4HE6A

Crystal structure of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
SLKTTREFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase family U32
publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Unknown function
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he6A00
4BPRA 5TR9A 2PIAA 1K73D 1W35A 5FA6A 3I56B 4RD6A 3QFSA 3CPWB 1QGZA 4B47A 3MHPA 4QFMA 5GV8A 3CW2A 3VMFA 2QA4B 1XB2A 4G1VA 5EMNA 3CCEB 1EWYA 1YHQB 1QUEA 1W87A 3G6EB 5AN9A 3CC2B 4MYTA 3CB4A 2BVNA 4YAWA 3QFTA 3OJWA 1KK2A 3WXMA 3AVXA 1VQ6B 4G1BA 1JA0A 3VO2A 1Q81D 3B78A 2GQFA 1B23P 1K8AD 1J9ZA 1R5OA 1YJ9B 1VQOB 1NJID 1VQ9B 4M53A 3E1YE 2QDXA 1AMOA 3CCUB 4FN5A 4J0QA 4WQMA 1KK1A 1KQSB 1SM4A 1DG1G 4ZV4A 3G71B 2BSAA 3ES9A 1W2BB 1A8PA 3CMAB 2ZITA 2R6HA 3JQPA 1GR1A 1B2RA 5THXA 3W5HA 4ACAA 3CCRB 1QGAA 3QFCA 4YAUA 1GAQA 1ZM4A 1TUIA 2YWGA 4B44A 1YJNB 3CCMB 2BPOA 1BX0A 4N3GA 4DQLA 3ZC3A 1N0UA 1CNFA 4ZGNB 1K9MD 1VQ4B 1D1NA 4AF7A 2VNJA 1OGJA 1QG0A 4FWTA 2OK8A 3WY9A 1ZUNB 2QTZA 2BV3A 1VQ7B 3MMPA 1VQPB 1QFYA 4RD3A 1SKQA 4ACBA 1E64A 4YAOA 1EP1B 1I7PA 2XNCA 1XE1A 2OTJB 3W2GA 4TMXA 1DARA 1H42A 3ZBUA 1YJWB 3FJOA 1G7SA 1KTVA 3LVBA 3AVWA 1QVGB 2DERA 1S0UA 4Y9RA 4K1XA 1QVFB 1FRQA 3W2IA 1AIPA 1EP3B 3WBKA 1OGIA 4YHBA 1QFZA 2QTLA 4PGOA 1EFUA 2CNDA 3AGQA 4B3XA 1GO2A 4RJLA 3OW2B 4R71A 1KK0A 1KK3A 4TMVA 1JJ2B 4LBYA 1S72B 3I1FA 1ELOA 2AHOA 3CRZA 4UAJA 4LBVA 3B82A 3AVUA 1TLLA 3FPKA 1GJRA 4P6VF 1VQNB 3CCSB 3OJXA 1QUFA 4TMTA 4M4SA 3AVTA 1FNDA 1QX4A 1YITB 3ZZ0A 4DQKA 1OB2A 3U6BA 5HXBA 1IB0A 4LC0A 1F20A 1FNMA 1CNEA 1VQ8B 3U2QA 3CD6B 1JA1A 1FDRA 1BJKA 1DDGA 4YALA 2VYQA 4B48A 2YWHA 1D2EA 3QFRA 4G5GA 2BGJA 2GPJA 2DCUA 2QN6A 2HCJB 1VQLB 4EH1A 3MCAA 4PC1A 2D74A 2BM1A 3CC4B 1GVHA 4RD1A 4RD2A 2HMAA 2XEXA 2E1RA 3QE2A 4Q7JB 3AGPA 1DDIA 3E20A 2QEXB 1UMKA 2PMDA 2BGIA 2FX3A 1IJFA 2BF4A 3W2EA 5TY0A 2VZLA 5KSWB 2BM0A 3J81k 3OZUA 4TN1A 4U9UA 1BQEA 1ZM3A 1JNYA 2DETA 4ZCMA 1VQ5B 3I55B 1R5BA 4HE6A 2VNHA 3V76A 1FRNA 4NBSA 4MYUA 5JBQA 1EXMA 2NPFA 4M0LA 1ZM2A 1KJZA 4Y7CA 2VNKA 2C77A 3G4SB 3U6KA 4QHYA 2QMUA 3P27A 2BMWA 3W2FA 3WBJA 2RC5A 1M1KD 1E62A 2YWEA 4PC6A 3WYAA 4B4DA 4C0SA 3LO8A 1FNCA 1G7TA 3CC7B 1OB5A 1H85A 3CCJB 1BX1A 2VNIA 1WDTA 4TMZA 1D8TA 3CXCB 4LBZA 1EFCA 1Q86D 4RD0A 5GV7A 4RD4A 4PC2A 4YAFA 1TTTA 3WNDA 3W5VA 2RC6A 5H5JA 2DEUA 2PLFA 3JQQA 3CCQB 3SJZA 1N0VC 2YWFA 3VNUA 4PC3A 4AF6A 5TV2A 2XNJA 3CMEB 2HDNB 1N8RD 3OZVA 1EFTA 4ZCIA 3AVVA 2B7BA 3OZWA 2J7KA 3WNCA 1ZM9A 4N3NA 2X3UA 4NCNA 2OTLB 2DY1A 3WNBA 1QH0A 4LBWA 4B43A 4M2LA 4TMWA 1QGYA 4FK8A 1CQXA 3ZZTA 5DSZA 4RCZA 1G7CA 4HE5A 1EP2B 5H59A 1YI2B 1W34A 3W2HA 4F7DA 1R5NA 1FNBA 1QFJA 1U2RA 1TVCA 1KRHA 4RCYA 1YIJB 4IW3B 3P26A 2C78A 3CCLB 1E63A 2EFGA 3B8HA 3ZZUA 2B5OA 3AVYA 3CCVB 1JB9A 3ZBTA 1Q82D 3VNVA 1NDHA 4M1KA 4P3YA 1Q7YD 2OK7A 3W5UA 1M90D 2B7CA 2BN4A 4PC7A 4H9GA 1KD1D 3PENA 4C43A 1G7RA 1HA3A 4ZGQB 2EIXA 1VQMB 3QSYA 4Y9UA 1IJEA 4AC9A 4ZCLA 1VQKB 1KC8D 2CRVA 3VO1A 1GAWA 3JQRA 1F60A
chains in the Genus database with same CATH superfamily
