP A;  1OB5 A;  3CME B;  1G7C A;  1KK2 A;  1KK3 A;  4BPR A;  4RJL A;  3W2F A;  3CPW B;  3I56 B;  1EWY A;  4ACA A;  1W34 A;  4TMW A;  2R6H A;  4TMV A;  3B8H A;  4PC2 A;  1QFZ A;  5AN9 A;  4G1V A;  3LVB A;  1KJZ A;  4DQK A;  3W2H A;  3U6K A;  1KK0 A;  1W2B B;  3AVV A;  1XE1 A;  1U2R A;  1QH0 A;  2DY1 A;  2OK7 A;  1DDG A;  2QTZ A;  1YIJ B;  3AVW A;  1JA0 A;  1SKQ A;  4B44 A;  2GPJ A;  3WXM A;  4ZCI A;  3V76 A;  4ZCM A;  1ZM2 A;  4NCN A;  1FRQ A;  4C43 A;  3AVX A;  4FWT A;  4B47 A;  2B7C A;  3AVY A;  3CCV B;  2XNJ A;  4RCZ A;  4B4D A;  1TVC A;  4YAF A;  1KTV A;  3MHP A;  5DSZ A;  3U2Q A;  4P6V F;  3AGQ A;  1YJW B;  3W5V A;  1E64 A;  3CRZ A;  1K9M D;  3CCL B;  4C0S A;  3W5H A;  3WND A;  2XEX A;  1QG0 A;  4QHY A;  1VQP B;  1W35 A;  4LBV A;  3CW2 A;  2QMU A;  4M2L A;  3ZBU A;  3CCS B;  1VQ7 B;  1OGJ A;  2RC5 A;  4M1K A;  1JJ2 B;  1CQX A;  3QFT A;  1QFY A;  1AMO A;  1G7T A;  3I55 B;  4MYT A;  1GVH A;  3JQQ A;  4B3X A;  3VNV A;  1VQ4 B;  4H9G A;  4HE6 A;  1W87 A;  3CD6 B;  1F20 A;  2J7K A;  4YAL A;  1EFT A;  1JNY A;  1ZM3 A;  1I7P A;  2YWE A;  3QFS A;  4UAJ A;  4M53 A;  4U9U A;  1F60 A;  1CNE A;  3CCJ B;  1G7R A;  3CC7 B;  1YHQ B;  1QGA A;  3QE2 A;  5GV8 A;  2BM0 A;  4PC7 A;  3ZZ0 A;  2C78 A;  2VZL A;  2OTJ B;  1NJI D;  5TV2 A;  4MYU A;  3OW2 B;  1M1K D;  3ZZT A;  4G5G A;  5H5J A;  1FRN A;  1QVF B;  3B78 A;  3CB4 A;  1TUI A;  1FND A;  3CCQ B;  1Q81 D;  4TN1 A;  2QEX B;  1QUF A;  2VNJ A;  4N3N A;  5TY0 A;  5FA6 A;  3AGP A;  4M4S A;  1R5B A;  3CC2 B;  1VQM B;  4RD2 A;  4AF7 A;  1IJE A;  1Q7Y D;  1K8A D;  3OZW A;  3CXC B;  1GAW A;  1TLL A;  4PC1 A;  5JBQ A;  3QFC A;  3AVT A;  1S0U A;  1D1N A;  4R71 A;  2X3U A;  1B23 P;  2PMD A;  2CRV A;  3ZBT A;  2BF4 A;  4LBW A;  1VQ6 B;  2FX3 A;  1OB2 A;  3J81 k;  1SM4 A;  3CC4 B;  1Q86 D;  4PC6 A;  3W2E A;  3W2I A;  1DG1 G;  3MCA A;  1QGY A;  2YWG A;  1D2E A;  4TMX A;  3WY9 A;  4NBS A;  3G6E B;  2B5O A;  2QA4 B;  2OK8 A;  1GAQ A;  2BV3 A;  3P27 A;  2VNI A;  1M90 D;  1EXM A;  4LBZ A;  3OZV A;  1N0U A;  3ZC3 A;  1DDI A;  1VQL B;  2BVN A;  2DEU A;  1KC8 D;  1EP1 B;  2HDN B;  2ZIT A;  4QFM A;  1TTT A;  1B2R A;  2DCU A;  1EFU A;  4HE5 A;  1QGZ A;  1NDH A;  1S72 B;  1N0V C;  3W2G A;  4RD1 A; 