2PE3A 5F4OA 3A3BA 4BPRA 5TR9A 2JN9A 3BCFA 2P3MA 2PIAA 1K73D 1W35A 3ASTA 5FA6A 2ZZQA 3I56B 4RD6A 3QFSA 3CPWB 1QGZA 4B47A 2GK7A 2Q6KA 3MHPA 3WQZA 2KVOA 3BY1A 4QFMA 5IYPA 4P25A 5GV8A 3BCDA 3CW2A 5IYRA 1W9XA 3ISXA 4QVJA 3VMFA 2QA4B 1XB2A 5CDFA 4B3FX 4X05A 2V7QA 4G1VA 2ZZGA 5EMNA 3CCEB 1EWYA 1YHQB 1V5VA 2ZL6A 1QUEA 4XLEA 1W87A 4Z4SA 3G6EB 3CC2B 4MYTA 5AN9A 4DNTB 3CB4A 4B3GA 5HZBA 2BVNA 2V7XA 4OPVA 2WZPP 1OB0A 2ZZFA 4YAWA 2VBSA 3QFTA 4RLZA 4Z4YA 3OJWA 1T5EA 1S4MA 1T6YA 1KK2A 3WXMA 1P4MA 4OPOA 3AVXA 3SEJA 3GQBA 1VQ6B 4G1BA 1W0JA 1JA0A 4KKUA 3VO2A 4OPSA 3Q6RA 1Q81D 5DN6A 3B78A 2GQFA 1E1QA 1B23P 1K8AD 1J9ZA 1R5OA 1YJ9B 1NB9A 1VQOB 1VHOA 1WP6A 1NJID 2XZOA 1VQ9B 2C2WA 4M53A 2V7TA 5KW9A 3E1YE 3Q39A 2QDXA 3ZUGA 1AMOA 3CCUB 4FN5A 1PKVA 2QE7A 4J0QA 4WQMA 1YLOA 1N05A 1KK1A 2V7VA 1KQSB 2X6XA 4II2A 2CW5A 1SM4A 1DG1G 4ZV4A 3G71B 2XOKA 4Z4VA 4XR6A 2BSAA 4Z4RA 5FL7A 1SKYB 3OKXA 3ES9A 2E1BA 1W2BB 1A8PA 4WZEA 4YEJA 3CMAB 2ZITA 2R6HA 1NB0A 3JQPA 3OOCA 4P1VA 3KEWA 4XOTA 1GR1A 1B2RA 3CESA 3CTAA 5THXA 3W5HA 4XKVA 4ACAA 3CCRB 1QGAA 2GJKA 4WZKA 3H94A 3QFCA 4TT3A 4YAUA 1GAQA 2CK3A 1ZM4A 1TUIA 2YWGA 4B44A 5IYQA 1YJNB 3CCMB 2BPOA 1V0FA 2R9VA 1Q9SA 1BX0A 3OPOA 2GJPA 4N3GA 4DQLA 3SKBA 3Q3AA 3PA2A 1N0UA 1PJ7A 1CNFA 4QUZA 3ZC3A 3A8JA 4ZGNB 1OHHA 1K9MD 4P2NA 1VQ4B 1D1NA 4AF7A 2V7WA 2VNJA 4XLAA 1UD6A 4XM3A 1OGJA 1QG0A 5IK2A 2DOGA 4ASUA 4FWTA 1I18A 2OK8A 2GK6A 1PJ6A 1XQBA 3WY9A 1ZUNB 2JDIA 4X07A 2QTZA 2BV3A 1VQ7B 3CMMA 2ZBUA 3MMPA 1VQPB 2JIZA 1QFYA 4RD3A 1SKQA 2X85A 1E64A 4RDLA 4ACBA 1W0KA 3VR6A 1NBMA 1EP1B 1WSRA 4YAOA 3BY2A 4X7CA 1I7PA 2XNCA 1XE1A 2OTJB 3W2GA 4TMXA 1DARA 1H42A 3ZBUA 1YJWB 3FJOA 2ZBVA 1NRKA 2FVGA 1G7SA 1KTVA 3LVBA 4HIZA 3AVWA 2VJIA 1QVGB 1WPCA 2DERA 1S0UA 4Y9RA 2ZTGA 5HZAA 4K1XA 1QVFB 1FRQA 1BLIA 1MABA 3W2IA 1AIPA 1EP3B 4PAAA 3WBKA 2F4NA 1OGIA 3ASRA 1QFZA 3OEHA 4YHBA 1VHEA 2QTLA 4PGOA 1EFUA 1V0EA 2CNDA 3AGQA 5BSXA 4B3XA 1GO2A 4RDKA 1VLYA 2C4UA 4RJLA 3OW2B 3LQEA 1KK0A 4R71A 1E3XA 1KK3A 2F43A 4TMVA 1JJ2B 4LBYA 5E6TA 4G6IA 1S72B 2LZJA 3I1FA 1ELOA 3ONYA 2AHOA 3CRZA 3RY8A 4AVZA 4DK0A 4UAJA 4LBVA 3Q38A 2Q6OA 3B82A 3T56B 1VJSA 4XD7A 3AVUA 5J3OA 1Y0YA 1TLLA 3FPKA 1GJRA 3SJPA 1WU8A 2C5BA 3CPXA 4P6VF 3OE7A 1VQNB 3CCSB 3OJXA 1UD4A 1QUFA 4TMTA 4M4SA 3AVTA 3R6KA 1FNDA 1K28D 2XNDA 1QX4A 1YITB 2XGJA 4X7DA 3ZZ0A 4DQKA 2WYRA 3Q6QA 5FO0A 1OB2A 1IHMA 3U6BA 1HZEA 5HXBA 4P22A 4KKTA 1COWA 1IB0A 5BSYA 4LC0A 5A89A 1F20A 1FNMA 2X8KA 2ZTNA 1CNEA 1VQ8B 3U2QA 1RQRA 2VBVA 4XLFA 3A8KA 2VBUA 3CD6B 1JA1A 1FDRA 4E0FA 3NE5B 1BJKA 1DDGA 3SLDA 3GIRA 4YALA 2VYQA 1BPLA 1N08A 3ASPA 2X6YA 4RM0A 4B48A 3JU4A 2YWHA 1D2EA 4WZLA 3QFRA 5A88A 4G5GA 2QN6A 2GPJA 2DCUA 2BGJA 5FNZA 2HCJB 1WORA 4TKOB 1VQLB 5B6IA 4EH1A 3MCAA 4PC1A 2D74A 2WR8A 4II3A 4P12A 2BM1A 3CC4B 1GVHA 2JJ1A 4P6YA 4RD2A 4RD1A 4RDJA 2HMAA 3A3GA 2C5HA 2Q6IA 3SLNA 2XEXA 4OOSA 2E1RA 3ASQA 4OOVA 3QE2A 4Q7JB 4X0CA 4X8IA 3BNWA 2GJRA 3AGPA 2DYIA 4XMYA 4OP7A 1DDIA 3E20A 2QEXB 3LNNA 1UMKA 2PMDA 2BGIA 2FX3A 1IJFA 2BF4A 3W2EA 5TY0A 3CP8A 2VZLA 5KSWB 2BM0A 3J81k 3OZUA 4TN1A 4DK1A 4U9UA 3PA1A 1BQEA 1RQPA 1ZM3A 1JNYA 2X6WA 4L8JA 2DETA 4ZCMA 1PJ5A 1VQ5B 3I55B 4XNFA 1R5BA 4HE6A 2VNHA 4WZTA 3V76A 1FRNA 1YX2A 4NBSA 2JJ2A 3H9NA 4MYUA 4WWVA 5JBQA 1EXMA 2NPFA 4ROXA 4TSFA 5TRDA 4M0LA 1ZM2A 2X53S 1KJZA 4P3IA 1MRZA 1WOOA 4KKSA 3FPPA 4Y7CA 2VNKA 2WPDA 2Z6BD 2OBTA 2C77A 5HKKA 3G4SB 3U6KA 4QHYA 2CC2A 2QMUA 3P27A 2BMWA 2W6IA 3W2FA 1N07A 3WBJA 2HLDA 2RC5A 1M1KD 1E62A 2YWEA 4PC6A 4NNJA 3HAGA 3WYAA 4B4DA 4YXWA 3LO8A 4C0SA 1FNCA 3ZIAA 1G7TA 3CC7B 5FO1A 3A8IA 2DIEA 2ZXHA 4XKWA 1OB5A 2WZNA 4PABA 1H85A 2V31A 3CCJB 1BX1A 2VNIA 1E1RA 1WDTA 3GVJA 1FX0A 1D8TA 4TMZA 3CXCB 4LBZA 3PVDA 1EFCA 2GREA 1Q86D 2XZPA 2F1LA 4RD0A 2I1LA 5GV7A 4X7FA 3OP1A 4RD4A 4XL9A 4PC2A 4YELA 3ASSA 3OEEA 5IYWA 4YAFA 4UZEA 1UD3A 4JMQA 2D3LA 3T51B 3ZPNA 2M5SA 3ONUA 4Z4ZA 1TTTA 3WNDA 2CBXA 3PUNA 4XN0A 3W5VA 2OYNA 5IYNA 4XORA 2RC6A 5H5JA 4XN3A 2DEUA 4QVAA 3GVLA 2PLFA 2WJYA 3JQQA 3CCQB 3CP2A 3SJZA 1KZLA 4Z4UA 1N0VC 2D9RA 2YWFA 3BC9A 3GVKA 3VNUA 4PC3A 4X7EA 1I8DA 4XOPA 4AF6A 5TV2A 4CQJA 1E43A 2XNJA 3CMEB 2HDNB 1N8RD 4G7WA 2WJVA 3A1PA 3OZVA 2D3NA 2Q6LA 1EFTA 1VF7A 2WSSA 4UZFA 1Y0RA 1KMHA 1UD2A 5F4JA 4ZCIA 3AVVA 2B7BA 3OZWA 4UZUA 5KNLA 3D26A 2F1MA 2J7KA 3WNCA 2XZLA 1ZM9A 4N3NA 1WOPA 2X3UA 4NCNA 2OTLB 2DY1A 3WNBA 1QH0A 4LBWA 3FKSA 1VLOA 4B43A 4M2LA 4TMWA 4DNRB 4XLCA 1QGYA 4FK8A 1CQXA 5FIUA 5L46A 3ZZTA 2V7UA 1UD8A 4RPDA 5DSZA 4Z4WA 1WTHD 4RCZA 1G7CA 4HE5A 4Z4TA 1EP2B 5H59A 4XQFA 3OAAA 1YI2B 4Z1MA 3PUMA 4GQNA 1W34A 3W2HA 4F7DA 1R5NA 3R6JA 2ZZEA 1FNBA 1QFJA 1U2RA 4P26A 1TVCA 1KRHA 1H8HA 4RCYA 1YIJB 4QV2A 2OBSA 4IW3B 4P9SA 3P26A 1XFOA 4RPBA 2C78A 4XONA 3CCLB 1E63A 2VJJA 3OW7A 5A8AA 1WOSA 2EFGA 3A35A 3B8HA 3ZZUA 2B5OA 3AVYA 1E79A 3CCVB 1JB9A 3ZBTA 3KL9A 1HVXA 3V7AA 1Q82D 3VNVA 4G7XA 1NDHA 3LQ6A 3DDYA 2C4TA 2ZL7A 4FXUA 4M1KA 5J35A 3T53B 1H8EA 4XLHA 4P3YA 1Q7YD 2OK7A 3W5UA 1BMFA 1UD5A 4X06A 2B7CA 1M90D 1T6XA 2BN4A 4PC7A 4H9GA 1KD1D 3PENA 1WSVA 4OOXA 3G05A 4C43A 1G7RA 3BH4A 1HA3A 1E3ZA 4ZGQB 2EIXA 1VQMB 3QSYA 2CF4A 5DS0A 5LMZA 3GSIA 3OFNA 2NV4A 2OBRA 3BQJA 4Y9UA 1IJEA 4AC9A 4ZCLA 1VQKB 2VBTA 2W6JA 1KC8D 2X0KA 2CRVA 3VO1A 1T6ZA 1GAWA 2ZL5A 2ZXIA 3JQRA 1F60A 2V4DA 1EFRA 2QGGA 5F4MA 1N06A
chains in the Genus database with same CATH topology
4BPRA 5TR9A 2PIAA 1K73D 1W35A 5FA6A 3I56B 4RD6A 3QFSA 3CPWB 1QGZA 4B47A 3MHPA 4QFMA 5GV8A 3CW2A 3VMFA 2QA4B 1XB2A 4G1VA 5EMNA 3CCEB 1EWYA 1YHQB 1QUEA 1W87A 3G6EB 5AN9A 3CC2B 4MYTA 3CB4A 2BVNA 4YAWA 3QFTA 3OJWA 1KK2A 3WXMA 3AVXA 1VQ6B 4G1BA 1JA0A 3VO2A 1Q81D 3B78A 2GQFA 1B23P 1K8AD 1J9ZA 1R5OA 1YJ9B 1VQOB 1NJID 1VQ9B 4M53A 3E1YE 2QDXA 1AMOA 3CCUB 4FN5A 4J0QA 4WQMA 1KK1A 1KQSB 1SM4A 1DG1G 4ZV4A 3G71B 2BSAA 3ES9A 1W2BB 1A8PA 3CMAB 2ZITA 2R6HA 3JQPA 1GR1A 1B2RA 5THXA 3W5HA 4ACAA 3CCRB 1QGAA 3QFCA 4YAUA 1GAQA 1ZM4A 1TUIA 2YWGA 4B44A 1YJNB 3CCMB 2BPOA 1BX0A 4N3GA 4DQLA 3ZC3A 1N0UA 1CNFA 4ZGNB 1K9MD 1VQ4B 1D1NA 4AF7A 2VNJA 1OGJA 1QG0A 4FWTA 2OK8A 3WY9A 1ZUNB 2QTZA 2BV3A 1VQ7B 3MMPA 1VQPB 1QFYA 4RD3A 1SKQA 4ACBA 1E64A 4YAOA 1EP1B 1I7PA 2XNCA 1XE1A 2OTJB 3W2GA 4TMXA 1DARA 1H42A 3ZBUA 1YJWB 3FJOA 1G7SA 1KTVA 3LVBA 3AVWA 1QVGB 2DERA 1S0UA 4Y9RA 4K1XA 1QVFB 1FRQA 3W2IA 1AIPA 1EP3B 3WBKA 1OGIA 4YHBA 1QFZA 2QTLA 4PGOA 1EFUA 2CNDA 3AGQA 4B3XA 1GO2A 4RJLA 3OW2B 4R71A 1KK0A 1KK3A 4TMVA 1JJ2B 4LBYA 1S72B 3I1FA 1ELOA 2AHOA 3CRZA 4UAJA 4LBVA 3B82A 3AVUA 1TLLA 3FPKA 1GJRA 4P6VF 1VQNB 3CCSB 3OJXA 1QUFA 4TMTA 4M4SA 3AVTA 1FNDA 1QX4A 1YITB 3ZZ0A 4DQKA 1OB2A 3U6BA 5HXBA 1IB0A 4LC0A 1F20A 1FNMA 1CNEA 1VQ8B 3U2QA 3CD6B 1JA1A 1FDRA 1BJKA 1DDGA 4YALA 2VYQA 4B48A 2YWHA 1D2EA 3QFRA 4G5GA 2BGJA 2GPJA 2DCUA 2QN6A 2HCJB 1VQLB 4EH1A 3MCAA 4PC1A 2D74A 2BM1A 3CC4B 1GVHA 4RD1A 4RD2A 2HMAA 2XEXA 2E1RA 3QE2A 4Q7JB 3AGPA 1DDIA 3E20A 2QEXB 1UMKA 2PMDA 2BGIA 2FX3A 1IJFA 2BF4A 3W2EA 5TY0A 2VZLA 5KSWB 2BM0A 3J81k 3OZUA 4TN1A 4U9UA 1BQEA 1ZM3A 1JNYA 2DETA 4ZCMA 1VQ5B 3I55B 1R5BA 4HE6A 2VNHA 3V76A 1FRNA 4NBSA 4MYUA 5JBQA 1EXMA 2NPFA 4M0LA 1ZM2A 1KJZA 4Y7CA 2VNKA 2C77A 3G4SB 3U6KA 4QHYA 2QMUA 3P27A 2BMWA 3W2FA 3WBJA 2RC5A 1M1KD 1E62A 2YWEA 