#chains in the Genus database with same CATH topology
 1T6Y A;  1ZUN B;  4FXU A;  4X7C A;  2V7Q A;  3ASS A;  4WZL A;  3VR6 A;  4XD7 A;  2BM1 A;  3WBK A;  4DK0 A;  2WZN A;  1KD1 D;  4YHB A;  1FNB A;  3FPK A;  5H59 A;  3CTA A;  4Y7C A;  4ZCL A;  3JQR A;  2OTL B;  2C5H A;  1VQ5 B;  4YEJ A;  1IB0 A;  1YLO A;  3FJO A;  4RLZ A;  2YWF A;  4RPD A;  2ZBV A;  3OOC A;  3I1F A;  2VYQ A;  2C4U A;  1PJ6 A;  2BSA A;  2XZL A;  3PUN A;  2NV4 A;  1PJ7 A;  2X53 S;  2V7V A;  2B7B A;  1E79 A;  3ES9 A;  1D8T A;  2JJ2 A;  3WBJ A;  1CNF A;  4KKT A;  4YAO A;  3PA1 A;  4QUZ A;  1V0F A;  1E62 A;  1IHM A;  2XNC A;  4RCY A;  4EH1 A;  3OJX A;  3QFR A;  1VQK B;  1VQ9 B;  4P3Y A;  4RD0 A;  4IW3 B;  5EMN A;  4RD3 A;  4YEL A;  2OBS A;  1QX4 A;  1GO2 A;  2DET A;  3CCM B;  4XR6 A;  2DIE A;  4QVJ A;  1FDR A;  1V0E A;  3E1Y E;  4L8J A;  4X7E A;  1NRK A;  4XLH A;  1XFO A;  3SJZ A;  3VNU A;  2GQF A;  3NE5 B;  4UZU A;  2Q6O A;  5F4O A;  1VHO A;  4G1B A;  4II2 A;  4QV2 A;  2KVO A;  1IJF A;  1W9X A;  1H8E A;  3VO1 A;  2X8K A;  2X6X A;  3WNC A;  3JQP A;  1VJS A;  5GV7 A;  2EIX A;  1FNM A;  4ACB A;  4OOV A;  3QSY A;  4F7D A;  1YI2 B;  2E1R A;  1JB9 A;  4B48 A;  1VQO B;  3VO2 A;  4LC0 A;  2JDI A;  3W5U A;  3ISX A;  2BN4 A;  5F4M A;  4CQJ A;  1BLI A;  4PC3 A;  1A8P A;  3DDY A;  2VNK A;  4PGO A;  4XL9 A;  5B6I A;  2PIA A;  2HLD A;  3KL9 A;  4TMT A;  1VQN B;  1N8R D;  4ZGN B;  3CPX A;  2OBR A;  4XNF A;  1BX1 A;  1P4M A;  1BX0 A;  1HZE A;  1ZM4 A;  3CMA B;  2HCJ B;  4OOX A;  5J35 A;  3ZZU A;  5IYP A;  4WZT A;  4AF6 A;  1KQS B;  1HA3 A;  1UD6 A;  4DQL A;  3GQB A;  4XM3 A;  3OKX A;  4TSF A;  3OP1 A;  1YJ9 B;  2CND A;  4FK8 A;  2Q6K A;  2V7U A;  3BQJ A;  1Q9S A;  3FKS A;  4XOT A;  4XOP A;  3OJW A;  1WOP A;  1YIT B;  2QTL A;  2WPD A;  5DN6 A;  4Y9R A;  3WQZ A;  5HXB A;  2AHO A;  1FNC A;  3G05 A;  2ZL5 A;  1JA1 A;  3AVU A;  3A3G A;  4RDL A;  3OZU A;  1N08 A;  2C77 A;  2PLF A;  2Q6L A;  2DYI A;  1J9Z A;  4UZF A;  1GJR A;  5FO1 A;  3CCU B;  4J0Q A;  2WSS A;  3Q6Q A;  2YWH A;  1UMK A;  4RD6 A;  4PAB A;  5THX A;  5KSW B;  4XN0 A;  2V4D A;  1R5N A;  5HZB A;  1GR1 A;  1E3X A;  2JJ1 A;  4OOS A;  1ZM9 A;  5FIU A;  1N06 A;  1H42 A;  4TMZ A;  4K1X A;  1R5O A;  4LBY A;  1K28 D;  2BGJ A;  4XON A;  1NB9 A;  4DNT B;  2X6Y A;  4AC9 A;  1WOO A;  1EP3 B;  2NPF A;  4WWV A;  4YXW A;  1WDT A;  1WU8 A;  1COW A;  1E63 A;  3WNB A;  1N05 A;  3WYA A;  1UD5 A;  2F4N A;  1QUE A;  3SLD A;  3OW7 A;  3ASP A;  4X05 A;  3RY8 A;  1KZL A;  2Q6I A;  4N3G A;  5FL7 A;  4RDJ A;  1BJK A;  2EFG A;  2F1L A;  1Q82 D;  2D74 A;  4FN5 A;  4XLA A;  1ELO A;  1G7S A;  3A8J A;  2C2W A;  3LO8 A;  4B43 A;  3W2G A;  4JMQ A;  4Z4S A;  1EP2 B;  3AST A;  2BPO A;  3CCE B;  3CP2 A;  2DER A;  3A8K A;  1WOR A;  1XQB A;  1OGI A;  4YAU A;  3ZUG A;  4X7D A;  3B82 A;  4YAW A;  2QN6 A;  3A1P A;  3P26 A;  4Y9U A;  4HIZ A;  3BC9 A;  1H85 A;  5TR9 A;  4DK1 A;  3HAG A;  2V7T A;  4WQM A;  3G4S B;  1K73 D;  2HMA A;  1VQ8 B;  1BQE A;  3ONY A;  4RD4 A;  1Y0R A;  4M0L A;  2RC6 A;  4X0C A;  4Z1M A;  3ZIA A;  4ZGQ B;  1EFC A;  2LZJ A;  2ZZF A;  3CCR B;  1QFJ A;  2BMW A;  2BGI A;  4Q7J B;  3VMF A;  1YJN B;  2ZXH A;  1KK1 A;  5A8A A;  3G71 B;  3GSI A;  4ZV4 A;  1DAR A;  3GVL A;  3E20 A;  2VNH A;  1XB2 A;  3GVJ A;  1QVG B;  2JIZ A;  3MMP A;  2GJK A;  1KRH A;  1HVX A;  2GK6 A;  1YX2 A;  2C4T A;  2QDX A;  3PEN A;  3U6B A;  1AIP A;  1OB5 A;  3A35 A;  3CME B;  1RQP A;  1G7C A;  1KK2 A;  3BH4 A;  1KK3 A;  4BPR A;  4RJL A;  3W2F A;  3CPW B;  1UD2 A;  4B3F X;  3I56 B;  1EWY A;  2JN9 A;  4ACA A;  2D3N A;  1W34 A;  4TMW A;  2R6H A;  4TMV A;  3B8H A;  4PC2 A;  1QFZ A;  5AN9 A;  2ZTN A;  4G1V A;  4Z4W A;  3R6J A;  4Z4Z A;  1KJZ A;  3LVB A;  1T6X A;  1VHE A;  2VBT A;  5IYW A;  4DQK A;  4ASU A;  3OEE A;  5TRD A;  2XGJ A;  4P9S A;  2WYR A;  3W2H