4PC6A 3WYAA 4B4DA 4C0SA 3LO8A 1FNCA 1G7TA 3CC7B 1OB5A 1H85A 3CCJB 1BX1A 2VNIA 1WDTA 4TMZA 1D8TA 3CXCB 4LBZA 1EFCA 1Q86D 4RD0A 5GV7A 4RD4A 4PC2A 4YAFA 1TTTA 3WNDA 3W5VA 2RC6A 5H5JA 2DEUA 2PLFA 3JQQA 3CCQB 3SJZA 1N0VC 2YWFA 3VNUA 4PC3A 4AF6A 5TV2A 2XNJA 3CMEB 2HDNB 1N8RD 3OZVA 1EFTA 4ZCIA 3AVVA 2B7BA 3OZWA 2J7KA 3WNCA 1ZM9A 4N3NA 2X3UA 4NCNA 2OTLB 2DY1A 3WNBA 1QH0A 4LBWA 4B43A 4M2LA 4TMWA 1QGYA 4FK8A 1CQXA 3ZZTA 5DSZA 4RCZA 1G7CA 4HE5A 1EP2B 5H59A 1YI2B 1W34A 3W2HA 4F7DA 1R5NA 1FNBA 1QFJA 1U2RA 1TVCA 1KRHA 4RCYA 1YIJB 4IW3B 3P26A 2C78A 3CCLB 1E63A 2EFGA 3B8HA 3ZZUA 2B5OA 3AVYA 3CCVB 1JB9A 3ZBTA 1Q82D 3VNVA 1NDHA 4M1KA 4P3YA 1Q7YD 2OK7A 3W5UA 1M90D 2B7CA 2BN4A 4PC7A 4H9GA 1KD1D 3PENA 4C43A 1G7RA 1HA3A 4ZGQB 2EIXA 1VQMB 3QSYA 4Y9UA 1IJEA 4AC9A 4ZCLA 1VQKB 1KC8D 2CRVA 3VO1A 1GAWA 3JQRA 1F60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPR A;  5TR9 A;  2PIA A;  1K73 D;  1W35 A;  5FA6 A;  3I56 B;  4RD6 A;  3QFS A;  3CPW B;  1QGZ A;  4B47 A;  3MHP A;  4QFM A;  5GV8 A;  3CW2 A;  3VMF A;  2QA4 B;  1XB2 A;  4G1V A;  5EMN A;  3CCE B;  1EWY A;  1YHQ B;  1QUE A;  1W87 A;  3G6E B;  5AN9 A;  3CC2 B;  4MYT A;  3CB4 A;  2BVN A;  4YAW A;  3QFT A;  3OJW A;  1KK2 A;  3WXM A;  3AVX A;  1VQ6 B;  4G1B A;  1JA0 A;  3VO2 A;  1Q81 D;  3B78 A;  2GQF A;  1B23 P;  1K8A D;  1J9Z A;  1R5O A;  1YJ9 B;  1VQO B;  1NJI D;  1VQ9 B;  4M53 A;  3E1Y E;  2QDX A;  1AMO A;  3CCU B;  4FN5 A;  4J0Q A;  4WQM A;  1KK1 A;  1KQS B;  1SM4 A;  1DG1 G;  4ZV4 A;  3G71 B;  2BSA A;  3ES9 A;  1W2B B;  1A8P A;  3CMA B;  2ZIT A;  2R6H A;  3JQP A;  1GR1 A;  1B2R A;  5THX A;  3W5H A;  4ACA A;  3CCR B;  1QGA A;  3QFC A;  4YAU A;  1GAQ A;  1ZM4 A;  1TUI A;  2YWG A;  4B44 A;  1YJN B;  3CCM B;  2BPO A;  1BX0 A;  4N3G A;  4DQL A;  3ZC3 A;  1N0U A;  1CNF A;  4ZGN B;  1K9M D;  1VQ4 B;  1D1N A;  4AF7 A;  2VNJ A;  1OGJ A;  1QG0 A;  4FWT A;  2OK8 A;  3WY9 A;  1ZUN B;  2QTZ A;  2BV3 A;  1VQ7 B;  3MMP A;  1VQP B;  1QFY A;  4RD3 A;  1SKQ A;  4ACB A;  1E64 A;  4YAO A;  1EP1 B;  1I7P A;  2XNC A;  1XE1 A;  2OTJ B;  3W2G A;  4TMX A;  1DAR A;  1H42 A;  3ZBU A;  1YJW B;  3FJO A;  1G7S A;  1KTV A;  3LVB A;  3AVW A;  1QVG B;  2DER A;  1S0U A;  4Y9R A;  4K1X A;  1QVF B;  1FRQ A;  3W2I A;  1AIP A;  1EP3 B;  3WBK A;  1OGI A;  4YHB A;  1QFZ A;  2QTL A;  4PGO A;  1EFU A;  2CND A;  3AGQ A;  4B3X A;  1GO2 A;  4RJL A;  3OW2 B;  4R71 A;  1KK0 A;  1KK3 A;  4TMV A;  1JJ2 B;  4LBY A;  1S72 B;  3I1F A;  1ELO A;  2AHO A;  3CRZ A;  4UAJ A;  4LBV A;  3B82 A;  3AVU A;  1TLL A;  3FPK A;  1GJR A;  4P6V F;  1VQN B;  3CCS B;  3OJX A;  1QUF A;  4TMT A;  4M4S A;  3AVT A;  1FND A;  1QX4 A;  1YIT B;  3ZZ0 A;  4DQK A;  1OB2 A;  3U6B A;  5HXB A;  1IB0 A;  4LC0 A;  1F20 A;  1FNM A;  1CNE A;  1VQ8 B;  3U2Q A;  3CD6 B;  1JA1 A;  1FDR A;  1BJK A;  1DDG A;  4YAL A;  2VYQ A;  4B48 A;  2YWH A;  1D2E A;  3QFR A;  4G5G A;  2BGJ A;  2GPJ A;  2DCU A;  2QN6 A;  2HCJ B;  1VQL B;  4EH1 A;  3MCA A;  4PC1 A;  2D74 A;  2BM1 A;  3CC4 B;  1GVH A;  4RD1 A;  4RD2 A;  2HMA A;  2XEX A;  2E1R A;  3QE2 A;  4Q7J B;  3AGP A;  1DDI A;  3E20 A;  2QEX B;  1UMK A;  2PMD A;  2BGI A;  2FX3 A;  1IJF A;  2BF4 A;  3W2E A;  5TY0 A;  2VZL A;  5KSW B;  2BM0 A;  3J81 k;  3OZU A;  4TN1 A;  4U9U A;  1BQE A;  1ZM3 A;  1JNY A;  2DET A;  4ZCM A;  1VQ5 B;  3I55 B;  1R5B A;  4HE6 A;  2VNH A;  3V76 