A;  1WPC A;  3U6K A;  1KK0 A;  4P2N A;  1W2B B;  1E1R A;  3AVV A;  1XE1 A;  5BSY A;  2XOK A;  1U2R A;  4XKW A;  4E0F A;  3BNW A;  1QH0 A;  5IYN A;  5A88 A;  2DY1 A;  2CK3 A;  1BPL A;  2CC2 A;  2OK7 A;  2VBS A;  1DDG A;  1PKV A;  1T5E A;  2QTZ A;  4OP7 A;  3T56 B;  1UD3 A;  1YIJ B;  1VLY A;  3AVW A;  1JA0 A;  4Z4R A;  1SKQ A;  4RPB A;  3T53 B;  4B44 A;  2GPJ A;  2D3L A;  3WXM A;  4ZCI A;  2GJP A;  1W0J A;  3V76 A;  4ZCM A;  1W0K A;  2VJJ A;  3V7A A;  1ZM2 A;  4NCN A;  1FRQ A;  4C43 A;  3AVX A;  4FWT A;  4B47 A;  4G7W A;  2B7C A;  3A8I A;  4XLC A;  4GQN A;  3AVY A;  3OEH A;  3CCV B;  5IYQ A;  2XNJ A;  3BY2 A;  4RCZ A;  1V5V A;  2CBX A;  4B4D A;  2VBV A;  1TVC A;  4YAF A;  1KTV A;  2X85 A;  3MHP A;  3Q38 A;  4ROX A;  5DSZ A;  2ZL7 A;  3U2Q A;  4P6V F;  3AGQ A;  4KKS A;  1WP6 A;  4X06 A;  4X07 A;  1YJW B;  2ZZE A;  3W5V A;  4XLF A;  3OPO A;  1KMH A;  1OB0 A;  1E64 A;  3CRZ A;  1K9M D;  4X8I A;  3CCL B;  2ZZG A;  4NNJ A;  3SJP A;  4C0S A;  3W5H A;  4X7F A;  3WND A;  1OHH A;  2XEX A;  1QG0 A;  4QHY A;  5A89 A;  1VQP B;  4XKV A;  1W35 A;  4TKO B;  1UD4 A;  2X0K A;  4LBV A;  3CW2 A;  2D9R A;  4P3I A;  2M5S A;  3LQ6 A;  2QMU A;  4M2L A;  3ZBU A;  2GK7 A;  3CCS B;  1OGJ A;  2RC5 A;  4M1K A;  3LQE A;  1VQ7 B;  2WJV A;  1JJ2 B;  2GJR A;  2V7X A;  3Q6R A;  1NBM A;  1CQX A;  3QFT A;  3H9N A;  2VJI A;  1QFY A;  5KNL A;  2XZP A;  1AMO A;  1G7T A;  1Y0Y A;  4XLE A;  3ONU A;  4UZE A;  1MAB A;  3I55 B;  2V31 A;  4MYT A;  1GVH A;  3JQQ A;  5FNZ A;  4B3X A;  3PUM A;  3VNV A;  1VQ4 B;  4H9G A;  4HE6 A;  4XMY A;  2CF4 A;  5IK2 A;  3D26 A;  1W87 A;  4II3 A;  4PAA A;  3CD6 B;  1F20 A;  4RDK A;  5DS0 A;  2J7K A;  4YAL A;  4P12 A;  1EFT A;  2C5B A;  2ZBU A;  1JNY A;  1ZM3 A;  3CP8 A;  1I7P A;  2YWE A;  3OAA A;  3QFS A;  4UAJ A;  2WZP P;  4M53 A;  4U9U A;  1EFR A;  4OPO A;  1F60 A;  4P22 A;  1CNE A;  3CCJ B;  1G7R A;  3CC7 B;  1YHQ B;  4RM0 A;  2OBT A;  3LNN A;  4TT3 A;  3FPP A;  5CDF A;  3OFN A;  1QGA A;  3QE2 A;  5GV8 A;  2BM0 A;  