A;  1FRN A;  4NBS A;  4MYU A;  5JBQ A;  1EXM A;  2NPF A;  4M0L A;  1ZM2 A;  1KJZ A;  4Y7C A;  2VNK A;  2C77 A;  3G4S B;  3U6K A;  4QHY A;  2QMU A;  3P27 A;  2BMW A;  3W2F A;  3WBJ A;  2RC5 A;  1M1K D;  1E62 A;  2YWE A;  4PC6 A;  3WYA A;  4B4D A;  4C0S A;  3LO8 A;  1FNC A;  1G7T A;  3CC7 B;  1OB5 A;  1H85 A;  3CCJ B;  1BX1 A;  2VNI A;  1WDT A;  4TMZ A;  1D8T A;  3CXC B;  4LBZ A;  1EFC A;  1Q86 D;  4RD0 A;  5GV7 A;  4RD4 A;  4PC2 A;  4YAF A;  1TTT A;  3WND A;  3W5V A;  2RC6 A;  5H5J A;  2DEU A;  2PLF A;  3JQQ A;  3CCQ B;  3SJZ A;  1N0V C;  2YWF A;  3VNU A;  4PC3 A;  4AF6 A;  5TV2 A;  2XNJ A;  3CME B;  2HDN B;  1N8R D;  3OZV A;  1EFT A;  4ZCI A;  3AVV A;  2B7B A;  3OZW A;  2J7K A;  3WNC A;  1ZM9 A;  4N3N A;  2X3U A;  4NCN A;  2OTL B;  2DY1 A;  3WNB A;  1QH0 A;  4LBW A;  4B43 A;  4M2L A;  4TMW A;  1QGY A;  4FK8 A;  1CQX A;  3ZZT A;  5DSZ A;  4RCZ A;  1G7C A;  4HE5 A;  1EP2 B;  5H59 A;  1YI2 B;  1W34 A;  3W2H A;  4F7D A;  1R5N A;  1FNB A;  1QFJ A;  1U2R A;  1TVC A;  1KRH A;  4RCY A;  1YIJ B;  4IW3 B;  3P26 A;  2C78 A;  3CCL B;  1E63 A;  2EFG A;  3B8H A;  3ZZU A;  2B5O A;  3AVY A;  3CCV B;  1JB9 A;  3ZBT A;  1Q82 D;  3VNV A;  1NDH A;  4M1K A;  4P3Y A;  1Q7Y D;  2OK7 A;  3W5U A;  1M90 D;  2B7C A;  2BN4 A;  4PC7 A;  4H9G A;  1KD1 D;  3PEN A;  4C43 A;  1G7R A;  1HA3 A;  4ZGQ B;  2EIX A;  1VQM B;  3QSY A;  4Y9U A;  1IJE A;  4AC9 A;  4ZCL A;  1VQK B;  1KC8 D;  2CRV A;  3VO1 A;  1GAW A;  3JQR A;  1F60 A; 
#chains in the Genus database with same CATH topology
 2PE3 A;  5F4O A;  3A3B A;  4BPR A;  5TR9 A;  2JN9 A;  3BCF A;  2P3M A;  2PIA A;  1K73 D;  1W35 A;  3AST A;  5FA6 A;  2ZZQ A;  3I56 B;  4RD6 A;  3QFS A;  3CPW B;  1QGZ A;  4B47 A;  2GK7 A;  2Q6K A;  3MHP A;  3WQZ A;  2KVO A;  3BY1 A;  4QFM A;  5IYP A;  4P25 A;  5GV8 A;  3BCD A;  3CW2 A;  5IYR A;  1W9X A;  3ISX A;  4QVJ A;  3VMF A;  2QA4 B;  1XB2 A;  5CDF A;  4B3F X;  4X05 A;  2V7Q A;  4G1V A;  2ZZG A;  5EMN A;  3CCE B;  1EWY A;  1YHQ B;  1V5V A;  2ZL6 A;  1QUE A;  4XLE A;  1W87 A;  4Z4S A;  3G6E B;  3CC2 B;  4MYT A;  5AN9 A;  4DNT B;  3CB4 A;  4B3G A;  5HZB A;  2BVN A;  2V7X A;  4OPV A;  2WZP P;  1OB0 A;  2ZZF A;  4YAW A;  2VBS A;  3QFT A;  4RLZ A;  4Z4Y A;  3OJW A;  1T5E A;  1S4M A;  1T6Y A;  1KK2 A;  3WXM A;  1P4M A;  4OPO A;  3AVX A;  3SEJ A;  3GQB A;  1VQ6 B;  4G1B A;  1W0J A;  1JA0 A;  4KKU A;  3VO2 A;  4OPS A;  3Q6R A;  1Q81 D;  5DN6 A;  3B78 A;  2GQF A;  1E1Q A;  1B23 P;  1K8A D;  1J9Z A;  1R5O A;  1YJ9 B;  1NB9 A;  1VQO B;  1VHO A;  1WP6 A;  1NJI D;  2XZO A;  1VQ9 B;  2C2W A;  4M53 A;  2V7T A;  5KW9 A;  3E1Y E;  3Q39 A;  2QDX A;  3ZUG A;  1AMO A;  3CCU B;  4FN5 A;  1PKV A;  2QE7 A;  4J0Q A;  4WQM A;  1YLO A;  1N05 A;  1KK1 A;  2V7V A;  1KQS B;  2X6X A;  4II2 A;  2CW5 A;  1SM4 A;  1DG1 G;  4ZV4 A;  3G71 B;  2XOK A;  4Z4V A;  4XR6 A;  2BSA A;  4Z4R A;  5FL7 A;  1SKY B;  3OKX A;  3ES9 A;  2E1B A;  1W2B B;  1A8P A;  4WZE A;  4YEJ A;  3CMA B;  2ZIT A;  2R6H A;  1NB0 A;  3JQP A;  3OOC A;  4P1V A;  3KEW A;  4XOT A;  1GR1 A;  1B2R A;  3CES A;  3CTA A;  5THX A;  3W5H A;  4XKV A;  4ACA A;  3CCR B;  1QGA A;  2GJK A;  4WZK A;  3H94 A;  3QFC A;  4TT3 A;  4YAU A;  1GAQ A;  2CK3 A;  1ZM4 A;  1TUI A;  2YWG A;  4B44 A;  5IYQ A;  1YJN B;  3CCM B;  2BPO A;  1V0F A;  2R9V A;  1Q9S A;  1BX0 A;  3OPO A;  2GJP A;  4N3G A;  4DQL