4Z4Y A;  1T6Z A;  4PC7 A;  4Z4V A;  3ZZ0 A;  3CES A;  2W6I A;  2C78 A;  2VZL A;  5LMZ A;  3Q3A A;  2OTJ B;  3ZPN A;  1NJI D;  3A3B A;  5TV2 A;  4MYU A;  3OW2 B;  1M1K D;  2ZL6 A;  3ZZT A;  1E1Q A;  2WJY A;  5BSX A;  4G5G A;  5H5J A;  1FRN A;  2E1B A;  3B78 A;  3CB4 A;  3PA2 A;  1TUI A;  5HKK A;  1QVF B;  1FND A;  3CCQ B;  4P25 A;  1Q81 D;  4TN1 A;  4XQF A;  2ZZQ A;  2QEX B;  1QUF A;  1WSR A;  2VNJ A;  3PVD A;  4N3N A;  3BY1 A;  5TY0 A;  4Z4U A;  5FA6 A;  2P3M A;  2R9V A;  2W6J A;  3AGP A;  4M4S A;  2QE7 A;  1RQR A;  1MRZ A;  3GIR A;  1R5B A;  4G6I A;  3CC2 B;  1VQM B;  4RD2 A;  4AF7 A;  1IJE A;  1Q7Y D;  1K8A D;  3SLN A;  3OZW A;  3ASQ A;  3CXC B;  2Z6B D;  1H8H A;  1BMF A;  3KEW A;  4OPV A;  1GAW A;  1TLL A;  4PC1 A;  5JBQ A;  1UD8 A;  3QFC A;  3AVT A;  3ASR A;  3OE7 A;  1E3Z A;  1S0U A;  5FO0 A;  1D1N A;  4R71 A;  1NB0 A;  4G7X A;  2X3U A;  1B23 P;  2PMD A;  2CRV A;  2X6W A;  1N07 A;  4WZE A;  3ZBT A;  1WSV A;  2BF4 A;  1I18 A;  4P6Y A;  3BCD A;  4LBW A;  4KKU A;  1VQ6 B;  2FX3 A;  1OB2 A;  3JU4 A;  3J81 k;  2F1M A;  1SM4 A;  3CC4 B;  1Q86 D;  4PC6 A;  3W2E A;  1DG1 G;  3W2I A;  1E43 A;  3MCA A;  1WTH D;  1QGY A;  1S4M A;  4XN3 A;  3GVK A;  4Z4T A;  2XZO A;  2VBU A;  4WZK A;  2YWG A;  1FX0 A;  1D2E A;  4TMX A;  5J3O A;  3WY9 A;  4NBS A;  5HZA A;  3G6E B;  4AVZ A;  2B5O A;  2QA4 B;  2V7W A;  1VF7 A;  2OK8 A;  1GAQ A;  2BV3 A;  2CW5 A;  2FVG A;  3CMM A;  2QGG A;  3P27 A;  5KW9 A;  3T51 B;  2ZTG A;  5L46 A;  4P1V A;  2VNI A;  1I8D A;  1EXM A;  2DOG A;  4LBZ A;  1M90 D;  3OZV A;  1N0U A;  5F4J A;  1DDI A;  3SKB A;  3ZC3 A;  1VQL B;  2BVN A;  2OYN A;  2DEU A;  1KC8 D;  1EP1 B;  2HDN B;  2ZIT A;  1VLO A;  4QFM A;  5E6T A;  1WOS A;  2PE3 A;  1TTT A;  3BCF A;  3H94 A;  2WR8 A;  4DNR B;  3R6K A;  4P26 A;  2F43 A;  5IYR A;  1B2R A;  2DCU A;  1EFU A;  2GRE A;  4HE5 A;  1PJ5 A;  4OPS A;  4B3G A;  1QGZ A;  2XND A;  3SEJ A;  2I1L A;  4XOR A;  3Q39 A;  4QVA A;  1NDH A;  1S72 B;  1N0V C;  1SKY B;  2ZXI A;  4RD1 A; 