A;  3SKB A;  3Q3A A;  3PA2 A;  1N0U A;  1PJ7 A;  1CNF A;  4QUZ A;  3ZC3 A;  3A8J A;  4ZGN B;  1OHH A;  1K9M D;  4P2N A;  1VQ4 B;  1D1N A;  4AF7 A;  2V7W A;  2VNJ A;  4XLA A;  1UD6 A;  4XM3 A;  1OGJ A;  1QG0 A;  5IK2 A;  2DOG A;  4ASU A;  4FWT A;  1I18 A;  2OK8 A;  2GK6 A;  1PJ6 A;  1XQB A;  3WY9 A;  1ZUN B;  2JDI A;  4X07 A;  2QTZ A;  2BV3 A;  1VQ7 B;  3CMM A;  2ZBU A;  3MMP A;  1VQP B;  2JIZ A;  1QFY A;  4RD3 A;  1SKQ A;  2X85 A;  1E64 A;  4RDL A;  4ACB A;  1W0K A;  3VR6 A;  1NBM A;  1EP1 B;  1WSR A;  4YAO A;  3BY2 A;  4X7C A;  1I7P A;  2XNC A;  1XE1 A;  2OTJ B;  3W2G A;  4TMX A;  1DAR A;  1H42 A;  3ZBU A;  1YJW B;  3FJO A;  2ZBV A;  1NRK A;  2FVG A;  1G7S A;  1KTV A;  3LVB A;  4HIZ A;  3AVW A;  2VJI A;  1QVG B;  1WPC A;  2DER A;  1S0U A;  4Y9R A;  2ZTG A;  5HZA A;  4K1X A;  1QVF B;  1FRQ A;  1BLI A;  1MAB A;  3W2I A;  1AIP A;  1EP3 B;  4PAA A;  3WBK A;  2F4N A;  1OGI A;  3ASR A;  1QFZ A;  3OEH A;  4YHB A;  1VHE A;  2QTL A;  4PGO A;  1EFU A;  1V0E A;  2CND A;  3AGQ A;  5BSX A;  4B3X A;  1GO2 A;  4RDK A;  1VLY A;  2C4U A;  4RJL A;  3OW2 B;  3LQE A;  1KK0 A;  4R71 A;  1E3X A;  1KK3 A;  2F43 A;  4TMV A;  1JJ2 B;  4LBY A;  5E6T A;  4G6I A;  1S72 B;  2LZJ A;  3I1F A;  1ELO A;  3ONY A;  2AHO A;  3CRZ A;  3RY8 A;  4AVZ A;  4DK0 A;  4UAJ A;  4LBV A;  3Q38 A;  2Q6O A;  3B82 A;  3T56 B;  1VJS A;  4XD7 A;  3AVU A;  5J3O A;  1Y0Y A;  1TLL A;  3FPK A;  1GJR A;  3SJP A;  1WU8 A;  2C5B A;  3CPX A;  4P6V F;  3OE7 A;  1VQN B;  3CCS B;  3OJX A;  1UD4 A;  1QUF A;  4TMT A;  4M4S A;  3AVT A;  3R6K A;  1FND A;  1K28 D;  2XND A;  1QX4 A;  1YIT B;  2XGJ A;  4X7D A;  3ZZ0 A;  4DQK A;  2WYR A;  3Q6Q A;  5FO0 A;  1OB2 A;  1IHM A;  3U6B A;  1HZE A;  5HXB A;  4P22 A;  4KKT A;  1COW A;  1IB0 A;  5BSY A;  4LC0 A;  5A89 A;  1F20 A;  1FNM A;  2X8K A;  2ZTN A;  1CNE A;  1VQ8 B;  3U2Q A;  1RQR A;  2VBV A;  4XLF A;  3A8K A;  2VBU A;  3CD6 B;  1JA1 A;  1FDR A;  4E0F A;  3NE5 B;  1BJK A;  1DDG A;  3SLD A;  3GIR A;  4YAL A;  2VYQ A;  1BPL A;  1N08 A;  3ASP A;  2X6Y A;  4RM0 A;  4B48 A;  3JU4 A;  2YWH A;  1D2E A;  4WZL A;  3QFR A;  5A88 A;  4G5G A;  2QN6 A;  2GPJ A;  2DCU A;  2BGJ A;  5FNZ A;  2HCJ B;  1WOR A;  4TKO B;  1VQL B;  5B6I A;  4EH1 A;  3MCA A;  4PC1 A;  2D74 A;  2WR8 A;  4II3 A;  4P12 A;  2BM1 A;  3CC4 B;  1GVH A;  2JJ1 A;  4P6Y A;  4RD2 A;  4RD1 A;  4RDJ A;  2HMA A;  3A3G A;  2C5H A;  2Q6I A;  3SLN A;  2XEX A;  4OOS A;  2E1R A;  3ASQ A;  4OOV A;  3QE2 A;  4Q7J B;  4X0C A;  4X8I A;  3BNW A;  2GJR A;  3AGP A;  2DYI A;  4XMY A;  4OP7 A;  1DDI A;  3E20 A;  2QEX B;  3LNN A;  1UMK A;  2PMD A;  2BGI A;  2FX3 A;  1IJF A;  2BF4 A;  3W2E A;  5TY0 A;  3CP8 A;  2VZL A;  5KSW B;  2BM0 A;  3J81 k;  3OZU A;  4TN1 A;  4DK1 A;  4U9U A;  3PA1 A;  1BQE A;  1RQP A;  1ZM3 A;  1JNY A;  2X6W A;  4L8J A;  2DET A;  4ZCM A;  1PJ5 A;  1VQ5 B;  3I55 B;  4XNF A;  1R5B A;  4HE6 A;  2VNH A;  4WZT A;  3V76 A;  1FRN A;  1YX2 A;  4NBS A;  2JJ2 A;  3H9N A;  4MYU A;  4WWV A;  5JBQ A;  1EXM A;  2NPF A;  4ROX A;  4TSF A;  5TRD A;  4M0L A;  1ZM2 A;  2X53 S;  1KJZ A;  4P3I A;  1MRZ A;  1WOO A;  4KKS A;  3FPP A;  4Y7C A;  2VNK A;  2WPD A;  2Z6B D;  2OBT A;  2C77 A;  5HKK A;  3G4S B;  3U6K A;  4QHY A;  2CC2 A;  2QMU A;  3P27 A;  2BMW A;  2W6I A;  3W2F A;  1N07 A;  3WBJ A;  2HLD A;  2RC5 A;  1M1K D;  1E62 A;  2YWE A;  4PC6 A;  4NNJ A;  3HAG A;  3WYA A;  4B4D A;  4YXW A;  3LO8 A;  4C0S A;  1FNC A;  3ZIA A;  1G7T A;  3CC7 B;  5FO1 A;  3A8I A;  2DIE A;  2ZXH A;  4XKW A;  1OB5 A;  2WZN A;  4PAB A;  1H85 A;  2V31 A;  3CCJ B;  1BX1 A;  2VNI A;  1E1R A;  1WDT A;  3GVJ A;  1FX0 A;  1D8T A;  4TMZ A;  3CXC B;  4LBZ A;  3PVD A;  1EFC A;  2GRE A;  1Q86 D;  2XZP A;  2F1L A;  4RD0 A;  2I1L A;  5GV7 A;  4X7F A;  3OP1 A;  4RD4 A;  4XL9 A;  4PC2 A;  4YEL A;  3ASS A;  3OEE A;  5IYW A;  4YAF A;  4UZE A;  1UD3 A;  4JMQ A;  2D3L A;  3T51 B;  3ZPN A;  2M5S A;  3ONU A;  4Z4Z A;  1TTT A;  3WND A;  2CBX A;  3PUN A;  4XN0 A;  3W5V A;  2OYN A;  5IYN A;  4XOR A;  2RC6 A;  5H5J A;  4XN3 A;  2DEU A;  4QVA A;  3GVL A;  2PLF A;  2WJY A;  3JQQ A;  3CCQ B;  3CP2 A;  3SJZ A;  1KZL A;  4Z4U A;  1N0V C;  2D9R A;  2YWF A;  3BC9 A;  3GVK A;  3VNU A;  4PC3 A;  4X7E A;  1I8D A;  4XOP A;  4AF6 A;  5TV2 A;  4CQJ A;  1E43 A;  2XNJ A;  3CME B;  2HDN B;  1N8R D;  4G7W A;  2WJV A;  3A1P A;  3OZV A;  2D3N A;  2Q6L A;  1EFT A;  1VF7 A;  2WSS A;  4UZF A;  1Y0R A;  1KMH A;  1UD2 A;  5F4J A;  4ZCI A;  3AVV A;  2B7B A;  3OZW A;  4UZU A;  5KNL A;  3D26 A;  2F1M A;  2J7K A;  3WNC A;  2XZL A;  1ZM9 A;  4N3N A;  1WOP A;  2X3U A;  4NCN A;  2OTL B;  2DY1 A;  3WNB A;  1QH0 A;  4LBW A;  3FKS A;  1VLO A;  4B43 A;  4M2L A;  4TMW A;  4DNR B;  4XLC A;  1QGY A;  4FK8 A;  1CQX A;  5FIU A;  5L46 A;  3ZZT A;  2V7U A;  1UD8 A;  4RPD A;  5DSZ A;  4Z4W A;  1WTH D;  4RCZ A;  1G7C A;  4HE5 A;  4Z4T A;  1EP2 B;  5H59 A;  4XQF A;  3OAA A;  1YI2 B;  4Z1M A;  3PUM A;  4GQN A;  1W34 A;  3W2H A;  4F7D A;  1R5N A;  3R6J A;  2ZZE A;  1FNB A;  1QFJ A;  1U2R A;  4P26 A;  1TVC A;  1KRH A;  1H8H A;  4RCY A;  1YIJ B;  4QV2 A;  2OBS A;  4IW3 B;  4P9S A;  3P26 A;  1XFO A;  4RPB A;  2C78 A;  4XON A;  3CCL B;  1E63 A;  2VJJ A;  3OW7 A;  5A8A A;  1WOS A;  2EFG A;  3A35 A;  3B8H A;  3ZZU A;  2B5O A;  3AVY A;  1E79 A;  3CCV B;  1JB9 A;  3ZBT A;  3KL9 A;  1HVX A;  3V7A A;  1Q82 D;  3VNV A;  4G7X A;  1NDH A;  3LQ6 A;  3DDY A;  2C4T A;  2ZL7 A;  4FXU A;  4M1K A;  5J35 A;  3T53 B;  1H8E A;  4XLH A;  4P3Y A;  1Q7Y D;  2OK7 A;  3W5U A;  1BMF A;  1UD5 A;  4X06 A;  2B7C A;  1M90 D;  1T6X A;  2BN4 A;  4PC7 A;  4H9G A;  1KD1 D;  3PEN A;  1WSV A;  4OOX A;  3G05 A;  4C43 A;  1G7R A;  3BH4 A;  1HA3 A;  1E3Z A;  4ZGQ B;  2EIX A;  1VQM B;  3QSY A;  2CF4 A;  5DS0 A;  5LMZ A;  3GSI A;  3OFN A;  2NV4 A;  2OBR A;  3BQJ A;  4Y9U A;  1IJE A;  4AC9 A;  4ZCL A;  1VQK B;  2VBT A;  2W6J A;  1KC8 D;  2X0K A;  2CRV A;  3VO1 A;  1T6Z A;  1GAW A;  2ZL5 A;  2ZXI A;  3JQR A;  1F60 A;  2V4D A;  1EFR A;  2QGG A;  5F4M A;  1N06 A; 
#chains in the Genus database with same CATH homology
 4BPR A;  5TR9 A;  2PIA A;  1K73 D;  1W35 A;  5FA6 A;  3I56 B;  4RD6 A;  3QFS A;  3CPW B;  1QGZ A;  4B47 A;  3MHP A;  4QFM A;  5GV8 A;  3CW2 A;  3VMF A;  2QA4 B;  1XB2 A;  4G1V A;  5EMN A;  3CCE B;  1EWY A;  1YHQ B;  1QUE A;  1W87 A;  3G6E B;  5AN9 A;  3CC2 B;  4MYT A;  3CB4 A;  2BVN A;  4YAW A;  3QFT A;  3OJW A;  1KK2 A;  3WXM A;  3AVX A;  1VQ6 B;  4G1B A;  1JA0 A;  3VO2 A;  1Q81 D;  3B78 A;  2GQF A;  1B23 P;  1K8A D;  1J9Z A;  1R5O A;  1YJ9 B;  1VQO B;  1NJI D;  1VQ9 B;  4M53 A;  3E1Y E;  2QDX A;  1AMO A;  3CCU B;  4FN5 A;  4J0Q A;  4WQM A;  1KK1 A;  1KQS B;  1SM4 A;  1DG1 G;  4ZV4 A;  3G71 B;  2BSA A;  3ES9 A;  