#chains in the Genus database with same CATH homology
 1ZUN B;  2BM1 A;  3WBK A;  1KD1 D;  4YHB A;  1FNB A;  3FPK A;  5H59 A;  2OTL B;  4Y7C A;  4ZCL A;  3JQR A;  1VQ5 B;  1IB0 A;  3FJO A;  2YWF A;  3I1F A;  2VYQ A;  2BSA A;  2B7B A;  3ES9 A;  1D8T A;  3WBJ A;  1CNF A;  4YAO A;  1E62 A;  2XNC A;  4RCY A;  4EH1 A;  3OJX A;  3QFR A;  1VQK B;  1VQ9 B;  4P3Y A;  4RD0 A;  4IW3 B;  5EMN A;  4RD3 A;  1QX4 A;  1GO2 A;  2DET A;  3CCM B;  1FDR A;  3E1Y E;  3SJZ A;  3VNU A;  2GQF A;  4G1B A;  1IJF A;  3VO1 A;  3WNC A;  3JQP A;  4ACB A;  5GV7 A;  2EIX A;  1FNM A;  3QSY A;  4F7D A;  1YI2 B;  2E1R A;  1JB9 A;  4B48 A;  1VQO B;  3VO2 A;  4LC0 A;  3W5U A;  2BN4 A;  4PC3 A;  1A8P A;  4PGO A;  2VNK A;  2PIA A;  4TMT A;  1VQN B;  1N8R D;  4ZGN B;  1BX1 A;  1BX0 A;  1ZM4 A;  3CMA B;  2HCJ B;  3ZZU A;  4AF6 A;  1KQS B;  1HA3 A;  4DQL A;  1YJ9 B;  2CND A;  4FK8 A;  3OJW A;  1YIT B;  2QTL A;  4Y9R A;  5HXB A;  2AHO A;  1FNC A;  1JA1 A;  3AVU A;  3OZU A;  2C77 A;  2PLF A;  1J9Z A;  1GJR A;  3CCU B;  4J0Q A;  2YWH A;  1UMK A;  4RD6 A;  5THX A;  5KSW B;  1R5N A;  1GR1 A;  1ZM9 A;  1H42 A;  4TMZ A;  4K1X A;  1R5O A;  4LBY A;  2BGJ A;  4AC9 A;  1EP3 B;  2NPF A;  1WDT A;  1E63 A;  3WNB A;  3WYA A;  1QUE A;  4N3G A;  1BJK A;  2EFG A;  1Q82 D;  2D74 A;  4FN5 A;  1ELO A;  1G7S A;  3LO8 A;  4B43 A;  1EP2 B;  2BPO A;  3CCE B;  2DER A;  1OGI A;  4YAU A;  3B82 A;  4YAW A;  2QN6 A;  3P26 A;  4Y9U A;  1H85 A;  5TR9 A;  1K73 D;  3G4S B;  4WQM A;  2HMA A;  1VQ8 B;  1BQE A;  4RD4 A;  4M0L A;  2RC6 A;  4ZGQ B;  1EFC A;  3CCR B;  1QFJ A;  2BMW A;  3VMF A;  2BGI A;  4Q7J B;  1YJN B;  1KK1 A;  3G71 B;  4ZV4 A;  1DAR A;  3E20 A;  2VNH A;  1XB2 A;  1QVG B;  3MMP A;  1KRH A;  2QDX A;  3PEN A;  3U6B A;  1AIP A;  1OB5 A;  3CME B;  1G7C A;  1KK2 A;  1KK3 A;  4BPR A;  4RJL A;  3W2F A;  3CPW B;  3I56 B;  1EWY A;  4ACA A;  1W34 A;  4TMW A;  2R6H A;  4TMV A;  3B8H A;  4PC2 A;  1QFZ A;  5AN9 A;  4G1V A;  3LVB A;  1KJZ A;  4DQK A;  3W2H A;  3U6K A;  1KK0 A;  1W2B B;  