1W2B B;  1A8P A;  3CMA B;  2ZIT A;  2R6H A;  3JQP A;  1GR1 A;  1B2R A;  5THX A;  3W5H A;  4ACA A;  3CCR B;  1QGA A;  3QFC A;  4YAU A;  1GAQ A;  1ZM4 A;  1TUI A;  2YWG A;  4B44 A;  1YJN B;  3CCM B;  2BPO A;  1BX0 A;  4N3G A;  4DQL A;  3ZC3 A;  1N0U A;  1CNF A;  4ZGN B;  1K9M D;  1VQ4 B;  1D1N A;  4AF7 A;  2VNJ A;  1OGJ A;  1QG0 A;  4FWT A;  2OK8 A;  3WY9 A;  1ZUN B;  2QTZ A;  2BV3 A;  1VQ7 B;  3MMP A;  1VQP B;  1QFY A;  4RD3 A;  1SKQ A;  4ACB A;  1E64 A;  4YAO A;  1EP1 B;  1I7P A;  2XNC A;  1XE1 A;  2OTJ B;  3W2G A;  4TMX A;  1DAR A;  1H42 A;  3ZBU A;  1YJW B;  3FJO A;  1G7S A;  1KTV A;  3LVB A;  3AVW A;  1QVG B;  2DER A;  1S0U A;  4Y9R A;  4K1X A;  1QVF B;  1FRQ A;  3W2I A;  1AIP A;  1EP3 B;  3WBK A;  1OGI A;  4YHB A;  1QFZ A;  2QTL A;  4PGO A;  1EFU A;  2CND A;  3AGQ A;  4B3X A;  1GO2 A;  4RJL A;  3OW2 B;  4R71 A;  1KK0 A;  1KK3 A;  4TMV A;  1JJ2 B;  4LBY A;  1S72 B;  3I1F A;  1ELO A;  2AHO A;  3CRZ A;  4UAJ A;  4LBV A;  3B82 A;  3AVU A;  1TLL A;  3FPK A;  1GJR A;  4P6V F;  1VQN B;  3CCS B;  3OJX A;  1QUF A;  4TMT A;  4M4S A;  3AVT A;  1FND A;  1QX4 A;  1YIT B;  3ZZ0 A;  4DQK A;  1OB2 A;  3U6B A;  5HXB A;  1IB0 A;  4LC0 A;  1F20 A;  1FNM A;  1CNE A;  1VQ8 B;  3U2Q A;  3CD6 B;  1JA1 A;  1FDR A;  1BJK A;  1DDG A;  4YAL A;  2VYQ A;  4B48 A;  2YWH A;  1D2E A;  3QFR A;  4G5G A;  2BGJ A;  2GPJ A;  2DCU A;  2QN6 A;  2HCJ B;  1VQL B;  4EH1 A;  3MCA A;  4PC1 A;  2D74 A;  2BM1 A;  3CC4 B;  1GVH A;  4RD1 A;  4RD2 A;  2HMA A;  2XEX A;  2E1R A;  3QE2 A;  4Q7J B;  3AGP A;  1DDI A;  3E20 A;  2QEX B;  1UMK A;  2PMD A;  2BGI A;  2FX3 A;  1IJF A;  2BF4 A;  3W2E A;  5TY0 A;  2VZL A;  5KSW B;  2BM0 A;  3J81 k;  3OZU A;  4TN1 A;  4U9U A;  1BQE A;  1ZM3 A;  1JNY A;  2DET A;  4ZCM A;  1VQ5 B;  3I55 B;  1R5B A;  4HE6 A;  2VNH A;  3V76 A;  1FRN A;  4NBS A;  4MYU A;  5JBQ A;  1EXM A;  2NPF A;  4M0L A;  1ZM2 A;  1KJZ A;  4Y7C A;  2VNK A;  2C77 A;  3G4S B;  3U6K A;  4QHY A;  2QMU A;  3P27 A;  2BMW A;  3W2F A;  3WBJ A;  2RC5 A;  1M1K D;  1E62 A;  2YWE A;  4PC6 A;  3WYA A;  4B4D A;  4C0S A;  3LO8 A;  1FNC A;  1G7T A;  3CC7 B;  1OB5 A;  1H85 A;  3CCJ B;  1BX1 A;  2VNI A;  1WDT A;  4TMZ A;  1D8T A;  3CXC B;  4LBZ A;  1EFC A;  1Q86 D;  4RD0 A;  5GV7 A;  4RD4 A;  4PC2 A;  4YAF A;  1TTT A;  3WND A;  3W5V A;  2RC6 A;  5H5J A;  2DEU A;  2PLF A;  3JQQ A;  3CCQ B;  3SJZ A;  1N0V C;  2YWF A;  3VNU A;  4PC3 A;  4AF6 A;  5TV2 A;  2XNJ A;  3CME B;  2HDN B;  1N8R D;  3OZV A;  1EFT A;  4ZCI A;  3AVV A;  2B7B A;  3OZW A;  2J7K A;  3WNC A;  1ZM9 A;  4N3N A;  2X3U A;  4NCN A;  2OTL B;  2DY1 A;  3WNB A;  1QH0 A;  4LBW A;  4B43 A;  4M2L A;  4TMW A;  1QGY A;  4FK8 A;  1CQX A;  3ZZT A;  5DSZ A;  4RCZ A;  1G7C A;  4HE5 A;  1EP2 B;  5H59 A;  1YI2 B;  1W34 A;  3W2H A;  4F7D A;  1R5N A;  1FNB A;  1QFJ A;  1U2R A;  1TVC A;  1KRH A;  4RCY A;  1YIJ B;  4IW3 B;  3P26 A;  2C78 A;  3CCL B;  1E63 A;  2EFG A;  3B8H A;  3ZZU A;  2B5O A;  3AVY A;  3CCV B;  1JB9 A;  3ZBT A;  1Q82 D;  3VNV A;  1NDH A;  4M1K A;  4P3Y A;  1Q7Y D;  2OK7 A;  3W5U A;  1M90 D;  2B7C A;  2BN4 A;  4PC7 A;  4H9G A;  1KD1 D;  3PEN A;  4C43 A;  1G7R A;  1HA3 A;  4ZGQ B;  2EIX A;  1VQM B;  3QSY A;  4Y9U A;  1IJE A;  4AC9 A;  4ZCL A;  1VQK B;  1KC8 D;  2CRV A;  3VO1 A;  1GAW A;  3JQR A;  1F60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...