3AVV A;  1XE1 A;  1U2R A;  1QH0 A;  2DY1 A;  2OK7 A;  1DDG A;  2QTZ A;  1YIJ B;  3AVW A;  1JA0 A;  1SKQ A;  4B44 A;  2GPJ A;  3WXM A;  4ZCI A;  3V76 A;  4ZCM A;  1ZM2 A;  4NCN A;  1FRQ A;  4C43 A;  3AVX A;  4FWT A;  4B47 A;  2B7C A;  3AVY A;  3CCV B;  2XNJ A;  4RCZ A;  4B4D A;  1TVC A;  4YAF A;  1KTV A;  3MHP A;  5DSZ A;  3U2Q A;  4P6V F;  3AGQ A;  1YJW B;  3W5V A;  1E64 A;  3CRZ A;  1K9M D;  3CCL B;  4C0S A;  3W5H A;  3WND A;  2XEX A;  1QG0 A;  4QHY A;  1VQP B;  1W35 A;  4LBV A;  3CW2 A;  2QMU A;  4M2L A;  3ZBU A;  3CCS B;  1VQ7 B;  1OGJ A;  2RC5 A;  4M1K A;  1JJ2 B;  1CQX A;  3QFT A;  1QFY A;  1AMO A;  1G7T A;  3I55 B;  4MYT A;  1GVH A;  3JQQ A;  4B3X A;  3VNV A;  1VQ4 B;  4H9G A;  4HE6 A;  1W87 A;  3CD6 B;  1F20 A;  2J7K A;  4YAL A;  1EFT A;  1JNY A;  1ZM3 A;  1I7P A;  2YWE A;  3QFS A;  4UAJ A;  4M53 A;  4U9U A;  1F60 A;  1CNE A;  3CCJ B;  1G7R A;  3CC7 B;  1YHQ B;  1QGA A;  3QE2 A;  5GV8 A;  2BM0 A;  4PC7 A;  3ZZ0 A;  2C78 A;  2VZL A;  2OTJ B;  1NJI D;  5TV2 A;  4MYU A;  3OW2 B;  1M1K D;  3ZZT A;  4G5G A;  5H5J A;  1FRN A;  1QVF B;  3B78 A;  3CB4 A;  1TUI A;  1FND A;  3CCQ B;  1Q81 D;  4TN1 A;  2QEX B;  1QUF A;  2VNJ A;  4N3N A;  5TY0 A;  5FA6 A;  3AGP A;  4M4S A;  1R5B A;  3CC2 B;  1VQM B;  4RD2 A;  4AF7 A;  1IJE A;  1Q7Y D;  1K8A D;  3OZW A;  3CXC B;  1GAW A;  1TLL A;  4PC1 A;  5JBQ A;  3QFC A;  3AVT A;  1S0U A;  1D1N A;  4R71 A;  2X3U A;  1B23 P;  2PMD A;  2CRV A;  3ZBT A;  2BF4 A;  4LBW A;  1VQ6 B;  2FX3 A;  1OB2 A;  3J81 k;  1SM4 A;  3CC4 B;  1Q86 D;  4PC6 A;  3W2E A;  3W2I A;  1DG1 G;  3MCA A;  1QGY A;  2YWG A;  1D2E A;  4TMX A;  3WY9 A;  4NBS A;  3G6E B;  2B5O A;  2QA4 B;  2OK8 A;  1GAQ A;  2BV3 A;  3P27 A;  2VNI A;  1M90 D;  1EXM A;  4LBZ A;  3OZV A;  1N0U A;  3ZC3 A;  1DDI A;  1VQL B;  2BVN A;  2DEU A;  1KC8 D;  1EP1 B;  2HDN B;  2ZIT A;  4QFM A;  1TTT A;  1B2R A;  2DCU A;  1EFU A;  4HE5 A;  1QGZ A;  1NDH A;  1S72 B;  1N0V C;  3W2G A;  4RD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...